3A4UB

Crystal structure of mcfd2 in complex with carbohydrate recognition domain of ergic-53
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
65
Chain Sequence
EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein ERGIC-53
total genus 23
structure length 65
sequence length 78
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a4uB00
2JT0A 1NCXA 1H8BA 4ICBA 1G8IA 1KFUS 4GBAA 1IWQA 4I5KA 1K9KA 1JFJA 1MHOA 4ZCUA 1B4CA 3FWCA 1F8HA 3GOFA 1LKJA 2Y1MA 1S5GZ 1F55A 1AVSA 2LMUA 3FWBA 5DKNA 1OQPA 1YRUB 1M31A 1M63B 4DS7A 4GGNA 5J3XA 1OMRA 1SR6B 2WCFA 1K90D 1CTRA 4FTGA 2M7NA 4I5NB 2FCEA 1EH2A 3DD4A 1G4YR 5CSFA 4GGFC 3D0YB 4HRHA 3NSLA 4JPZB 3KHEA 2JWWA 2OPOA 2JRFA 4NDDA 3ZNIA 2JPTA 1D1OA 2L4IA 1XFVO 4XJKA 2BCXA 3DVMA 3OB2B 3NSIA 4GAOA 2OS8C 1XK4C 5HLVA 1WY9A 1RWYA 1FI5A 1A2XA 3SG6A 1Y6WA 2WCBA 2F2OA 3WNXB 1UHJA 2KGBC 1NX2A 2LLSA 3A8RA 3JVTC 4M2QA 4ORCB 5AEQA 1JF2A 1DGVA 4QJ5B 3RLZA 2KBIA 1KK8B 1RK9A 1NCYA 4XYNA 1ZOTB 2LHLA 2CT9A 4ZCVA 1IG5A 4MBEA 5I2QA 3SG5A 5PALA 3EK7A 1KWOC 4N1GA 4OVNF 3DF0A 1WDCC 3GK4X 5ER5A 2Y1NA 5HYDA 3GK2A 2LVKA 3I5IB 2K7OA 1L2OB 1L7ZA 2AAOA 4BY5A 2I94A 4C0JA 2OTGB 5G08A 2KI4C 2LMTA 1CKKA 4QJ4B 3O2PA 4M2PA 4OCIA 3BXKA 2E6WA 1X02A 2HQWA 2F33A 2R2IA 4MZLA 1FI6A 1BF5A 1MUXA 1SYMA 3IQQA 4CLNA 5JJGA 1H4BA 3FIAA 1U5IB 1YUUA 1QVIY 1AP4A 2K7DA 2ISDA 2BKHB 4ORAB 1B8RA 5HKWA 1K8UA 3F45A 1J7OA 2LLTA 5TNCA 3CR4X 2HQ8A 2KI4B 5CSJA 1Y1UA 3O6BA 2GGMA 3WHTB 1QX2A 2F8PA 1IJ6A 1SCVA 3EKHA 1XK4A 1SKTA 1YURA 1IQ5A 1YTZC 3SJSA 1N65A 2COLB 1MF8B 2ZRTA 1HT9A 3LCPC 1IJ5A 2KYFA 2ZKMX 2KGRA 3NXAA 2DOQA 1R6PA 3JVTB 5AANA 3RM1A 1JBAA 1IH0A 1DMOA 3CTNA 1XVJA 3PN7B 3EK8A 1F4QA 1UURA 2L4HA 2KI6C 2NCOA 3DVKA 3SIAA 2LVJA 3CR2A 4MEWA 2GGZA 1KFXS 2KNEA 1BU3A 2L0PA 2A4JA 3VROA 4C0KA 1CDPA 2K8MB 1SL8A 2JC2A 1L2OC 1GQMA 1TIZA 2QACA 1KSOA 1ZFSA 3BOWB 1NCZA 2BE6A 1BT6A 1CMGA 2EC6C 1CFDA 1YRTB 2MA2A 5AFPA 4YGEB 1NWDA 4CFQA 3I5GC 3CLNA 2O5GA 4YGBB 1QLSA 1BR4B 3KO0A 2H2KA 4PALA 2LVIA 1BR1B 3DVEA 2BCBA 1DT7B 1S6CA 1QASA 2MLEC 2LNKA 4USLA 4PE1A 3WHUB 2KSPA 1KQMB 2ZRSA 1YUTA 3AKBA 4ORBB 3JTDB 3KEVA 4NDCA 2ZN9A 4P2YB 2HETA 1QXPA 5ER4X 5HKYA 2K2FA 1YR5A 2M1UA 2PSRA 3EVVA 2Y5IA 2L2EA 1ZACA 1EL4A 2LP2A 1S36A 1C07A 3CR5X 4OR9B 1M45A 3PATA 1BOCA 3VGOA 2VRGA 4GFTA 4AQIA 2JQ6A 2ZN8A 3I5IC 1OE9B 4N5XA 3CZTX 3BUWB 2KAXA 1S6IA 4R1EA 1UWOA 1FBVA 1SY9A 1MXLC 1XFUO 4PHMA 2BL0C 4PHNA 4HSZA 4PHJA 4YGAA 1V1FA 1OZOA 1LA3A 1NPQA 1KK7Z 2NZ0A 4P5OE 1CFFA 4A4BA 1PVAA 2CBLA 1ODBA 1B47A 1QIWA 1BMOA 3EVRA 2WNDA 1DTLA 3BOWA 3CGAA 1B8LA 2AUCA 1TNQA 2HF5A 2MAZA 4MRYA 2WC8A 5DKRA 1CLBA 1QTXA 1GJYA 4D1EA 1B9AA 2JOJA 1DF0A 1EXRA 1PSRA 5GQQC 2MLFC 2PALA 4YBHB 1YVLA 1DVIA 3AAKA 2CXJA 2EC6B 5HLOA 4FQOA 3I5FC 1QS7A 1J1DA 1SCMC 4MN0A 2I7AA 5B8IB 4YGDB 1JC2A 2BE4A 2K2AA 3TDUA 3QRXA 1DGUA 4DUQA 2BBNA 1AUIB 3BUNB 4UPGA 2M0RA 3IQOA 5KSZA 2LM5A 1B8CA 1J7RA 4YRUA 3OX6A 1DJIA 1A4PA 1SL9A 2LVVA 4OKHA 4YGCB 4BY4A 2JXLA 3I5HC 2ZFDA 1QV0A 2TN4A 1CM1A 1TTXA 4OV2A 1BODA 1YVHA 1OMDA 1QVIZ 4NDBA 1SK6D 1FF1A 2M9GA 3SG3A 2O60A 2H61C 2KFGA 4MLWA 2G9BA 1KQVA 1UUSA 1UHKA 1KFXL 3PFVA 2JNXA 2G2BA 2JT3A 2KOTA 3MSEB 4PCWA 2I2RE 4I5LB 4QJ3B 4MSPA 4DIRA 1VRKA 4WRIA 1F54A 1DJZA 2PVBA 3BUOB 2CTNA 2I18A 1PVBA 1NX0A 4F0ZB 3KF9A 2M1KB 1SPYA 1NUBA 2BCAA 2F3ZA 2KAYA 3NSKA 2SCPA 4C0LA 1UHIA 2OS8B 1LVCD 2LLUA 3VRQA 3TDZA 2LE9B 5AXIA 2LC5A 5CSIA 1XFZO 2KI6D 1XFYO 5DKQA 2KFHA 3EKJA 3PSRA 3TUYB 2BECA 2KBMA 3BQ3A 2P6BB 4MVFA 2Q4UA 2EHBA 4GPLB 3AKAA 4Q04A 1K9UA 3O78A 2LMVA 1J7PA 2BL0B 1OSAA 3KPXA 1B7TZ 5BPJA 1NX1A 1JWDA 1UP5A 1NP8A 2MRDA 1BG1A 4CPVA 2KYCA 3K21A 1M46A 1CMFA 1DJGA 1UHHA 4GUKA 1NYAA 1FW4A 1RTP1 2KFFA 2LAPA 2K7CA 1K93D 1PULA 1SBJA 2K61A 1TN4A 1KQMC 3BUXB 3I5HB 5IBWA 3DF0B 1CNPA 2D8NA 3AAJA 4L9MA 4MRXA 1XFXO 4E68A 3VRPA 5K89A 2PRUA 1DJXA 3TS5B 5KU1A 1A03A 1C7VA 2RGIA 2KDHA 1QJTA 2H61A 1CM4A 2LUXA 1XYDA 1K2HA 2HPSA 2B1UA 1AJ4A 4ETOA 1EG3A 5JOLA 1BJFA 1W7IB 3OX5A 1KK7Y 1KWOB 1WLMA 3BUMB 4CIDA 1CLMA 4MZJA 1MR8A 5D69A 2FCDA 1S5GY 4PE4A 1CB1A 1FPWA 4MZKA 2FJUB 1U5IA 1CLLA 1QLKA 3D10A 1A29A 2BBMA 3LK0A 1N2DA 2LHIA 1A75B 1IRJA 2KHNA 4DCKA 2EGDA 1G33A 4U8DA 1DJYA 4NQGA 1XA5A 1K95A 1NX3A 3EK4A 1J55A 3JTDC 1F71A 3H4SE 5CPVA 2LUCA 3FS7A 1ZUZA 1CDNA 4AOMA 4I5JA 1TNWA 3TZ1A 3PALA 1YX7A 2CNPA 4HREE 2KAVA 2NLNA 5F6TA 1SCMB 3I5GB 3A4UB 1RROA 3EVUA 1Y0VH 2JTZA 1PRWA 2Q91A 3I5FB 1SR6C 2JU0A 4PDZA 1F70A 3BYAA 1S6JA 5I2OA 3OB1B 3VRRA 1PK0D 1LXFC 1OZSA 2NCPA 2PASA 3NSOA 1R2UA 1MXEA 1OOJA 1SNLA 1AK8A 1E8AA 2AMIA 1CFCA 1IQ3A 2M3WA 2M8UA 4TNCA 3CWGA 1S3PA 4WQ3A 4HRGA 4GGFA 1J1EA 2Y4QA 1RECA 4PE0A 2F2PA 2NXQA 1SW8A 1KSMA 3ZWHA 5I8NA 3PN7C 1AJ5A 3OP0A 1TCFA 2M29A 2KQYA 5D7FA 1TOPA 2WOSA 1S26D 3ICBA 4JWQA 2PMYA 1V1GA 5FYXA 1B7TY 2QPTA 3HCMA 2KQ6A 2OTGC 1A75A 3CS1A 2L98A 1N0YA 2MBXA 1DJWA 2JT8A 1EJ3A 3LLEA 2JTTA 1QX7A 1JF0A 3E3RA 1AHRA 1WDCB 4YI8A 4PE7A 1K9PA 1OMVA 1ZMZA 2BKIB 1SMGA 1CFPA 1TCOB 3PM8A 1WRKA 1MQ1A 4YI9A 1MWNA 2LCPA 3PLFB 4CFRA 3VRNA 1BLQA 1QIVA 1UHNA 2JULA 5CSNA 4JQ0D 1PALA 1QV1A 1CDMA 2V53A 1DJHA 1TRFA 1GGZA 1Q80A 3IF7A 1LA0A 3LK1A 1SRAA 1JUOA 2JXCA 1RFJA 1NSHA 3HX4A 2MHHA 4PHKA 4AQJA 1RJVA 2MJWB 4A4CA 1C7WA 2L51A 3OHMB 1IGVA 2FOTA 1GGWA 4M2OA 1JSAA 1S1EA 1YUSA 1B1GA 5AERA 1KK8C 1HQVA 3WXAA 1QX5B 4DRWA 2GV5A 2M7LA 1F4OA 2L5XB 1TNPA 1LINA 2E30A 1DF0B 2IS9A 1Y1XA 3SG7A 1WLZA 2SASA 3C1VA 1ALVA 1W7JB 3O4YA 5I2LA 3GK1A 3TS5C 1KFUL 2CCMA 5HKZA 1J7QA 4IL1A 3TUYC 1YX8A 2K0JA 1JFKA 2ZNDA 2WCEA 1Y1AA 4N1FA 1XO5A 1WRLA 1PSBA 3D0YA 2WORA 1ALWA 4GNKB 1KCYA 1CDLA 2K7BA 2M97A 1IKUA 1K96A 1WRZA 5KTYA 1QATA 2LANA 1K94A 2ZNEA 4XJKB 2JZIA 1TNXA 1M39A 3LL8B 3SIBA 2F3YA 3M0WA 2LP3A 3DVJA 1XFWO 1EG4A 1SL7A 2LV7A 2L50A 1NIWA 4WQ2A 3SG4A 2M49B 3SG2A 3TDIA 2JNFA
