3A4UB

Crystal structure of mcfd2 in complex with carbohydrate recognition domain of ergic-53
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
65
Chain Sequence
EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein ERGIC-53
total genus 23
structure length 65
sequence length 78
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a4uB00
3D0YA 1S6IA 3VRNA 1A03A 3BUWB 1C7VA 1QJTA 5I2QA 2KAVA 2LP2A 1KQVA 5FYXA 3I5IB 1EG4A 3NSOA 3D10A 1F8HA 3NSLA 2LCPA 1SKTA 1NX1A 2CXJA 1WLZA 1Y1UA 1L7ZA 4ORCB 2M8UA 2EGDA 2JULA 3SIAA 1YUSA 4OKHA 1EL4A 1QASA 1B47A 1S1EA 3NXAA 1N65A 4R1EA 3I5FB 1QATA 1SBJA 2BL0B 1U5IA 2FJUB 1J1DA 2KI4B 3OB2B 5GQQC 1YVLA 5AFPA 2AUCA 2L50A 2LHIA 3DF0A 4QJ3B 4MEWA 4USLA 4XJKA 2MLFC 2ZRTA 4P2YB 4PHMA 3SG5A 3TDZA 2WCBA 2JT3A 3PM8A 2H2KA 4MZLA 4BY4A 4PHKA 1TNPA 1KK8B 1QLKA 1UHJA 3WXAA 1PULA 3DVMA 1XK4C 3EVVA 1XFYO 2JQ6A 4NDCA 5I2OA 2K61A 1QV1A 1KSOA 2MHHA 2SCPA 3JVTB 2LM5A 1TNXA 4JQ0D 4MSPA 1IKUA 1Y1AA 1M63B 2WORA 1K93D 2KI6C 2F33A 4CLNA 5ER4X 4CIDA 3PN7B 5HLOA 1WRZA 1A75A 2JWWA 2PASA 1QX2A 1UHHA 2F2PA 4PE1A 1KSMA 1BF5A 4M2PA 1KFUL 1SCMC 3EVRA 5DKQA 2NLNA 3EK7A 2HQ8A 2HQWA 2LUXA 1SL7A 1S6CA 2WCFA 1U5IB 3CTNA 3OX6A 2BKHB 1CFCA 1KCYA 2ZNEA 1S36A 1OMRA 2A4JA 1XFVO 3PFVA 3KF9A 2BCAA 1KQMB 1MXEA 2L5XB 1SL8A 1AJ4A 2LVJA 3KEVA 4PDZA 2JTZA 2L2EA 3OB1B 2JOJA 4TNCA 3I5HB 2HPSA 3FWBA 1Q80A 3SG3A 1H4BA 1NWDA 2M7LA 4CPVA 1OSAA 3O6BA 3VGOA 4GAOA 1JSAA 4Q04A 1X02A 2HETA 2LE9B 1PRWA 2Y1MA 2LMTA 2OTGB 1UUSA 1OQPA 3AAJA 2OPOA 3O78A 1TTXA 4MLWA 3H4SE 3TS5B 4HRHA 2CT9A 4C0KA 1H8BA 3JVTC 1MWNA 1WRKA 1NCYA 2LAPA 2K2AA 2MA2A 1DF0B 2M3WA 3F45A 4MN0A 1CDNA 3VRRA 1CDMA 2OS8B 2M7NA 3A8RA 2ISDA 3CZTX 1ZMZA 5JJGA 4ORBB 4PE7A 2LVIA 4MZJA 1F4OA 4CFQA 4OV2A 1TN4A 3SJSA 4C0LA 4QJ4B 5BPJA 1CNPA 1G33A 2Y5IA 2B1UA 3AKBA 1K9UA 3DVKA 1CTRA 3SG4A 3HCMA 2EHBA 1G4YR 1OZOA 1MR8A 2KQ6A 1QXPA 3D0YB 2JXLA 1BMOA 2EC6C 5G08A 2BCBA 3PSRA 3VROA 3ZNIA 1UWOA 3I5GB 3AKAA 4YGCB 2LHLA 4NDBA 1B7TZ 1OMVA 4PHNA 1AP4A 2ZRSA 3LLEA 4GGFA 3I5FC 1OZSA 2HF5A 3FIAA 1RK9A 1K94A 1AHRA 1IWQA 1V1GA 3DD4A 1DJGA 1WRLA 1CKKA 1JF0A 2F8PA 1ODBA 2BKIB 5DKNA 1UP5A 2KDHA 1BR1B 4YBHB 2L4HA 3IQQA 1J7OA 1GGZA 2AMIA 4GBAA 3LK1A 1BODA 1G8IA 1M31A 2KSPA 2LLTA 3ICBA 1DJYA 1SPYA 2BL0C 1SL9A 2MJWB 2MLEC 2NCPA 3JTDB 4XYNA 1CLMA 1K9KA 1QIWA 1UHIA 2LMVA 4FQOA 4C0JA 3VRQA 2TN4A 2ZFDA 3FWCA 5PALA 2K7OA 2JNXA 1CFFA 5AEQA 4OVNF 2DOQA 2R2IA 2P6BB 1QX7A 1XK4A 4YI9A 1B8LA 3RM1A 2I7AA 3IF7A 4YGAA 4ICBA 4PALA 2KI6D 3TZ1A 3TUYC 1K8UA 2VRGA 1YR5A 1YX8A 1KK8C 3DF0B 2KNEA 5TNCA 1JFKA 4D1EA 5K89A 1SW8A 2JRFA 2KAYA 2H61C 3FS7A 2GGZA 2BBNA 2IS9A 2F3YA 3QRXA 2GV5A 3CS1A 3EVUA 1Y6WA 4PCWA 1KFXS 2KBMA 4FTGA 1RFJA 2BECA 1S5GY 1AJ5A 1BU3A 1TCOB 3BUNB 4JWQA 4MVFA 4MBEA 5KSZA 4E68A 1DTLA 2LLUA 1DJXA 2QPTA 1CDLA 2KI4C 3CR5X 3OX5A 5F6TA 1EG3A 3KO0A 1Y1XA 2G2BA 4ORAB 4A4CA 2K0JA 1JC2A 2WOSA 4GFTA 1TOPA 3DVJA 4F0ZB 2KHNA 1BT6A 3CGAA 5JOLA 3MSEB 3TS5C 1UURA 2KFHA 2I94A 1L2OC 1C07A 3EKHA 1LVCD 4N1FA 4A4BA 2M9GA 4GPLB 2FOTA 5D7FA 1HQVA 1K96A 1DJZA 1SY9A 4MRYA 2D8NA 2ZNDA 1JWDA 1JFJA 1R2UA 2JTTA 1RROA 3GK1A 2COLB 3TDUA 1AK8A 2LMUA 1CDPA 1B9AA 1SR6B 3BOWB 2JZIA 1ZUZA 1TNWA 1NUBA 1EH2A 2ZN9A 3KPXA 2LUCA 4DCKA 2KFGA 1QVIY 1NX0A 5CSIA 4I5KA 2K2FA 2L51A 1ZFSA 4WRIA 1DJIA 1KK7Z 3GK2A 4N5XA 1PSBA 4DRWA 1PVAA 1LKJA 2PRUA 3OHMB 2F2OA 2LVVA 2KQYA 3WHTB 1IQ3A 2EC6B 1CMGA 1WDCB 4XJKB 1F4QA 1C7WA 4UPGA 2Q91A 2Q4UA 3AAKA 5AANA 1Y0VH 5CSJA 4AOMA 3K21A 2QACA 5AERA 1A4PA 2V53A 1BG1A 1DVIA 1SRAA 2BBMA 1L2OB 4HREE 1A75B 5D69A 3HX4A 3O4YA 1YVHA 1DMOA 1KK7Y 4GNKB 3BUXB 1J7QA 1WY9A 4OR9B 4MRXA 2E30A 3E3RA 1M46A 2KBIA 1OOJA 1FF1A 4ZCUA 2MRDA 4NDDA 1DT7B 1PVBA 4CFRA 2WNDA 1LA3A 1QS7A 3PN7C 5J3XA 1W7IB 3SG7A 1MHOA 1NYAA 1FW4A 1IG5A 1CLLA 3GOFA 1BR4B 2MBXA 1SYMA 2LANA 1CM1A 1F70A 1V1FA 2I18A 1J7RA 1N0YA 2PSRA 3KHEA 4M2OA 4WQ3A 1XYDA 2F3ZA 1J1EA 1LXFC 1J7PA 2L98A 4I5NB 4ETOA 1B8RA 5AXIA 1YRTB 4AQIA 1F54A 1TIZA 2I2RE 1SCVA 2O5GA 4WQ2A 1K9PA 2KOTA 1CM4A 1M39A 1XA5A 3EKJA 1IRJA 1CFPA 1SK6D 4I5LB 4QJ5B 3LK0A 4PHJA 3O2PA 1CFDA 1EJ3A 1E8AA 2O60A 4I5JA 1SCMB 1DJWA 1YURA 2BCXA 1FI6A 3IQOA 4YGDB 2WCEA 1FPWA 5CPVA 1B8CA 1DF0A 1M45A 1VRKA 1XFWO 3EK8A 2K7DA 3PLFB 4YRUA 1W7JB 4P5OE 2KFFA 1A2XA 2KYFA 2LP3A 2L4IA 4OCIA 1KQMC 2K7CA 4ZCVA 2LLSA 1GQMA 1IJ5A 2AAOA 3I5HC 2FCEA 2JNFA 2M97A 2M1KB 4GGFC 2BE6A 5HLVA 5HKYA 1ZOTB 1NPQA 2KGRA 5CSFA 3SIBA 1B1GA 1UHKA 4U8DA 2PVBA 2ZN8A 2OTGC 3TDIA 1TCFA 2LNKA 1MQ1A 2M49B 1IQ5A 2WC8A 4AQJA 1K95A 5HKZA 4DUQA 1RECA 1IH0A 3EK4A 1XFZO 1NCZA 1QLSA 1QTXA 2H61A 2PALA 1ALVA 2CNPA 3CWGA 3LL8B 1XVJA 1DGVA 2KYCA 5B8IB 1SR6C 1QV0A 1S6JA 1QVIZ 2NZ0A 1TNQA 2JU0A 2CBLA 3NSIA 1FBVA 3RLZA 3PATA 5KU1A 1TRFA 1PALA 4L9MA 1BOCA 1FI5A 1YUUA 1CMFA 2Y4QA 1ALWA 1LINA 1IGVA 1KWOC 2JC2A 2NCOA 1CLBA 1NSHA 1JF2A 2Y1NA 1K2HA 1S26D 3I5IC 3WNXB 1PK0D 1HT9A 4YGEB 3OP0A 2JT8A 1QX5B 5IBWA 1DGUA 1LA0A 2M29A 4YI8A 1JBAA 2JPTA 2K8MB 2RGIA 5HYDA 2GGMA 1OMDA 5KTYA 1N2DA 1NIWA 1ZACA 5ER5A 1A29A 4HRGA 1NX3A 1QIVA 4PE0A 2CCMA 1RTP1 1BLQA 3BXKA 1MUXA 1F71A 2LC5A 1SNLA 2JXCA 1GJYA 4NQGA 1XFXO 1NCXA 1EXRA 4IL1A 1YRUB 1B4CA 1WLMA 5HKWA 1YX7A 1GGWA 1DJHA 1S3PA 2K7BA 2CTNA 2M0RA 2ZKMX 1AVSA 3I5GC 2NXQA 4GUKA 5DKRA 2SASA 4N1GA 3BQ3A 1BJFA 1PSRA 2BE4A 3BUOB 4YGBB 4DS7A 2KGBC 5I2LA 1IJ6A 5CSNA 3C1VA 3SG6A 3VRPA 5I8NA 2FCDA 3BYAA 3CLNA 1KWOB 1MXLC 1WDCC 4GGNA 1MF8B 3BUMB 4MZKA 1RWYA 2LVKA 1YUTA 3M0WA 2L0PA 3NSKA 1UHNA 1K90D 1NP8A 4BY5A 1JUOA 1XO5A 3BOWA 2M1UA 1R6PA 2OS8C 4HSZA 4M2QA 1SMGA 3SG2A 2LV7A 2E6WA 2KAXA 1OE9B 3CR2A 3JTDC 1NX2A 3ZWHA 3WHUB 2JT0A 2PMYA 3TUYB 3CR4X 1KFUS 1F55A 3DVEA 1S5GZ 1RJVA 3A4UB 1YTZC 1B7TY 3GK4X 4JPZB 1XFUO 4PE4A 1AUIB 1D1OA 4DIRA 1CB1A 2MAZA 3PALA 1J55A 1KFXL 2G9BA 3LCPC
