3A4UB

Crystal structure of mcfd2 in complex with carbohydrate recognition domain of ergic-53
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
65
Chain Sequence
EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 23
structure length 65
sequence length 78
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a4uB00
2L2EA 4M2QA 1UHIA 1IQ3A 1LKJA 1DTLA 2L4HA 1XO5A 4YI8A 3BUXB 2M97A 1S5GZ 1DJXA 1KWOC 2D8NA 2SASA 3OHMB 2ZNEA 2M49B 4OR9B 1V1GA 3FWBA 2PMYA 2JTZA 5AXIA 1ZACA 2LMUA 4A4BA 2BCBA 2R2IA 4DS7A 3TDUA 3NSOA 2MLEC 2MBXA 2PASA 2LVVA 4ZCUA 4PE1A 3WHUB 1CDNA 4F0ZB 1C07A 4PDZA 2LM5A 1RJVA 1YRTB 3JVTC 2LLSA 2K7DA 2V53A 5CSFA 2BECA 1M45A 1UUSA 2KBMA 1F8HA 2LVIA 1DT7B 1F4QA 2CT9A 3CTNA 1KK7Z 4PHMA 4MLWA 1FF1A 3VRRA 1K90D 2GGZA 2KHNA 3JTDC 1OMDA 2Y1NA 4GNKB 1B7TY 4E68A 1CFCA 3CGAA 5HKWA 4OCIA 3DF0B 2AAOA 3NSLA 1CLBA 3SG7A 1UWOA 4BY4A 5TNCA 1XVJA 1DGVA 2ISDA 4CPVA 1SMGA 2I18A 1NP8A 1BF5A 3BUWB 3LK0A 1DF0B 3KPXA 2KI4B 3PATA 1XFUO 1CKKA 1DJIA 1XFXO 5JOLA 3TS5B 3PALA 4P5OE 1MUXA 3DVKA 2KDHA 3TDZA 1HQVA 1NX3A 1ZUZA 5FYXA 2BCXA 2SCPA 4PHKA 1BT6A 1ODBA 3DD4A 1QIVA 3SG3A 1YTZC 1JF2A 2KSPA 1CDLA 4N1FA 1Y1XA 2CCMA 2BKIB 1WY9A 4UPGA 1DJHA 1JFKA 3LK1A 4AQJA 2Q4UA 2K61A 2K7OA 3KHEA 3D10A 1KQMC 1NCYA 5HLVA 4JWQA 4YRUA 1JWDA 5HYDA 4IL1A 4C0LA 1NIWA 3EVUA 1WLMA 2KYFA 5I2QA 1IKUA 2ZRTA 1N2DA 2ZFDA 4TNCA 1FPWA 1GGZA 1QTXA 3AKBA 4ORAB 2ZN9A 1L2OC 1EG3A 5F6TA 1XA5A 3IF7A 2K2FA 1KK8C 1X02A 1ZFSA 4NDDA 1RK9A 1SCVA 2LC5A 2LHIA 1LINA 1J55A 4ORCB 1BG1A 1G33A 1NX2A 3FIAA 4JPZB 2M7LA 1YX7A 3PLFB 2JWWA 1OZOA 2WCEA 3VROA 1OSAA 1WDCC 2OPOA 4I5NB 4A4CA 3KO0A 1OMVA 3I5GC 1IJ6A 2BBMA 1OQPA 1G4YR 1UHJA 3ZWHA 5CPVA 2FCDA 4DUQA 1S6IA 2FCEA 2OTGC 1PULA 2LAPA 3SG4A 1NX0A 1EG4A 5BPJA 1Y6WA 1IWQA 1Q80A 2M7NA 1QLKA 2KBIA 1YRUB 2PSRA 4MSPA 3PN7C 1QVIY 1TNWA 2F33A 2QPTA 4PE0A 2ZKMX 3ZNIA 1PK0D 1QATA 1SY9A 1AHRA 1KFUS 4HRGA 4DRWA 2Y1MA 1RFJA 2K2AA 2KAYA 1UP5A 2LE9B 3LL8B 3FWCA 2WCFA 3RM1A 1K9KA 1MR8A 2EC6C 1E8AA 1K93D 1KCYA 1AJ5A 4AOMA 3AKAA 1RECA 5K89A 3ICBA 1IJ5A 1SKTA 1WLZA 1G8IA 2JU0A 3RLZA 3I5IB 1NPQA 4U8DA 3OX6A 1XK4C 1RTP1 1YUUA 1EL4A 2BL0B 2DOQA 1LVCD 4P2YB 4NDBA 1CLLA 2FOTA 5I2LA 5AEQA 1J7OA 3K21A 3IQQA 1NCZA 3I5FC 2B1UA 1J7RA 1QV0A 4ZCVA 4CLNA 1XFWO 1CM1A 3QRXA 1DJWA 2JT0A 1DJZA 1MXLC 3CLNA 4XJKA 1JUOA 2AUCA 1TTXA 3BUOB 2A4JA 3SJSA 1BLQA 4ICBA 1KQVA 1YURA 1UHNA 2JOJA 4HRHA 2LP3A 1DJYA 3LLEA 1CFDA 4N5XA 2H2KA 4QJ3B 2BE6A 2WORA 2H61C 2KAXA 2O5GA 1A4PA 1QIWA 4YGEB 2FJUB 5JJGA 1M63B 1IRJA 2JRFA 3DVEA 3OB1B 3HCMA 4YGCB 5ER5A 2NXQA 1RWYA 1SR6B 2E6WA 1BODA 4FQOA 1HT9A 3OP0A 2IS9A 2JXLA 2M29A 4C0JA 3CWGA 1JFJA 1NSHA 1A75A 1SL7A 2L51A 1H4BA 2JC2A 4GGFC 3DVMA 1AUIB 3CR2A 3C1VA 5DKQA 2JPTA 1NCXA 4M2OA 2M9GA 1SNLA 4JQ0D 3VRQA 1KSMA 1PSRA 1L7ZA 1C7WA 1LXFC 1PALA 2F2OA 2I94A 2JTTA 4WQ2A 4ETOA 5I2OA 4FTGA 5DKRA 3GK2A 1C7VA 1SW8A 2P6BB 3SG2A 1OZSA 2KI4C 2KI6C 5CSIA 5KTYA 1PVBA 1B8CA 3EVRA 3TS5C 3VGOA 4PHJA 3VRNA 4PE4A 1XFYO 1F70A 2CBLA 3PM8A 5J3XA 1TCFA 1CB1A 1KFUL 1K8UA 2HPSA 2MRDA 4GFTA 1W7IB 4GUKA 1EH2A 1TRFA 3KF9A 3LCPC 3CZTX 1VRKA 1SL9A 2L98A 4USLA 2WC8A 5HKYA 1A2XA 1YR5A 3FS7A 1BJFA 4YGDB 3EK4A 2JZIA 1SPYA 2JT3A 5DKNA 4GPLB 2MJWB 1B7TZ 1J7PA 3EK7A 1OOJA 1SCMB 1BU3A 1YUSA 4ORBB 4Q04A 2JXCA 2F3ZA 3F45A 4YI9A 4GBAA 2BBNA 4MEWA 4XJKB 5KU1A 1Y0VH 1F4OA 2L0PA 1J7QA 1S26D 1CM4A 1LA3A 3OX5A 5D7FA 1NUBA 3NXAA 2EGDA 1YVLA 2KI6D 1ZMZA 4OKHA 2Y5IA 1AK8A 2KOTA 2L5XB 1OMRA 2L4IA 2MHHA 3I5HB 1YUTA 2K0JA 1QS7A 5CSJA 1K2HA 1TCOB 1F54A 5AANA 4QJ5B 2TN4A 5AERA 3DVJA 3A8RA 2K7BA 5B8IB 1FI5A 1DMOA 1SK6D 4NDCA 1QLSA 2CTNA 4PCWA 1EJ3A 4DCKA 1H8BA 2OS8B 4YBHB 1M31A 3EVVA 2NZ0A 3SG5A 1GJYA 2KGBC 3WXAA 1NYAA 1QX5B 1Y1UA 2WNDA 1CMGA 2LMTA 1A75B 1S6CA 1R6PA 1M39A 1N65A 3TUYB 2ZN8A 4DIRA 3VRPA 4MZLA 1KK7Y 3O4YA 2CXJA 2RGIA 3GOFA 1KSOA 3IQOA 1K9UA 3BOWA 3EK8A 3SIBA 1JC2A 3TZ1A 1UURA 2HETA 2LVKA 4N1GA 1KWOB 3A4UB 4OVNF 2HQWA 4PE7A 4YGBB 3M0WA 1S3PA 2MAZA 4OV2A 1M46A 1KFXS 5KSZA 1UHKA 3I5IC 1QX7A 4YGAA 2BL0C 1ZOTB 1CMFA 1W7JB 1GGWA 1DGUA 2JQ6A 2KFHA 1S6JA 5HLOA 4CFRA 3BYAA 3JVTB 3OB2B 3SG6A 1TIZA 5PALA 2HF5A 2NLNA 1D1OA 1CDPA 1QVIZ 1TNPA 2PALA 4XYNA 2HQ8A 3KEVA 1BMOA 1PRWA 1YVHA 1K95A 4AQIA 1LA0A 1CFPA 2PVBA 2O60A 4QJ4B 2AMIA 2WCBA 1CDMA 1S36A 2JT8A 2LCPA 3JTDB 4MRYA 2I7AA 4D1EA 3GK1A 1QX2A 3O2PA 3D0YA 3CS1A 3CR5X 2WOSA 4M2PA 2KFGA 4MRXA 4CFQA 1DJGA 1MWNA 1MXEA 1CLMA 1DVIA 2KAVA 2F2PA 1SR6C 3BQ3A 1U5IA 2KYCA 3WHTB 1XK4A 1UHHA 2PRUA 3MSEB 1FBVA 1TOPA 2CNPA 3O6BA 1NWDA 1B8RA 1EXRA 4CIDA 1FI6A 2Q91A 2JULA 2LNKA 1ALVA 1AP4A 5G08A 5CSNA 2F3YA 1JSAA 2KQ6A 1PVAA 3WNXB 3O78A 4MVFA 5HKZA 2K8MB 1IQ5A 1GQMA 1KQMB 1R2UA 1B8LA 2JNFA 3BUNB 1SRAA 3TDIA 1CNPA 3E3RA 3SIAA 1QJTA 1BR4B 4HREE 4PHNA 1A29A 4PALA 1SBJA 3GK4X 2LP2A 4I5JA 1J1EA 1WRKA 1OE9B 2LV7A 2H61A 1B1GA 1K94A 1AJ4A 2GGMA 1L2OB 2LUXA 4WQ3A 1SYMA 2LMVA 2MLFC 1IH0A 3BOWB 1J1DA 1KK8B 2E30A 2KFFA 4I5KA 2M1UA 5GQQC 1RROA 2K7CA 1Y1AA 1K9PA 2F8PA 1TNQA 1A03A 1CTRA 1B47A 1SL8A 2ZRSA 2LUCA 5D69A 1WDCB 1BR1B 3I5GB 1KFXL 1MHOA 1MQ1A 3EKHA 1SCMC 2KQYA 2GV5A 4GGFA 1S5GY 2M8UA 1F71A 4HSZA 4R1EA 1ALWA 4C0KA 2OTGB 1WRZA 4MZKA 2I2RE 1FW4A 4WRIA 1N0YA 3DF0A 1K96A 4NQGA 1F55A 1B4CA 3PFVA 1IGVA 2Y4QA 3EKJA 2NCOA 4MN0A 2ZNDA 3NSIA 3PN7B 1QASA 1DF0A 1B9AA 1S1EA 3NSKA 1QXPA 4MZJA 5IBWA 2M3WA 3BXKA 1V1FA 1YX8A 2BE4A 2LHLA 3D0YB 2G9BA 3I5HC 1NX1A 1TN4A 1IG5A 4BY5A 5I8NA 2EC6B 1JF0A 1XFVO 2NCPA 1MF8B 2M1KB 3AAKA 1AVSA 5AFPA 1BOCA 1XFZO 1CFFA 3PSRA 1JBAA 2G2BA 3CR4X 4MBEA 4L9MA 1XYDA 2OS8C 2VRGA 1U5IB 1TNXA 2LLUA 4I5LB 3HX4A 2LVJA 4GAOA 2KNEA 2LLTA 2JNXA 2EHBA 2BCAA 2BKHB 2LANA 3I5FB 2QACA 4GGNA 5ER4X 3TUYC 2KGRA 3BUMB 1PSBA 3AAJA 3H4SE 2L50A 1QV1A 1WRLA 2MA2A 2M0RA 2COLB