chains in the Genus database with same CATH superfamily
2JT0A 1NCXA 1H8BA 4ICBA 1G8IA 1KFUS 4GBAA 1IWQA 4I5KA 1K9KA 1JFJA 1MHOA 4ZCUA 1B4CA 3FWCA 1F8HA 3GOFA 3S0AA 1LKJA 2Y1MA 4IJ7A 2WCHA 1S5GZ 1F55A 2YGUA 1AVSA 2LMUA 3FWBA 5DKNA 1OQPA 1YRUB 1M31A 1M63B 3D73A 4GGNA 4DS7A 5J3XA 1OMRA 1SR6B 2WCFA 1K90D 1CTRA 4FTGA 2M7NA 2WC6A 2FCEA 4I5NB 1EH2A 3DD4A 1G4YR 5CSFA 4GGFC 3D0YB 4HRHA 3NSLA 5I94A 4JPZB 2KLDA 3KHEA 2JWWA 2OPOA 3Q8IA 2JRFA 4NDDA 3ZNIA 2JPTA 1D1OA 2L4IA 1XFVO 3IVTA 4XJKA 2BCXA 3DVMA 2JPOA 3OB2B 3V2LA 3BFAA 3NSIA 4GAOA 2OS8C 1XK4C 5HLVA 1WY9A 1RWYA 1FI5A 1A2XA 3SG6A 1Y6WA 1Z2CB 2WCBA 2F2OA 5D3OA 3WNXB 1UHJA 3NHTA 2KGBC 1NX2A 2LLSA 3A8RA 3JVTC 4M2QA 4ORCB 5AEQA 1JF2A 1DGVA 4QJ5B 3RLZA 2KBIA 1KK8B 1RK9A 1NCYA 2FJYA 4XYNA 1ZOTB 2LHLA 2CT9A 4ZCVA 1IG5A 4MBEA 2KPHA 5I2QA 3SG5A 5PALA 3EK7A 1KWOC 4N1GA 4OVNF 3DF0A 1WDCC 3GK4X 5ER5A 2Y1NA 5HYDA 3GK2A 2LVKA 3I5IB 1TUJA 2K7OA 1L2OB 1L7ZA 2AAOA 4BY5A 2PYQA 2I94A 4C0JA 2GTEA 1TWOA 2WCLA 2OTGB 5G08A 2KI4C 2LMTA 1CKKA 4QJ4B 3O2PA 4M2PA 4OCIA 1C3YA 3BXKA 2E6WA 1X02A 2HQWA 2F33A 2R2IA 4MZLA 1FI6A 1IIOA 1BF5A 1MUXA 1SYMA 3IQQA 4CLNA 5JJGA 1H4BA 1OW4A 3FIAA 1U5IB 1YUUA 1QVIY 1AP4A 2K7DA 2ISDA 2BKHB 4ORAB 1B8RA 5HKWA 1K8UA 3F45A 1J7OA 2LLTA 5TNCA 3CR4X 2HQ8A 2KI4B 3PM2A 5CSJA 1Y1UA 3O6BA 2GGMA 3WHTB 1QX2A 3S0EA 2WCMA 2F8PA 1IJ6A 1SCVA 3EKHA 1XK4A 1SKTA 1YURA 1IQ5A 1YTZC 3SJSA 3SS4A 1N65A 2COLB 1ORGA 1MF8B 2ZRTA 1HT9A 3LCPC 1OOGA 5FI7A 1IJ5A 1DQEA 2KYFA 2KGRA 2ZKMX 2DOQA 1R6PA 1P28A 3JVTB 3NXAA 5AANA 3RM1A 1IH0A 1DMOA 3CTNA 1XVJA 3PN7B 3EK8A 1F4QA 1UURA 2L4HA 2KI6C 4KYNA 4INWA 2NCOA 3DVKA 3SIAA 2LVJA 3CR2A 4MEWA 2KLEA 2GGZA 1KFXS 2KNEA 1BU3A 2L0PA 2A4JA 3VROA 2QEHA 4C0KA 1CDPA 3B6XA 2K8MB 5FI6A 1SL8A 2JC2A 1L2OC 1GQMA 1TIZA 2QACA 1KSOA 1ZFSA 3BOWB 5EL2A 1NCZA 2BE6A 1BT6A 1CMGA 2EC6C 1CFDA 1YRTB 2MA2A 5AFPA 4YGEB 1NWDA 4CFQA 3I5GC 3CLNA 2O5GA 4YGBB 1QLSA 1BR4B 3R1OA 4JD9A 3KO0A 2H2KA 4PALA 2LVIA 1BR1B 3DVEA 2BCBA 1DT7B 1S6CA 1QASA 2MLEC 2LNKA 4USLA 4PE1A 3WHUB 2KSPA 1KQMB 2WCJA 2ZRSA 1YUTA 3AKBA 4ORBB 1QWVA 3JTDB 3KEVA 4NDCA 2ZN9A 4P2YB 2HETA 1QXPA 5ER4X 5HKYA 2K2FA 1YR5A 2M1UA 2PSRA 3EVVA 2Y5IA 2L2EA 1ZACA 1EL4A 2LP2A 1S36A 3B88A 1C07A 3CR5X 4OR9B 1M45A 3PATA 2ERBA 3VGOA 2VRGA 4GFTA 4AQIA 1BOCA 2JQ6A 2ZN8A 3I5IC 1OE9B 4OZDA 4N5XA 3CZTX 3BUWB 2KAXA 2BAPA 1S6IA 4R1EA 5DICA 1UWOA 1OOFA 1FBVA 1SY9A 1XFUO 1MXLC 4PHMA 1W9ZA 3B86A 3OGNA 2BL0C 4PHNA 4HSZA 4PHJA 4YGAA 1V1FA 1OZOA 1LA3A 1NPQA 1KK7Z 2NZ0A 4P5OE 1CFFA 4A4BA 1PVAA 2CBLA 1ODBA 3EG5B 1B47A 1QIWA 1BMOA 3EVRA 2WNDA 1DTLA 3BOWA 3CGAA 1B8LA 2AUCA 1TNQA 2HF5A 2MAZA 4MRYA 2WC8A 5DKRA 1CLBA 1QTXA 2QEOA 1GJYA 4D1EA 1B9AA 2JOJA 1DF0A 1EXRA 1PSRA 5GQQC 3D74A 2MLFC 2P71A 2PALA 3FE6A 1YVLA 4YBHB 1DVIA 3AAKA 3L4AA 2CXJA 2EC6B 3BFBA 5HLOA 4FQOA 3I5FC 1QS7A 1J1DA 1SCMC 4MN0A 2I7AA 5B8IB 4YGDB 1JC2A 2BE4A 2K2AA 3TDUA 3QRXA 1DGUA 4DUQA 2BBNA 1AUIB 3BUNB 4UPGA 2M0RA 3IQOA 5KSZA 2LM5A 1B8CA 1J7RA 4YRUA 3OX6A 1DJIA 1A4PA 1SL9A 2LVVA 4OKHA 4YGCB 4BY4A 2JXLA 3I5HC 2ZFDA 1QV0A 2TN4A 1CM1A 3FE8A 1TTXA 4OV2A 1BODA 1YVHA 1XFRA 1OMDA 1QVIZ 4NDBA 1SK6D 1FF1A 2M9GA 3SG3A 2O60A 2K60A 3SG4A 2H61C 2KFGA 4MLWA 2G9BA 1KQVA 2WC5A 1UUSA 1UHKA 1KFXL 3PFVA 2JNXA 2G2BA 2JT3A 2KOTA 3MSEB 4FQTA 3L47A 2I2RE 3B87A 4I5LB 3CZ1A 4PCWA 4QJ3B 4MSPA 4DIRA 1VRKA 4WRIA 1F54A 1DJZA 2PVBA 3D76A 3BUOB 2CTNA 2I18A 3B7AA 1PVBA 1NX0A 4F0ZB 3KF9A 2M1KB 1SPYA 3UNWA 1NUBA 2BCAA 3DYEA 2F3ZA 2KAYA 3NSKA 2SCPA 4C0LA 1UHIA 2OS8B 1LVCD 2LLUA 1OOHA 3VRQA 3TDZA 3CYZA 2LE9B 5AXIA 2LC5A 3NHIA 5CSIA 1XFZO 2KI6D 1XFYO 5DKQA 2KFHA 3EKJA 3PSRA 3TUYB 2BECA 2KBMA 3BQ3A 2P6BB 4MVFA 2Q4UA 3CABA 2EHBA 4GPLB 2H8VA 3AKAA 3D78A 4Q04A 1K9UA 3O78A 2LMVA 1J7PA 2BL0B 1OSAA 3KPXA 1B7TZ 5BPJA 1NX1A 1JWDA 1UP5A 1NP8A 2MRDA 1BG1A 4CPVA 2KYCA 3K21A 1M46A 1CMFA 1DJGA 1UHHA 4GUKA 1NYAA 1FW4A 1RTP1 2KFFA 2LAPA 3SS3A 2K7CA 1K93D 1PULA 1SBJA 2K61A 1TN4A 1KQMC 3BUXB 3I5HB 1GM0A 5IBWA 3DF0B 1CNPA 2D8NA 3AAJA 4L9MA 4MRXA 1XFXO 3D75A 4E68A 3VRPA 5K89A 2PRUA 1DJXA 3TS5B 5KU1A 1A03A 1C7VA 2RGIA 2KDHA 4PT1A 1QJTA 3S0GA 2H61A 1CM4A 2LUXA 3DXLA 3O4XA 1C3ZA 1XYDA 1K2HA 1LS8A 2HPSA 2B1UA 1AJ4A 4ETOA 1EG3A 5JOLA 3S0BA 1BJFA 3PJIA 1W7IB 3CDNA 3OX5A 1KK7Y 1KWOB 1WLMA 3BUMB 4CIDA 1CLMA 2WCKA 1MR8A 4MZJA 5D69A 2FCDA 1S5GY 4PE4A 1CB1A 1FPWA 4MZKA 2FJUB 3L4LA 1U5IA 1CLLA 1QLKA 2BNXA 1A29A 3D10A 3FE9A 2BBMA 3LK0A 1N2DA 2LHIA 1A75B 1IRJA 2KHNA 4DCKA 2EGDA 1G33A 4U8DA 1DJYA 4NQGA 1XA5A 1K95A 1JBAA 1NX3A 3EK4A 1J55A 3JTDC 1F71A 3H4SE 4INXA 5CPVA 2LUCA 3FS7A 1ZUZA 1CDNA 5FI2A 4I5JA 4AOMA 1TNWA 3TZ1A 3PALA 1DEKA 1YX7A 2CNPA 3CZ2A 4HREE 2KAVA 2NLNA 5F6TA 1OOIX 1SCMB 3I5GB 3A4UB 1RROA 3EVUA 2QEBA 1Y0VH 2JTZA 3K1EA 1PRWA 2Q91A 3I5FB 1SR6C 2JU0A 4PDZA 1F70A 3BYAA 1S6JA 5I2OA 3OB1B 3VRRA 1PK0D 1LXFC 1OZSA 2NCPA 2PASA 3NSOA 1R2UA 1MXEA 1OOJA 1SNLA 1AK8A 1E8AA 2AMIA 2L5YA 1CFCA 1IQ3A 2M3WA 3S0DA 2M8UA 4TNCA 3CWGA 1S3PA 3S0FA 1DC1A 4WQ3A 4HRGA 3UO9A 4GGFA 1J1EA 2P70A 2Y4QA 1RECA 3BJHA 4PE0A 2F2PA 2NXQA 1SW8A 1KSMA 3ZWHA 5I8NA 3PN7C 1AJ5A 