chains in the Genus database with same CATH superfamily
2WCHA 3Q8IA 3D0YA 2WCJA 1S6IA 3VRNA 1A03A 3BUWB 1C7VA 1QJTA 5I2QA 2KAVA 2LP2A 1KQVA 3K1EA 5FYXA 3I5IB 1EG4A 3NSOA 3D10A 1F8HA 3NSLA 2LCPA 1SKTA 1NX1A 2CXJA 3S0FA 1WLZA 1Y1UA 1L7ZA 4ORCB 2M8UA 2EGDA 2JULA 3SIAA 1YUSA 4OKHA 1EL4A 1T14A 4F7FA 1QASA 4KYNA 1B47A 1S1EA 3NXAA 1N65A 4R1EA 3I5FB 1QATA 1SBJA 2BL0B 1U5IA 2FJUB 1J1DA 2KI4B 3OB2B 3B6XA 5GQQC 1YVLA 5AFPA 2AUCA 2L50A 2LHIA 3DF0A 4QJ3B 4MEWA 4USLA 4XJKA 2MLFC 2ZRTA 4P2YB 4PHMA 3SG5A 3TDZA 2WCBA 2GTEA 2JT3A 3PM8A 2H2KA 4MZLA 4BY4A 4PHKA 1TNPA 1KK8B 1QLKA 1UHJA 3WXAA 1PULA 3DVMA 1XK4C 3EVVA 1XFYO 2KPHA 2JQ6A 4NDCA 5I2OA 2K61A 1QV1A 1KSOA 2MHHA 2SCPA 3JVTB 2LM5A 1TNXA 3CDNA 4JQ0D 4MSPA 1IKUA 1Y1AA 1M63B 2WORA 1K93D 2KI6C 2F33A 3SS5A 4CLNA 5ER4X 4CIDA 3PN7B 5HLOA 1WRZA 1A75A 2JWWA 2PASA 1QX2A 1UHHA 2WCLA 2F2PA 2K60A 3CZ1A 4PE1A 1KSMA 3D73A 1BF5A 4M2PA 1KFUL 1SCMC 3EVRA 5DKQA 2NLNA 3EK7A 2HQ8A 2HQWA 2LUXA 2BAPA 1SL7A 1S6CA 3S0AA 3OGNA 2WCFA 1U5IB 3CTNA 2PQLA 3OX6A 2BKHB 1CFCA 1KCYA 2ZNEA 1S36A 1OMRA 2A4JA 1XFVO 3PFVA 3KF9A 2BCAA 1DELA 1KQMB 1MXEA 2L5XB 1SL8A 1AJ4A 2LVJA 2WCMA 1OOGA 3KEVA 4PDZA 2JTZA 2L2EA 3OB1B 2JOJA 4TNCA 3I5HB 2HPSA 3B86A 3FWBA 1Q80A 3SG3A 1H4BA 3SS4A 1NWDA 3DY9A 2M7LA 4CPVA 1OSAA 3O6BA 3VGOA 4GAOA 1JSAA 3BFBA 4Q04A 1X02A 2HETA 2LE9B 1PRWA 2Y1MA 2LMTA 2OTGB 1UUSA 1OQPA 3AAJA 2OPOA 3O78A 1TTXA 4MLWA 3H4SE 3TS5B 3B7AA 4HRHA 2CT9A 4C0KA 1H8BA 3JVTC 1MWNA 1WRKA 1NCYA 2LAPA 2K2AA 2MA2A 1DF0B 2M3WA 3F45A 4MN0A 1CDNA 3D74A 3VRRA 1CDMA 2OS8B 2M7NA 3A8RA 2ISDA 3CZTX 1ZMZA 5JJGA 4ORBB 4PE7A 2LVIA 4MZJA 1F4OA 4CFQA 4OV2A 1TN4A 3D78A 3SJSA 4C0LA 4QJ4B 5BPJA 1CNPA 1G33A 2Y5IA 2B1UA 3AKBA 1K9UA 3DVKA 1CTRA 3SG4A 1C3YA 3HCMA 2EHBA 1G4YR 1OZOA 1MR8A 3CZ2A 2KQ6A 1QXPA 3D0YB 2JXLA 1BMOA 1ORGA 2EC6C 5G08A 2BCBA 3PSRA 3R1OA 3VROA 1UWOA 3ZNIA 3I5GB 3AKAA 4YGCB 2LHLA 4NDBA 1B7TZ 1OMVA 4PHNA 1AP4A 2ZRSA 3LLEA 4GGFA 3I5FC 1OZSA 2HF5A 5FI7A 3FIAA 1RK9A 1K94A 1AHRA 1IWQA 3D75A 1V1GA 3DD4A 1DJGA 1WRLA 1CKKA 2QDIA 1JF0A 2F8PA 1ODBA 2BKIB 5DKNA 1UP5A 2KDHA 1BR1B 4YBHB 2L4HA 3IQQA 1J7OA 1GGZA 2AMIA 4GBAA 3LK1A 3IVTA 1BODA 1G8IA 3CZ0A 1M31A 2KSPA 2LLTA 3ICBA 1DJYA 1SPYA 2BL0C 1SL9A 2MJWB 2MLEC 2NCPA 3JTDB 4XYNA 1CLMA 1K9KA 1QIWA 1UHIA 2LMVA 4FQOA 2QEVA 3VRQA 2TN4A 2ZFDA 3FWCA 5PALA 2K7OA 2JNXA 1CFFA 5AEQA 4OVNF 2DOQA 2R2IA 2P6BB 1QX7A 1XK4A 4YI9A 1B8LA 3RM1A 2I7AA 3IF7A 4YGAA 4ICBA 4PALA 2KI6D 3TZ1A 3TUYC 1K8UA 2VRGA 1YR5A 1YX8A 1KK8C 3DF0B 2KNEA 5TNCA 1JFKA 4D1EA 5K89A 2PYQA 1SW8A 2JRFA 2KAYA 2H61C 3FS7A 2GGZA 1C3ZA 1DEKA 2BBNA 2IS9A 2F3YA 3QRXA 2GV5A 3CS1A 3EVUA 1Y6WA 3V2LA 4PCWA 1KFXS 2KBMA 2WCKA 3FE6A 4FTGA 1RFJA 3B87A 2BECA 1S5GY 1AJ5A 1BU3A 1TCOB 3BUNB 2P71A 4JWQA 4MBEA 4MVFA 5KSZA 4E68A 1DTLA 2LLUA 2FJYA 1DJXA 2QPTA 1CDLA 2KI4C 3CR5X 3OX5A 5F6TA 3S0DA 1EG3A 3KO0A 3N7HA 1Y1XA 2G2BA 4ORAB 4A4CA 2K0JA 1JC2A 2WOSA 4GFTA 1TOPA 3DVJA 4F0ZB 2KHNA 1BT6A 3CGAA 5JOLA 3MSEB 3TS5C 1UURA 2KFHA 3R1PA 2I94A 1L2OC 1C07A 3EKHA 1SSEB 4FQTA 1LVCD 4N1FA 4A4BA 3NHIA 2M9GA 4GPLB 2FOTA 4OZDA 5D7FA 1HQVA 1K96A 3R1VA 1DJZA 1SY9A 4MRYA 2D8NA 2ZNDA 1JWDA 1JFJA 1R2UA 2JTTA 1RROA 3GK1A 2COLB 3S0GA 3TDUA 1Z2CB 2LMUA 1AK8A 5FI6A 1CDPA 1B9AA 1SR6B 3BOWB 3UO9A 2JZIA 1ZUZA 1TNWA 1NUBA 2L5YA 2ZN9A 3KPXA 1EH2A 2LUCA 2H8VA 4DCKA 2KFGA 1QVIY 3BFAA 1NX0A 5CSIA 4I5KA 1Z4HA 2K2FA 2L51A 3PM2A 1ZFSA 4WRIA 1DJIA 1KK7Z 3GK2A 2KLDA 1PSBA 4N5XA 4DRWA 1PVAA 1LKJA 2PRUA 3OHMB 2F2OA 3L47A 2LVVA 2KQYA 3WHTB 1IQ3A 2EC6B 1CMGA 1WDCB 4XJKB 1F4QA 3FE9A 1C7WA 4UPGA 2Q91A 3DYEA 2Q4UA 3AAKA 3EG5B 5AANA 1Y0VH 5CSJA 4AOMA 3K21A 2QACA 5AERA 5I94A 1A4PA 2V53A 1BG1A 1DVIA 1SRAA 2BBMA 1L2OB 4HREE 1A75B 5D69A 3HX4A 3O4YA 1YVHA 1DMOA 1KK7Y 3L4LA 4GNKB 3BUXB 1J7QA 1WY9A 4OR9B 4MRXA 2E30A 3E3RA 1M46A 2KBIA 1OOJA 1FF1A 4PT1A 4ZCUA 2MRDA 4NDDA 1DT7B 1PVBA 4CFRA 2WNDA 1LA3A 1QS7A 3PN7C 5J3XA 1W7IB 5D3OA 1MHOA 1NYAA 3SG7A 2KLEA 4C0JA 1FW4A 1IG5A 1CLLA 3GOFA 1BR4B 2MBXA 1OW4A 1SYMA 2LANA 1CM1A 1F70A 1OOFA 1V1FA 2I18A 1J7RA 1N0YA 2PSRA 3KHEA 4M2OA 4WQ3A 1XYDA 2F3ZA 1J1EA 1LXFC 1J7PA 2L98A 2WC6A 4I5NB 4ETOA 1B8RA 5AXIA 1YRTB 4AQIA 2QEOA 1F54A 1TIZA 3BJHA 2I2RE 1SCVA 2O5GA 4WQ2A 1K9PA 2KOTA 5DICA 1CM4A 1M39A 1XA5A 3EKJA 1IRJA 1P28A 1CFPA 1SK6D 4I5LB 4QJ5B 3LK0A 4PHJA 3O2PA 1CFDA 1EJ3A 1E8AA 2O60A 1OOIX 1SCMB 4I5JA 1DJWA 1YURA 2BCXA 1FI6A 3IQOA 4YGDB 2WCEA 1FPWA 5CPVA 1B8CA 1DF0A 1M45A 1VRKA 1XFWO 3EK8A 3D76A 3R72A 2K7DA 3PJIA 3PLFB 4YRUA 1W7JB 4P5OE 2KFFA 1A2XA 2KYFA 2LP3A 2L4IA 5EL2A 3NGVA 4OCIA 1KQMC 2K7CA 2JPOA 4ZCVA 2LLSA 1GQMA 1IJ5A 2AAOA 3I5HC 3DZTA 2FCEA 2JNFA 2M97A 2M1KB 4GGFC 2BE6A 5HLVA 5HKYA 1ZOTB 1NPQA 2KGRA 2P70A 5CSFA 3SIBA 1B1GA 1UHKA 4U8DA 2PVBA 2ZN8A 2OTGC 3FE8A 3TDIA 1TCFA 2BNXA 2LNKA 1MQ1A 2M49B 1IQ5A 2WC8A 4AQJA 1K95A 5HKZA 4DUQA 1RECA 1IH0A 4JKTA 3EK4A 1XFZO 1NCZA 3OBVA 2QEHA 1QLSA 1QTXA 2H61A 2PALA 1ALVA 2CNPA 3CWGA 3LL8B 1XVJA 1DGVA 2KYCA 5B8IB 1SR6C 1QV0A 1S6JA 1QVIZ 2NZ0A 1TNQA 2JU0A 3S0BA 2CBLA 3NSIA 1FBVA 3RLZA 3PATA 5KU1A 1TRFA 1PALA 4L9MA 3CABA 1BOCA 