chains in the Genus database with same CATH superfamily
4INXA 3CZ0A 2L2EA 3D76A 4M2QA 1TUJA 1UHIA 1IQ3A 1LKJA 1DTLA 2L4HA 1XO5A 4YI8A 3BUXB 2M97A 1T14A 1S5GZ 1DJXA 1KWOC 2D8NA 2SASA 3OHMB 2ZNEA 3IVTA 3SS4A 3CZ1A 2M49B 3B86A 4OR9B 1V1GA 3FWBA 2PMYA 2JTZA 5AXIA 1ZACA 2LMUA 4A4BA 2BCBA 5HL1A 2R2IA 4DS7A 3TDUA 3NSOA 2MLEC 2MBXA 3V2LA 2PASA 2LVVA 4ZCUA 4PE1A 3WHUB 1CDNA 2QDIA 4F0ZB 1C07A 4PDZA 2LM5A 1RJVA 1YRTB 3JVTC 1W9ZA 2LLSA 3DZTA 2K7DA 5FI6A 2V53A 5CSFA 2BECA 1M45A 1UUSA 2KBMA 3UNWA 3OGNA 1F8HA 2LVIA 1DT7B 1F4QA 2CT9A 3CTNA 1KK7Z 3NHTA 4PHMA 3B6XA 4MLWA 1FF1A 5DICA 3Q8IA 3VRRA 1K90D 2GGZA 2KHNA 3JTDC 1OMDA 2Y1NA 3NHIA 1B7TY 4GNKB 4E68A 1CFCA 5EL2A 3CGAA 5HKWA 4OCIA 3DF0B 2AAOA 3NSLA 1CLBA 2WCKA 3SG7A 3CZ2A 1UWOA 4BY4A 5TNCA 1XVJA 1DGVA 2ISDA 4CPVA 1SMGA 2I18A 1NP8A 1BF5A 3BUWB 3LK0A 1DF0B 3KPXA 2KI4B 3PATA 1XFUO 2WCMA 4JD9A 1CKKA 1DJIA 1XFXO 2QEHA 5JOLA 3TS5B 3PALA 4P5OE 1MUXA 3DVKA 2KDHA 3TDZA 1HQVA 1NX3A 1ZUZA 5FYXA 2BCXA 2SCPA 4PHKA 1BT6A 1ODBA 3DD4A 1QIVA 3SG3A 1YTZC 1JF2A 2KSPA 4FQTA 4KYNA 1DQEA 1CDLA 4N1FA 3S0GA 1Y1XA 2CCMA 2BKIB 1WY9A 3B88A 3VB1A 4UPGA 1DJHA 1JFKA 3LK1A 4AQJA 2JPOA 2Q4UA 2K61A 2K7OA 3KHEA 3D10A 1KQMC 1NCYA 5HLVA 3H4SE 4JWQA 4YRUA 1JWDA 5HYDA 4IL1A 4C0LA 1NIWA 3EVUA 1WLMA 2KYFA 5I2QA 1IKUA 2ZRTA 1N2DA 2ZFDA 4TNCA 1FPWA 1GGZA 1QTXA 3AKBA 4ORAB 2ZN9A 1L2OC 1EG3A 5F6TA 1XA5A 3IF7A 2K2FA 1KK8C 1X02A 5FI7A 1ZFSA 3DY9A 4NDDA 1RK9A 1SCVA 2LC5A 2LHIA 1LINA 1J55A 4ORCB 3PM2A 1BG1A 1G33A 1NX2A 3FIAA 4JPZB 2L2CA 1YX7A 2M7LA 3PLFB 2JWWA 1OZOA 2WCEA 3D73A 1OSAA 3VROA 1WDCC 2OPOA 4I5NB 4A4CA 3KO0A 1OMVA 3I5GC 1IJ6A 2BBMA 1OQPA 1G4YR 1UHJA 3ZWHA 5CPVA 2FCDA 4DUQA 3L47A 1S6IA 2FCEA 2OTGC 1PULA 2LAPA 3SG4A 1NX0A 1EG4A 2K60A 5BPJA 1Y6WA 1IWQA 3R72A 1Q80A 2M7NA 2PYQA 1QLKA 2KBIA 1YRUB 2PSRA 4MSPA 3PN7C 1QVIY 1TNWA 2F33A 2QPTA 3QMEA 2ZKMX 4PE0A 3ZNIA 1PK0D 1QATA 1SY9A 1AHRA 1KFUS 4HRGA 4DRWA 1C3YA 2Y1MA 1RFJA 2K2AA 2KAYA 3S0FA 1UP5A 2LE9B 3LL8B 3FWCA 2WCFA 3RM1A 1K9KA 1MR8A 2EC6C 1E8AA 1K93D 1KCYA 1AJ5A 3SS5A 4AOMA 3AKAA 1RECA 5K89A 3ICBA 1IJ5A 1SKTA 1WLZA 1G8IA 2JU0A 3RLZA 3I5IB 1NPQA 4U8DA 3OX6A 1XK4C 1RTP1 1YUUA 1EL4A 2BL0B 2DOQA 1LVCD 4P2YB 4NDBA 1CLLA 1DEKA 2FOTA 3CDNA 5AEQA 1J7OA 3K21A 3IQQA 1NCZA 3I5FC 2P70A 2B1UA 1J7RA 1QV0A 4ZCVA 4CLNA 1XFWO 1CM1A 3QRXA 1DJWA 2JT0A 1DJZA 1MXLC 3CLNA 4XJKA 1SSEB 1JUOA 2AUCA 1TTXA 5I94A 3BUOB 2A4JA 3K1EA 3SJSA 1BLQA 4ICBA 1KQVA 1YURA 1UHNA 2JOJA 4HRHA 2LP3A 1DJYA 3LLEA 4JKTA 1CFDA 4N5XA 2H2KA 4QJ3B 2BE6A 2WORA 2H61C 2KAXA 2O5GA 1A4PA 2ERBA 1QIWA 4YGEB 2FJUB 5JJGA 1M63B 1IRJA 2JRFA 3DVEA 3OB1B 3HCMA 4YGCB 5ER5A 2NXQA 1RWYA 1SR6B 2E6WA 5I2LA 1P28A 1BODA 2BAPA 4FQOA 1HT9A 3CYZA 3OP0A 2IS9A 2JXLA 2M29A 1QWVA 3CWGA 2KLEA 4C0JA 1JFJA 1DC1A 1NSHA 1A75A 1SL7A 2L51A 1H4BA 2JC2A 4GGFC 3DVMA 1AUIB 3CR2A 3C1VA 5DKQA 2JPTA 2PQLA 1NCXA 4M2OA 2M9GA 1SNLA 4JQ0D 3VRQA 1KSMA 1PSRA 1L7ZA 1C7WA 1LXFC 1PALA 2F2OA 2I94A 2JTTA 4WQ2A 4ETOA 5I2OA 4FTGA 3UO9A 3R1PA 5DKRA 3GK2A 5FI2A 1C7VA 1SW8A 2P6BB 3SG2A 1OZSA 2KI4C 2KI6C 5CSIA 5KTYA 1PVBA 1B8CA 3EVRA 3TS5C 3VGOA 4PHJA 3VRNA 4PE4A 1XFYO 1F70A 2CBLA 3PM8A 4F7FA 5J3XA 1TCFA 1CB1A 1KFUL 1K8UA 2HPSA 2MRDA 4GFTA 1W7IB 3D75A 4GUKA 1EH2A 1TRFA 3KF9A 3LCPC 3CZTX 1VRKA 1SL9A 2L98A 4USLA 2WC8A 5HKYA 1A2XA 1YR5A 3FS7A 1BJFA 2L5YA 4YGDB 3EK4A 2JZIA 1SPYA 2JT3A 5DKNA 2KLDA 4GPLB 2MJWB 1B7TZ 2QEVA 1J7PA 3EK7A 1OOJA 1SCMB 1BU3A 1YUSA 4ORBB 4INWA 4Q04A 2JXCA 2F3ZA 3F45A 4YI9A 4GBAA 2BBNA 4MEWA 4XJKB 5KU1A 1Y0VH 1F4OA 2L0PA 1OOGA 1J7QA 1S26D 1CM4A 3R1OA 1LA3A 3OX5A 5D7FA 1NUBA 1ORGA 3NXAA 2EGDA 1YVLA 2KI6D 1ZMZA 4OKHA 2Y5IA 1AK8A 2KOTA 2L5XB 1OMRA 3BFHA 3D77A 2L4IA 2MHHA 3I5HB 1YUTA 2K0JA 1QS7A 5CSJA 1K2HA 1TCOB 1F54A 5AANA 4QJ5B 2TN4A 5AERA 3DVJA 3A8RA 2K7BA 5B8IB 1FI5A 3L4LA 3R1VA 1SK6D 1DMOA 4NDCA 3CABA 1QLSA 2CTNA 4PCWA 1EJ3A 4DCKA 1H8BA 2OS8B 3FE9A 4YBHB 1M31A 3EVVA 2NZ0A 2QEBA 3SG5A 1GJYA 2KGBC 3WXAA 1NYAA 1QX5B 1Y1UA 2WNDA 1CMGA 2LMTA 1A75B 1S6CA 1R6PA 1M39A 1N65A 2WCLA 3TUYB 2ZN8A 4DIRA 3VRPA 4MZLA 1KK7Y 3O4YA 2CXJA 2RGIA 3GOFA 1KSOA 3IQOA 1K9UA 3BOWA 3EK8A 3SIBA 1JC2A 2YGUA 3TZ1A 1UURA 2HETA 2LVKA 4N1GA 1KWOB 3A4UB 4OVNF 2HQWA 4PE7A 4YGBB 3M0WA 1S3PA 2MAZA 4OV2A 1M46A 1TWOA 1KFXS 2WC6A 5KSZA 1UHKA 3I5IC 1QX7A 4YGAA 2BL0C 3EG5B 1ZOTB 3FE6A 3S0BA 1CMFA 1W7JB 1GGWA 1DGUA 2JQ6A 2KFHA 1S6JA 5HLOA 4CFRA 3B7AA 3BYAA 3DXLA 3JVTB 3OB2B 2FJYA 3SG6A 1TIZA 5PALA 2HF5A 2NLNA 1D1OA 2WCJA 1CDPA 1QVIZ 1TNPA 2PALA 4XYNA 2HQ8A 3KEVA 1BMOA 1PRWA 1YVHA 1K95A 4AQIA 1LA0A 1CFPA 2PVBA 2O60A 4QJ4B 2AMIA 2WCBA 2QEOA 3S0EA 3N7HA 1CDMA 1S36A 2JT8A 2LCPA 3JTDB 4MRYA 2I7AA 4D1EA 1IIOA 3L4AA 3GK1A 1QX2A 4OZDA 3O2PA 3D0YA 3CS1A 3CR5X 2WOSA 4M2PA 1TUZA 2KFGA 4MRXA 3PJIA 4CFQA 1DJGA 1MWNA 3FE8A 3D74A 1MXEA 1CLMA 1DVIA 2KAVA 2F2PA 3OBVA 1SR6C 2WC5A 1U5IA 3BQ3A 2KYCA 3WHTB 1XK4A 1UHHA 2WCHA 2PRUA 3MSEB 1FBVA 1TOPA 2CNPA 2H8VA 3O6BA 1NWDA 1B8RA 1EXRA 4CIDA 1FI6A 2Q91A 2JULA 2LNKA 1ALVA 1AP4A 4IJ7A 5G08A 5CSNA 2F3YA 1JSAA 3BJHA 2KQ6A 1PVAA 3WNXB 3O78A 4MVFA 5HKZA 2K8MB 1IQ5A 1GQMA 1KQMB 1R2UA 