3OP0A 1TCFA 2M29A 2KQYA 5D7FA 1TOPA 2WOSA 1S26D 3ICBA 4JWQA 2PMYA 1V1GA 5FYXA 1B7TY 2QPTA 1SSEB 2KQ6A 3HCMA 2OTGC 1A75A 3CS1A 3RZSA 2L98A 1N0YA 2MBXA 1DJWA 2JT8A 1EJ3A 3QMEA 3LLEA 2JTTA 1QX7A 3DY9A 1JF0A 3E3RA 1AHRA 1WDCB 2QDIA 3R72A 4YI8A 4PE7A 1K9PA 1OMVA 1ZMZA 2BKIB 1SMGA 1CFPA 1TCOB 3PM8A 1WRKA 1MQ1A 4YI9A 1MWNA 2LCPA 3CZ0A 3PLFB 3D77A 3VRNA 4CFRA 1BLQA 1QIVA 1UHNA 2JULA 5CSNA 4JQ0D 1PALA 2QEVA 1QV1A 1CDMA 2V53A 1DJHA 1TRFA 1GGZA 1Q80A 3IF7A 1LA0A 3LK1A 1SRAA 1JUOA 2JXCA 1RFJA 1NSHA 3HX4A 2MHHA 4PHKA 4AQJA 1RJVA 2MJWB 3N7HA 4A4CA 3BFHA 1C7WA 2L51A 3OHMB 1IGVA 2FOTA 3R1VA 1GGWA 5HL1A 4M2OA 2L2CA 4F7FA 1S1EA 1YUSA 4JKTA 1B1GA 1JSAA 1T14A 5AERA 1TUZA 1KK8C 1HQVA 3WXAA 1QX5B 4DRWA 2GV5A 2M7LA 1F4OA 2L5XB 1TNPA 1LINA 2E30A 1DF0B 2IS9A 1Y1XA 3SG7A 1WLZA 3VB1A 2SASA 3C1VA 1DELA 1ALVA 1W7JB 3O4YA 5I2LA 3GK1A 3TS5C 1KFUL 2CCMA 5HKZA 1J7QA 4IL1A 3SS5A 3TUYC 1YX8A 2K0JA 1JFKA 2PQLA 2WCEA 1Y1AA 2ZNDA 3NGVA 4N1FA 1XO5A 1WRLA 1PSBA 3D0YA 2WORA 1ALWA 4GNKB 1KCYA 1CDLA 2K7BA 2M97A 1IKUA 1Z4HA 1K96A 1WRZA 5KTYA 1QATA 2LANA 1K94A 2ZNEA 4XJKB 2JZIA 1TNXA 1M39A 3DZTA 3R1PA 3LL8B 3SIBA 2F3YA 3M0WA 2LP3A 3DVJA 1XFWO 1EG4A 1SL7A 2LV7A 2L50A 1NIWA 3OBVA 4WQ2A 2M49B 3SG2A 3TDIA 2JNFA
chains in the Genus database with same CATH topology
2JT0A 1NCXA 1H8BA 4ICBA 1G8IA 1KFUS 4GBAA 1IWQA 4I5KA 1K9KA 1JFJA 1MHOA 4ZCUA 1B4CA 3FWCA 1F8HA 3GOFA 1LKJA 2Y1MA 1S5GZ 1F55A 1AVSA 2LMUA 3FWBA 5DKNA 1OQPA 1YRUB 1M31A 1M63B 4DS7A 4GGNA 5J3XA 1OMRA 1SR6B 2WCFA 1K90D 1CTRA 4FTGA 2M7NA 4I5NB 2FCEA 1EH2A 3DD4A 1G4YR 5CSFA 4GGFC 3D0YB 4HRHA 3NSLA 4JPZB 3KHEA 2JWWA 2OPOA 2JRFA 4NDDA 3ZNIA 2JPTA 1D1OA 2L4IA 1XFVO 4XJKA 2BCXA 3DVMA 3OB2B 3NSIA 4GAOA 2OS8C 1XK4C 5HLVA 1WY9A 1RWYA 1FI5A 1A2XA 3SG6A 1Y6WA 2WCBA 2F2OA 3WNXB 1UHJA 2KGBC 1NX2A 2LLSA 3A8RA 3JVTC 4M2QA 4ORCB 5AEQA 1JF2A 1DGVA 4QJ5B 3RLZA 2KBIA 1KK8B 1RK9A 1NCYA 4XYNA 1ZOTB 2LHLA 2CT9A 4ZCVA 1IG5A 4MBEA 5I2QA 3SG5A 5PALA 3EK7A 1KWOC 4N1GA 4OVNF 3DF0A 1WDCC 3GK4X 5ER5A 2Y1NA 5HYDA 3GK2A 2LVKA 3I5IB 2K7OA 1L2OB 1L7ZA 2AAOA 4BY5A 2I94A 4C0JA 2OTGB 5G08A 2KI4C 2LMTA 1CKKA 4QJ4B 3O2PA 4M2PA 4OCIA 3BXKA 2E6WA 1X02A 2HQWA 2F33A 2R2IA 4MZLA 1FI6A 1BF5A 1MUXA 1SYMA 3IQQA 4CLNA 5JJGA 1H4BA 3FIAA 1U5IB 1YUUA 1QVIY 1AP4A 2K7DA 2ISDA 2BKHB 4ORAB 1B8RA 5HKWA 1K8UA 3F45A 1J7OA 2LLTA 5TNCA 3CR4X 2HQ8A 2KI4B 5CSJA 1Y1UA 3O6BA 2GGMA 3WHTB 1QX2A 2F8PA 1IJ6A 1SCVA 3EKHA 1XK4A 1SKTA 1YURA 1IQ5A 1YTZC 3SJSA 1N65A 2COLB 1MF8B 2ZRTA 1HT9A 3LCPC 1IJ5A 2KYFA 2ZKMX 2KGRA 3NXAA 2DOQA 1R6PA 3JVTB 5AANA 3RM1A 1JBAA 1IH0A 1DMOA 3CTNA 1XVJA 3PN7B 3EK8A 1F4QA 1UURA 2L4HA 2KI6C 2NCOA 3DVKA 3SIAA 2LVJA 3CR2A 4MEWA 2GGZA 1KFXS 2KNEA 1BU3A 2L0PA 2A4JA 3VROA 4C0KA 1CDPA 2K8MB 1SL8A 2JC2A 1L2OC 1GQMA 1TIZA 2QACA 1KSOA 1ZFSA 3BOWB 1NCZA 2BE6A 1BT6A 1CMGA 2EC6C 1CFDA 1YRTB 2MA2A 5AFPA 4YGEB 1NWDA 4CFQA 3I5GC 3CLNA 2O5GA 4YGBB 1QLSA 1BR4B 3KO0A 2H2KA 4PALA 2LVIA 1BR1B 3DVEA 2BCBA 1DT7B 1S6CA 1QASA 2MLEC 2LNKA 4USLA 4PE1A 3WHUB 2KSPA 1KQMB 2ZRSA 1YUTA 3AKBA 4ORBB 3JTDB 3KEVA 4NDCA 2ZN9A 4P2YB 2HETA 1QXPA 5ER4X 5HKYA 2K2FA 1YR5A 2M1UA 2PSRA 3EVVA 2Y5IA 2L2EA 1ZACA 1EL4A 2LP2A 1S36A 1C07A 3CR5X 4OR9B 1M45A 3PATA 1BOCA 3VGOA 2VRGA 4GFTA 4AQIA 2JQ6A 2ZN8A 3I5IC 1OE9B 4N5XA 3CZTX 3BUWB 2KAXA 1S6IA 4R1EA 1UWOA 1FBVA 1SY9A 1MXLC 1XFUO 4PHMA 2BL0C 4PHNA 4HSZA 4PHJA 4YGAA 1V1FA 1OZOA 1LA3A 1NPQA 1KK7Z 2NZ0A 4P5OE 1CFFA 4A4BA 1PVAA 2CBLA 1ODBA 1B47A 1QIWA 1BMOA 3EVRA 2WNDA 1DTLA 3BOWA 3CGAA 1B8LA 2AUCA 1TNQA 2HF5A 2MAZA 4MRYA 2WC8A 5DKRA 1CLBA 1QTXA 1GJYA 4D1EA 1B9AA 2JOJA 1DF0A 1EXRA 1PSRA 5GQQC 2MLFC 2PALA 4YBHB 1YVLA 1DVIA 3AAKA 2CXJA 2EC6B 5HLOA 4FQOA 3I5FC 1QS7A 1J1DA 1SCMC 4MN0A 2I7AA 5B8IB 4YGDB 1JC2A 2BE4A 2K2AA 3TDUA 3QRXA 1DGUA 4DUQA 2BBNA 1AUIB 3BUNB 4UPGA 2M0RA 3IQOA 5KSZA 2LM5A 1B8CA 1J7RA 4YRUA 3OX6A 1DJIA 1A4PA 1SL9A 2LVVA 4OKHA 4YGCB 4BY4A 2JXLA 3I5HC 2ZFDA 1QV0A 2TN4A 1CM1A 1TTXA 4OV2A 1BODA 1YVHA 1OMDA 1QVIZ 4NDBA 1SK6D 1FF1A 2M9GA 3SG3A 2O60A 2H61C 2KFGA 4MLWA 2G9BA 1KQVA 1UUSA 1UHKA 1KFXL 3PFVA 2JNXA 2G2BA 2JT3A 2KOTA 3MSEB 4PCWA 2I2RE 4I5LB 4QJ3B 4MSPA 4DIRA 1VRKA 4WRIA 1F54A 1DJZA 2PVBA 3BUOB 2CTNA 2I18A 1PVBA 1NX0A 4F0ZB 3KF9A 2M1KB 1SPYA 1NUBA 2BCAA 2F3ZA 2KAYA 3NSKA 2SCPA 4C0LA 1UHIA 2OS8B 1LVCD 2LLUA 3VRQA 3TDZA 2LE9B 5AXIA 2LC5A 5CSIA 1XFZO 2KI6D 1XFYO 5DKQA 2KFHA 3EKJA 3PSRA 3TUYB 2BECA 2KBMA 3BQ3A 2P6BB 4MVFA 2Q4UA 2EHBA 4GPLB 3AKAA 4Q04A 1K9UA 3O78A 2LMVA 1J7PA 2BL0B 1OSAA 3KPXA 1B7TZ 5BPJA 1NX1A 1JWDA 1UP5A 1NP8A 2MRDA 1BG1A 4CPVA 2KYCA 3K21A 1M46A 1CMFA 1DJGA 1UHHA 4GUKA 1NYAA 1FW4A 1RTP1 2KFFA 2LAPA 2K7CA 1K93D 1PULA 1SBJA 2K61A 1TN4A 1KQMC 3BUXB 3I5HB 5IBWA 3DF0B 1CNPA 2D8NA 3AAJA 4L9MA 4MRXA 1XFXO 4E68A 3VRPA 5K89A 2PRUA 1DJXA 3TS5B 5KU1A 1A03A 1C7VA 2RGIA 2KDHA 1QJTA 2H61A 1CM4A 2LUXA 1XYDA 1K2HA 2HPSA 2B1UA 1AJ4A 4ETOA 1EG3A 5JOLA 1BJFA 1W7IB 3OX5A 1KK7Y 1KWOB 1WLMA 3BUMB 4CIDA 1CLMA 4MZJA 1MR8A 5D69A 2FCDA 1S5GY 4PE4A 1CB1A 1FPWA 4MZKA 2FJUB 1U5IA 1CLLA 1QLKA 3D10A 1A29A 2BBMA 3LK0A 1N2DA 2LHIA 1A75B 1IRJA 2KHNA 4DCKA 2EGDA 1G33A 4U8DA 1DJYA 4NQGA 1XA5A 1K95A 1NX3A 3EK4A 1J55A 3JTDC 1F71A 3H4SE 5CPVA 2LUCA 3FS7A 1ZUZA 1CDNA 4AOMA 4I5JA 1TNWA 3TZ1A 3PALA 1YX7A 2CNPA 4HREE 2KAVA 2NLNA 5F6TA 1SCMB 3I5GB 3A4UB 1RROA 3EVUA 1Y0VH 2JTZA 1PRWA 2Q91A 3I5FB 1SR6C 2JU0A 4PDZA 1F70A 3BYAA 1S6JA 5I2OA 3OB1B 3VRRA 1PK0D 1LXFC 1OZSA 2NCPA 