3A4UB

Crystal structure of mcfd2 in complex with carbohydrate recognition domain of ergic-53
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
65
Chain Sequence
EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Protein ERGIC-53
publication title Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 65
sequence length 78
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a4uB00
1C07A 1R2UA 2LVIA 1XFWO 1L7ZA 4IL1A 1EG3A 2HQWA 1BODA 2F2PA 2HPSA 1NP8A 1CTRA 2OS8B 1UHHA 1NCXA 3TDZA 1NCZA 3SG4A 5HKZA 1S26D 2PMYA 4P2YB 3AKBA 1RFJA 4WQ2A 1CFPA 5CSFA 3TUYC 1QS7A 3JTDC 1BOCA 3LCPC 4NDCA 3I5FC 1H4BA 1ZMZA 3ZNIA 4N1GA 3MSEB 1V1FA 2CBLA 4GGFA 1LA3A 1AVSA 5B8IB 3VROA 2LC5A 2E6WA 1MUXA 1UHNA 2PVBA 5AANA 2JTZA 1QLSA 1S36A 2BCBA 2JT0A 2EHBA 2PASA 3EKJA 3KHEA 3OP0A 3BUOB 4BY5A 1OSAA 4WRIA 2LE9B 2PSRA 4M2PA 1TOPA 2FCDA 2CNPA 2E30A 3LK1A 2AAOA 4F0ZB 1VRKA 5AERA 3SG2A 4PHMA 1CLMA 1B9AA 1S5GY 3BUWB 2BBMA 1TTXA 2EC6B 2EGDA 2OS8C 1OMDA 3DVKA 5D69A 3WHTB 1KK7Y 1IH0A 3PFVA 3KO0A 2L98A 5F6TA 1DMOA 2KI6D 1HT9A 1AK8A 1SK6D 1SL9A 1S5GZ 2ZFDA 1CLBA 2KAYA 2KDHA 1KK7Z 1OOJA 2VRGA 4DS7A 1JFJA 1FI6A 2PALA 1MXLC 5CPVA 1HQVA 1CM4A 1GGZA 1JUOA 2LVKA 4Q04A 2KFGA 3BXKA 2KI4C 1Y1AA 3I5IB 2NCPA 1U5IA 4MEWA 1QASA 1F70A 1KFUS 2OTGB 5ER4X 2JT8A 4A4CA 2H2KA 2WCBA 1BU3A 4AQJA 2KAVA 1RJVA 4DCKA 1BR4B 1NPQA 3AKAA 2JXCA 4XYNA 1B8LA 3A8RA 1YX8A 4BY4A 3CZTX 2EC6C 2MA2A 5G08A 1A29A 2SASA 5BPJA 1FW4A 2ZN8A 1TNXA 3BUXB 1SL8A 1XVJA 1KSOA 3DD4A 4OKHA 1AJ5A 2K0JA 3CR4X 5HYDA 3LK0A 1XO5A 1YURA 1JF2A 2TN4A 1QXPA 1G4YR 5FYXA 1BLQA 2JTTA 2ZRSA 1PULA 2FCEA 3TDIA 1F54A 2O5GA 1YUTA 1N65A 1IKUA 2DOQA 2KNEA 4HSZA 3I5IC 4QJ4B 2ZN9A 1SL7A 3CR2A 1F71A 3WXAA 2BBNA 3EVVA 5CSIA 2OTGC 1EL4A 1U5IB 5J3XA 5I2OA 1NYAA 3BOWA 2KOTA 2HF5A 1XFUO 1KSMA 1NX3A 1UHIA 2BE4A 2K7BA 4NDDA 1TCOB 1AJ4A 2K7OA 3O4YA 2COLB 1K96A 1GGWA 4NQGA 4PE1A 2HETA 4OV2A 