1B8LA 1Z2CB 2JNFA 1SRAA 3BUNB 3TDIA 1CNPA 3E3RA 3SIAA 1QJTA 1BR4B 4HREE 4PHNA 1A29A 4PALA 1SBJA 3GK4X 2LP2A 4I5JA 1J1EA 1WRKA 1OE9B 2LV7A 2H61A 2BNXA 1B1GA 1K94A 1AJ4A 2GGMA 1L2OB 2LUXA 4WQ3A 1SYMA 2LMVA 2MLFC 1IH0A 3NGVA 3BOWB 1J1DA 1KK8B 2E30A 2KFFA 4I5KA 2M1UA 5GQQC 1RROA 2K7CA 3SS3A 1Y1AA 1K9PA 2F8PA 1TNQA 1XFRA 1A03A 1CTRA 1B47A 1SL8A 2ZRSA 1LS8A 2LUCA 5D69A 1WDCB 1BR1B 3I5GB 1KFXL 1MHOA 3S0DA 1MQ1A 3EKHA 1SCMC 2KQYA 2GV5A 4GGFA 1S5GY 2M8UA 3O4XA 1F71A 4HSZA 4R1EA 1ALWA 4C0KA 2OTGB 1WRZA 4MZKA 2I2RE 1FW4A 4WRIA 1N0YA 3DF0A 1K96A 3BFBA 2KPHA 4NQGA 1F55A 1B4CA 3PFVA 1IGVA 2Y4QA 3EKJA 2NCOA 4MN0A 2ZNDA 3NSIA 3PN7B 1QASA 1DF0A 1B9AA 1S1EA 3NSKA 1QXPA 4MZJA 3S0AA 5IBWA 2M3WA 3BXKA 1V1FA 1OOHA 3B87A 1YX8A 2BE4A 2LHLA 3D0YB 2G9BA 3I5HC 1NX1A 4PT1A 1TN4A 1IG5A 4BY5A 5I8NA 2EC6B 1GM0A 1JF0A 1XFVO 2NCPA 1MF8B 2M1KB 3AAKA 1AVSA 5AFPA 1BOCA 1XFZO 1CFFA 3PSRA 1JBAA 2G2BA 3CR4X 4MBEA 1Z4HA 4L9MA 3BFAA 3RZSA 1XYDA 2OS8C 2VRGA 1U5IB 1TNXA 1DELA 2LLUA 4I5LB 3HX4A 2LVJA 4GAOA 2KNEA 2LLTA 2GTEA 2JNXA 2P71A 5D3OA 2EHBA 1OOIX 2BCAA 2BKHB 2LANA 3I5FB 2QACA 4GGNA 5ER4X 3TUYC 2KGRA 3BUMB 1PSBA 3AAJA 1OW4A 1C3ZA 2L50A 1QV1A 1WRLA 3D78A 3DYEA 2MA2A 2M0RA 2COLB 1OOFA
chains in the Genus database with same CATH topology
2L2EA 4M2QA 1UHIA 1IQ3A 1LKJA 1DTLA 2L4HA 1XO5A 4YI8A 3BUXB 2M97A 1S5GZ 1DJXA 1KWOC 2D8NA 2SASA 3OHMB 2ZNEA 2M49B 4OR9B 1V1GA 3FWBA 2PMYA 2JTZA 5AXIA 1ZACA 2LMUA 4A4BA 2BCBA 2R2IA 4DS7A 3TDUA 3NSOA 2MLEC 2MBXA 2PASA 2LVVA 4ZCUA 4PE1A 3WHUB 1CDNA 4F0ZB 1C07A 4PDZA 2LM5A 1RJVA 1YRTB 3JVTC 2LLSA 2K7DA 2V53A 5CSFA 2BECA 1M45A 1UUSA 2KBMA 1F8HA 2LVIA 1DT7B 1F4QA 2CT9A 3CTNA 1KK7Z 4PHMA 4MLWA 1FF1A 3VRRA 1K90D 2GGZA 2KHNA 3JTDC 1OMDA 2Y1NA 4GNKB 1B7TY 4E68A 1CFCA 3CGAA 5HKWA 4OCIA 3DF0B 2AAOA 3NSLA 1CLBA 3SG7A 1UWOA 4BY4A 5TNCA 1XVJA 1DGVA 2ISDA 4CPVA 1SMGA 2I18A 1NP8A 1BF5A 3BUWB 3LK0A 1DF0B 3KPXA 2KI4B 3PATA 1XFUO 1CKKA 1DJIA 1XFXO 5JOLA 3TS5B 3PALA 4P5OE 1MUXA 3DVKA 2KDHA 3TDZA 1HQVA 1NX3A 1ZUZA 5FYXA 2BCXA 2SCPA 4PHKA 1BT6A 1ODBA 3DD4A 1QIVA 3SG3A 1YTZC 1JF2A 2KSPA 1CDLA 4N1FA 1Y1XA 2CCMA 2BKIB 1WY9A 4UPGA 1DJHA 1JFKA 3LK1A 4AQJA 2Q4UA 2K61A 2K7OA 3KHEA 3D10A 1KQMC 1NCYA 5HLVA 4JWQA 4YRUA 1JWDA 5HYDA 4IL1A 4C0LA 1NIWA 3EVUA 1WLMA 2KYFA 5I2QA 1IKUA 2ZRTA 1N2DA 2ZFDA 4TNCA 1FPWA 1GGZA 1QTXA 3AKBA 4ORAB 2ZN9A 1L2OC 1EG3A 5F6TA 1XA5A 3IF7A 2K2FA 1KK8C 1X02A 1ZFSA 4NDDA 1RK9A 1SCVA 2LC5A 2LHIA 1LINA 1J55A 4ORCB 1BG1A 1G33A 1NX2A 3FIAA 4JPZB 2M7LA 1YX7A 3PLFB 2JWWA 1OZOA 2WCEA 3VROA 1OSAA 1WDCC 2OPOA 4I5NB 4A4CA 3KO0A 1OMVA 3I5GC 1IJ6A 2BBMA 1OQPA 1G4YR 1UHJA 3ZWHA 5CPVA 2FCDA 4DUQA 1S6IA 2FCEA 2OTGC 1PULA 2LAPA 3SG4A 1NX0A 1EG4A 5BPJA 1Y6WA 1IWQA 1Q80A 2M7NA 1QLKA 2KBIA 1YRUB 2PSRA 4MSPA 3PN7C 1QVIY 1TNWA 2F33A 2QPTA 4PE0A 2ZKMX 3ZNIA 1PK0D 1QATA 1SY9A 1AHRA 1KFUS 4HRGA 4DRWA 2Y1MA 1RFJA 2K2AA 2KAYA 1UP5A 2LE9B 3LL8B 3FWCA 2WCFA 3RM1A 1K9KA 1MR8A 2EC6C 1E8AA 1K93D 1KCYA 1AJ5A 4AOMA 3AKAA 1RECA 5K89A 3ICBA 1IJ5A 1SKTA 1WLZA 1G8IA 2JU0A 3RLZA 3I5IB 1NPQA 4U8DA 3OX6A 1XK4C 1RTP1 1YUUA 1EL4A 2BL0B 2DOQA 1LVCD 4P2YB 4NDBA 1CLLA 2FOTA 5I2LA 5AEQA 1J7OA 3K21A 3IQQA 1NCZA 3I5FC 2B1UA 1J7RA 1QV0A 4ZCVA 4CLNA 1XFWO 1CM1A 3QRXA 1DJWA 2JT0A 1DJZA 1MXLC 3CLNA 4XJKA 1JUOA 2AUCA 1TTXA 3BUOB 2A4JA 3SJSA 1BLQA 4ICBA 1KQVA 1YURA 1UHNA 2JOJA 4HRHA 2LP3A 1DJYA 3LLEA 1CFDA 4N5XA 2H2KA 4QJ3B 2BE6A 2WORA 2H61C 2KAXA 2O5GA 1A4PA 1QIWA 4YGEB 2FJUB 5JJGA 1M63B 1IRJA 2JRFA 3DVEA 3OB1B 3HCMA 4YGCB 5ER5A 2NXQA 1RWYA 1SR6B 2E6WA 1BODA 4FQOA 1HT9A 3OP0A 2IS9A 2JXLA 2M29A 4C0JA 3CWGA 1JFJA 1NSHA 1A75A 1SL7A 2L51A 1H4BA 2JC2A 4GGFC 3DVMA 1AUIB 3CR2A 3C1VA 5DKQA 2JPTA 1NCXA 4M2OA 2M9GA 1SNLA 4JQ0D 3VRQA 1KSMA 1PSRA 1L7ZA 1C7WA 1LXFC 1PALA 2F2OA 2I94A 2JTTA 4WQ2A 4ETOA 5I2OA 4FTGA 5DKRA 3GK2A 1C7VA 1SW8A 2P6BB 3SG2A 1OZSA 2KI4C 2KI6C 5CSIA 5KTYA 1PVBA 1B8CA 3EVRA 3TS5C 3VGOA 4PHJA 3VRNA 4PE4A 1XFYO 1F70A 2CBLA 3PM8A 5J3XA 1TCFA 1CB1A 1KFUL 1K8UA 2HPSA 2MRDA 4GFTA 1W7IB 4GUKA 1EH2A 1TRFA 3KF9A 3LCPC 3CZTX 1VRKA 1SL9A 2L98A 4USLA 2WC8A 5HKYA 1A2XA 1YR5A 3FS7A 1BJFA 4YGDB 3EK4A 2JZIA 1SPYA 2JT3A 5DKNA 4GPLB 2MJWB 1B7TZ 1J7PA 3EK7A 1OOJA 1SCMB 1BU3A 1YUSA 4ORBB 4Q04A 2JXCA 2F3ZA 3F45A 4YI9A 4GBAA 2BBNA 4MEWA 4XJKB 5KU1A 1Y0VH 1F4OA 2L0PA 1J7QA 1S26D 1CM4A 1LA3A 3OX5A 5D7FA 1NUBA 3NXAA 2EGDA 1YVLA 2KI6D 1ZMZA 4OKHA 2Y5IA 1AK8A 2KOTA 2L5XB 1OMRA 2L4IA 2MHHA 3I5HB 1YUTA 2K0JA 1QS7A 5CSJA 1K2HA 1TCOB 1F54A 5AANA 4QJ5B 2TN4A 5AERA 3DVJA 3A8RA 2K7BA 5B8IB 1FI5A 1DMOA 1SK6D 4NDCA 1QLSA 2CTNA 4PCWA 1EJ3A 4DCKA 1H8BA 2OS8B 4YBHB 1M31A 3EVVA 2NZ0A 3SG5A 1GJYA 2KGBC 3WXAA 1NYAA 1QX5B 1Y1UA 2WNDA 1CMGA 2LMTA 1A75B 1S6CA 1R6PA 1M39A 1N65A 3TUYB 2ZN8A 4DIRA 3VRPA 4MZLA 1KK7Y 3O4YA 2CXJA 2RGIA 3GOFA 1KSOA 3IQOA 1K9UA 3BOWA 3EK8A 3SIBA 1JC2A 3TZ1A 1UURA 2HETA 2LVKA 4N1GA 1KWOB 3A4UB 4OVNF 2HQWA 4PE7A 4YGBB 3M0WA 1S3PA 2MAZA 4OV2A 1M46A 1KFXS 5KSZA 1UHKA 3I5IC 1QX7A 4YGAA 2BL0C 1ZOTB 1CMFA 1W7JB 1GGWA 1DGUA 2JQ6A 2KFHA 1S6JA 5HLOA 4CFRA 3BYAA 3JVTB 3OB2B 3SG6A 1TIZA 5PALA 2HF5A 2NLNA 1D1OA 1CDPA 1QVIZ 1TNPA 2PALA 4XYNA 2HQ8A 3KEVA 1BMOA 1PRWA 1YVHA 1K95A 4AQIA 1LA0A 1CFPA 2PVBA 2O60A 4QJ4B 2AMIA 2WCBA 1CDMA 1S36A 2JT8A 2LCPA 3JTDB 4MRYA 2I7AA 4D1EA 3GK1A 1QX2A 3O2PA 3D0YA 3CS1A 3CR5X 2WOSA 4M2PA 2KFGA 4MRXA 4CFQA 1DJGA 1MWNA 1MXEA 1CLMA 1DVIA 2KAVA 2F2PA 1SR6C 3BQ3A 1U5IA 2KYCA 3WHTB 