2PASA 3NSOA 1R2UA 1MXEA 1OOJA 1SNLA 1AK8A 1E8AA 2AMIA 1CFCA 1IQ3A 2M3WA 2M8UA 4TNCA 3CWGA 1S3PA 4WQ3A 4HRGA 4GGFA 1J1EA 2Y4QA 1RECA 4PE0A 2F2PA 2NXQA 1SW8A 1KSMA 3ZWHA 5I8NA 3PN7C 1AJ5A 3OP0A 1TCFA 2M29A 2KQYA 5D7FA 1TOPA 2WOSA 1S26D 3ICBA 4JWQA 2PMYA 1V1GA 5FYXA 1B7TY 2QPTA 3HCMA 2KQ6A 2OTGC 1A75A 3CS1A 2L98A 1N0YA 2MBXA 1DJWA 2JT8A 1EJ3A 3LLEA 2JTTA 1QX7A 1JF0A 3E3RA 1AHRA 1WDCB 4YI8A 4PE7A 1K9PA 1OMVA 1ZMZA 2BKIB 1SMGA 1CFPA 1TCOB 3PM8A 1WRKA 1MQ1A 4YI9A 1MWNA 2LCPA 3PLFB 4CFRA 3VRNA 1BLQA 1QIVA 1UHNA 2JULA 5CSNA 4JQ0D 1PALA 1QV1A 1CDMA 2V53A 1DJHA 1TRFA 1GGZA 1Q80A 3IF7A 1LA0A 3LK1A 1SRAA 1JUOA 2JXCA 1RFJA 1NSHA 3HX4A 2MHHA 4PHKA 4AQJA 1RJVA 2MJWB 4A4CA 1C7WA 2L51A 3OHMB 1IGVA 2FOTA 1GGWA 4M2OA 1JSAA 1S1EA 1YUSA 1B1GA 5AERA 1KK8C 1HQVA 3WXAA 1QX5B 4DRWA 2GV5A 2M7LA 1F4OA 2L5XB 1TNPA 1LINA 2E30A 1DF0B 2IS9A 1Y1XA 3SG7A 1WLZA 2SASA 3C1VA 1ALVA 1W7JB 3O4YA 5I2LA 3GK1A 3TS5C 1KFUL 2CCMA 5HKZA 1J7QA 4IL1A 3TUYC 1YX8A 2K0JA 1JFKA 2ZNDA 2WCEA 1Y1AA 4N1FA 1XO5A 1WRLA 1PSBA 3D0YA 2WORA 1ALWA 4GNKB 1KCYA 1CDLA 2K7BA 2M97A 1IKUA 1K96A 1WRZA 5KTYA 1QATA 2LANA 1K94A 2ZNEA 4XJKB 2JZIA 1TNXA 1M39A 3LL8B 3SIBA 2F3YA 3M0WA 2LP3A 3DVJA 1XFWO 1EG4A 1SL7A 2LV7A 2L50A 1NIWA 4WQ2A 3SG4A 2M49B 3SG2A 3TDIA 2JNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JT0 A;  1NCX A;  1H8B A;  4ICB A;  1G8I A;  1KFU S;  4GBA A;  1IWQ A;  4I5K A;  1K9K A;  1JFJ A;  1MHO A;  4ZCU A;  1B4C A;  3FWC A;  1F8H A;  3GOF A;  1LKJ A;  2Y1M A;  1S5G Z;  1F55 A;  1AVS A;  2LMU A;  3FWB A;  5DKN A;  1OQP A;  1YRU B;  1M31 A;  1M63 B;  4DS7 A;  4GGN A;  5J3X A;  1OMR A;  1SR6 B;  2WCF A;  1K90 D;  1CTR A;  4FTG A;  2M7N A;  4I5N B;  2FCE A;  1EH2 A;  3DD4 A;  1G4Y R;  5CSF A;  4GGF C;  3D0Y B;  4HRH A;  3NSL A;  4JPZ B;  3KHE A;  2JWW A;  2OPO A;  2JRF A;  4NDD A;  3ZNI A;  2JPT A;  1D1O A;  2L4I A;  1XFV O;  4XJK A;  2BCX A;  3DVM A;  3OB2 B;  3NSI A;  4GAO A;  2OS8 C;  1XK4 C;  5HLV A;  1WY9 A;  1RWY A;  1FI5 A;  1A2X A;  3SG6 A;  1Y6W A;  2WCB A;  2F2O A;  3WNX B;  1UHJ A;  2KGB C;  1NX2 A;  2LLS A;  3A8R A;  3JVT C;  4M2Q A;  4ORC B;  5AEQ A;  1JF2 A;  1DGV A;  4QJ5 B;  3RLZ A;  2KBI A;  1KK8 B;  1RK9 A;  1NCY A;  4XYN A;  1ZOT B;  2LHL A;  2CT9 A;  4ZCV A;  1IG5 A;  4MBE A;  5I2Q A;  3SG5 A;  5PAL A;  3EK7 A;  1KWO C;  4N1G A;  4OVN F;  3DF0 A;  1WDC C;  3GK4 X;  5ER5 A;  2Y1N A;  5HYD A;  3GK2 A;  2LVK A;  3I5I B;  2K7O A;  1L2O B;  1L7Z A;  2AAO A;  4BY5 A;  2I94 A;  4C0J A;  2OTG B;  5G08 A;  2KI4 C;  2LMT A;  1CKK A;  4QJ4 B;  3O2P A;  4M2P A;  4OCI A;  3BXK A;  2E6W A;  1X02 A;  2HQW A;  2F33 A;  2R2I A;  4MZL A;  1FI6 A;  1BF5 A;  1MUX A;  1SYM A;  3IQQ A;  4CLN A;  5JJG A;  1H4B A;  3FIA A;  1U5I B;  1YUU A;  1QVI Y;  1AP4 A;  2K7D A;  2ISD A;  2BKH B;  4ORA B;  1B8R A;  5HKW A;  1K8U A;  3F45 A;  1J7O A;  2LLT A;  5TNC A;  3CR4 X;  2HQ8 A;  2KI4 B;  5CSJ A;  1Y1U A;  3O6B A;  2GGM A;  3WHT B;  1QX2 A;  2F8P A;  1IJ6 A;  1SCV A;  3EKH A;  1XK4 A;  1SKT A;  1YUR A;  1IQ5 A;  1YTZ C;  3SJS A;  1N65 A;  2COL B;  1MF8 B;  2ZRT A;  1HT9 A;  3LCP C;  1IJ5 A;  2KYF A;  2ZKM X;  2KGR A;  3NXA A;  2DOQ A;  1R6P A;  3JVT B;  5AAN A;  3RM1 A;  1JBA A;  1IH0 A;  1DMO A;  3CTN A;  1XVJ A;  3PN7 B;  3EK8 A;  1F4Q A;  1UUR A;  2L4H A;  2KI6 C;  2NCO A;  3DVK A;  3SIA A;  2LVJ A;  3CR2 A;  4MEW A;  2GGZ A;  1KFX S;  2KNE A;  1BU3 A;  2L0P A;  2A4J A;  3VRO A;  4C0K A;  1CDP A;  2K8M B;  1SL8 A;  2JC2 A;  1L2O C;  1GQM A;  1TIZ A;  2QAC A;  1KSO A;  1ZFS A;  3BOW B;  1NCZ A;  2BE6 A;  1BT6 A;  1CMG A;  2EC6 C;  1CFD A;  1YRT B;  2MA2 A;  5AFP A;  4YGE B;  1NWD A;  4CFQ A;  3I5G C;  3CLN A;  2O5G A;  4YGB B;  1QLS A;  1BR4 B;  3KO0 A;  2H2K A;  4PAL A;  2LVI A;  1BR1 B;  3DVE A;  2BCB A;  1DT7 B;  1S6C A;  1QAS A;  2MLE C;  2LNK A;  4USL A;  4PE1 A;  3WHU B;  2KSP A;  1KQM B;  2ZRS A;  1YUT A;  3AKB A;  4ORB B;  3JTD B;  3KEV A;  4NDC A;  2ZN9 A;  4P2Y B;  2HET A;  1QXP A;  5ER4 X;  5HKY A;  2K2F A;  1YR5 A;  2M1U A;  2PSR A;  3EVV A;  2Y5I A;  2L2E A;  1ZAC A;  1EL4 A;  2LP2 A;  1S36 A;  1C07 A;  3CR5 X;  4OR9 B;  1M45 A;  3PAT A;  1BOC A;  3VGO A;  2VRG A;  4GFT A;  4AQI A;  2JQ6 A;  2ZN8 A;  3I5I C;  1OE9 B;  4N5X A;  3CZT X;  3BUW B;  2KAX A;  1S6I A;  4R1E A;  1UWO A;  1FBV A;  1SY9 A;  1MXL C;  1XFU O;  4PHM A;  2BL0 C;  4PHN A;  4HSZ A;  4PHJ A;  4YGA A;  1V1F A;  1OZO A;  1LA3 A;  1NPQ A;  1KK7 Z;  2NZ0 A;  4P5O E;  1CFF A;  4A4B A;  1PVA A;  2CBL A;  1ODB A;  1B47 A;  1QIW A;  1BMO A;  3EVR A;  2WND A;  1DTL A;  3BOW A;  3CGA A;  1B8L A;  2AUC A;  1TNQ A;  2HF5 A;  2MAZ A;  4MRY A;  2WC8 A;  5DKR A;  1CLB A;  1QTX A;  1GJY A;  4D1E A;  1B9A A;  2JOJ A;  1DF0 A;  1EXR A;  1PSR A;  5GQQ C;  2MLF C;  2PAL A;  4YBH B;  1YVL A;  1DVI A;  3AAK A;  2CXJ A;  2EC6 B;  5HLO A;  4FQO A;  3I5F C;  1QS7 A;  1J1D A;  1SCM C;  4MN0 A;  2I7A A;  5B8I B;  4YGD B;  1JC2 A;  2BE4 A;  2K2A A;  3TDU A;  3QRX A;  1DGU A;  4DUQ A;  2BBN A;  1AUI B;  3BUN B;  4UPG A;  2M0R A;  3IQO A;  5KSZ A;  2LM5 A;  1B8C A;  1J7R A;  4YRU A;  3OX6 A;  1DJI A;  1A4P A;  1SL9 A;  2LVV A;  4OKH A;  4YGC B;  4BY4 A;  2JXL A;  3I5H C;  2ZFD A;  1QV0 A;  2TN4 A;  1CM1 A;  1TTX A;  4OV2 A;  1BOD A;  1YVH A;  1OMD A;  1QVI Z;  4NDB A;  1SK6 D;  1FF1 A;  2M9G A;  3SG3 A;  2O60 A;  2H61 C;  2KFG A;  