2GGMA 1PSBA 2A4JA 2H61C 1JWDA 2NLNA 3JTDB 1BF5A 1BG1A 2BECA 1IGVA 1K9UA 2JNXA 3EVUA 2MLFC 4M2OA 4PALA 5CSJA 1B8RA 3KPXA 4N1FA 1M63B 3TDUA 1LINA 1WRKA 1YUSA 2LLTA 1OMRA 2JNFA 2ISDA 4PE0A 1N2DA 2K2AA 1NX2A 2LVJA 2PRUA 1TNWA 5DKNA 1Y6WA 5TNCA 1NSHA 4MLWA 1X02A 1EG4A 1K2HA 2KFFA 1DJXA 4YI9A 2OPOA 3FIAA 1QV0A 3RLZA 3BOWB 3O2PA 4I5JA 4YGAA 1N0YA 3O78A 2I94A 2Y4QA 1WRLA 2LP3A 1KFXS 1UWOA 4MVFA 4ORAB 3CR5X 4TNCA 1RK9A 3PN7B 3AAKA 2KGRA 5I2QA 3O6BA 3A4UB 1NX0A 1OQPA 2NCOA 2L2EA 2I18A 1S6CA 1CFDA 1J7RA 1SMGA 3QRXA 2KI4B 3D10A 1H8BA 4MZLA 2K61A 1SCVA 1GQMA 1KQMC 1ODBA 1MR8A 1TNQA 2KAXA 4YGCB 5PALA 4CFQA 3CTNA 2WNDA 3DVEA 2BCXA 1S1EA 1KK8B 1UUSA 1TN4A 1WDCB 1XK4C 2LM5A 1M39A 3SG5A 1W7JB 5KTYA 3WHUB 1J7PA 2CCMA 4HRGA 3LLEA 2JC2A 1IJ6A 1A2XA 4U8DA 4PHJA 1JSAA 1DT7B 1S6IA 1QLKA 2H61A 3I5HB 1MQ1A 1LVCD 1YX7A 1BMOA 2NZ0A 3SG6A 1FBVA 2Q91A 1RROA 3FS7A 3PN7C 3RM1A 1JC2A 1ZUZA 1J1DA 3SIBA 1KFUL 3SG7A 2ZNDA 4JQ0D 2M7NA 3GOFA 3GK2A 1DJIA 1ZOTB 2M1UA 2LMVA 2KI6C 2MHHA 1TCFA 4C0LA 4GGNA 3EK8A 4UPGA 2QACA 4DUQA 1KK8C 1QIVA 1WDCC 1YRUB 2JXLA 3EK7A 1SW8A 2BKHB 1Q80A 1IJ5A 2JRFA 1IQ3A 1DGUA 2LUXA 3BUNB 1Y1XA 1RECA 4ZCUA 5AEQA 1EH2A 3I5HC 3VRNA 2M97A 3FWBA 1BR1B 2MJWB 1DJZA 2KQ6A 1GJYA 1J55A 1QJTA 2WCEA 5HLOA 3SG3A 2WORA 4PE4A 1C7VA 1SYMA 2GV5A 1K95A 4YGEB 1PVBA 1CMFA 4D1EA 1SKTA 1BT6A 1AUIB 1ZFSA 1DJWA 1FPWA 2LV7A 3CGAA 4CIDA 1DTLA 2LUCA 1OMVA 1XK4A 4OCIA 5HKYA 2I2RE 2M8UA 1CMGA 4GBAA 4MZKA 1SCMB 4HRHA 5DKQA 1S3PA 2L5XB 3PLFB 2K2FA 2KGBC 2BL0B 3EVRA 1NUBA 3NSKA 1A75B 4YBHB 1CDNA 3VGOA 1LKJA 4PE7A 3E3RA 1YUUA 2B1UA 4PDZA 4QJ3B 3H4SE 2KQYA 4QJ5B 1FF1A 4FQOA 3NSLA 1DVIA 5I8NA 5AFPA 3TS5B 2JWWA 4JWQA 2KBMA 1WY9A 3I5GB 4ZCVA 1YVHA 4P5OE 1MWNA 1CLLA 1CDLA 5D7FA 2KBIA 3PALA 2LHLA 1QX5B 3K21A 1NX1A 2M7LA 2JPTA 4PCWA 1IRJA 2CT9A 1E8AA 1KQMB 1ZACA 4MSPA 1LA0A 3FWCA 1MXEA 2CXJA 1PALA 5GQQC 3D0YB 3WNXB 4XJKB 1QX2A 