1FI5A 1YUUA 1CMFA 2Y4QA 1ALWA 1DQEA 4IJ7A 1LINA 1IGVA 1KWOC 2JC2A 2NCOA 1CLBA 1TUJA 2YGUA 1NSHA 1JF2A 2Y1NA 1K2HA 1S26D 3I5IC 3WNXB 4JD9A 1PK0D 1HT9A 4YGEB 3OP0A 2JT8A 3B88A 1QX5B 4INWA 2WC5A 3QMEA 5IBWA 1DGUA 1LA0A 2M29A 3O4XA 4YI8A 1JBAA 1TWOA 1TUZA 3VB1A 2JPTA 2K8MB 2RGIA 5HYDA 2GGMA 1OMDA 5KTYA 3CYZA 1N2DA 1GM0A 1NIWA 1XFRA 1ZACA 5HL1A 1W9ZA 1A29A 5ER5A 4HRGA 1NX3A 3RZSA 1QIVA 4PE0A 2CCMA 1RTP1 1BLQA 3BXKA 1MUXA 1F71A 2LC5A 1SNLA 2JXCA 1GJYA 4NQGA 2L2CA 1XFXO 1NCXA 1EXRA 3BFHA 4IL1A 1YRUB 1B4CA 1WLMA 5HKWA 1YX7A 1GGWA 1DJHA 1S3PA 2K7BA 2CTNA 3UNWA 2M0RA 2ZKMX 3L4AA 1AVSA 3I5GC 4INXA 3NHTA 2NXQA 1QWVA 4GUKA 5DKRA 2SASA 4N1GA 3BQ3A 1BJFA 1PSRA 2BE4A 3BUOB 2QEBA 4YGBB 4DS7A 2KGBC 5I2LA 1IJ6A 2ERBA 1LS8A 3SS3A 5CSNA 3C1VA 3SG6A 3VRPA 5I8NA 2FCDA 3BYAA 3CLNA 1KWOB 1MXLC 1WDCC 4GGNA 1MF8B 3BUMB 4MZKA 1RWYA 3D77A 2LVKA 1YUTA 3M0WA 2L0PA 3NSKA 1IIOA 1UHNA 1K90D 1NP8A 4BY5A 1JUOA 1XO5A 3BOWA 5FI2A 2M1UA 1R6PA 2OS8C 4HSZA 4M2QA 1SMGA 3SG2A 2LV7A 2E6WA 2KAXA 1OE9B 3CR2A 3JTDC 1NX2A 3ZWHA 3DXLA 3WHUB 2JT0A 2PMYA 3TUYB 3CR4X 1KFUS 1F55A 1OOHA 3DVEA 1S5GZ 1RJVA 3A4UB 1YTZC 1B7TY 3GK4X 4JPZB 1XFUO 4PE4A 1AUIB 1D1OA 4DIRA 1CB1A 2MAZA 3PALA 1J55A 1KFXL 3S0EA 2G9BA 3LCPC 1DC1A
chains in the Genus database with same CATH topology
3D0YA 1S6IA 3VRNA 1A03A 3BUWB 1C7VA 1QJTA 5I2QA 2KAVA 2LP2A 1KQVA 5FYXA 3I5IB 1EG4A 3NSOA 3D10A 1F8HA 3NSLA 2LCPA 1SKTA 1NX1A 2CXJA 1WLZA 1Y1UA 1L7ZA 4ORCB 2M8UA 2EGDA 2JULA 3SIAA 1YUSA 4OKHA 1EL4A 1QASA 1B47A 1S1EA 3NXAA 1N65A 4R1EA 3I5FB 1QATA 1SBJA 2BL0B 1U5IA 2FJUB 1J1DA 2KI4B 3OB2B 5GQQC 1YVLA 5AFPA 2AUCA 2L50A 2LHIA 3DF0A 4QJ3B 4MEWA 4USLA 4XJKA 2MLFC 2ZRTA 4P2YB 4PHMA 3SG5A 3TDZA 2WCBA 2JT3A 3PM8A 2H2KA 4MZLA 4BY4A 4PHKA 1TNPA 1KK8B 1QLKA 1UHJA 3WXAA 1PULA 3DVMA 1XK4C 3EVVA 1XFYO 2JQ6A 4NDCA 5I2OA 2K61A 1QV1A 1KSOA 2MHHA 2SCPA 3JVTB 2LM5A 1TNXA 4JQ0D 4MSPA 1IKUA 1Y1AA 1M63B 2WORA 1K93D 2KI6C 2F33A 4CLNA 5ER4X 4CIDA 3PN7B 5HLOA 1WRZA 1A75A 2JWWA 2PASA 1QX2A 1UHHA 2F2PA 4PE1A 1KSMA 1BF5A 4M2PA 1KFUL 1SCMC 3EVRA 5DKQA 2NLNA 3EK7A 2HQ8A 2HQWA 2LUXA 1SL7A 1S6CA 2WCFA 1U5IB 3CTNA 3OX6A 2BKHB 1CFCA 1KCYA 2ZNEA 1S36A 1OMRA 2A4JA 1XFVO 3PFVA 3KF9A 2BCAA 1KQMB 1MXEA 2L5XB 1SL8A 1AJ4A 2LVJA 3KEVA 4PDZA 2JTZA 2L2EA 3OB1B 2JOJA 4TNCA 3I5HB 2HPSA 3FWBA 1Q80A 3SG3A 1H4BA 1NWDA 2M7LA 4CPVA 1OSAA 3O6BA 3VGOA 4GAOA 1JSAA 4Q04A 1X02A 2HETA 2LE9B 1PRWA 2Y1MA 2LMTA 2OTGB 1UUSA 1OQPA 3AAJA 2OPOA 3O78A 1TTXA 4MLWA 3H4SE 3TS5B 4HRHA 2CT9A 4C0KA 1H8BA 3JVTC 1MWNA 1WRKA 1NCYA 2LAPA 2K2AA 2MA2A 1DF0B 2M3WA 3F45A 4MN0A 1CDNA 3VRRA 1CDMA 2OS8B 2M7NA 3A8RA 2ISDA 3CZTX 1ZMZA 5JJGA 4ORBB 4PE7A 2LVIA 4MZJA 1F4OA 4CFQA 4OV2A 1TN4A 3SJSA 4C0LA 4QJ4B 5BPJA 1CNPA 1G33A 2Y5IA 2B1UA 3AKBA 1K9UA 3DVKA 1CTRA 3SG4A 3HCMA 2EHBA 1G4YR 1OZOA 1MR8A 2KQ6A 1QXPA 3D0YB 2JXLA 1BMOA 2EC6C 5G08A 2BCBA 3PSRA 3VROA 3ZNIA 1UWOA 3I5GB 3AKAA 4YGCB 2LHLA 4NDBA 1B7TZ 1OMVA 4PHNA 1AP4A 2ZRSA 3LLEA 4GGFA 3I5FC 1OZSA 2HF5A 3FIAA 1RK9A 1K94A 1AHRA 1IWQA 1V1GA 3DD4A 1DJGA 1WRLA 1CKKA 1JF0A 2F8PA 1ODBA 2BKIB 5DKNA 1UP5A 2KDHA 1BR1B 4YBHB 2L4HA 3IQQA 1J7OA 1GGZA 2AMIA 4GBAA 3LK1A 1BODA 1G8IA 1M31A 2KSPA 2LLTA 3ICBA 1DJYA 1SPYA 2BL0C 1SL9A 2MJWB 2MLEC 2NCPA 3JTDB 4XYNA 1CLMA 1K9KA 1QIWA 1UHIA 2LMVA 4FQOA 4C0JA 3VRQA 2TN4A 2ZFDA 3FWCA 5PALA 2K7OA 2JNXA 1CFFA 5AEQA 4OVNF 2DOQA 2R2IA 2P6BB 1QX7A 1XK4A 4YI9A 1B8LA 3RM1A 2I7AA 3IF7A 4YGAA 4ICBA 4PALA 2KI6D 3TZ1A 3TUYC 1K8UA 2VRGA 1YR5A 1YX8A 1KK8C 3DF0B 2KNEA 5TNCA 1JFKA 4D1EA 5K89A 1SW8A 2JRFA 2KAYA 2H61C 3FS7A 2GGZA 2BBNA 2IS9A 2F3YA 3QRXA 2GV5A 3CS1A 3EVUA 1Y6WA 4PCWA 1KFXS 2KBMA 4FTGA 1RFJA 2BECA 1S5GY 1AJ5A 1BU3A 1TCOB 3BUNB 4JWQA 4MVFA 4MBEA 5KSZA 4E68A 1DTLA 2LLUA 1DJXA 2QPTA 1CDLA 2KI4C 3CR5X 3OX5A 5F6TA 1EG3A 3KO0A 1Y1XA 2G2BA 4ORAB 4A4CA 2K0JA 1JC2A 2WOSA 4GFTA 1TOPA 3DVJA 4F0ZB 2KHNA 1BT6A 3CGAA 5JOLA 3MSEB 3TS5C 1UURA 2KFHA 2I94A 1L2OC 1C07A 3EKHA 1LVCD 4N1FA 4A4BA 2M9GA 4GPLB 2FOTA 5D7FA 1HQVA 1K96A 1DJZA 1SY9A 4MRYA 2D8NA 2ZNDA 1JWDA 1JFJA 1R2UA 2JTTA 1RROA 3GK1A 2COLB 3TDUA 1AK8A 2LMUA 1CDPA 1B9AA 1SR6B 3BOWB 2JZIA 1ZUZA 1TNWA 1NUBA 1EH2A 2ZN9A 3KPXA 2LUCA 4DCKA 2KFGA 1QVIY 1NX0A 5CSIA 4I5KA 2K2FA 2L51A 1ZFSA 4WRIA 1DJIA 1KK7Z 3GK2A 4N5XA 1PSBA 4DRWA 1PVAA 1LKJA 2PRUA 3OHMB 2F2OA 2LVVA 2KQYA 3WHTB 1IQ3A 2EC6B 1CMGA 1WDCB 4XJKB 1F4QA 1C7WA 4UPGA 2Q91A 2Q4UA 3AAKA 5AANA 1Y0VH 5CSJA 4AOMA 3K21A 2QACA 5AERA 1A4PA 2V53A 1BG1A 1DVIA 1SRAA 2BBMA 1L2OB 4HREE 1A75B 5D69A 3HX4A 3O4YA 1YVHA 1DMOA 1KK7Y 4GNKB 3BUXB 1J7QA 1WY9A 4OR9B 4MRXA 2E30A 3E3RA 1M46A 2KBIA 1OOJA 1FF1A 4ZCUA 2MRDA 4NDDA 1DT7B 1PVBA 4CFRA 2WNDA 1LA3A 1QS7A 3PN7C 5J3XA 1W7IB 3SG7A 1MHOA 1NYAA 1FW4A 1IG5A 1CLLA 3GOFA 1BR4B 2MBXA 1SYMA 2LANA 1CM1A 1F70A 1V1FA 2I18A 1J7RA 1N0YA 2PSRA 3KHEA 4M2OA 4WQ3A 1XYDA 2F3ZA 1J1EA 1LXFC 1J7PA 2L98A 4I5NB 4ETOA 1B8RA 5AXIA 1YRTB 4AQIA 1F54A 1TIZA 2I2RE 1SCVA 2O5GA 4WQ2A 1K9PA 2KOTA 1CM4A 1M39A 1XA5A 3EKJA 1IRJA 1CFPA 1SK6D 4I5LB 4QJ5B 3LK0A 4PHJA 3O2PA 1CFDA 1EJ3A 1E8AA 2O60A 4I5JA 1SCMB 1DJWA 1YURA 2BCXA 1FI6A 3IQOA 4YGDB 2WCEA 1FPWA 5CPVA 1B8CA 1DF0A 1M45A 1VRKA 1XFWO 3EK8A 2K7DA 3PLFB 4YRUA 1W7JB 4P5OE 2KFFA 1A2XA 2KYFA 2LP3A 2L4IA 4OCIA 1KQMC 2K7CA 4ZCVA 2LLSA 1GQMA 1IJ5A 2AAOA 3I5HC 2FCEA 2JNFA 2M97A 2M1KB 4GGFC 2BE6A 5HLVA 5HKYA 1ZOTB 1NPQA 2KGRA 5CSFA 3SIBA 1B1GA 1UHKA 4U8DA 2PVBA 2ZN8A 2OTGC 3TDIA 1TCFA 2LNKA 