4MLW A;  2G9B A;  1KQV A;  1UUS A;  1UHK A;  1KFX L;  3PFV A;  2JNX A;  2G2B A;  2JT3 A;  2KOT A;  3MSE B;  4PCW A;  2I2R E;  4I5L B;  4QJ3 B;  4MSP A;  4DIR A;  1VRK A;  4WRI A;  1F54 A;  1DJZ A;  2PVB A;  3BUO B;  2CTN A;  2I18 A;  1PVB A;  1NX0 A;  4F0Z B;  3KF9 A;  2M1K B;  1SPY A;  1NUB A;  2BCA A;  2F3Z A;  2KAY A;  3NSK A;  2SCP A;  4C0L A;  1UHI A;  2OS8 B;  1LVC D;  2LLU A;  3VRQ A;  3TDZ A;  2LE9 B;  5AXI A;  2LC5 A;  5CSI A;  1XFZ O;  2KI6 D;  1XFY O;  5DKQ A;  2KFH A;  3EKJ A;  3PSR A;  3TUY B;  2BEC A;  2KBM A;  3BQ3 A;  2P6B B;  4MVF A;  2Q4U A;  2EHB A;  4GPL B;  3AKA A;  4Q04 A;  1K9U A;  3O78 A;  2LMV A;  1J7P A;  2BL0 B;  1OSA A;  3KPX A;  1B7T Z;  5BPJ A;  1NX1 A;  1JWD A;  1UP5 A;  1NP8 A;  2MRD A;  1BG1 A;  4CPV A;  2KYC A;  3K21 A;  1M46 A;  1CMF A;  1DJG A;  1UHH A;  4GUK A;  1NYA A;  1FW4 A;  1RTP 1;  2KFF A;  2LAP A;  2K7C A;  1K93 D;  1PUL A;  1SBJ A;  2K61 A;  1TN4 A;  1KQM C;  3BUX B;  3I5H B;  5IBW A;  3DF0 B;  1CNP A;  2D8N A;  3AAJ A;  4L9M A;  4MRX A;  1XFX O;  4E68 A;  3VRP A;  5K89 A;  2PRU A;  1DJX A;  3TS5 B;  5KU1 A;  1A03 A;  1C7V A;  2RGI A;  2KDH A;  1QJT A;  2H61 A;  1CM4 A;  2LUX A;  1XYD A;  1K2H A;  2HPS A;  2B1U A;  1AJ4 A;  4ETO A;  1EG3 A;  5JOL A;  1BJF A;  1W7I B;  3OX5 A;  1KK7 Y;  1KWO B;  1WLM A;  3BUM B;  4CID A;  1CLM A;  4MZJ A;  1MR8 A;  5D69 A;  2FCD A;  1S5G Y;  4PE4 A;  1CB1 A;  1FPW A;  4MZK A;  2FJU B;  1U5I A;  1CLL A;  1QLK A;  3D10 A;  1A29 A;  2BBM A;  3LK0 A;  1N2D A;  2LHI A;  1A75 B;  1IRJ A;  2KHN A;  4DCK A;  2EGD A;  1G33 A;  4U8D A;  1DJY A;  4NQG A;  1XA5 A;  1K95 A;  1NX3 A;  3EK4 A;  1J55 A;  3JTD C;  1F71 A;  3H4S E;  5CPV A;  2LUC A;  3FS7 A;  1ZUZ A;  1CDN A;  4AOM A;  4I5J A;  1TNW A;  3TZ1 A;  3PAL A;  1YX7 A;  2CNP A;  4HRE E;  2KAV A;  2NLN A;  5F6T A;  1SCM B;  3I5G B;  3A4U B;  1RRO A;  3EVU A;  1Y0V H;  2JTZ A;  1PRW A;  2Q91 A;  3I5F B;  1SR6 C;  2JU0 A;  4PDZ A;  1F70 A;  3BYA A;  1S6J A;  5I2O A;  3OB1 B;  3VRR A;  1PK0 D;  1LXF C;  1OZS A;  2NCP A;  2PAS A;  3NSO A;  1R2U A;  1MXE A;  1OOJ A;  1SNL A;  1AK8 A;  1E8A A;  2AMI A;  1CFC A;  1IQ3 A;  2M3W A;  2M8U A;  4TNC A;  3CWG A;  1S3P A;  4WQ3 A;  4HRG A;  4GGF A;  1J1E A;  2Y4Q A;  1REC A;  4PE0 A;  2F2P A;  2NXQ A;  1SW8 A;  1KSM A;  3ZWH A;  5I8N A;  3PN7 C;  1AJ5 A;  3OP0 A;  1TCF A;  2M29 A;  2KQY A;  5D7F A;  1TOP A;  2WOS A;  1S26 D;  3ICB A;  4JWQ A;  2PMY A;  1V1G A;  5FYX A;  1B7T Y;  2QPT A;  3HCM A;  2KQ6 A;  2OTG C;  1A75 A;  3CS1 A;  2L98 A;  1N0Y A;  2MBX A;  1DJW A;  2JT8 A;  1EJ3 A;  3LLE A;  2JTT A;  1QX7 A;  1JF0 A;  3E3R A;  1AHR A;  1WDC B;  4YI8 A;  4PE7 A;  1K9P A;  1OMV A;  1ZMZ A;  2BKI B;  1SMG A;  1CFP A;  1TCO B;  3PM8 A;  1WRK A;  1MQ1 A;  4YI9 A;  1MWN A;  2LCP A;  3PLF B;  4CFR A;  3VRN A;  1BLQ A;  1QIV A;  1UHN A;  2JUL A;  5CSN A;  4JQ0 D;  1PAL A;  1QV1 A;  1CDM A;  2V53 A;  1DJH A;  1TRF A;  1GGZ A;  1Q80 A;  3IF7 A;  1LA0 A;  3LK1 A;  1SRA A;  1JUO A;  2JXC A;  1RFJ A;  1NSH A;  3HX4 A;  2MHH A;  4PHK A;  4AQJ A;  1RJV A;  2MJW B;  4A4C A;  1C7W A;  2L51 A;  3OHM B;  1IGV A;  2FOT A;  1GGW A;  4M2O A;  1JSA A;  1S1E A;  1YUS A;  1B1G A;  5AER A;  1KK8 C;  1HQV A;  3WXA A;  1QX5 B;  4DRW A;  2GV5 A;  2M7L A;  1F4O A;  2L5X B;  1TNP A;  1LIN A;  2E30 A;  1DF0 B;  2IS9 A;  1Y1X A;  3SG7 A;  1WLZ A;  2SAS A;  3C1V A;  1ALV A;  1W7J B;  3O4Y A;  5I2L A;  3GK1 A;  3TS5 C;  1KFU L;  2CCM A;  5HKZ A;  1J7Q A;  4IL1 A;  3TUY C;  1YX8 A;  2K0J A;  1JFK A;  2ZND A;  2WCE A;  1Y1A A;  4N1F A;  1XO5 A;  1WRL A;  1PSB A;  3D0Y A;  2WOR A;  1ALW A;  4GNK B;  1KCY A;  1CDL A;  2K7B A;  2M97 A;  1IKU A;  1K96 A;  1WRZ A;  5KTY A;  1QAT A;  2LAN A;  1K94 A;  2ZNE A;  4XJK B;  2JZI A;  1TNX A;  1M39 A;  3LL8 B;  3SIB A;  2F3Y A;  3M0W A;  2LP3 A;  3DVJ A;  1XFW O;  1EG4 A;  1SL7 A;  2LV7 A;  2L50 A;  1NIW A;  4WQ2 A;  3SG4 A;  2M49 B;  3SG2 A;  3TDI A;  2JNF A; 
#chains in the Genus database with same CATH topology
 2JT0 A;  1NCX A;  1H8B A;  4ICB A;  1G8I A;  1KFU S;  4GBA A;  1IWQ A;  4I5K A;  1K9K A;  1JFJ A;  1MHO A;  4ZCU A;  1B4C A;  3FWC A;  1F8H A;  3GOF A;  3S0A A;  1LKJ A;  2Y1M A;  4IJ7 A;  2WCH A;  1S5G Z;  1F55 A;  2YGU A;  1AVS A;  2LMU A;  3FWB A;  5DKN A;  1OQP A;  1YRU B;  1M31 A;  1M63 B;  3D73 A;  4GGN A;  4DS7 A;  5J3X A;  1OMR A;  1SR6 B;  2WCF A;  1K90 D;  1CTR A;  4FTG A;  2M7N A;  2WC6 A;  2FCE A;  4I5N B;  1EH2 A;  3DD4 A;  1G4Y R;  5CSF A;  4GGF C;  3D0Y B;  4HRH A;  3NSL A;  5I94 A;  4JPZ B;  2KLD A;  3KHE A;  2JWW A;  2OPO A;  3Q8I A;  2JRF A;  4NDD A;  3ZNI A;  2JPT A;  1D1O A;  2L4I A;  1XFV O;  3IVT A;  4XJK A;  2BCX A;  3DVM A;  2JPO A;  3OB2 B;  3V2L A;  3BFA A;  3NSI A;  4GAO A;  2OS8 C;  1XK4 C;  5HLV A;  1WY9 A;  1RWY A;  1FI5 A;  1A2X A;  3SG6 A;  1Y6W A;  1Z2C B;  2WCB A;  2F2O A;  5D3O A;  3WNX B;  1UHJ A;  3NHT A;  2KGB C;  1NX2 A;  2LLS A;  3A8R A;  3JVT C;  4M2Q A;  4ORC B;  5AEQ A;  1JF2 A;  1DGV A;  4QJ5 B;  3RLZ A;  2KBI A;  1KK8 B;  1RK9 A;  1NCY A;  2FJY A;  4XYN A;  1ZOT B;  2LHL A;  2CT9 A;  4ZCV A;  1IG5 A;  4MBE A;  2KPH A;  5I2Q A;  3SG5 A;  5PAL A;  3EK7 A;  1KWO C;  4N1G A;  4OVN F;  3DF0 A;  1WDC C;  3GK4 X;  5ER5 A;  2Y1N A;  5HYD A;  3GK2 A;  2LVK A;  3I5I B;  1TUJ A;  2K7O A;  1L2O B;  1L7Z A;  2AAO A;  4BY5 