2WC8A 1SCMC 3PATA 1KFXL 4AOMA 1AP4A 1K9KA 1B47A 2MBXA 5KSZA 1K9PA 1CB1A 4GUKA 2BL0C 2F8PA 2V53A 3DVJA 3KEVA 1UHKA 1DJHA 1AHRA 3AAJA 2BE6A 4GFTA 4C0JA 2D8NA 1LXFC 2K7DA 1CM1A 2L51A 4I5LB 2Y1MA 3SJSA 5I2LA 3IF7A 4USLA 1JF0A 1MHOA 4CLNA 1DJYA 3F45A 4DIRA 1ALWA 3TS5C 4HREE 1MF8B 3VRQA 3I5GC 1UHJA 2RGIA 4YGDB 1G8IA 4N5XA 1B1GA 3BQ3A 2Q4UA 1A4PA 1S6JA 2KHNA 1K8UA 1JFKA 3EKHA 3IQOA 3KF9A 1RTP1 3JVTC 3OB2B 4NDBA 3ICBA 4GAOA 2NXQA 2M3WA 3CWGA 1F8HA 1SNLA 4ORBB 1SR6C 2LNKA 1EXRA 2ZKMX 4JPZB 5AXIA 1PRWA 1B4CA 1NIWA 1DF0B 1J7OA 4M2QA 5JOLA 1YTZC 1SY9A 3HCMA 1QATA 4ORCB 1CFCA 1F4QA 2LVVA 4MZJA 2LANA 4PHKA 1NWDA 1WLZA 1C7WA 1TRFA 4MBEA 4C0KA 1XFYO 2GGZA 1B8CA 3DF0B 2F33A 4YGBB 2JQ6A 1IWQA 3CS1A 2G2BA 1YVLA 3PM8A 2G9BA 2M49B 1CDPA 5DKRA 4MRXA 1XYDA 2K8MB 1L2OB 1QIWA 3VRRA 2HQ8A 3NSOA 2L4IA 1XA5A 4OVNF 1UP5A 2WOSA 1A75A 1RWYA 2BKIB 1QV1A 5JJGA 1CKKA 1SPYA 3OB1B 4GNKB 1XFVO 1A03A 4A4BA 2FOTA 2MAZA 2L0PA 2KSPA 1NCYA 3ZWHA 2JULA 1QX7A 2Y5IA 3BUMB 2AUCA 3GK1A 3C1VA 1EJ3A 3GK4X 2KYCA 1KWOB 2FJUB 1WRZA 1BJFA 1CDMA 1CNPA 3PSRA 2LHIA 1TNPA 1DGVA 3VRPA 2LMTA 1V1GA 1IG5A 1Y0VH 5K89A 2ZRTA 1G33A 1OZSA 3LL8B 4ICBA 4I5NB 1F55A 1IQ5A 3D0YA 4XJKA 1L2OC 3DVMA 1M45A 1M46A 2LLUA 4R1EA 2M9GA 1DJGA 4WQ3A 1KQVA 4CPVA 1OE9B 1B7TY 2R2IA 3OX6A 1CFFA 1YRTB 1W7IB 1SBJA 2M1KB 2LP2A 1QTXA 2F3ZA 2BCAA 1ALVA 2ZNEA 2IS9A 3M0WA 1PSRA 3BYAA 5IBWA 2SCPA 1PK0D 2LCPA 3SIAA 2F3YA 2I7AA 3OX5A 1JBAA 1B7TZ 2JU0A 2LMUA 2JOJA 1M31A 1PVAA 2WCFA 2LAPA 3TZ1A 5ER5A 3HX4A 4I5KA 4YI8A 1QVIY 1KWOC 4GPLB 4GGFC 4L9MA 4MRYA 3OHMB 1FI5A 1XFXO 1K94A 1KCYA 1F4OA 1Y1UA 1OZOA 2CTNA 2QPTA 3NXAA 1QVIZ 2JT3A 2M0RA 4MN0A 4DRWA 1WLMA 3JVTB 2MRDA 4FTGA 2K7CA 4E68A 3IQQA 4CFRA 1UURA 1SRAA 1SR6B 2Y1NA 1DF0A 1K90D 2JZIA 1J1EA 1R6PA 5HLVA 4YRUA 2AMIA 3TUYB 5HKWA 4AQIA 1D1OA 4ETOA 2O60A 3EK4A 3I5FB 2L50A 1K93D 5CSNA 2LLSA 2MLEC 1J7QA 2M29A 1TIZA 3CLNA 2F2OA 3DF0A 2KYFA 5KU1A 4OR9B 1XFZO 1YR5A 2L4HA 2P6BB 2KFHA 4PHNA 3NSIA