1MQ1A 2M49B 1IQ5A 2WC8A 4AQJA 1K95A 5HKZA 4DUQA 1RECA 1IH0A 3EK4A 1XFZO 1NCZA 1QLSA 1QTXA 2H61A 2PALA 1ALVA 2CNPA 3CWGA 3LL8B 1XVJA 1DGVA 2KYCA 5B8IB 1SR6C 1QV0A 1S6JA 1QVIZ 2NZ0A 1TNQA 2JU0A 2CBLA 3NSIA 1FBVA 3RLZA 3PATA 5KU1A 1TRFA 1PALA 4L9MA 1BOCA 1FI5A 1YUUA 1CMFA 2Y4QA 1ALWA 1LINA 1IGVA 1KWOC 2JC2A 2NCOA 1CLBA 1NSHA 1JF2A 2Y1NA 1K2HA 1S26D 3I5IC 3WNXB 1PK0D 1HT9A 4YGEB 3OP0A 2JT8A 1QX5B 5IBWA 1DGUA 1LA0A 2M29A 4YI8A 1JBAA 2JPTA 2K8MB 2RGIA 5HYDA 2GGMA 1OMDA 5KTYA 1N2DA 1NIWA 1ZACA 5ER5A 1A29A 4HRGA 1NX3A 1QIVA 4PE0A 2CCMA 1RTP1 1BLQA 3BXKA 1MUXA 1F71A 2LC5A 1SNLA 2JXCA 1GJYA 4NQGA 1XFXO 1NCXA 1EXRA 4IL1A 1YRUB 1B4CA 1WLMA 5HKWA 1YX7A 1GGWA 1DJHA 1S3PA 2K7BA 2CTNA 2M0RA 2ZKMX 1AVSA 3I5GC 2NXQA 4GUKA 5DKRA 2SASA 4N1GA 3BQ3A 1BJFA 1PSRA 2BE4A 3BUOB 4YGBB 4DS7A 2KGBC 5I2LA 1IJ6A 5CSNA 3C1VA 3SG6A 3VRPA 5I8NA 2FCDA 3BYAA 3CLNA 1KWOB 1MXLC 1WDCC 4GGNA 1MF8B 3BUMB 4MZKA 1RWYA 2LVKA 1YUTA 3M0WA 2L0PA 3NSKA 1UHNA 1K90D 1NP8A 4BY5A 1JUOA 1XO5A 3BOWA 2M1UA 1R6PA 2OS8C 4HSZA 4M2QA 1SMGA 3SG2A 2LV7A 2E6WA 2KAXA 1OE9B 3CR2A 3JTDC 1NX2A 3ZWHA 3WHUB 2JT0A 2PMYA 3TUYB 3CR4X 1KFUS 1F55A 3DVEA 1S5GZ 1RJVA 3A4UB 1YTZC 1B7TY 3GK4X 4JPZB 1XFUO 4PE4A 1AUIB 1D1OA 4DIRA 1CB1A 2MAZA 3PALA 1J55A 1KFXL 2G9BA 3LCPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0Y A;  1S6I A;  3VRN A;  1A03 A;  3BUW B;  1C7V A;  1QJT A;  5I2Q A;  2KAV A;  2LP2 A;  1KQV A;  5FYX A;  3I5I B;  1EG4 A;  3NSO A;  3D10 A;  1F8H A;  3NSL A;  2LCP A;  1SKT A;  1NX1 A;  2CXJ A;  1WLZ A;  1Y1U A;  1L7Z A;  4ORC B;  2M8U A;  2EGD A;  2JUL A;  3SIA A;  1YUS A;  4OKH A;  1EL4 A;  1QAS A;  1B47 A;  1S1E A;  3NXA A;  1N65 A;  4R1E A;  3I5F B;  1QAT A;  1SBJ A;  2BL0 B;  1U5I A;  2FJU B;  1J1D A;  2KI4 B;  3OB2 B;  5GQQ C;  1YVL A;  5AFP A;  2AUC A;  2L50 A;  2LHI A;  3DF0 A;  4QJ3 B;  4MEW A;  4USL A;  4XJK A;  2MLF C;  2ZRT A;  4P2Y B;  4PHM A;  3SG5 A;  3TDZ A;  2WCB A;  2JT3 A;  3PM8 A;  2H2K A;  4MZL A;  4BY4 A;  4PHK A;  1TNP A;  1KK8 B;  1QLK A;  1UHJ A;  3WXA A;  1PUL A;  3DVM A;  1XK4 C;  3EVV A;  1XFY O;  2JQ6 A;  4NDC A;  5I2O A;  2K61 A;  1QV1 A;  1KSO A;  2MHH A;  2SCP A;  3JVT B;  2LM5 A;  1TNX A;  4JQ0 D;  4MSP A;  1IKU A;  1Y1A A;  1M63 B;  2WOR A;  1K93 D;  2KI6 C;  2F33 A;  4CLN A;  5ER4 X;  4CID A;  3PN7 B;  5HLO A;  1WRZ A;  1A75 A;  2JWW A;  2PAS A;  1QX2 A;  1UHH A;  2F2P A;  4PE1 A;  1KSM A;  1BF5 A;  4M2P A;  1KFU L;  1SCM C;  3EVR A;  5DKQ A;  2NLN A;  3EK7 A;  2HQ8 A;  2HQW A;  2LUX A;  1SL7 A;  1S6C A;  2WCF A;  1U5I B;  3CTN A;  3OX6 A;  2BKH B;  1CFC A;  1KCY A;  2ZNE A;  1S36 A;  1OMR A;  2A4J A;  1XFV O;  3PFV A;  3KF9 A;  2BCA A;  1KQM B;  1MXE A;  2L5X B;  1SL8 A;  1AJ4 A;  2LVJ A;  3KEV A;  4PDZ A;  2JTZ A;  2L2E A;  3OB1 B;  2JOJ A;  4TNC A;  3I5H B;  2HPS A;  3FWB A;  1Q80 A;  3SG3 A;  1H4B A;  1NWD A;  2M7L A;  4CPV A;  1OSA A;  3O6B A;  3VGO A;  4GAO A;  1JSA A;  4Q04 A;  1X02 A;  2HET A;  2LE9 B;  1PRW A;  2Y1M A;  2LMT A;  2OTG B;  1UUS A;  1OQP A;  3AAJ A;  2OPO A;  3O78 A;  1TTX A;  4MLW A;  3H4S E;  3TS5 B;  4HRH A;  2CT9 A;  4C0K A;  1H8B A;  3JVT C;  1MWN A;  1WRK A;  1NCY A;  2LAP A;  2K2A A;  2MA2 A;  1DF0 B;  2M3W A;  3F45 A;  4MN0 A;  1CDN A;  3VRR A;  1CDM A;  2OS8 B;  2M7N A;  3A8R A;  2ISD A;  3CZT X;  1ZMZ A;  5JJG A;  4ORB B;  4PE7 A;  2LVI A;  4MZJ A;  1F4O A;  4CFQ A;  4OV2 A;  1TN4 A;  3SJS A;  4C0L A;  4QJ4 B;  5BPJ A;  1CNP A;  1G33 A;  2Y5I A;  2B1U A;  3AKB A;  1K9U A;  3DVK A;  1CTR A;  3SG4 A;  3HCM A;  2EHB A;  1G4Y R;  1OZO A;  1MR8 A;  2KQ6 A;  1QXP A;  3D0Y B;  2JXL A;  1BMO A;  2EC6 C;  5G08 A;  2BCB A;  3PSR A;  3VRO A;  3ZNI A;  1UWO A;  3I5G B;  3AKA A;  4YGC B;  2LHL A;  4NDB A;  1B7T Z;  1OMV A;  4PHN A;  1AP4 A;  2ZRS A;  3LLE A;  4GGF A;  3I5F C;  1OZS A;  2HF5 A;  3FIA A;  1RK9 A;  1K94 A;  1AHR A;  1IWQ A;  1V1G A;  3DD4 A;  1DJG A;  1WRL A;  1CKK A;  1JF0 A;  2F8P A;  1ODB A;  2BKI B;  5DKN A;  1UP5 A;  2KDH A;  1BR1 B;  4YBH B;  2L4H A;  3IQQ A;  1J7O A;  1GGZ A;  2AMI A;  4GBA A;  3LK1 A;  1BOD A;  1G8I A;  1M31 A;  2KSP A;  2LLT A;  3ICB A;  1DJY A;  1SPY A;  2BL0 C;  1SL9 A;  2MJW B;  2MLE C;  2NCP A;  3JTD B;  4XYN A;  1CLM A;  1K9K A;  1QIW A;  1UHI A;  2LMV A;  4FQO A;  4C0J A;  3VRQ A;  2TN4 A;  2ZFD A;  3FWC A;  5PAL A;  2K7O A;  2JNX A;  1CFF A;  5AEQ A;  4OVN F;  2DOQ A;  2R2I A;  2P6B B;  1QX7 A;  1XK4 A;  4YI9 A;  1B8L A;  3RM1 A;  2I7A A;  3IF7 A;  4YGA A;  4ICB A;  4PAL A;  2KI6 D;  3TZ1 A;  3TUY C;  1K8U A;  2VRG A;  1YR5 A;  1YX8 A;  1KK8 C;  3DF0 B;  2KNE A;  5TNC A;  1JFK A;  4D1E A;  5K89 A;  1SW8 A;  2JRF A;  2KAY A;  2H61 C;  3FS7 A;  2GGZ A;  2BBN A;  2IS9 A;  2F3Y A;  3QRX A;  2GV5 A;  3CS1 A;  3EVU A;  1Y6W A;  4PCW A;  1KFX S;  2KBM A;  4FTG A;  1RFJ A;  2BEC A;  1S5G Y;  1AJ5 A;  1BU3 A;  1TCO B;  3BUN B;  4JWQ A;  4MVF A;  4MBE A;  5KSZ A;  4E68 A;  1DTL A;  2LLU A;  1DJX A;  2QPT A;  1CDL A;  2KI4 C;  3CR5 X;  3OX5 A;  5F6T A;  1EG3 A;  3KO0 A;  1Y1X A;  2G2B A;  4ORA B;  4A4C A;  2K0J A;  1JC2 A;  2WOS A;  4GFT A;  1TOP A;  3DVJ A;  4F0Z B;  2KHN A;  1BT6 A;  3CGA A;  5JOL A;  3MSE B;  3TS5 C;  1UUR A;  2KFH A;  2I94 A;  1L2O C;  1C07 A;  3EKH A;  1LVC D;  4N1F A;  4A4B A;  2M9G A;  4GPL B;  2FOT A;  5D7F A;  1HQV A;  1K96 A;  1DJZ A;  1SY9 A;  4MRY A;  2D8N A;  