1XK4A 1UHHA 2PRUA 3MSEB 1FBVA 1TOPA 2CNPA 3O6BA 1NWDA 1B8RA 1EXRA 4CIDA 1FI6A 2Q91A 2JULA 2LNKA 1ALVA 1AP4A 5G08A 5CSNA 2F3YA 1JSAA 2KQ6A 1PVAA 3WNXB 3O78A 4MVFA 5HKZA 2K8MB 1IQ5A 1GQMA 1KQMB 1R2UA 1B8LA 2JNFA 3BUNB 1SRAA 3TDIA 1CNPA 3E3RA 3SIAA 1QJTA 1BR4B 4HREE 4PHNA 1A29A 4PALA 1SBJA 3GK4X 2LP2A 4I5JA 1J1EA 1WRKA 1OE9B 2LV7A 2H61A 1B1GA 1K94A 1AJ4A 2GGMA 1L2OB 2LUXA 4WQ3A 1SYMA 2LMVA 2MLFC 1IH0A 3BOWB 1J1DA 1KK8B 2E30A 2KFFA 4I5KA 2M1UA 5GQQC 1RROA 2K7CA 1Y1AA 1K9PA 2F8PA 1TNQA 1A03A 1CTRA 1B47A 1SL8A 2ZRSA 2LUCA 5D69A 1WDCB 1BR1B 3I5GB 1KFXL 1MHOA 1MQ1A 3EKHA 1SCMC 2KQYA 2GV5A 4GGFA 1S5GY 2M8UA 1F71A 4HSZA 4R1EA 1ALWA 4C0KA 2OTGB 1WRZA 4MZKA 2I2RE 1FW4A 4WRIA 1N0YA 3DF0A 1K96A 4NQGA 1F55A 1B4CA 3PFVA 1IGVA 2Y4QA 3EKJA 2NCOA 4MN0A 2ZNDA 3NSIA 3PN7B 1QASA 1DF0A 1B9AA 1S1EA 3NSKA 1QXPA 4MZJA 5IBWA 2M3WA 3BXKA 1V1FA 1YX8A 2BE4A 2LHLA 3D0YB 2G9BA 3I5HC 1NX1A 1TN4A 1IG5A 4BY5A 5I8NA 2EC6B 1JF0A 1XFVO 2NCPA 1MF8B 2M1KB 3AAKA 1AVSA 5AFPA 1BOCA 1XFZO 1CFFA 3PSRA 1JBAA 2G2BA 3CR4X 4MBEA 4L9MA 1XYDA 2OS8C 2VRGA 1U5IB 1TNXA 2LLUA 4I5LB 3HX4A 2LVJA 4GAOA 2KNEA 2LLTA 2JNXA 2EHBA 2BCAA 2BKHB 2LANA 3I5FB 2QACA 4GGNA 5ER4X 3TUYC 2KGRA 3BUMB 1PSBA 3AAJA 3H4SE 2L50A 1QV1A 1WRLA 2MA2A 2M0RA 2COLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2E A;  4M2Q A;  1UHI A;  1IQ3 A;  1LKJ A;  1DTL A;  2L4H A;  1XO5 A;  4YI8 A;  3BUX B;  2M97 A;  1S5G Z;  1DJX A;  1KWO C;  2D8N A;  2SAS A;  3OHM B;  2ZNE A;  2M49 B;  4OR9 B;  1V1G A;  3FWB A;  2PMY A;  2JTZ A;  5AXI A;  1ZAC A;  2LMU A;  4A4B A;  2BCB A;  2R2I A;  4DS7 A;  3TDU A;  3NSO A;  2MLE C;  2MBX A;  2PAS A;  2LVV A;  4ZCU A;  4PE1 A;  3WHU B;  1CDN A;  4F0Z B;  1C07 A;  4PDZ A;  2LM5 A;  1RJV A;  1YRT B;  3JVT C;  2LLS A;  2K7D A;  2V53 A;  5CSF A;  2BEC A;  1M45 A;  1UUS A;  2KBM A;  1F8H A;  2LVI A;  1DT7 B;  1F4Q A;  2CT9 A;  3CTN A;  1KK7 Z;  4PHM A;  4MLW A;  1FF1 A;  3VRR A;  1K90 D;  2GGZ A;  2KHN A;  3JTD C;  1OMD A;  2Y1N A;  4GNK B;  1B7T Y;  4E68 A;  1CFC A;  3CGA A;  5HKW A;  4OCI A;  3DF0 B;  2AAO A;  3NSL A;  1CLB A;  3SG7 A;  1UWO A;  4BY4 A;  5TNC A;  1XVJ A;  1DGV A;  2ISD A;  4CPV A;  1SMG A;  2I18 A;  1NP8 A;  1BF5 A;  3BUW B;  3LK0 A;  1DF0 B;  3KPX A;  2KI4 B;  3PAT A;  1XFU O;  1CKK A;  1DJI A;  1XFX O;  5JOL A;  3TS5 B;  3PAL A;  4P5O E;  1MUX A;  3DVK A;  2KDH A;  3TDZ A;  1HQV A;  1NX3 A;  1ZUZ A;  5FYX A;  2BCX A;  2SCP A;  4PHK A;  1BT6 A;  1ODB A;  3DD4 A;  1QIV A;  3SG3 A;  1YTZ C;  1JF2 A;  2KSP A;  1CDL A;  4N1F A;  1Y1X A;  2CCM A;  2BKI B;  1WY9 A;  4UPG A;  1DJH A;  1JFK A;  3LK1 A;  4AQJ A;  2Q4U A;  2K61 A;  2K7O A;  3KHE A;  3D10 A;  1KQM C;  1NCY A;  5HLV A;  4JWQ A;  4YRU A;  1JWD A;  5HYD A;  4IL1 A;  4C0L A;  1NIW A;  3EVU A;  1WLM A;  2KYF A;  5I2Q A;  1IKU A;  2ZRT A;  1N2D A;  2ZFD A;  4TNC A;  1FPW A;  1GGZ A;  1QTX A;  3AKB A;  4ORA B;  2ZN9 A;  1L2O C;  1EG3 A;  5F6T A;  1XA5 A;  3IF7 A;  2K2F A;  1KK8 C;  1X02 A;  1ZFS A;  4NDD A;  1RK9 A;  1SCV A;  2LC5 A;  2LHI A;  1LIN A;  1J55 A;  4ORC B;  1BG1 A;  1G33 A;  1NX2 A;  3FIA A;  4JPZ B;  2M7L A;  1YX7 A;  3PLF B;  2JWW A;  1OZO A;  2WCE A;  3VRO A;  1OSA A;  1WDC C;  2OPO A;  4I5N B;  4A4C A;  3KO0 A;  1OMV A;  3I5G C;  1IJ6 A;  2BBM A;  1OQP A;  1G4Y R;  1UHJ A;  3ZWH A;  5CPV A;  2FCD A;  4DUQ A;  1S6I A;  2FCE A;  2OTG C;  1PUL A;  2LAP A;  3SG4 A;  1NX0 A;  1EG4 A;  5BPJ A;  1Y6W A;  1IWQ A;  1Q80 A;  2M7N A;  1QLK A;  2KBI A;  1YRU B;  2PSR A;  4MSP A;  3PN7 C;  1QVI Y;  1TNW A;  2F33 A;  2QPT A;  4PE0 A;  2ZKM X;  3ZNI A;  1PK0 D;  1QAT A;  1SY9 A;  1AHR A;  1KFU S;  4HRG A;  4DRW A;  2Y1M A;  1RFJ A;  2K2A A;  2KAY A;  1UP5 A;  2LE9 B;  3LL8 B;  3FWC A;  2WCF A;  3RM1 A;  1K9K A;  1MR8 A;  2EC6 C;  1E8A A;  1K93 D;  1KCY A;  1AJ5 A;  4AOM A;  3AKA A;  1REC A;  5K89 A;  3ICB A;  1IJ5 A;  1SKT A;  1WLZ A;  1G8I A;  2JU0 A;  3RLZ A;  3I5I B;  1NPQ A;  4U8D A;  3OX6 A;  1XK4 C;  1RTP 1;  1YUU A;  1EL4 A;  2BL0 B;  2DOQ A;  1LVC D;  4P2Y B;  4NDB A;  1CLL A;  2FOT A;  5I2L A;  5AEQ A;  1J7O A;  3K21 A;  3IQQ A;  1NCZ A;  3I5F C;  2B1U A;  1J7R A;  1QV0 A;  4ZCV A;  4CLN A;  1XFW O;  1CM1 A;  3QRX A;  1DJW A;  2JT0 A;  1DJZ A;  1MXL C;  3CLN A;  4XJK A;  1JUO A;  2AUC A;  1TTX A;  3BUO B;  2A4J A;  3SJS A;  1BLQ A;  4ICB A;  1KQV A;  1YUR A;  1UHN A;  2JOJ A;  4HRH A;  2LP3 A;  1DJY A;  3LLE A;  1CFD A;  4N5X A;  2H2K A;  4QJ3 B;  2BE6 A;  2WOR A;  2H61 C;  2KAX A;  2O5G A;  1A4P A;  1QIW A;  4YGE B;  2FJU B;  5JJG A;  1M63 B;  1IRJ A;  2JRF A;  3DVE A;  3OB1 B;  3HCM A;  4YGC B;  5ER5 A;  2NXQ A;  1RWY A;  1SR6 B;  2E6W A;  1BOD A;  4FQO A;  1HT9 A;  3OP0 A;  2IS9 A;  2JXL A;  2M29 A;  4C0J A;  3CWG A;  1JFJ A;  1NSH A;  1A75 A;  1SL7 A;  2L51 A;  1H4B A;  2JC2 A;  4GGF C;  3DVM A;  1AUI B;  3CR2 A;  3C1V A;  5DKQ A;  2JPT A;  1NCX A;  4M2O A;  2M9G A;  1SNL A;  4JQ0 D;  3VRQ A;  1KSM A;  1PSR A;  1L7Z A;  1C7W A;  1LXF C;  1PAL A;  2F2O A;  2I94 A;  2JTT A;  4WQ2 A;  4ETO A;  5I2O A;  4FTG A;  5DKR A;  3GK2 A;  1C7V A;  1SW8 A;  2P6B B;  3SG2 A;  1OZS A;  2KI4 C;  2KI6 C;  5CSI A;  5KTY A;  1PVB A;  1B8C A;  3EVR A;  3TS5 C;  3VGO A;  4PHJ A;  3VRN A;  4PE4 A;  1XFY O;  1F70 A;  2CBL A;  3PM8 A;  5J3X A;  1TCF A;  1CB1 A;  1KFU L;  1K8U A;  2HPS A;  2MRD A;  4GFT A;  1W7I B;  4GUK