A;  2PYQ A;  2I94 A;  4C0J A;  2GTE A;  1TWO A;  2WCL A;  2OTG B;  5G08 A;  2KI4 C;  2LMT A;  1CKK A;  4QJ4 B;  3O2P A;  4M2P A;  4OCI A;  1C3Y A;  3BXK A;  2E6W A;  1X02 A;  2HQW A;  2F33 A;  2R2I A;  4MZL A;  1FI6 A;  1IIO A;  1BF5 A;  1MUX A;  1SYM A;  3IQQ A;  4CLN A;  5JJG A;  1H4B A;  1OW4 A;  3FIA A;  1U5I B;  1YUU A;  1QVI Y;  1AP4 A;  2K7D A;  2ISD A;  2BKH B;  4ORA B;  1B8R A;  5HKW A;  1K8U A;  3F45 A;  1J7O A;  2LLT A;  5TNC A;  3CR4 X;  2HQ8 A;  2KI4 B;  3PM2 A;  5CSJ A;  1Y1U A;  3O6B A;  2GGM A;  3WHT B;  1QX2 A;  3S0E A;  2WCM A;  2F8P A;  1IJ6 A;  1SCV A;  3EKH A;  1XK4 A;  1SKT A;  1YUR A;  1IQ5 A;  1YTZ C;  3SJS A;  3SS4 A;  1N65 A;  2COL B;  1ORG A;  1MF8 B;  2ZRT A;  1HT9 A;  3LCP C;  1OOG A;  5FI7 A;  1IJ5 A;  1DQE A;  2KYF A;  2KGR A;  2ZKM X;  2DOQ A;  1R6P A;  1P28 A;  3JVT B;  3NXA A;  5AAN A;  3RM1 A;  1IH0 A;  1DMO A;  3CTN A;  1XVJ A;  3PN7 B;  3EK8 A;  1F4Q A;  1UUR A;  2L4H A;  2KI6 C;  4KYN A;  4INW A;  2NCO A;  3DVK A;  3SIA A;  2LVJ A;  3CR2 A;  4MEW A;  2KLE A;  2GGZ A;  1KFX S;  2KNE A;  1BU3 A;  2L0P A;  2A4J A;  3VRO A;  2QEH A;  4C0K A;  1CDP A;  3B6X A;  2K8M B;  5FI6 A;  1SL8 A;  2JC2 A;  1L2O C;  1GQM A;  1TIZ A;  2QAC A;  1KSO A;  1ZFS A;  3BOW B;  5EL2 A;  1NCZ A;  2BE6 A;  1BT6 A;  1CMG A;  2EC6 C;  1CFD A;  1YRT B;  2MA2 A;  5AFP A;  4YGE B;  1NWD A;  4CFQ A;  3I5G C;  3CLN A;  2O5G A;  4YGB B;  1QLS A;  1BR4 B;  3R1O A;  4JD9 A;  3KO0 A;  2H2K A;  4PAL A;  2LVI A;  1BR1 B;  3DVE A;  2BCB A;  1DT7 B;  1S6C A;  1QAS A;  2MLE C;  2LNK A;  4USL A;  4PE1 A;  3WHU B;  2KSP A;  1KQM B;  2WCJ A;  2ZRS A;  1YUT A;  3AKB A;  4ORB B;  1QWV A;  3JTD B;  3KEV A;  4NDC A;  2ZN9 A;  4P2Y B;  2HET A;  1QXP A;  5ER4 X;  5HKY A;  2K2F A;  1YR5 A;  2M1U A;  2PSR A;  3EVV A;  2Y5I A;  2L2E A;  1ZAC A;  1EL4 A;  2LP2 A;  1S36 A;  3B88 A;  1C07 A;  3CR5 X;  4OR9 B;  1M45 A;  3PAT A;  2ERB A;  3VGO A;  2VRG A;  4GFT A;  4AQI A;  1BOC A;  2JQ6 A;  2ZN8 A;  3I5I C;  1OE9 B;  4OZD A;  4N5X A;  3CZT X;  3BUW B;  2KAX A;  2BAP A;  1S6I A;  4R1E A;  5DIC A;  1UWO A;  1OOF A;  1FBV A;  1SY9 A;  1XFU O;  1MXL C;  4PHM A;  1W9Z A;  3B86 A;  3OGN A;  2BL0 C;  4PHN A;  4HSZ A;  4PHJ A;  4YGA A;  1V1F A;  1OZO A;  1LA3 A;  1NPQ A;  1KK7 Z;  2NZ0 A;  4P5O E;  1CFF A;  4A4B A;  1PVA A;  2CBL A;  1ODB A;  3EG5 B;  1B47 A;  1QIW A;  1BMO A;  3EVR A;  2WND A;  1DTL A;  3BOW A;  3CGA A;  1B8L A;  2AUC A;  1TNQ A;  2HF5 A;  2MAZ A;  4MRY A;  2WC8 A;  5DKR A;  1CLB A;  1QTX A;  2QEO A;  1GJY A;  4D1E A;  1B9A A;  2JOJ A;  1DF0 A;  1EXR A;  1PSR A;  5GQQ C;  3D74 A;  2MLF C;  2P71 A;  2PAL A;  3FE6 A;  1YVL A;  4YBH B;  1DVI A;  3AAK A;  3L4A A;  2CXJ A;  2EC6 B;  3BFB A;  5HLO A;  4FQO A;  3I5F C;  1QS7 A;  1J1D A;  1SCM C;  4MN0 A;  2I7A A;  5B8I B;  4YGD B;  1JC2 A;  2BE4 A;  2K2A A;  3TDU A;  3QRX A;  1DGU A;  4DUQ A;  2BBN A;  1AUI B;  3BUN B;  4UPG A;  2M0R A;  3IQO A;  5KSZ A;  2LM5 A;  1B8C A;  1J7R A;  4YRU A;  3OX6 A;  1DJI A;  1A4P A;  1SL9 A;  2LVV A;  4OKH A;  4YGC B;  4BY4 A;  2JXL A;  3I5H C;  2ZFD A;  1QV0 A;  2TN4 A;  1CM1 A;  3FE8 A;  1TTX A;  4OV2 A;  1BOD A;  1YVH A;  1XFR A;  1OMD A;  1QVI Z;  4NDB A;  1SK6 D;  1FF1 A;  2M9G A;  3SG3 A;  2O60 A;  2K60 A;  3SG4 A;  2H61 C;  2KFG A;  4MLW A;  2G9B A;  1KQV A;  2WC5 A;  1UUS A;  1UHK A;  1KFX L;  3PFV A;  2JNX A;  2G2B A;  2JT3 A;  2KOT A;  3MSE B;  4FQT A;  3L47 A;  2I2R E;  3B87 A;  4I5L B;  3CZ1 A;  4PCW A;  4QJ3 B;  4MSP A;  4DIR A;  1VRK A;  4WRI A;  1F54 A;  1DJZ A;  2PVB A;  3D76 A;  3BUO B;  2CTN A;  2I18 A;  3B7A A;  1PVB A;  1NX0 A;  4F0Z B;  3KF9 A;  2M1K B;  1SPY A;  3UNW A;  1NUB A;  2BCA A;  3DYE A;  2F3Z A;  2KAY A;  3NSK A;  2SCP A;  4C0L A;  1UHI A;  2OS8 B;  1LVC D;  2LLU A;  1OOH A;  3VRQ A;  3TDZ A;  3CYZ A;  2LE9 B;  5AXI A;  2LC5 A;  3NHI A;  5CSI A;  1XFZ O;  2KI6 D;  1XFY O;  5DKQ A;  2KFH A;  3EKJ A;  3PSR A;  3TUY B;  2BEC A;  2KBM A;  3BQ3 A;  2P6B B;  4MVF A;  2Q4U A;  3CAB A;  2EHB A;  4GPL B;  2H8V A;  3AKA A;  3D78 A;  4Q04 A;  1K9U A;  3O78 A;  2LMV A;  1J7P A;  2BL0 B;  1OSA A;  3KPX A;  1B7T Z;  5BPJ A;  1NX1 A;  1JWD A;  1UP5 A;  1NP8 A;  2MRD A;  1BG1 A;  4CPV A;  2KYC A;  3K21 A;  1M46 A;  1CMF A;  1DJG A;  1UHH A;  4GUK A;  1NYA A;  1FW4 A;  1RTP 1;  2KFF A;  2LAP A;  3SS3 A;  2K7C A;  1K93 D;  1PUL A;  1SBJ A;  2K61 A;  1TN4 A;  1KQM C;  3BUX B;  3I5H B;  1GM0 A;  5IBW A;  3DF0 B;  1CNP A;  2D8N A;  3AAJ A;  4L9M A;  4MRX A;  1XFX O;  3D75 A;  4E68 A;  3VRP A;  5K89 A;  2PRU A;  1DJX A;  3TS5 B;  5KU1 A;  1A03 A;  1C7V A;  2RGI A;  2KDH A;  4PT1 A;  1QJT A;  3S0G A;  2H61 A;  1CM4 A;  2LUX A;  3DXL A;  3O4X A;  1C3Z A;  1XYD A;  1K2H A;  1LS8 A;  2HPS A;  2B1U A;  1AJ4 A;  4ETO A;  1EG3 A;  5JOL A;  3S0B A;  1BJF A;  3PJI A;  1W7I B;  3CDN A;  3OX5 A;  1KK7 Y;  1KWO B;  1WLM A;  3BUM B;  4CID A;  1CLM A;  2WCK A;  1MR8 A;  4MZJ A;  5D69 A;  2FCD A;  1S5G Y;  4PE4 A;  1CB1 A;  1FPW A;  4MZK A;  2FJU B;  3L4L A;  1U5I A;  1CLL A;  1QLK A;  2BNX A;  1A29 A;  3D10 A;  3FE9 A;  2BBM A;  3LK0 A;  1N2D A;  2LHI A;  1A75 B;  1IRJ A;  2KHN A;  4DCK A;  2EGD A;  1G33 A;  4U8D A;  1DJY A;  4NQG A;  1XA5 A;  1K95 A;  1JBA A;  1NX3 A;  3EK4 A;  1J55 A;  3JTD C;  1F71 A;  3H4S E;  4INX A;  5CPV A;  2LUC A;  3FS7 A;  1ZUZ A;  