2ZND A;  1JWD A;  1JFJ A;  1R2U A;  2JTT A;  1RRO A;  3GK1 A;  2COL B;  3TDU A;  1AK8 A;  2LMU A;  1CDP A;  1B9A A;  1SR6 B;  3BOW B;  2JZI A;  1ZUZ A;  1TNW A;  1NUB A;  1EH2 A;  2ZN9 A;  3KPX A;  2LUC A;  4DCK A;  2KFG A;  1QVI Y;  1NX0 A;  5CSI A;  4I5K A;  2K2F A;  2L51 A;  1ZFS A;  4WRI A;  1DJI A;  1KK7 Z;  3GK2 A;  4N5X A;  1PSB A;  4DRW A;  1PVA A;  1LKJ A;  2PRU A;  3OHM B;  2F2O A;  2LVV A;  2KQY A;  3WHT B;  1IQ3 A;  2EC6 B;  1CMG A;  1WDC B;  4XJK B;  1F4Q A;  1C7W A;  4UPG A;  2Q91 A;  2Q4U A;  3AAK A;  5AAN A;  1Y0V H;  5CSJ A;  4AOM A;  3K21 A;  2QAC A;  5AER A;  1A4P A;  2V53 A;  1BG1 A;  1DVI A;  1SRA A;  2BBM A;  1L2O B;  4HRE E;  1A75 B;  5D69 A;  3HX4 A;  3O4Y A;  1YVH A;  1DMO A;  1KK7 Y;  4GNK B;  3BUX B;  1J7Q A;  1WY9 A;  4OR9 B;  4MRX A;  2E30 A;  3E3R A;  1M46 A;  2KBI A;  1OOJ A;  1FF1 A;  4ZCU A;  2MRD A;  4NDD A;  1DT7 B;  1PVB A;  4CFR A;  2WND A;  1LA3 A;  1QS7 A;  3PN7 C;  5J3X A;  1W7I B;  3SG7 A;  1MHO A;  1NYA A;  1FW4 A;  1IG5 A;  1CLL A;  3GOF A;  1BR4 B;  2MBX A;  1SYM A;  2LAN A;  1CM1 A;  1F70 A;  1V1F A;  2I18 A;  1J7R A;  1N0Y A;  2PSR A;  3KHE A;  4M2O A;  4WQ3 A;  1XYD A;  2F3Z A;  1J1E A;  1LXF C;  1J7P A;  2L98 A;  4I5N B;  4ETO A;  1B8R A;  5AXI A;  1YRT B;  4AQI A;  1F54 A;  1TIZ A;  2I2R E;  1SCV A;  2O5G A;  4WQ2 A;  1K9P A;  2KOT A;  1CM4 A;  1M39 A;  1XA5 A;  3EKJ A;  1IRJ A;  1CFP A;  1SK6 D;  4I5L B;  4QJ5 B;  3LK0 A;  4PHJ A;  3O2P A;  1CFD A;  1EJ3 A;  1E8A A;  2O60 A;  4I5J A;  1SCM B;  1DJW A;  1YUR A;  2BCX A;  1FI6 A;  3IQO A;  4YGD B;  2WCE A;  1FPW A;  5CPV A;  1B8C A;  1DF0 A;  1M45 A;  1VRK A;  1XFW O;  3EK8 A;  2K7D A;  3PLF B;  4YRU A;  1W7J B;  4P5O E;  2KFF A;  1A2X A;  2KYF A;  2LP3 A;  2L4I A;  4OCI A;  1KQM C;  2K7C A;  4ZCV A;  2LLS A;  1GQM A;  1IJ5 A;  2AAO A;  3I5H C;  2FCE A;  2JNF A;  2M97 A;  2M1K B;  4GGF C;  2BE6 A;  5HLV A;  5HKY A;  1ZOT B;  1NPQ A;  2KGR A;  5CSF A;  3SIB A;  1B1G A;  1UHK A;  4U8D A;  2PVB A;  2ZN8 A;  2OTG C;  3TDI A;  1TCF A;  2LNK A;  1MQ1 A;  2M49 B;  1IQ5 A;  2WC8 A;  4AQJ A;  1K95 A;  5HKZ A;  4DUQ A;  1REC A;  1IH0 A;  3EK4 A;  1XFZ O;  1NCZ A;  1QLS A;  1QTX A;  2H61 A;  2PAL A;  1ALV A;  2CNP A;  3CWG A;  3LL8 B;  1XVJ A;  1DGV A;  2KYC A;  5B8I B;  1SR6 C;  1QV0 A;  1S6J A;  1QVI Z;  2NZ0 A;  1TNQ A;  2JU0 A;  2CBL A;  3NSI A;  1FBV A;  3RLZ A;  3PAT A;  5KU1 A;  1TRF A;  1PAL A;  4L9M A;  1BOC A;  1FI5 A;  1YUU A;  1CMF A;  2Y4Q A;  1ALW A;  1LIN A;  1IGV A;  1KWO C;  2JC2 A;  2NCO A;  1CLB A;  1NSH A;  1JF2 A;  2Y1N A;  1K2H A;  1S26 D;  3I5I C;  3WNX B;  1PK0 D;  1HT9 A;  4YGE B;  3OP0 A;  2JT8 A;  1QX5 B;  5IBW A;  1DGU A;  1LA0 A;  2M29 A;  4YI8 A;  1JBA A;  2JPT A;  2K8M B;  2RGI A;  5HYD A;  2GGM A;  1OMD A;  5KTY A;  1N2D A;  1NIW A;  1ZAC A;  5ER5 A;  1A29 A;  4HRG A;  1NX3 A;  1QIV A;  4PE0 A;  2CCM A;  1RTP 1;  1BLQ A;  3BXK A;  1MUX A;  1F71 A;  2LC5 A;  1SNL A;  2JXC A;  1GJY A;  4NQG A;  1XFX O;  1NCX A;  1EXR A;  4IL1 A;  1YRU B;  1B4C A;  1WLM A;  5HKW A;  1YX7 A;  1GGW A;  1DJH A;  1S3P A;  2K7B A;  2CTN A;  2M0R A;  2ZKM X;  1AVS A;  3I5G C;  2NXQ A;  4GUK A;  5DKR A;  2SAS A;  4N1G A;  3BQ3 A;  1BJF A;  1PSR A;  2BE4 A;  3BUO B;  4YGB B;  4DS7 A;  2KGB C;  5I2L A;  1IJ6 A;  5CSN A;  3C1V A;  3SG6 A;  3VRP A;  5I8N A;  2FCD A;  3BYA A;  3CLN A;  1KWO B;  1MXL C;  1WDC C;  4GGN A;  1MF8 B;  3BUM B;  4MZK A;  1RWY A;  2LVK A;  1YUT A;  3M0W A;  2L0P A;  3NSK A;  1UHN A;  1K90 D;  1NP8 A;  4BY5 A;  1JUO A;  1XO5 A;  3BOW A;  2M1U A;  1R6P A;  2OS8 C;  4HSZ A;  4M2Q A;  1SMG A;  3SG2 A;  2LV7 A;  2E6W A;  2KAX A;  1OE9 B;  3CR2 A;  3JTD C;  1NX2 A;  3ZWH A;  3WHU B;  2JT0 A;  2PMY A;  3TUY B;  3CR4 X;  1KFU S;  1F55 A;  3DVE A;  1S5G Z;  1RJV A;  3A4U B;  1YTZ C;  1B7T Y;  3GK4 X;  4JPZ B;  1XFU O;  4PE4 A;  1AUI B;  1D1O A;  4DIR A;  1CB1 A;  2MAZ A;  3PAL A;  1J55 A;  1KFX L;  2G9B A;  3LCP C; 
#chains in the Genus database with same CATH topology
 2WCH A;  3Q8I A;  3D0Y A;  2WCJ A;  1S6I A;  3VRN A;  1A03 A;  3BUW B;  1C7V A;  1QJT A;  5I2Q A;  2KAV A;  2LP2 A;  1KQV A;  3K1E A;  5FYX A;  3I5I B;  1EG4 A;  3NSO A;  3D10 A;  1F8H A;  3NSL A;  2LCP A;  1SKT A;  1NX1 A;  2CXJ A;  3S0F A;  1WLZ A;  1Y1U A;  1L7Z A;  4ORC B;  2M8U A;  2EGD A;  2JUL A;  3SIA A;  1YUS A;  4OKH A;  1EL4 A;  1T14 A;  4F7F A;  1QAS A;  4KYN A;  1B47 A;  1S1E A;  3NXA A;  1N65 A;  4R1E A;  3I5F B;  1QAT A;  1SBJ A;  2BL0 B;  1U5I A;  2FJU B;  1J1D A;  2KI4 B;  3OB2 B;  3B6X A;  5GQQ C;  1YVL A;  5AFP A;  2AUC A;  2L50 A;  2LHI A;  3DF0 A;  4QJ3 B;  4MEW A;  4USL A;  4XJK A;  2MLF C;  2ZRT A;  4P2Y B;  4PHM A;  3SG5 A;  3TDZ A;  2WCB A;  2GTE A;  2JT3 A;  3PM8 A;  2H2K A;  4MZL A;  4BY4 A;  4PHK A;  1TNP A;  1KK8 B;  1QLK A;  1UHJ A;  3WXA A;  1PUL A;  3DVM A;  1XK4 C;  3EVV A;  1XFY O;  2KPH A;  2JQ6 A;  4NDC A;  5I2O A;  2K61 A;  1QV1 A;  1KSO A;  2MHH A;  2SCP A;  3JVT B;  2LM5 A;  1TNX A;  3CDN A;  4JQ0 D;  4MSP A;  1IKU A;  1Y1A A;  1M63 B;  2WOR A;  1K93 D;  2KI6 C;  2F33 A;  3SS5 A;  4CLN A;  5ER4 X;  4CID A;  3PN7 B;  5HLO A;  1WRZ A;  1A75 A;  2JWW A;  2PAS A;  1QX2 A;  1UHH A;  2WCL A;  2F2P A;  2K60 A;  3CZ1 A;  4PE1 A;  1KSM A;  3D73 A;  1BF5 A;  4M2P A;  1KFU L;  1SCM C;  3EVR A;  5DKQ A;  2NLN A;  3EK7 A;  2HQ8 