A;  1EH2 A;  1TRF A;  3KF9 A;  3LCP C;  3CZT X;  1VRK A;  1SL9 A;  2L98 A;  4USL A;  2WC8 A;  5HKY A;  1A2X A;  1YR5 A;  3FS7 A;  1BJF A;  4YGD B;  3EK4 A;  2JZI A;  1SPY A;  2JT3 A;  5DKN A;  4GPL B;  2MJW B;  1B7T Z;  1J7P A;  3EK7 A;  1OOJ A;  1SCM B;  1BU3 A;  1YUS A;  4ORB B;  4Q04 A;  2JXC A;  2F3Z A;  3F45 A;  4YI9 A;  4GBA A;  2BBN A;  4MEW A;  4XJK B;  5KU1 A;  1Y0V H;  1F4O A;  2L0P A;  1J7Q A;  1S26 D;  1CM4 A;  1LA3 A;  3OX5 A;  5D7F A;  1NUB A;  3NXA A;  2EGD A;  1YVL A;  2KI6 D;  1ZMZ A;  4OKH A;  2Y5I A;  1AK8 A;  2KOT A;  2L5X B;  1OMR A;  2L4I A;  2MHH A;  3I5H B;  1YUT A;  2K0J A;  1QS7 A;  5CSJ A;  1K2H A;  1TCO B;  1F54 A;  5AAN A;  4QJ5 B;  2TN4 A;  5AER A;  3DVJ A;  3A8R A;  2K7B A;  5B8I B;  1FI5 A;  1DMO A;  1SK6 D;  4NDC A;  1QLS A;  2CTN A;  4PCW A;  1EJ3 A;  4DCK A;  1H8B A;  2OS8 B;  4YBH B;  1M31 A;  3EVV A;  2NZ0 A;  3SG5 A;  1GJY A;  2KGB C;  3WXA A;  1NYA A;  1QX5 B;  1Y1U A;  2WND A;  1CMG A;  2LMT A;  1A75 B;  1S6C A;  1R6P A;  1M39 A;  1N65 A;  3TUY B;  2ZN8 A;  4DIR A;  3VRP A;  4MZL A;  1KK7 Y;  3O4Y A;  2CXJ A;  2RGI A;  3GOF A;  1KSO A;  3IQO A;  1K9U A;  3BOW A;  3EK8 A;  3SIB A;  1JC2 A;  3TZ1 A;  1UUR A;  2HET A;  2LVK A;  4N1G A;  1KWO B;  3A4U B;  4OVN F;  2HQW A;  4PE7 A;  4YGB B;  3M0W A;  1S3P A;  2MAZ A;  4OV2 A;  1M46 A;  1KFX S;  5KSZ A;  1UHK A;  3I5I C;  1QX7 A;  4YGA A;  2BL0 C;  1ZOT B;  1CMF A;  1W7J B;  1GGW A;  1DGU A;  2JQ6 A;  2KFH A;  1S6J A;  5HLO A;  4CFR A;  3BYA A;  3JVT B;  3OB2 B;  3SG6 A;  1TIZ A;  5PAL A;  2HF5 A;  2NLN A;  1D1O A;  1CDP A;  1QVI Z;  1TNP A;  2PAL A;  4XYN A;  2HQ8 A;  3KEV A;  1BMO A;  1PRW A;  1YVH A;  1K95 A;  4AQI A;  1LA0 A;  1CFP A;  2PVB A;  2O60 A;  4QJ4 B;  2AMI A;  2WCB A;  1CDM A;  1S36 A;  2JT8 A;  2LCP A;  3JTD B;  4MRY A;  2I7A A;  4D1E A;  3GK1 A;  1QX2 A;  3O2P A;  3D0Y A;  3CS1 A;  3CR5 X;  2WOS A;  4M2P A;  2KFG A;  4MRX A;  4CFQ A;  1DJG A;  1MWN A;  1MXE A;  1CLM A;  1DVI A;  2KAV A;  2F2P A;  1SR6 C;  3BQ3 A;  1U5I A;  2KYC A;  3WHT B;  1XK4 A;  1UHH A;  2PRU A;  3MSE B;  1FBV A;  1TOP A;  2CNP A;  3O6B A;  1NWD A;  1B8R A;  1EXR A;  4CID A;  1FI6 A;  2Q91 A;  2JUL A;  2LNK A;  1ALV A;  1AP4 A;  5G08 A;  5CSN A;  2F3Y A;  1JSA A;  2KQ6 A;  1PVA A;  3WNX B;  3O78 A;  4MVF A;  5HKZ A;  2K8M B;  1IQ5 A;  1GQM A;  1KQM B;  1R2U A;  1B8L A;  2JNF A;  3BUN B;  1SRA A;  3TDI A;  1CNP A;  3E3R A;  3SIA A;  1QJT A;  1BR4 B;  4HRE E;  4PHN A;  1A29 A;  4PAL A;  1SBJ A;  3GK4 X;  2LP2 A;  4I5J A;  1J1E A;  1WRK A;  1OE9 B;  2LV7 A;  2H61 A;  1B1G A;  1K94 A;  1AJ4 A;  2GGM A;  1L2O B;  2LUX A;  4WQ3 A;  1SYM A;  2LMV A;  2MLF C;  1IH0 A;  3BOW B;  1J1D A;  1KK8 B;  2E30 A;  2KFF A;  4I5K A;  2M1U A;  5GQQ C;  1RRO A;  2K7C A;  1Y1A A;  1K9P A;  2F8P A;  1TNQ A;  1A03 A;  1CTR A;  1B47 A;  1SL8 A;  2ZRS A;  2LUC A;  5D69 A;  1WDC B;  1BR1 B;  3I5G B;  1KFX L;  1MHO A;  1MQ1 A;  3EKH A;  1SCM C;  2KQY A;  2GV5 A;  4GGF A;  1S5G Y;  2M8U A;  1F71 A;  4HSZ A;  4R1E A;  1ALW A;  4C0K A;  2OTG B;  1WRZ A;  4MZK A;  2I2R E;  1FW4 A;  4WRI A;  1N0Y A;  3DF0 A;  1K96 A;  4NQG A;  1F55 A;  1B4C A;  3PFV A;  1IGV A;  2Y4Q A;  3EKJ A;  2NCO A;  4MN0 A;  2ZND A;  3NSI A;  3PN7 B;  1QAS A;  1DF0 A;  1B9A A;  1S1E A;  3NSK A;  1QXP A;  4MZJ A;  5IBW A;  2M3W A;  3BXK A;  1V1F A;  1YX8 A;  2BE4 A;  2LHL A;  3D0Y B;  2G9B A;  3I5H C;  1NX1 A;  1TN4 A;  1IG5 A;  4BY5 A;  5I8N A;  2EC6 B;  1JF0 A;  1XFV O;  2NCP A;  1MF8 B;  2M1K B;  3AAK A;  1AVS A;  5AFP A;  1BOC A;  1XFZ O;  1CFF A;  3PSR A;  1JBA A;  2G2B A;  3CR4 X;  4MBE A;  4L9M A;  1XYD A;  2OS8 C;  2VRG A;  1U5I B;  1TNX A;  2LLU A;  4I5L B;  3HX4 A;  2LVJ A;  4GAO A;  2KNE A;  2LLT A;  2JNX A;  2EHB A;  2BCA A;  2BKH B;  2LAN A;  3I5F B;  2QAC A;  4GGN A;  5ER4 X;  3TUY C;  2KGR A;  3BUM B;  1PSB A;  3AAJ A;  3H4S E;  2L50 A;  1QV1 A;  1WRL A;  2MA2 A;  2M0R A;  2COL B; 
#chains in the Genus database with same CATH topology
 4INX A;  3CZ0 A;  2L2E A;  3D76 A;  4M2Q A;  1TUJ A;  1UHI A;  1IQ3 A;  1LKJ A;  1DTL A;  2L4H A;  1XO5 A;  4YI8 A;  3BUX B;  2M97 A;  1T14 A;  1S5G Z;  1DJX A;  1KWO C;  2D8N A;  2SAS A;  3OHM B;  2ZNE A;  3IVT A;  3SS4 A;  3CZ1 A;  2M49 B;  3B86 A;  4OR9 B;  1V1G A;  3FWB A;  2PMY A;  2JTZ A;  5AXI A;  1ZAC A;  2LMU A;  4A4B A;  2BCB A;  5HL1 A;  2R2I A;  4DS7 A;  3TDU A;  3NSO A;  2MLE C;  2MBX A;  3V2L A;  2PAS A;  2LVV A;  4ZCU A;  4PE1 A;  3WHU B;  1CDN A;  2QDI A;  4F0Z B;  1C07 A;  4PDZ A;  2LM5 A;  1RJV A;  1YRT B;  3JVT C;  1W9Z A;  2LLS A;  3DZT A;  2K7D A;  5FI6 A;  2V53 A;  5CSF A;  2BEC A;  1M45 A;  1UUS A;  2KBM A;  3UNW A;  3OGN A;  1F8H A;  2LVI A;  1DT7 B;  1F4Q A;  2CT9 A;  3CTN A;  1KK7 Z;  3NHT A;  4PHM A;  3B6X A;  4MLW A;  1FF1 A;  5DIC A;  3Q8I A;  3VRR A;  1K90 D;  2GGZ A;  2KHN A;  3JTD C;  1OMD A;  2Y1N A;  3NHI A;  1B7T Y;  4GNK B;  4E68 A;  1CFC A;  5EL2 A;  3CGA A;  5HKW A;  4OCI A;  3DF0 B;  2AAO A;  3NSL A;  1CLB A;  2WCK A;  3SG7 A;  3CZ2 A;  1UWO A;  4BY4 A;  5TNC A;  1XVJ A;  1DGV A;  2ISD A;  4CPV A;  1SMG A;  2I18 A;  1NP8 A;  1BF5 A;  3BUW B;  3LK0 A;  1DF0 B;  3KPX A;  2KI4 B;  3PAT A;  1XFU O;  2WCM A;  4JD9 A;  1CKK A;  1DJI A;  1XFX O;  2QEH A;  5JOL A;  3TS5 B;  3PAL A;  4P5O E;  1MUX A;  3DVK A;  2KDH A;  3TDZ A;  1HQV