1CDN A;  5FI2 A;  4I5J A;  4AOM A;  1TNW A;  3TZ1 A;  3PAL A;  1DEK A;  1YX7 A;  2CNP A;  3CZ2 A;  4HRE E;  2KAV A;  2NLN A;  5F6T A;  1OOI X;  1SCM B;  3I5G B;  3A4U B;  1RRO A;  3EVU A;  2QEB A;  1Y0V H;  2JTZ A;  3K1E A;  1PRW A;  2Q91 A;  3I5F B;  1SR6 C;  2JU0 A;  4PDZ A;  1F70 A;  3BYA A;  1S6J A;  5I2O A;  3OB1 B;  3VRR A;  1PK0 D;  1LXF C;  1OZS A;  2NCP A;  2PAS A;  3NSO A;  1R2U A;  1MXE A;  1OOJ A;  1SNL A;  1AK8 A;  1E8A A;  2AMI A;  2L5Y A;  1CFC A;  1IQ3 A;  2M3W A;  3S0D A;  2M8U A;  4TNC A;  3CWG A;  1S3P A;  3S0F A;  1DC1 A;  4WQ3 A;  4HRG A;  3UO9 A;  4GGF A;  1J1E A;  2P70 A;  2Y4Q A;  1REC A;  3BJH A;  4PE0 A;  2F2P A;  2NXQ A;  1SW8 A;  1KSM A;  3ZWH A;  5I8N A;  3PN7 C;  1AJ5 A;  3OP0 A;  1TCF A;  2M29 A;  2KQY A;  5D7F A;  1TOP A;  2WOS A;  1S26 D;  3ICB A;  4JWQ A;  2PMY A;  1V1G A;  5FYX A;  1B7T Y;  2QPT A;  1SSE B;  2KQ6 A;  3HCM A;  2OTG C;  1A75 A;  3CS1 A;  3RZS A;  2L98 A;  1N0Y A;  2MBX A;  1DJW A;  2JT8 A;  1EJ3 A;  3QME A;  3LLE A;  2JTT A;  1QX7 A;  3DY9 A;  1JF0 A;  3E3R A;  1AHR A;  1WDC B;  2QDI A;  3R72 A;  4YI8 A;  4PE7 A;  1K9P A;  1OMV A;  1ZMZ A;  2BKI B;  1SMG A;  1CFP A;  1TCO B;  3PM8 A;  1WRK A;  1MQ1 A;  4YI9 A;  1MWN A;  2LCP A;  3CZ0 A;  3PLF B;  3D77 A;  3VRN A;  4CFR A;  1BLQ A;  1QIV A;  1UHN A;  2JUL A;  5CSN A;  4JQ0 D;  1PAL A;  2QEV A;  1QV1 A;  1CDM A;  2V53 A;  1DJH A;  1TRF A;  1GGZ A;  1Q80 A;  3IF7 A;  1LA0 A;  3LK1 A;  1SRA A;  1JUO A;  2JXC A;  1RFJ A;  1NSH A;  3HX4 A;  2MHH A;  4PHK A;  4AQJ A;  1RJV A;  2MJW B;  3N7H A;  4A4C A;  3BFH A;  1C7W A;  2L51 A;  3OHM B;  1IGV A;  2FOT A;  3R1V A;  1GGW A;  5HL1 A;  4M2O A;  2L2C A;  4F7F A;  1S1E A;  1YUS A;  4JKT A;  1B1G A;  1JSA A;  1T14 A;  5AER A;  1TUZ A;  1KK8 C;  1HQV A;  3WXA A;  1QX5 B;  4DRW A;  2GV5 A;  2M7L A;  1F4O A;  2L5X B;  1TNP A;  1LIN A;  2E30 A;  1DF0 B;  2IS9 A;  1Y1X A;  3SG7 A;  1WLZ A;  3VB1 A;  2SAS A;  3C1V A;  1DEL A;  1ALV A;  1W7J B;  3O4Y A;  5I2L A;  3GK1 A;  3TS5 C;  1KFU L;  2CCM A;  5HKZ A;  1J7Q A;  4IL1 A;  3SS5 A;  3TUY C;  1YX8 A;  2K0J A;  1JFK A;  2PQL A;  2WCE A;  1Y1A A;  2ZND A;  3NGV A;  4N1F A;  1XO5 A;  1WRL A;  1PSB A;  3D0Y A;  2WOR A;  1ALW A;  4GNK B;  1KCY A;  1CDL A;  2K7B A;  2M97 A;  1IKU A;  1Z4H A;  1K96 A;  1WRZ A;  5KTY A;  1QAT A;  2LAN A;  1K94 A;  2ZNE A;  4XJK B;  2JZI A;  1TNX A;  1M39 A;  3DZT A;  3R1P A;  3LL8 B;  3SIB A;  2F3Y A;  3M0W A;  2LP3 A;  3DVJ A;  1XFW O;  1EG4 A;  1SL7 A;  2LV7 A;  2L50 A;  1NIW A;  3OBV A;  4WQ2 A;  2M49 B;  3SG2 A;  3TDI A;  2JNF A; 
#chains in the Genus database with same CATH homology
 2JT0 A;  1NCX A;  1H8B A;  4ICB A;  1G8I A;  1KFU S;  4GBA A;  1IWQ A;  4I5K A;  1K9K A;  1JFJ A;  1MHO A;  4ZCU A;  1B4C A;  3FWC A;  1F8H A;  3GOF A;  1LKJ A;  2Y1M A;  1S5G Z;  1F55 A;  1AVS A;  2LMU A;  3FWB A;  5DKN A;  1OQP A;  1YRU B;  1M31 A;  1M63 B;  4DS7 A;  4GGN A;  5J3X A;  1OMR A;  1SR6 B;  2WCF A;  1K90 D;  1CTR A;  4FTG A;  2M7N A;  4I5N B;  2FCE A;  1EH2 A;  3DD4 A;  1G4Y R;  5CSF A;  4GGF C;  3D0Y B;  4HRH A;  3NSL A;  4JPZ B;  3KHE A;  2JWW A;  2OPO A;  2JRF A;  4NDD A;  3ZNI A;  2JPT A;  1D1O A;  2L4I A;  1XFV O;  4XJK A;  2BCX A;  3DVM A;  3OB2 B;  3NSI A;  4GAO A;  2OS8 C;  1XK4 C;  5HLV A;  1WY9 A;  1RWY A;  1FI5 A;  1A2X A;  3SG6 A;  1Y6W A;  2WCB A;  2F2O A;  3WNX B;  1UHJ A;  2KGB C;  1NX2 A;  2LLS A;  3A8R A;  3JVT C;  4M2Q A;  4ORC B;  5AEQ A;  1JF2 A;  1DGV A;  4QJ5 B;  3RLZ A;  2KBI A;  1KK8 B;  1RK9 A;  1NCY A;  4XYN A;  1ZOT B;  2LHL A;  2CT9 A;  4ZCV A;  1IG5 A;  4MBE A;  5I2Q A;  3SG5 A;  5PAL A;  3EK7 A;  1KWO C;  4N1G A;  4OVN F;  3DF0 A;  1WDC C;  3GK4 X;  5ER5 A;  2Y1N A;  5HYD A;  3GK2 A;  2LVK A;  3I5I B;  2K7O A;  1L2O B;  1L7Z A;  2AAO A;  4BY5 A;  2I94 A;  4C0J A;  2OTG B;  5G08 A;  2KI4 C;  2LMT A;  1CKK A;  4QJ4 B;  3O2P A;  4M2P A;  4OCI A;  3BXK A;  2E6W A;  1X02 A;  2HQW A;  2F33 A;  2R2I A;  4MZL A;  1FI6 A;  1BF5 A;  1MUX A;  1SYM A;  3IQQ A;  4CLN A;  5JJG A;  1H4B A;  3FIA A;  1U5I B;  1YUU A;  1QVI Y;  1AP4 A;  2K7D A;  2ISD A;  2BKH B;  4ORA B;  1B8R A;  5HKW A;  1K8U A;  3F45 A;  1J7O A;  2LLT A;  5TNC A;  3CR4 X;  2HQ8 A;  2KI4 B;  5CSJ A;  1Y1U A;  3O6B A;  2GGM A;  3WHT B;  1QX2 A;  2F8P A;  1IJ6 A;  1SCV A;  3EKH A;  1XK4 A;  1SKT A;  1YUR A;  1IQ5 A;  1YTZ C;  3SJS A;  1N65 A;  2COL B;  1MF8 B;  2ZRT A;  1HT9 A;  3LCP C;  1IJ5 A;  2KYF A;  2ZKM X;  2KGR A;  3NXA A;  2DOQ A;  1R6P A;  3JVT B;  5AAN A;  3RM1 A;  1JBA A;  1IH0 A;  1DMO A;  3CTN A;  1XVJ A;  3PN7 B;  3EK8 A;  1F4Q A;  1UUR A;  2L4H A;  2KI6 C;  2NCO A;  3DVK A;  3SIA A;  2LVJ A;  3CR2 A;  4MEW A;  2GGZ A;  1KFX S;  2KNE A;  1BU3 A;  2L0P A;  2A4J A;  3VRO A;  4C0K A;  1CDP A;  2K8M B;  1SL8 A;  2JC2 A;  1L2O C;  1GQM A;  1TIZ A;  2QAC A;  1KSO A;  1ZFS A;  3BOW B;  1NCZ A;  2BE6 A;  1BT6 A;  1CMG A;  2EC6 C;  1CFD A;  1YRT B;  2MA2 A;  5AFP A;  4YGE B;  1NWD A;  4CFQ A;  3I5G C;  3CLN A;  2O5G A;  4YGB B;  1QLS A;  1BR4 B;  3KO0 A;  2H2K A;  4PAL A;  2LVI A;  1BR1 B;  3DVE A;  2BCB A;  1DT7 B;  1S6C A;  1QAS A;  2MLE C;  2LNK A;  4USL A;  4PE1 A;  3WHU B;  2KSP A;  1KQM B;  2ZRS A;  1YUT A;  3AKB A;  4ORB B;  3JTD B;  3KEV A;  4NDC A;  2ZN9 A;  4P2Y B;  2HET A;  1QXP A;  5ER4 X;  5HKY A;  2K2F A;  1YR5 A;  