A;  2HQW A;  2LUX A;  2BAP A;  1SL7 A;  1S6C A;  3S0A A;  3OGN A;  2WCF A;  1U5I B;  3CTN A;  2PQL A;  3OX6 A;  2BKH B;  1CFC A;  1KCY A;  2ZNE A;  1S36 A;  1OMR A;  2A4J A;  1XFV O;  3PFV A;  3KF9 A;  2BCA A;  1DEL A;  1KQM B;  1MXE A;  2L5X B;  1SL8 A;  1AJ4 A;  2LVJ A;  2WCM A;  1OOG A;  3KEV A;  4PDZ A;  2JTZ A;  2L2E A;  3OB1 B;  2JOJ A;  4TNC A;  3I5H B;  2HPS A;  3B86 A;  3FWB A;  1Q80 A;  3SG3 A;  1H4B A;  3SS4 A;  1NWD A;  3DY9 A;  2M7L A;  4CPV A;  1OSA A;  3O6B A;  3VGO A;  4GAO A;  1JSA A;  3BFB A;  4Q04 A;  1X02 A;  2HET A;  2LE9 B;  1PRW A;  2Y1M A;  2LMT A;  2OTG B;  1UUS A;  1OQP A;  3AAJ A;  2OPO A;  3O78 A;  1TTX A;  4MLW A;  3H4S E;  3TS5 B;  3B7A A;  4HRH A;  2CT9 A;  4C0K A;  1H8B A;  3JVT C;  1MWN A;  1WRK A;  1NCY A;  2LAP A;  2K2A A;  2MA2 A;  1DF0 B;  2M3W A;  3F45 A;  4MN0 A;  1CDN A;  3D74 A;  3VRR A;  1CDM A;  2OS8 B;  2M7N A;  3A8R A;  2ISD A;  3CZT X;  1ZMZ A;  5JJG A;  4ORB B;  4PE7 A;  2LVI A;  4MZJ A;  1F4O A;  4CFQ A;  4OV2 A;  1TN4 A;  3D78 A;  3SJS A;  4C0L A;  4QJ4 B;  5BPJ A;  1CNP A;  1G33 A;  2Y5I A;  2B1U A;  3AKB A;  1K9U A;  3DVK A;  1CTR A;  3SG4 A;  1C3Y A;  3HCM A;  2EHB A;  1G4Y R;  1OZO A;  1MR8 A;  3CZ2 A;  2KQ6 A;  1QXP A;  3D0Y B;  2JXL A;  1BMO A;  1ORG A;  2EC6 C;  5G08 A;  2BCB A;  3PSR A;  3R1O A;  3VRO A;  1UWO A;  3ZNI A;  3I5G B;  3AKA A;  4YGC B;  2LHL A;  4NDB A;  1B7T Z;  1OMV A;  4PHN A;  1AP4 A;  2ZRS A;  3LLE A;  4GGF A;  3I5F C;  1OZS A;  2HF5 A;  5FI7 A;  3FIA A;  1RK9 A;  1K94 A;  1AHR A;  1IWQ A;  3D75 A;  1V1G A;  3DD4 A;  1DJG A;  1WRL A;  1CKK A;  2QDI A;  1JF0 A;  2F8P A;  1ODB A;  2BKI B;  5DKN A;  1UP5 A;  2KDH A;  1BR1 B;  4YBH B;  2L4H A;  3IQQ A;  1J7O A;  1GGZ A;  2AMI A;  4GBA A;  3LK1 A;  3IVT A;  1BOD A;  1G8I A;  3CZ0 A;  1M31 A;  2KSP A;  2LLT A;  3ICB A;  1DJY A;  1SPY A;  2BL0 C;  1SL9 A;  2MJW B;  2MLE C;  2NCP A;  3JTD B;  4XYN A;  1CLM A;  1K9K A;  1QIW A;  1UHI A;  2LMV A;  4FQO A;  2QEV A;  3VRQ A;  2TN4 A;  2ZFD A;  3FWC A;  5PAL A;  2K7O A;  2JNX A;  1CFF A;  5AEQ A;  4OVN F;  2DOQ A;  2R2I A;  2P6B B;  1QX7 A;  1XK4 A;  4YI9 A;  1B8L A;  3RM1 A;  2I7A A;  3IF7 A;  4YGA A;  4ICB A;  4PAL A;  2KI6 D;  3TZ1 A;  3TUY C;  1K8U A;  2VRG A;  1YR5 A;  1YX8 A;  1KK8 C;  3DF0 B;  2KNE A;  5TNC A;  1JFK A;  4D1E A;  5K89 A;  2PYQ A;  1SW8 A;  2JRF A;  2KAY A;  2H61 C;  3FS7 A;  2GGZ A;  1C3Z A;  1DEK A;  2BBN A;  2IS9 A;  2F3Y A;  3QRX A;  2GV5 A;  3CS1 A;  3EVU A;  1Y6W A;  3V2L A;  4PCW A;  1KFX S;  2KBM A;  2WCK A;  3FE6 A;  4FTG A;  1RFJ A;  3B87 A;  2BEC A;  1S5G Y;  1AJ5 A;  1BU3 A;  1TCO B;  3BUN B;  2P71 A;  4JWQ A;  4MBE A;  4MVF A;  5KSZ A;  4E68 A;  1DTL A;  2LLU A;  2FJY A;  1DJX A;  2QPT A;  1CDL A;  2KI4 C;  3CR5 X;  3OX5 A;  5F6T A;  3S0D A;  1EG3 A;  3KO0 A;  3N7H A;  1Y1X A;  2G2B A;  4ORA B;  4A4C A;  2K0J A;  1JC2 A;  2WOS A;  4GFT A;  1TOP A;  3DVJ A;  4F0Z B;  2KHN A;  1BT6 A;  3CGA A;  5JOL A;  3MSE B;  3TS5 C;  1UUR A;  2KFH A;  3R1P A;  2I94 A;  1L2O C;  1C07 A;  3EKH A;  1SSE B;  4FQT A;  1LVC D;  4N1F A;  4A4B A;  3NHI A;  2M9G A;  4GPL B;  2FOT A;  4OZD A;  5D7F A;  1HQV A;  1K96 A;  3R1V A;  1DJZ A;  1SY9 A;  4MRY A;  2D8N A;  2ZND A;  1JWD A;  1JFJ A;  1R2U A;  2JTT A;  1RRO A;  3GK1 A;  2COL B;  3S0G A;  3TDU A;  1Z2C B;  2LMU A;  1AK8 A;  5FI6 A;  1CDP A;  1B9A A;  1SR6 B;  3BOW B;  3UO9 A;  2JZI A;  1ZUZ A;  1TNW A;  1NUB A;  2L5Y A;  2ZN9 A;  3KPX A;  1EH2 A;  2LUC A;  2H8V A;  4DCK A;  2KFG A;  1QVI Y;  3BFA A;  1NX0 A;  5CSI A;  4I5K A;  1Z4H A;  2K2F A;  2L51 A;  3PM2 A;  1ZFS A;  4WRI A;  1DJI A;  1KK7 Z;  3GK2 A;  2KLD A;  1PSB A;  4N5X A;  4DRW A;  1PVA A;  1LKJ A;  2PRU A;  3OHM B;  2F2O A;  3L47 A;  2LVV A;  2KQY A;  3WHT B;  1IQ3 A;  2EC6 B;  1CMG A;  1WDC B;  4XJK B;  1F4Q A;  3FE9 A;  1C7W A;  4UPG A;  2Q91 A;  3DYE A;  2Q4U A;  3AAK A;  3EG5 B;  5AAN A;  1Y0V H;  5CSJ A;  4AOM A;  3K21 A;  2QAC A;  5AER A;  5I94 A;  1A4P A;  2V53 A;  1BG1 A;  1DVI A;  1SRA A;  2BBM A;  1L2O B;  4HRE E;  1A75 B;  5D69 A;  3HX4 A;  3O4Y A;  1YVH A;  1DMO A;  1KK7 Y;  3L4L A;  4GNK B;  3BUX B;  1J7Q A;  1WY9 A;  4OR9 B;  4MRX A;  2E30 A;  3E3R A;  1M46 A;  2KBI A;  1OOJ A;  1FF1 A;  4PT1 A;  4ZCU A;  2MRD A;  4NDD A;  1DT7 B;  1PVB A;  4CFR A;  2WND A;  1LA3 A;  1QS7 A;  3PN7 C;  5J3X A;  1W7I B;  5D3O A;  1MHO A;  1NYA A;  3SG7 A;  2KLE A;  4C0J A;  1FW4 A;  1IG5 A;  1CLL A;  3GOF A;  1BR4 B;  2MBX A;  1OW4 A;  1SYM A;  2LAN A;  1CM1 A;  1F70 A;  1OOF A;  1V1F A;  2I18 A;  1J7R A;  1N0Y A;  2PSR A;  3KHE A;  4M2O A;  4WQ3 A;  1XYD A;  2F3Z A;  1J1E A;  1LXF C;  1J7P A;  2L98 A;  2WC6 A;  4I5N B;  4ETO A;  1B8R A;  5AXI A;  1YRT B;  4AQI A;  2QEO A;  1F54 A;  1TIZ A;  3BJH A;  2I2R E;  1SCV A;  2O5G A;  4WQ2 A;  1K9P A;  2KOT A;  5DIC A;  1CM4 A;  1M39 A;  1XA5 A;  3EKJ A;  1IRJ A;  1P28 A;  1CFP A;  1SK6 D;  4I5L B;  4QJ5 B;  3LK0 A;  4PHJ A;  3O2P A;  1CFD A;  1EJ3 A;  1E8A A;  2O60 A;  1OOI X;  1SCM B;  4I5J A;  1DJW A;  1YUR A;  2BCX A;  1FI6 A;  3IQO A;  4YGD B;  2WCE A;  1FPW A;  5CPV A;  1B8C A;  1DF0 A;  1M45 A;  1VRK A;  1XFW O;  3EK8 A;  3D76 A;  3R72 A;  2K7D A;  3PJI A;  3PLF B;  4YRU A;  1W7J B;  4P5O E;  2KFF A;  1A2X A;  2KYF A;  2LP3 A;  2L4I A;  5EL2 A;  3NGV A;  4OCI A;  1KQM C;  2K7C A;  2JPO A;  