A;  1NX3 A;  1ZUZ A;  5FYX A;  2BCX A;  2SCP A;  4PHK A;  1BT6 A;  1ODB A;  3DD4 A;  1QIV A;  3SG3 A;  1YTZ C;  1JF2 A;  2KSP A;  4FQT A;  4KYN A;  1DQE A;  1CDL A;  4N1F A;  3S0G A;  1Y1X A;  2CCM A;  2BKI B;  1WY9 A;  3B88 A;  3VB1 A;  4UPG A;  1DJH A;  1JFK A;  3LK1 A;  4AQJ A;  2JPO A;  2Q4U A;  2K61 A;  2K7O A;  3KHE A;  3D10 A;  1KQM C;  1NCY A;  5HLV A;  3H4S E;  4JWQ A;  4YRU A;  1JWD A;  5HYD A;  4IL1 A;  4C0L A;  1NIW A;  3EVU A;  1WLM A;  2KYF A;  5I2Q A;  1IKU A;  2ZRT A;  1N2D A;  2ZFD A;  4TNC A;  1FPW A;  1GGZ A;  1QTX A;  3AKB A;  4ORA B;  2ZN9 A;  1L2O C;  1EG3 A;  5F6T A;  1XA5 A;  3IF7 A;  2K2F A;  1KK8 C;  1X02 A;  5FI7 A;  1ZFS A;  3DY9 A;  4NDD A;  1RK9 A;  1SCV A;  2LC5 A;  2LHI A;  1LIN A;  1J55 A;  4ORC B;  3PM2 A;  1BG1 A;  1G33 A;  1NX2 A;  3FIA A;  4JPZ B;  2L2C A;  1YX7 A;  2M7L A;  3PLF B;  2JWW A;  1OZO A;  2WCE A;  3D73 A;  1OSA A;  3VRO A;  1WDC C;  2OPO A;  4I5N B;  4A4C A;  3KO0 A;  1OMV A;  3I5G C;  1IJ6 A;  2BBM A;  1OQP A;  1G4Y R;  1UHJ A;  3ZWH A;  5CPV A;  2FCD A;  4DUQ A;  3L47 A;  1S6I A;  2FCE A;  2OTG C;  1PUL A;  2LAP A;  3SG4 A;  1NX0 A;  1EG4 A;  2K60 A;  5BPJ A;  1Y6W A;  1IWQ A;  3R72 A;  1Q80 A;  2M7N A;  2PYQ A;  1QLK A;  2KBI A;  1YRU B;  2PSR A;  4MSP A;  3PN7 C;  1QVI Y;  1TNW A;  2F33 A;  2QPT A;  3QME A;  2ZKM X;  4PE0 A;  3ZNI A;  1PK0 D;  1QAT A;  1SY9 A;  1AHR A;  1KFU S;  4HRG A;  4DRW A;  1C3Y A;  2Y1M A;  1RFJ A;  2K2A A;  2KAY A;  3S0F A;  1UP5 A;  2LE9 B;  3LL8 B;  3FWC A;  2WCF A;  3RM1 A;  1K9K A;  1MR8 A;  2EC6 C;  1E8A A;  1K93 D;  1KCY A;  1AJ5 A;  3SS5 A;  4AOM A;  3AKA A;  1REC A;  5K89 A;  3ICB A;  1IJ5 A;  1SKT A;  1WLZ A;  1G8I A;  2JU0 A;  3RLZ A;  3I5I B;  1NPQ A;  4U8D A;  3OX6 A;  1XK4 C;  1RTP 1;  1YUU A;  1EL4 A;  2BL0 B;  2DOQ A;  1LVC D;  4P2Y B;  4NDB A;  1CLL A;  1DEK A;  2FOT A;  3CDN A;  5AEQ A;  1J7O A;  3K21 A;  3IQQ A;  1NCZ A;  3I5F C;  2P70 A;  2B1U A;  1J7R A;  1QV0 A;  4ZCV A;  4CLN A;  1XFW O;  1CM1 A;  3QRX A;  1DJW A;  2JT0 A;  1DJZ A;  1MXL C;  3CLN A;  4XJK A;  1SSE B;  1JUO A;  2AUC A;  1TTX A;  5I94 A;  3BUO B;  2A4J A;  3K1E A;  3SJS A;  1BLQ A;  4ICB A;  1KQV A;  1YUR A;  1UHN A;  2JOJ A;  4HRH A;  2LP3 A;  1DJY A;  3LLE A;  4JKT A;  1CFD A;  4N5X A;  2H2K A;  4QJ3 B;  2BE6 A;  2WOR A;  2H61 C;  2KAX A;  2O5G A;  1A4P A;  2ERB A;  1QIW A;  4YGE B;  2FJU B;  5JJG A;  1M63 B;  1IRJ A;  2JRF A;  3DVE A;  3OB1 B;  3HCM A;  4YGC B;  5ER5 A;  2NXQ A;  1RWY A;  1SR6 B;  2E6W A;  5I2L A;  1P28 A;  1BOD A;  2BAP A;  4FQO A;  1HT9 A;  3CYZ A;  3OP0 A;  2IS9 A;  2JXL A;  2M29 A;  1QWV A;  3CWG A;  2KLE A;  4C0J A;  1JFJ A;  1DC1 A;  1NSH A;  1A75 A;  1SL7 A;  2L51 A;  1H4B A;  2JC2 A;  4GGF C;  3DVM A;  1AUI B;  3CR2 A;  3C1V A;  5DKQ A;  2JPT A;  2PQL A;  1NCX A;  4M2O A;  2M9G A;  1SNL A;  4JQ0 D;  3VRQ A;  1KSM A;  1PSR A;  1L7Z A;  1C7W A;  1LXF C;  1PAL A;  2F2O A;  2I94 A;  2JTT A;  4WQ2 A;  4ETO A;  5I2O A;  4FTG A;  3UO9 A;  3R1P A;  5DKR A;  3GK2 A;  5FI2 A;  1C7V A;  1SW8 A;  2P6B B;  3SG2 A;  1OZS A;  2KI4 C;  2KI6 C;  5CSI A;  5KTY A;  1PVB A;  1B8C A;  3EVR A;  3TS5 C;  3VGO A;  4PHJ A;  3VRN A;  4PE4 A;  1XFY O;  1F70 A;  2CBL A;  3PM8 A;  4F7F A;  5J3X A;  1TCF A;  1CB1 A;  1KFU L;  1K8U A;  2HPS A;  2MRD A;  4GFT A;  1W7I B;  3D75 A;  4GUK A;  1EH2 A;  1TRF A;  3KF9 A;  3LCP C;  3CZT X;  1VRK A;  1SL9 A;  2L98 A;  4USL A;  2WC8 A;  5HKY A;  1A2X A;  1YR5 A;  3FS7 A;  1BJF A;  2L5Y A;  4YGD B;  3EK4 A;  2JZI A;  1SPY A;  2JT3 A;  5DKN A;  2KLD A;  4GPL B;  2MJW B;  1B7T Z;  2QEV A;  1J7P A;  3EK7 A;  1OOJ A;  1SCM B;  1BU3 A;  1YUS A;  4ORB B;  4INW A;  4Q04 A;  2JXC A;  2F3Z A;  3F45 A;  4YI9 A;  4GBA A;  2BBN A;  4MEW A;  4XJK B;  5KU1 A;  1Y0V H;  1F4O A;  2L0P A;  1OOG A;  1J7Q A;  1S26 D;  1CM4 A;  3R1O A;  1LA3 A;  3OX5 A;  5D7F A;  1NUB A;  1ORG A;  3NXA A;  2EGD A;  1YVL A;  2KI6 D;  1ZMZ A;  4OKH A;  2Y5I A;  1AK8 A;  2KOT A;  2L5X B;  1OMR A;  3BFH A;  3D77 A;  2L4I A;  2MHH A;  3I5H B;  1YUT A;  2K0J A;  1QS7 A;  5CSJ A;  1K2H A;  1TCO B;  1F54 A;  5AAN A;  4QJ5 B;  2TN4 A;  5AER A;  3DVJ A;  3A8R A;  2K7B A;  5B8I B;  1FI5 A;  3L4L A;  3R1V A;  1SK6 D;  1DMO A;  4NDC A;  3CAB A;  1QLS A;  2CTN A;  4PCW A;  1EJ3 A;  4DCK A;  1H8B A;  2OS8 B;  3FE9 A;  4YBH B;  1M31 A;  3EVV A;  2NZ0 A;  2QEB A;  3SG5 A;  1GJY A;  2KGB C;  3WXA A;  1NYA A;  1QX5 B;  1Y1U A;  2WND A;  1CMG A;  2LMT A;  1A75 B;  1S6C A;  1R6P A;  1M39 A;  1N65 A;  2WCL A;  3TUY B;  2ZN8 A;  4DIR A;  3VRP A;  4MZL A;  1KK7 Y;  3O4Y A;  2CXJ A;  2RGI A;  3GOF A;  1KSO A;  3IQO A;  1K9U A;  3BOW A;  3EK8 A;  3SIB A;  1JC2 A;  2YGU A;  3TZ1 A;  1UUR A;  2HET A;  2LVK A;  4N1G A;  1KWO B;  3A4U B;  4OVN F;  2HQW A;  4PE7 A;  4YGB B;  3M0W A;  1S3P A;  2MAZ A;  4OV2 A;  1M46 A;  1TWO A;  1KFX S;  2WC6 A;  5KSZ A;  1UHK A;  3I5I C;  1QX7 A;  4YGA A;  2BL0 C;  3EG5 B;  1ZOT B;  3FE6 A;  3S0B A;  1CMF A;  1W7J B;  1GGW A;  1DGU A;  2JQ6 A;  2KFH A;  1S6J A;  5HLO A;  4CFR A;  3B7A A;  3BYA A;  3DXL A;  3JVT B;  3OB2 B;  2FJY A;  3SG6 A;  1TIZ A;  5PAL A;  2HF5 A;  2NLN A;  1D1O A;  2WCJ A;  1CDP A;  1QVI Z;  1TNP A;  2PAL A;  4XYN A;  2HQ8 A;  3KEV A;  1BMO A;  1PRW A;  1YVH A;  1K95 A;  4AQI A;  1LA0 A;  1CFP A;  2PVB A;  2O60 A;  4QJ4 B;  2AMI