2M1U A;  2PSR A;  3EVV A;  2Y5I A;  2L2E A;  1ZAC A;  1EL4 A;  2LP2 A;  1S36 A;  1C07 A;  3CR5 X;  4OR9 B;  1M45 A;  3PAT A;  1BOC A;  3VGO A;  2VRG A;  4GFT A;  4AQI A;  2JQ6 A;  2ZN8 A;  3I5I C;  1OE9 B;  4N5X A;  3CZT X;  3BUW B;  2KAX A;  1S6I A;  4R1E A;  1UWO A;  1FBV A;  1SY9 A;  1MXL C;  1XFU O;  4PHM A;  2BL0 C;  4PHN A;  4HSZ A;  4PHJ A;  4YGA A;  1V1F A;  1OZO A;  1LA3 A;  1NPQ A;  1KK7 Z;  2NZ0 A;  4P5O E;  1CFF A;  4A4B A;  1PVA A;  2CBL A;  1ODB A;  1B47 A;  1QIW A;  1BMO A;  3EVR A;  2WND A;  1DTL A;  3BOW A;  3CGA A;  1B8L A;  2AUC A;  1TNQ A;  2HF5 A;  2MAZ A;  4MRY A;  2WC8 A;  5DKR A;  1CLB A;  1QTX A;  1GJY A;  4D1E A;  1B9A A;  2JOJ A;  1DF0 A;  1EXR A;  1PSR A;  5GQQ C;  2MLF C;  2PAL A;  4YBH B;  1YVL A;  1DVI A;  3AAK A;  2CXJ A;  2EC6 B;  5HLO A;  4FQO A;  3I5F C;  1QS7 A;  1J1D A;  1SCM C;  4MN0 A;  2I7A A;  5B8I B;  4YGD B;  1JC2 A;  2BE4 A;  2K2A A;  3TDU A;  3QRX A;  1DGU A;  4DUQ A;  2BBN A;  1AUI B;  3BUN B;  4UPG A;  2M0R A;  3IQO A;  5KSZ A;  2LM5 A;  1B8C A;  1J7R A;  4YRU A;  3OX6 A;  1DJI A;  1A4P A;  1SL9 A;  2LVV A;  4OKH A;  4YGC B;  4BY4 A;  2JXL A;  3I5H C;  2ZFD A;  1QV0 A;  2TN4 A;  1CM1 A;  1TTX A;  4OV2 A;  1BOD A;  1YVH A;  1OMD A;  1QVI Z;  4NDB A;  1SK6 D;  1FF1 A;  2M9G A;  3SG3 A;  2O60 A;  2H61 C;  2KFG A;  4MLW A;  2G9B A;  1KQV A;  1UUS A;  1UHK A;  1KFX L;  3PFV A;  2JNX A;  2G2B A;  2JT3 A;  2KOT A;  3MSE B;  4PCW A;  2I2R E;  4I5L B;  4QJ3 B;  4MSP A;  4DIR A;  1VRK A;  4WRI A;  1F54 A;  1DJZ A;  2PVB A;  3BUO B;  2CTN A;  2I18 A;  1PVB A;  1NX0 A;  4F0Z B;  3KF9 A;  2M1K B;  1SPY A;  1NUB A;  2BCA A;  2F3Z A;  2KAY A;  3NSK A;  2SCP A;  4C0L A;  1UHI A;  2OS8 B;  1LVC D;  2LLU A;  3VRQ A;  3TDZ A;  2LE9 B;  5AXI A;  2LC5 A;  5CSI A;  1XFZ O;  2KI6 D;  1XFY O;  5DKQ A;  2KFH A;  3EKJ A;  3PSR A;  3TUY B;  2BEC A;  2KBM A;  3BQ3 A;  2P6B B;  4MVF A;  2Q4U A;  2EHB A;  4GPL B;  3AKA A;  4Q04 A;  1K9U A;  3O78 A;  2LMV A;  1J7P A;  2BL0 B;  1OSA A;  3KPX A;  1B7T Z;  5BPJ A;  1NX1 A;  1JWD A;  1UP5 A;  1NP8 A;  2MRD A;  1BG1 A;  4CPV A;  2KYC A;  3K21 A;  1M46 A;  1CMF A;  1DJG A;  1UHH A;  4GUK A;  1NYA A;  1FW4 A;  1RTP 1;  2KFF A;  2LAP A;  2K7C A;  1K93 D;  1PUL A;  1SBJ A;  2K61 A;  1TN4 A;  1KQM C;  3BUX B;  3I5H B;  5IBW A;  3DF0 B;  1CNP A;  2D8N A;  3AAJ A;  4L9M A;  4MRX A;  1XFX O;  4E68 A;  3VRP A;  5K89 A;  2PRU A;  1DJX A;  3TS5 B;  5KU1 A;  1A03 A;  1C7V A;  2RGI A;  2KDH A;  1QJT A;  2H61 A;  1CM4 A;  2LUX A;  1XYD A;  1K2H A;  2HPS A;  2B1U A;  1AJ4 A;  4ETO A;  1EG3 A;  5JOL A;  1BJF A;  1W7I B;  3OX5 A;  1KK7 Y;  1KWO B;  1WLM A;  3BUM B;  4CID A;  1CLM A;  4MZJ A;  1MR8 A;  5D69 A;  2FCD A;  1S5G Y;  4PE4 A;  1CB1 A;  1FPW A;  4MZK A;  2FJU B;  1U5I A;  1CLL A;  1QLK A;  3D10 A;  1A29 A;  2BBM A;  3LK0 A;  1N2D A;  2LHI A;  1A75 B;  1IRJ A;  2KHN A;  4DCK A;  2EGD A;  1G33 A;  4U8D A;  1DJY A;  4NQG A;  1XA5 A;  1K95 A;  1NX3 A;  3EK4 A;  1J55 A;  3JTD C;  1F71 A;  3H4S E;  5CPV A;  2LUC A;  3FS7 A;  1ZUZ A;  1CDN A;  4AOM A;  4I5J A;  1TNW A;  3TZ1 A;  3PAL A;  1YX7 A;  2CNP A;  4HRE E;  2KAV A;  2NLN A;  5F6T A;  1SCM B;  3I5G B;  3A4U B;  1RRO A;  3EVU A;  1Y0V H;  2JTZ A;  1PRW A;  2Q91 A;  3I5F B;  1SR6 C;  2JU0 A;  4PDZ A;  1F70 A;  3BYA A;  1S6J A;  5I2O A;  3OB1 B;  3VRR A;  1PK0 D;  1LXF C;  1OZS A;  2NCP A;  2PAS A;  3NSO A;  1R2U A;  1MXE A;  1OOJ A;  1SNL A;  1AK8 A;  1E8A A;  2AMI A;  1CFC A;  1IQ3 A;  2M3W A;  2M8U A;  4TNC A;  3CWG A;  1S3P A;  4WQ3 A;  4HRG A;  4GGF A;  1J1E A;  2Y4Q A;  1REC A;  4PE0 A;  2F2P A;  2NXQ A;  1SW8 A;  1KSM A;  3ZWH A;  5I8N A;  3PN7 C;  1AJ5 A;  3OP0 A;  1TCF A;  2M29 A;  2KQY A;  5D7F A;  1TOP A;  2WOS A;  1S26 D;  3ICB A;  4JWQ A;  2PMY A;  1V1G A;  5FYX A;  1B7T Y;  2QPT A;  3HCM A;  2KQ6 A;  2OTG C;  1A75 A;  3CS1 A;  2L98 A;  1N0Y A;  2MBX A;  1DJW A;  2JT8 A;  1EJ3 A;  3LLE A;  2JTT A;  1QX7 A;  1JF0 A;  3E3R A;  1AHR A;  1WDC B;  4YI8 A;  4PE7 A;  1K9P A;  1OMV A;  1ZMZ A;  2BKI B;  1SMG A;  1CFP A;  1TCO B;  3PM8 A;  1WRK A;  1MQ1 A;  4YI9 A;  1MWN A;  2LCP A;  3PLF B;  4CFR A;  3VRN A;  1BLQ A;  1QIV A;  1UHN A;  2JUL A;  5CSN A;  4JQ0 D;  1PAL A;  1QV1 A;  1CDM A;  2V53 A;  1DJH A;  1TRF A;  1GGZ A;  1Q80 A;  3IF7 A;  1LA0 A;  3LK1 A;  1SRA A;  1JUO A;  2JXC A;  1RFJ A;  1NSH A;  3HX4 A;  2MHH A;  4PHK A;  4AQJ A;  1RJV A;  2MJW B;  4A4C A;  1C7W A;  2L51 A;  3OHM B;  1IGV A;  2FOT A;  1GGW A;  4M2O A;  1JSA A;  1S1E A;  1YUS A;  1B1G A;  5AER A;  1KK8 C;  1HQV A;  3WXA A;  1QX5 B;  4DRW A;  2GV5 A;  2M7L A;  1F4O A;  2L5X B;  1TNP A;  1LIN A;  2E30 A;  1DF0 B;  2IS9 A;  1Y1X A;  3SG7 A;  1WLZ A;  2SAS A;  3C1V A;  1ALV A;  1W7J B;  3O4Y A;  5I2L A;  3GK1 A;  3TS5 C;  1KFU L;  2CCM A;  5HKZ A;  1J7Q A;  4IL1 A;  3TUY C;  1YX8 A;  2K0J A;  1JFK A;  2ZND A;  2WCE A;  1Y1A A;  4N1F A;  1XO5 A;  1WRL A;  1PSB A;  3D0Y A;  2WOR A;  1ALW A;  4GNK B;  1KCY A;  1CDL A;  2K7B A;  2M97 A;  1IKU A;  1K96 A;  1WRZ A;  5KTY A;  1QAT A;  2LAN A;  1K94 A;  2ZNE A;  4XJK B;  2JZI A;  1TNX A;  1M39 A;  3LL8 B;  3SIB A;  2F3Y A;  3M0W A;  2LP3 A;  3DVJ A;  1XFW O;  1EG4 A;  1SL7 A;  2LV7 A;  2L50 A;  1NIW A;  4WQ2 A;  3SG4 A;  2M49 B;  3SG2 A;  3TDI A;  2JNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...