4ZCV A;  2LLS A;  1GQM A;  1IJ5 A;  2AAO A;  3I5H C;  3DZT A;  2FCE A;  2JNF A;  2M97 A;  2M1K B;  4GGF C;  2BE6 A;  5HLV A;  5HKY A;  1ZOT B;  1NPQ A;  2KGR A;  2P70 A;  5CSF A;  3SIB A;  1B1G A;  1UHK A;  4U8D A;  2PVB A;  2ZN8 A;  2OTG C;  3FE8 A;  3TDI A;  1TCF A;  2BNX A;  2LNK A;  1MQ1 A;  2M49 B;  1IQ5 A;  2WC8 A;  4AQJ A;  1K95 A;  5HKZ A;  4DUQ A;  1REC A;  1IH0 A;  4JKT A;  3EK4 A;  1XFZ O;  1NCZ A;  3OBV A;  2QEH A;  1QLS A;  1QTX A;  2H61 A;  2PAL A;  1ALV A;  2CNP A;  3CWG A;  3LL8 B;  1XVJ A;  1DGV A;  2KYC A;  5B8I B;  1SR6 C;  1QV0 A;  1S6J A;  1QVI Z;  2NZ0 A;  1TNQ A;  2JU0 A;  3S0B A;  2CBL A;  3NSI A;  1FBV A;  3RLZ A;  3PAT A;  5KU1 A;  1TRF A;  1PAL A;  4L9M A;  3CAB A;  1BOC A;  1FI5 A;  1YUU A;  1CMF A;  2Y4Q A;  1ALW A;  1DQE A;  4IJ7 A;  1LIN A;  1IGV A;  1KWO C;  2JC2 A;  2NCO A;  1CLB A;  1TUJ A;  2YGU A;  1NSH A;  1JF2 A;  2Y1N A;  1K2H A;  1S26 D;  3I5I C;  3WNX B;  4JD9 A;  1PK0 D;  1HT9 A;  4YGE B;  3OP0 A;  2JT8 A;  3B88 A;  1QX5 B;  4INW A;  2WC5 A;  3QME A;  5IBW A;  1DGU A;  1LA0 A;  2M29 A;  3O4X A;  4YI8 A;  1JBA A;  1TWO A;  1TUZ A;  3VB1 A;  2JPT A;  2K8M B;  2RGI A;  5HYD A;  2GGM A;  1OMD A;  5KTY A;  3CYZ A;  1N2D A;  1GM0 A;  1NIW A;  1XFR A;  1ZAC A;  5HL1 A;  1W9Z A;  1A29 A;  5ER5 A;  4HRG A;  1NX3 A;  3RZS A;  1QIV A;  4PE0 A;  2CCM A;  1RTP 1;  1BLQ A;  3BXK A;  1MUX A;  1F71 A;  2LC5 A;  1SNL A;  2JXC A;  1GJY A;  4NQG A;  2L2C A;  1XFX O;  1NCX A;  1EXR A;  3BFH A;  4IL1 A;  1YRU B;  1B4C A;  1WLM A;  5HKW A;  1YX7 A;  1GGW A;  1DJH A;  1S3P A;  2K7B A;  2CTN A;  3UNW A;  2M0R A;  2ZKM X;  3L4A A;  1AVS A;  3I5G C;  4INX A;  3NHT A;  2NXQ A;  1QWV A;  4GUK A;  5DKR A;  2SAS A;  4N1G A;  3BQ3 A;  1BJF A;  1PSR A;  2BE4 A;  3BUO B;  2QEB A;  4YGB B;  4DS7 A;  2KGB C;  5I2L A;  1IJ6 A;  2ERB A;  1LS8 A;  3SS3 A;  5CSN A;  3C1V A;  3SG6 A;  3VRP A;  5I8N A;  2FCD A;  3BYA A;  3CLN A;  1KWO B;  1MXL C;  1WDC C;  4GGN A;  1MF8 B;  3BUM B;  4MZK A;  1RWY A;  3D77 A;  2LVK A;  1YUT A;  3M0W A;  2L0P A;  3NSK A;  1IIO A;  1UHN A;  1K90 D;  1NP8 A;  4BY5 A;  1JUO A;  1XO5 A;  3BOW A;  5FI2 A;  2M1U A;  1R6P A;  2OS8 C;  4HSZ A;  4M2Q A;  1SMG A;  3SG2 A;  2LV7 A;  2E6W A;  2KAX A;  1OE9 B;  3CR2 A;  3JTD C;  1NX2 A;  3ZWH A;  3DXL A;  3WHU B;  2JT0 A;  2PMY A;  3TUY B;  3CR4 X;  1KFU S;  1F55 A;  1OOH A;  3DVE A;  1S5G Z;  1RJV A;  3A4U B;  1YTZ C;  1B7T Y;  3GK4 X;  4JPZ B;  1XFU O;  4PE4 A;  1AUI B;  1D1O A;  4DIR A;  1CB1 A;  2MAZ A;  3PAL A;  1J55 A;  1KFX L;  3S0E A;  2G9B A;  3LCP C;  1DC1 A; 
#chains in the Genus database with same CATH homology
 3D0Y A;  1S6I A;  3VRN A;  1A03 A;  3BUW B;  1C7V A;  1QJT A;  5I2Q A;  2KAV A;  2LP2 A;  1KQV A;  5FYX A;  3I5I B;  1EG4 A;  3NSO A;  3D10 A;  1F8H A;  3NSL A;  2LCP A;  1SKT A;  1NX1 A;  2CXJ A;  1WLZ A;  1Y1U A;  1L7Z A;  4ORC B;  2M8U A;  2EGD A;  2JUL A;  3SIA A;  1YUS A;  4OKH A;  1EL4 A;  1QAS A;  1B47 A;  1S1E A;  3NXA A;  1N65 A;  4R1E A;  3I5F B;  1QAT A;  1SBJ A;  2BL0 B;  1U5I A;  2FJU B;  1J1D A;  2KI4 B;  3OB2 B;  5GQQ C;  1YVL A;  5AFP A;  2AUC A;  2L50 A;  2LHI A;  3DF0 A;  4QJ3 B;  4MEW A;  4USL A;  4XJK A;  2MLF C;  2ZRT A;  4P2Y B;  4PHM A;  3SG5 A;  3TDZ A;  2WCB A;  2JT3 A;  3PM8 A;  2H2K A;  4MZL A;  4BY4 A;  4PHK A;  1TNP A;  1KK8 B;  1QLK A;  1UHJ A;  3WXA A;  1PUL A;  3DVM A;  1XK4 C;  3EVV A;  1XFY O;  2JQ6 A;  4NDC A;  5I2O A;  2K61 A;  1QV1 A;  1KSO A;  2MHH A;  2SCP A;  3JVT B;  2LM5 A;  1TNX A;  4JQ0 D;  4MSP A;  1IKU A;  1Y1A A;  1M63 B;  2WOR A;  1K93 D;  2KI6 C;  2F33 A;  4CLN A;  5ER4 X;  4CID A;  3PN7 B;  5HLO A;  1WRZ A;  1A75 A;  2JWW A;  2PAS A;  1QX2 A;  1UHH A;  2F2P A;  4PE1 A;  1KSM A;  1BF5 A;  4M2P A;  1KFU L;  1SCM C;  3EVR A;  5DKQ A;  2NLN A;  3EK7 A;  2HQ8 A;  2HQW A;  2LUX A;  1SL7 A;  1S6C A;  2WCF A;  1U5I B;  3CTN A;  3OX6 A;  2BKH B;  1CFC A;  1KCY A;  2ZNE A;  1S36 A;  1OMR A;  2A4J A;  1XFV O;  3PFV A;  3KF9 A;  2BCA A;  1KQM B;  1MXE A;  2L5X B;  1SL8 A;  1AJ4 A;  2LVJ A;  3KEV A;  4PDZ A;  2JTZ A;  2L2E A;  3OB1 B;  2JOJ A;  4TNC A;  3I5H B;  2HPS A;  3FWB A;  1Q80 A;  3SG3 A;  1H4B A;  1NWD A;  2M7L A;  4CPV A;  1OSA A;  3O6B A;  3VGO A;  4GAO A;  1JSA A;  4Q04 A;  1X02 A;  2HET A;  2LE9 B;  1PRW A;  2Y1M A;  2LMT A;  2OTG B;  1UUS A;  1OQP A;  3AAJ A;  2OPO A;  3O78 A;  1TTX A;  4MLW A;  3H4S E;  3TS5 B;  4HRH A;  2CT9 A;  4C0K A;  1H8B A;  3JVT C;  1MWN A;  1WRK A;  1NCY A;  2LAP A;  2K2A A;  2MA2 A;  1DF0 B;  2M3W A;  3F45 A;  4MN0 A;  1CDN A;  3VRR A;  1CDM A;  2OS8 B;  2M7N A;  3A8R A;  2ISD A;  3CZT X;  1ZMZ A;  5JJG A;  4ORB B;  4PE7 A;  2LVI A;  4MZJ A;  1F4O A;  4CFQ A;  4OV2 A;  1TN4 A;  3SJS A;  4C0L A;  4QJ4 B;  5BPJ A;  1CNP A;  1G33 A;  2Y5I A;  2B1U A;  3AKB A;  1K9U A;  3DVK A;  1CTR A;  3SG4 A;  3HCM A;  2EHB A;  1G4Y R;  1OZO A;  1MR8 A;  2KQ6 A;  1QXP A;  3D0Y B;  2JXL A;  1BMO A;  2EC6 C;  5G08 A;  2BCB A;  3PSR A;  3VRO A;  3ZNI A;  1UWO A;  3I5G B;  3AKA A;  4YGC B;  2LHL A;  4NDB A;  1B7T Z;  1OMV A;  4PHN A;  1AP4 A;  2ZRS A;  3LLE A;  4GGF A;  3I5F C;  1OZS A;  2HF5 A;  3FIA A;  1RK9 A;  1K94 A;  1AHR A;  1IWQ A;  1V1G A;  3DD4 A;  1DJG A;  1WRL A;  1CKK A;  1JF0 A;  2F8P A;  1ODB A;  2BKI B;  5DKN A;  1UP5 A;  2KDH A;  1BR1 B;  4YBH B;  2L4H A;  3IQQ A;  1J7O A;  1GGZ A;  2AMI A;  4GBA A;  3LK1 A;  1BOD A;  1G8I A;  1M31 A;  2KSP A;  2LLT A;  3ICB A;  1DJY A;  1SPY A;  2BL0 C;  1SL9 A;  2MJW B;  2MLE C;  2NCP A;  3JTD B;  4XYN A;  1CLM A;  1K9K A;  1QIW A;  1UHI A;  2LMV A;  4FQO A;  4C0J A;  3VRQ A;  2TN4 A;  2ZFD A;  3FWC A;  5PAL A;  2K7O A;  2JNX A;  1CFF A;  5AEQ A;  4OVN F;  2DOQ A;  2R2I A;  2P6B B;  1QX7 A;  1XK4 A;  4YI9 A;  1B8L A;  3RM1 A;  2I7A A;  3IF7 A;  4YGA A;  4ICB A;  4PAL A;  2KI6 D;  3TZ1 A;  3TUY C;  1K8U A;  2VRG A;  1YR5 A;  1YX8 A;  1KK8 C;  3DF0 B;  2KNE A;  5TNC A;  1JFK A;  4D1E A;  5K89 A;  1SW8 A;  2JRF A;  2KAY A;  2H61 C;  3FS7 A;  2GGZ A;  2BBN A;  2IS9 A;  2F3Y A;  3QRX A;  2GV5 A;  3CS1 A;  3EVU A;  1Y6W A;  4PCW A;  1KFX S;  2KBM A;  4FTG A;  1RFJ A;  2BEC A;  1S5G Y;  1AJ5 A;  1BU3 A;  1TCO B;  3BUN B;  4JWQ A;  4MVF A;  4MBE A;  5KSZ A;  4E68 A;  1DTL A;  2LLU A;  1DJX A;  2QPT A;  1CDL A;  2KI4 C;  3CR5 X;  3OX5 A;  5F6T A;  1EG3 A;  3KO0 A;  1Y1X A;  2G2B A;  4ORA B;  4A4C A;  2K0J A;  1JC2 A;  2WOS A;  4GFT A;  1TOP A;  3DVJ A;  4F0Z B;  2KHN A;  1BT6 A;  3CGA A;  5JOL A;  3MSE B;  3TS5 C;  1UUR A;  2KFH A;  2I94 A;  1L2O C;  1C07 A;  3EKH A;  1LVC D;  4N1F A;  4A4B A;  2M9G A;  4GPL B;  2FOT A;  5D7F A;  1HQV A;  1K96 A;  1DJZ A;  1SY9 A;  4MRY A;  2D8N A;  2ZND A;  1JWD A;  1JFJ A;  1R2U A;  2JTT A;  1RRO A;  3GK1 A;  2COL B;  3TDU A;  1AK8 A;  2LMU A;  1CDP A;  1B9A A;  1SR6 B;  3BOW B;  2JZI A;  1ZUZ A;  1TNW A;  1NUB A;  1EH2 A;  2ZN9 A;  3KPX A;  2LUC A;  4DCK A;  2KFG A;  1QVI Y;  1NX0 A;  5CSI A;  4I5K A;  2K2F A;  2L51 A;  1ZFS A;  4WRI A;  1DJI A;  1KK7 Z;  3GK2 A;  4N5X A;  1PSB A;  4DRW A;  1PVA A;  1LKJ A;  2PRU A;  3OHM B;  2F2O A;  2LVV A;  2KQY A;  3WHT B;  1IQ3 A;  2EC6 B;  1CMG A;  1WDC B;  4XJK B;  1F4Q A;  1C7W A;  4UPG A;  2Q91 A;  2Q4U A;  3AAK A;  5AAN A;  1Y0V H;  5CSJ A;  4AOM A;  3K21 A;  2QAC A;  5AER A;  1A4P A;  2V53 A;  1BG1 A;  1DVI A;  1SRA A;  2BBM A;  1L2O B;  4HRE E;  1A75 B;  5D69 A;  3HX4 A;  3O4Y A;  1YVH A;  1DMO A;  1KK7 Y;  4GNK B;  3BUX B;  1J7Q A;  1WY9 A;  4OR9 B;  4MRX A;  2E30 A;  3E3R A;  1M46 A;  2KBI A;  1OOJ A;  1FF1 A;  4ZCU A;  2MRD A;  4NDD A;  1DT7 B;  1PVB A;  4CFR A;  2WND A;  1LA3 A;  1QS7 A;  3PN7 C;  5J3X A;  1W7I B;  3SG7 A;  1MHO A;  1NYA A;  1FW4 A;  1IG5 A;  1CLL A;  3GOF A;  1BR4 B;  2MBX A;  1SYM A;  2LAN A;  1CM1 A;  1F70 A;  1V1F A;  2I18 A;  1J7R A;  1N0Y A;  2PSR A;  3KHE A;  4M2O A;  4WQ3 A;  1XYD A;  2F3Z A;  1J1E A;  1LXF C;  1J7P A;  2L98 A;  4I5N B;  4ETO A;  1B8R A;  5AXI A;  1YRT B;  4AQI A;  1F54 A;  1TIZ A;  2I2R E;  1SCV A;  2O5G A;  4WQ2 A;  1K9P A;  2KOT A;  1CM4 A;  1M39 A;  1XA5 A;  3EKJ A;  1IRJ A;  1CFP A;  1SK6 D;  4I5L B;  4QJ5 B;  3LK0 A;  4PHJ A;  3O2P A;  1CFD A;  1EJ3 A;  1E8A A;  2O60 A;  4I5J A;  1SCM B;  1DJW A;  1YUR A;  2BCX A;  1FI6 A;  3IQO A;  4YGD B;  2WCE A;  1FPW A;  5CPV A;  1B8C A;  1DF0 A;  1M45 A;  1VRK A;  1XFW O;  3EK8 A;  2K7D A;  3PLF B;  4YRU A;  1W7J B;  4P5O E;  2KFF A;  1A2X A;  2KYF A;  2LP3 A;  2L4I A;  4OCI A;  1KQM C;  2K7C A;  4ZCV A;  2LLS A;  1GQM A;  1IJ5 A;  2AAO A;  3I5H C;  2FCE A;  2JNF A;  2M97 A;  2M1K B;  4GGF C;  2BE6 A;  5HLV A;  5HKY A;  1ZOT B;  1NPQ A;  2KGR A;  5CSF A;  3SIB A;  1B1G A;  1UHK A;  4U8D A;  2PVB A;  2ZN8 A;  2OTG C;  3TDI A;  1TCF A;  2LNK A;  1MQ1 A;  2M49 B;  1IQ5 A;  2WC8 A;  4AQJ A;  1K95 A;  5HKZ A;  4DUQ A;  1REC A;  1IH0 A;  3EK4 A;  1XFZ O;  1NCZ A;  1QLS A;  1QTX A;  2H61 A;  2PAL A;  1ALV A;  2CNP A;  3CWG A;  3LL8 B;  1XVJ A;  1DGV A;  2KYC A;  5B8I B;  1SR6 C;  1QV0 A;  1S6J A;  1QVI Z;  2NZ0 A;  1TNQ A;  2JU0 A;  2CBL A;  3NSI A;  1FBV A;  3RLZ A;  3PAT A;  5KU1 A;  1TRF A;  1PAL A;  4L9M A;  1BOC A;  1FI5 A;  1YUU A;  1CMF A;  2Y4Q A;  1ALW A;  1LIN A;  1IGV A;  1KWO C;  2JC2 A;  2NCO A;  1CLB A;  1NSH A;  1JF2 A;  2Y1N A;  1K2H A;  1S26 D;  3I5I C;  3WNX B;  1PK0 D;  1HT9 A;  4YGE B;  3OP0 A;  2JT8 A;  1QX5 B;  5IBW A;  1DGU A;  1LA0 A;  2M29 A;  4YI8 A;  1JBA A;  2JPT A;  2K8M B;  2RGI A;  5HYD A;  2GGM A;  1OMD A;  5KTY A;  1N2D A;  1NIW A;  1ZAC A;  5ER5 A;  1A29 A;  4HRG A;  1NX3 A;  1QIV A;  4PE0 A;  2CCM A;  1RTP 1;  1BLQ A;  3BXK A;  1MUX A;  1F71 A;  2LC5 A;  1SNL A;  2JXC A;  1GJY A;  4NQG A;  1XFX O;  1NCX A;  1EXR A;  4IL1 A;  1YRU B;  1B4C A;  1WLM A;  5HKW A;  1YX7 A;  1GGW A;  1DJH A;  1S3P A;  2K7B A;  2CTN A;  2M0R A;  2ZKM X;  1AVS A;  3I5G C;  2NXQ A;  4GUK A;  5DKR A;  2SAS A;  4N1G A;  3BQ3 A;  1BJF A;  1PSR A;  2BE4 A;  3BUO B;  4YGB B;  4DS7 A;  2KGB C;  5I2L A;  1IJ6 A;  5CSN A;  3C1V A;  3SG6 A;  3VRP A;  5I8N A;  2FCD A;  3BYA A;  3CLN A;  1KWO B;  1MXL C;  1WDC C;  4GGN A;  1MF8 B;  3BUM B;  4MZK A;  1RWY A;  2LVK A;  1YUT A;  3M0W A;  2L0P A;  3NSK A;  1UHN A;  1K90 D;  1NP8 A;  4BY5 A;  1JUO A;  1XO5 A;  3BOW A;  2M1U A;  1R6P A;  2OS8 C;  4HSZ A;  4M2Q A;  1SMG A;  3SG2 A;  2LV7 A;  2E6W A;  2KAX A;  1OE9 B;  3CR2 A;  3JTD C;  1NX2 A;  3ZWH A;  3WHU B;  2JT0 A;  2PMY A;  3TUY B;  3CR4 X;  1KFU S;  1F55 A;  3DVE A;  1S5G Z;  1RJV A;  3A4U B;  1YTZ C;  1B7T Y;  3GK4 X;  4JPZ B;  1XFU O;  4PE4 A;  1AUI B;  1D1O A;  4DIR A;  1CB1 A;  2MAZ A;  3PAL A;  1J55 A;  1KFX L;  2G9B A;  3LCP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...