A;  2WCB A;  2QEO A;  3S0E A;  3N7H A;  1CDM A;  1S36 A;  2JT8 A;  2LCP A;  3JTD B;  4MRY A;  2I7A A;  4D1E A;  1IIO A;  3L4A A;  3GK1 A;  1QX2 A;  4OZD A;  3O2P A;  3D0Y A;  3CS1 A;  3CR5 X;  2WOS A;  4M2P A;  1TUZ A;  2KFG A;  4MRX A;  3PJI A;  4CFQ A;  1DJG A;  1MWN A;  3FE8 A;  3D74 A;  1MXE A;  1CLM A;  1DVI A;  2KAV A;  2F2P A;  3OBV A;  1SR6 C;  2WC5 A;  1U5I A;  3BQ3 A;  2KYC A;  3WHT B;  1XK4 A;  1UHH A;  2WCH A;  2PRU A;  3MSE B;  1FBV A;  1TOP A;  2CNP A;  2H8V A;  3O6B A;  1NWD A;  1B8R A;  1EXR A;  4CID A;  1FI6 A;  2Q91 A;  2JUL A;  2LNK A;  1ALV A;  1AP4 A;  4IJ7 A;  5G08 A;  5CSN A;  2F3Y A;  1JSA A;  3BJH A;  2KQ6 A;  1PVA A;  3WNX B;  3O78 A;  4MVF A;  5HKZ A;  2K8M B;  1IQ5 A;  1GQM A;  1KQM B;  1R2U A;  1B8L A;  1Z2C B;  2JNF A;  1SRA A;  3BUN B;  3TDI A;  1CNP A;  3E3R A;  3SIA A;  1QJT A;  1BR4 B;  4HRE E;  4PHN A;  1A29 A;  4PAL A;  1SBJ A;  3GK4 X;  2LP2 A;  4I5J A;  1J1E A;  1WRK A;  1OE9 B;  2LV7 A;  2H61 A;  2BNX A;  1B1G A;  1K94 A;  1AJ4 A;  2GGM A;  1L2O B;  2LUX A;  4WQ3 A;  1SYM A;  2LMV A;  2MLF C;  1IH0 A;  3NGV A;  3BOW B;  1J1D A;  1KK8 B;  2E30 A;  2KFF A;  4I5K A;  2M1U A;  5GQQ C;  1RRO A;  2K7C A;  3SS3 A;  1Y1A A;  1K9P A;  2F8P A;  1TNQ A;  1XFR A;  1A03 A;  1CTR A;  1B47 A;  1SL8 A;  2ZRS A;  1LS8 A;  2LUC A;  5D69 A;  1WDC B;  1BR1 B;  3I5G B;  1KFX L;  1MHO A;  3S0D A;  1MQ1 A;  3EKH A;  1SCM C;  2KQY A;  2GV5 A;  4GGF A;  1S5G Y;  2M8U A;  3O4X A;  1F71 A;  4HSZ A;  4R1E A;  1ALW A;  4C0K A;  2OTG B;  1WRZ A;  4MZK A;  2I2R E;  1FW4 A;  4WRI A;  1N0Y A;  3DF0 A;  1K96 A;  3BFB A;  2KPH A;  4NQG A;  1F55 A;  1B4C A;  3PFV A;  1IGV A;  2Y4Q A;  3EKJ A;  2NCO A;  4MN0 A;  2ZND A;  3NSI A;  3PN7 B;  1QAS A;  1DF0 A;  1B9A A;  1S1E A;  3NSK A;  1QXP A;  4MZJ A;  3S0A A;  5IBW A;  2M3W A;  3BXK A;  1V1F A;  1OOH A;  3B87 A;  1YX8 A;  2BE4 A;  2LHL A;  3D0Y B;  2G9B A;  3I5H C;  1NX1 A;  4PT1 A;  1TN4 A;  1IG5 A;  4BY5 A;  5I8N A;  2EC6 B;  1GM0 A;  1JF0 A;  1XFV O;  2NCP A;  1MF8 B;  2M1K B;  3AAK A;  1AVS A;  5AFP A;  1BOC A;  1XFZ O;  1CFF A;  3PSR A;  1JBA A;  2G2B A;  3CR4 X;  4MBE A;  1Z4H A;  4L9M A;  3BFA A;  3RZS A;  1XYD A;  2OS8 C;  2VRG A;  1U5I B;  1TNX A;  1DEL A;  2LLU A;  4I5L B;  3HX4 A;  2LVJ A;  4GAO A;  2KNE A;  2LLT A;  2GTE A;  2JNX A;  2P71 A;  5D3O A;  2EHB A;  1OOI X;  2BCA A;  2BKH B;  2LAN A;  3I5F B;  2QAC A;  4GGN A;  5ER4 X;  3TUY C;  2KGR A;  3BUM B;  1PSB A;  3AAJ A;  1OW4 A;  1C3Z A;  2L50 A;  1QV1 A;  1WRL A;  3D78 A;  3DYE A;  2MA2 A;  2M0R A;  2COL B;  1OOF A; 
#chains in the Genus database with same CATH homology
 2L2E A;  4M2Q A;  1UHI A;  1IQ3 A;  1LKJ A;  1DTL A;  2L4H A;  1XO5 A;  4YI8 A;  3BUX B;  2M97 A;  1S5G Z;  1DJX A;  1KWO C;  2D8N A;  2SAS A;  3OHM B;  2ZNE A;  2M49 B;  4OR9 B;  1V1G A;  3FWB A;  2PMY A;  2JTZ A;  5AXI A;  1ZAC A;  2LMU A;  4A4B A;  2BCB A;  2R2I A;  4DS7 A;  3TDU A;  3NSO A;  2MLE C;  2MBX A;  2PAS A;  2LVV A;  4ZCU A;  4PE1 A;  3WHU B;  1CDN A;  4F0Z B;  1C07 A;  4PDZ A;  2LM5 A;  1RJV A;  1YRT B;  3JVT C;  2LLS A;  2K7D A;  2V53 A;  5CSF A;  2BEC A;  1M45 A;  1UUS A;  2KBM A;  1F8H A;  2LVI A;  1DT7 B;  1F4Q A;  2CT9 A;  3CTN A;  1KK7 Z;  4PHM A;  4MLW A;  1FF1 A;  3VRR A;  1K90 D;  2GGZ A;  2KHN A;  3JTD C;  1OMD A;  2Y1N A;  4GNK B;  1B7T Y;  4E68 A;  1CFC A;  3CGA A;  5HKW A;  4OCI A;  3DF0 B;  2AAO A;  3NSL A;  1CLB A;  3SG7 A;  1UWO A;  4BY4 A;  5TNC A;  1XVJ A;  1DGV A;  2ISD A;  4CPV A;  1SMG A;  2I18 A;  1NP8 A;  1BF5 A;  3BUW B;  3LK0 A;  1DF0 B;  3KPX A;  2KI4 B;  3PAT A;  1XFU O;  1CKK A;  1DJI A;  1XFX O;  5JOL A;  3TS5 B;  3PAL A;  4P5O E;  1MUX A;  3DVK A;  2KDH A;  3TDZ A;  1HQV A;  1NX3 A;  1ZUZ A;  5FYX A;  2BCX A;  2SCP A;  4PHK A;  1BT6 A;  1ODB A;  3DD4 A;  1QIV A;  3SG3 A;  1YTZ C;  1JF2 A;  2KSP A;  1CDL A;  4N1F A;  1Y1X A;  2CCM A;  2BKI B;  1WY9 A;  4UPG A;  1DJH A;  1JFK A;  3LK1 A;  4AQJ A;  2Q4U A;  2K61 A;  2K7O A;  3KHE A;  3D10 A;  1KQM C;  1NCY A;  5HLV A;  4JWQ A;  4YRU A;  1JWD A;  5HYD A;  4IL1 A;  4C0L A;  1NIW A;  3EVU A;  1WLM A;  2KYF A;  5I2Q A;  1IKU A;  2ZRT A;  1N2D A;  2ZFD A;  4TNC A;  1FPW A;  1GGZ A;  1QTX A;  3AKB A;  4ORA B;  2ZN9 A;  1L2O C;  1EG3 A;  5F6T A;  1XA5 A;  3IF7 A;  2K2F A;  1KK8 C;  1X02 A;  1ZFS A;  4NDD A;  1RK9 A;  1SCV A;  2LC5 A;  2LHI A;  1LIN A;  1J55 A;  4ORC B;  1BG1 A;  1G33 A;  1NX2 A;  3FIA A;  4JPZ B;  2M7L A;  1YX7 A;  3PLF B;  2JWW A;  1OZO A;  2WCE A;  3VRO A;  1OSA A;  1WDC C;  2OPO A;  4I5N B;  4A4C A;  3KO0 A;  1OMV A;  3I5G C;  1IJ6 A;  2BBM A;  1OQP A;  1G4Y R;  1UHJ A;  3ZWH A;  5CPV A;  2FCD A;  4DUQ A;  1S6I A;  2FCE A;  2OTG C;  1PUL A;  2LAP A;  3SG4 A;  1NX0 A;  1EG4 A;  5BPJ A;  1Y6W A;  1IWQ A;  1Q80 A;  2M7N A;  1QLK A;  2KBI A;  1YRU B;  2PSR A;  4MSP A;  3PN7 C;  1QVI Y;  1TNW A;  2F33 A;  2QPT A;  4PE0 A;  2ZKM X;  3ZNI A;  1PK0 D;  1QAT A;  1SY9 A;  1AHR A;  1KFU S;  4HRG A;  4DRW A;  2Y1M A;  1RFJ A;  2K2A A;  2KAY A;  1UP5 A;  2LE9 B;  3LL8 B;  3FWC A;  2WCF A;  3RM1 A;  1K9K A;  1MR8 A;  2EC6 C;  1E8A A;  1K93 D;  1KCY A;  1AJ5 A;  4AOM A;  3AKA A;  1REC A;  5K89 A;  3ICB A;  1IJ5 A;  1SKT A;  1WLZ A;  1G8I A;  2JU0 A;  3RLZ A;  3I5I B;  1NPQ A;  4U8D A;  3OX6 A;  1XK4 C;  1RTP 1;  1YUU A;  1EL4 A;  2BL0 B;  2DOQ A;  1LVC D;  4P2Y B;  4NDB A;  1CLL A;  2FOT A;  5I2L A;  5AEQ A;  1J7O A;  3K21 A;  3IQQ A;  1NCZ A;  3I5F C;  2B1U A;  1J7R A;  1QV0 A;  4ZCV A;  4CLN A;  1XFW O;  1CM1 A;  3QRX A;  1DJW A;  2JT0 A;  1DJZ A;  1MXL C;  3CLN A;  4XJK A;  1JUO A;  2AUC A;  1TTX A;  3BUO B;  2A4J A;  3SJS A;  1BLQ A;  4ICB A;  1KQV A;  1YUR A;  1UHN A;  2JOJ A;  4HRH A;  2LP3 A;  1DJY A;  3LLE A;  1CFD A;  4N5X A;  2H2K A;  4QJ3 B;  2BE6 A;  2WOR A;  2H61 C;  2KAX A;  2O5G A;  1A4P A;  1QIW A;  4YGE B;  2FJU B;  5JJG A;  1M63 B;  1IRJ A;  2JRF A;  3DVE A;  3OB1 B;  3HCM A;  4YGC B;  5ER5 A;  2NXQ A;  1RWY A;  1SR6 B;  2E6W A;  1BOD A;  4FQO A;  1HT9 A;  3OP0 A;  2IS9 A;  2JXL A;  2M29 A;  4C0J A;  3CWG A;  1JFJ A;  1NSH A;  1A75 A;  1SL7 A;  2L51 A;  1H4B A;  2JC2 A;  4GGF C;  3DVM A;  1AUI B;  3CR2 A;  3C1V A;  5DKQ A;  2JPT A;  1NCX A;  4M2O A;  2M9G A;  1SNL A;  4JQ0 D;  3VRQ A;  1KSM A;  1PSR A;  1L7Z A;  1C7W A;  1LXF C;  1PAL A;  2F2O A;  2I94 A;  2JTT A;  4WQ2 A;  4ETO A;  5I2O A;  4FTG A;  5DKR A;  3GK2 A;  1C7V A;  1SW8 A;  2P6B B;  3SG2 A;  1OZS A;  2KI4 C;  2KI6 C;  5CSI A;  5KTY A;  1PVB A;  1B8C A;  3EVR A;  3TS5 C;  3VGO A;  4PHJ A;  3VRN A;  4PE4 A;  1XFY O;  1F70 A;  2CBL A;  3PM8 A;  5J3X A;  1TCF A;  1CB1 A;  1KFU L;  1K8U A;  2HPS A;  2MRD A;  4GFT A;  1W7I B;  4GUK A;  1EH2 A;  1TRF A;  3KF9 A;  3LCP C;  3CZT X;  1VRK A;  1SL9 A;  2L98 A;  4USL A;  2WC8 A;  5HKY A;  1A2X A;  1YR5 A;  3FS7 A;  1BJF A;  4YGD B;  3EK4 A;  2JZI A;  1SPY A;  2JT3 A;  5DKN A;  4GPL B;  2MJW B;  1B7T Z;  1J7P A;  3EK7 A;  1OOJ A;  1SCM B;  1BU3 A;  1YUS A;  4ORB B;  4Q04 A;  2JXC A;  2F3Z A;  3F45 A;  4YI9 A;  4GBA A;  2BBN A;  4MEW A;  4XJK B;  5KU1 A;  1Y0V H;  1F4O A;  2L0P A;  1J7Q A;  1S26 D;  1CM4 A;  1LA3 A;  3OX5 A;  5D7F A;  1NUB A;  3NXA A;  2EGD A;  1YVL A;  2KI6 D;  1ZMZ A;  4OKH A;  2Y5I A;  1AK8 A;  2KOT A;  2L5X B;  1OMR A;  2L4I A;  2MHH A;  3I5H B;  1YUT A;  2K0J A;  1QS7 A;  5CSJ A;  1K2H A;  1TCO B;  1F54 A;  5AAN A;  4QJ5 B;  2TN4 A;  5AER A;  3DVJ A;  3A8R A;  2K7B A;  5B8I B;  1FI5 A;  1DMO A;  1SK6 D;  4NDC A;  1QLS A;  2CTN A;  4PCW A;  1EJ3 A;  4DCK A;  1H8B A;  2OS8 B;  4YBH B;  1M31 A;  3EVV A;  2NZ0 A;  3SG5 A;  1GJY A;  2KGB C;  3WXA A;  1NYA A;  1QX5 B;  1Y1U A;  2WND A;  1CMG A;  2LMT A;  1A75 B;  1S6C A;  1R6P A;  1M39 A;  1N65 A;  3TUY B;  2ZN8 A;  4DIR A;  3VRP A;  4MZL A;  1KK7 Y;  3O4Y A;  2CXJ A;  2RGI A;  3GOF A;  1KSO A;  3IQO A;  1K9U A;  3BOW A;  3EK8 A;  3SIB A;  1JC2 A;  3TZ1 A;  1UUR A;  2HET A;  2LVK A;  4N1G A;  1KWO B;  3A4U B;  4OVN F;  2HQW A;  4PE7 A;  4YGB B;  3M0W A;  1S3P A;  2MAZ A;  4OV2 A;  1M46 A;  1KFX S;  5KSZ A;  1UHK A;  3I5I C;  1QX7 A;  4YGA A;  2BL0 C;  1ZOT B;  1CMF A;  1W7J B;  1GGW A;  1DGU A;  2JQ6 A;  2KFH A;  1S6J A;  5HLO A;  4CFR A;  3BYA A;  3JVT B;  3OB2 B;  3SG6 A;  1TIZ A;  5PAL A;  2HF5 A;  2NLN A;  1D1O A;  1CDP A;  1QVI Z;  1TNP A;  2PAL A;  4XYN A;  2HQ8 A;  3KEV A;  1BMO A;  1PRW A;  1YVH A;  1K95 A;  4AQI A;  1LA0 A;  1CFP A;  2PVB A;  2O60 A;  4QJ4 B;  2AMI A;  2WCB A;  1CDM A;  1S36 A;  2JT8 A;  2LCP A;  3JTD B;  4MRY A;  2I7A A;  4D1E A;  3GK1 A;  1QX2 A;  3O2P A;  3D0Y A;  3CS1 A;  3CR5 X;  2WOS A;  4M2P A;  2KFG A;  4MRX A;  4CFQ A;  1DJG A;  1MWN A;  1MXE A;  1CLM A;  1DVI A;  2KAV A;  2F2P A;  1SR6 C;  3BQ3 A;  1U5I A;  2KYC A;  3WHT B;  1XK4 A;  1UHH A;  2PRU A;  3MSE B;  1FBV A;  1TOP A;  2CNP A;  3O6B A;  1NWD A;  1B8R A;  1EXR A;  4CID A;  1FI6 A;  2Q91 A;  2JUL A;  2LNK A;  1ALV A;  1AP4 A;  5G08 A;  5CSN A;  2F3Y A;  1JSA A;  2KQ6 A;  1PVA A;  3WNX B;  3O78 A;  4MVF A;  5HKZ A;  2K8M B;  1IQ5 A;  1GQM A;  1KQM B;  1R2U A;  1B8L A;  2JNF A;  3BUN B;  1SRA A;  3TDI A;  1CNP A;  3E3R A;  3SIA A;  1QJT A;  1BR4 B;  4HRE E;  4PHN A;  1A29 A;  4PAL A;  1SBJ A;  3GK4 X;  2LP2 A;  4I5J A;  1J1E A;  1WRK A;  1OE9 B;  2LV7 A;  2H61 A;  1B1G A;  1K94 A;  1AJ4 A;  2GGM A;  1L2O B;  2LUX A;  4WQ3 A;  1SYM A;  2LMV A;  2MLF C;  1IH0 A;  3BOW B;  1J1D A;  1KK8 B;  2E30 A;  2KFF A;  4I5K A;  2M1U A;  5GQQ C;  1RRO A;  2K7C A;  1Y1A A;  1K9P A;  2F8P A;  1TNQ A;  1A03 A;  1CTR A;  1B47 A;  1SL8 A;  2ZRS A;  2LUC A;  5D69 A;  1WDC B;  1BR1 B;  3I5G B;  1KFX L;  1MHO A;  1MQ1 A;  3EKH A;  1SCM C;  2KQY A;  2GV5 A;  4GGF A;  1S5G Y;  2M8U A;  1F71 A;  4HSZ A;  4R1E A;  1ALW A;  4C0K A;  2OTG B;  1WRZ A;  4MZK A;  2I2R E;  1FW4 A;  4WRI A;  1N0Y A;  3DF0 A;  1K96 A;  4NQG A;  1F55 A;  1B4C A;  3PFV A;  1IGV A;  2Y4Q A;  3EKJ A;  2NCO A;  4MN0 A;  2ZND A;  3NSI A;  3PN7 B;  1QAS A;  1DF0 A;  1B9A A;  1S1E A;  3NSK A;  1QXP A;  4MZJ A;  5IBW A;  2M3W A;  3BXK A;  1V1F A;  1YX8 A;  2BE4 A;  2LHL A;  3D0Y B;  2G9B A;  3I5H C;  1NX1 A;  1TN4 A;  1IG5 A;  4BY5 A;  5I8N A;  2EC6 B;  1JF0 A;  1XFV O;  2NCP A;  1MF8 B;  2M1K B;  3AAK A;  1AVS A;  5AFP A;  1BOC A;  1XFZ O;  1CFF A;  3PSR A;  1JBA A;  2G2B A;  3CR4 X;  4MBE A;  4L9M A;  1XYD A;  2OS8 C;  2VRG A;  1U5I B;  1TNX A;  2LLU A;  4I5L B;  3HX4 A;  2LVJ A;  4GAO A;  2KNE A;  2LLT A;  2JNX A;  2EHB A;  2BCA A;  2BKH B;  2LAN A;  3I5F B;  2QAC A;  4GGN A;  5ER4 X;  3TUY C;  2KGR A;  3BUM B;  1PSB A;  3AAJ A;  3H4S E;  2L50 A;  1QV1 A;  1WRL A;  2MA2 A;  2M0R A;  2COL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...