chains in the Genus database with same CATH superfamily
1FI6A 1C07A 1R2UA 1DEKA 3Q8IA 2LVIA 1XFWO 1L7ZA 3QMEA 4IL1A 1EG3A 2HQWA 3FE9A 1BODA 2F2PA 2HPSA 3S0GA 1NP8A 1CTRA 3SS3A 2OS8B 1UHHA 1NCXA 3TDZA 3OGNA 1NCZA 3SG4A 5HKZA 1S26D 2PMYA 4P2YB 3AKBA 1RFJA 3D77A 4WQ2A 1CFPA 5CSFA 3TUYC 1QS7A 3JTDC 1BOCA 3LCPC 3R72A 4NDCA 3I5FC 1H4BA 1ZMZA 3ZNIA 4N1GA 3MSEB 1V1FA 2CBLA 4GGFA 1LA3A 1AVSA 5B8IB 3VROA 2LC5A 2E6WA 1MUXA 1UHNA 2PVBA 5AANA 1C3ZA 2JTZA 1QLSA 1S36A 2BCBA 2JT0A 2EHBA 2PASA 3EKJA 3KHEA 3OP0A 3BUOB 4BY5A 1OSAA 4WRIA 4JKTA 2LE9B 2PSRA 4M2PA 1TOPA 2FCDA 2CNPA 2E30A 3LK1A 2AAOA 4F0ZB 3VB1A 1VRKA 2PQLA 5AERA 1T14A 3SG2A 3FE8A 4PHMA 1CLMA 1B9AA 4IJ7A 1S5GY 3BUWB 2BBMA 1TTXA 2EC6B 4JD9A 2EGDA 2OS8C 1OMDA 1Z2CB 3DVKA 5D69A 1KK7Y 3WHTB 1IH0A 3PFVA 3KO0A 2L98A 4PT1A 5F6TA 2KI6D 1DMOA 1HT9A 1AK8A 1SK6D 1SL9A 1S5GZ 2ZFDA 3D74A 1CLBA 2KAYA 2KDHA 1KK7Z 1OOJA 2VRGA 4DS7A 1JFJA 3B86A 2PYQA 2PALA 1MXLC 1OOGA 3V2LA 5CPVA 1HQVA 1CM4A 1GGZA 1JUOA 2LVKA 3NGVA 3D76A 4Q04A 2KFGA 3BXKA 2KI4C 1Y1AA 3I5IB 1TUZA 2NCPA 2P71A 1U5IA 5EL2A 4MEWA 1QASA 1F70A 1KFUS 2OTGB 5ER4X 2JT8A 4A4CA 2H2KA 2WCBA 1BU3A 4AQJA 2KAVA 1RJVA 4DCKA 1BR4B 1NPQA 3AKAA 2JXCA 4XYNA 1B8LA 4INWA 3A8RA 1YX8A 4BY4A 3CZTX 2BNXA 2EC6C 2MA2A 3DYEA 2BAPA 5G08A 1SSEB 1A29A 2SASA 5BPJA 1FW4A 2ZN8A 1TNXA 3BUXB 1SL8A 1XVJA 1DQEA 1KSOA 3DD4A 4OKHA 1AJ5A 2K0JA 3CR4X 5HYDA 3LK0A 1C3YA 1XO5A 1YURA 1JF2A 2TN4A 1QXPA 1G4YR 5FYXA 1BLQA 2JTTA 2ZRSA 1PULA 2FCEA 3TDIA 1F54A 2O5GA 1YUTA 3S0BA 1N65A 1IKUA 2DOQA 2KNEA 4HSZA 3I5IC 4QJ4B 2ZN9A 1SL7A 3B7AA 3CR2A 1F71A 3WXAA 2BBNA 3EVVA 5CSIA 2OTGC 1EL4A 1U5IB 5J3XA 5I2OA 3DZTA 1NYAA 3BOWA 2KOTA 2HF5A 1XFUO 3L4AA 1KSMA 1NX3A 3CZ1A 1UHIA 2BE4A 2K7BA 4NDDA 5D3OA 1TCOB 1AJ4A 2K7OA 3O4YA 2COLB 1K96A 5DICA 1GGWA 4NQGA 4PE1A 2HETA 4OV2A 2GGMA 1PSBA 2A4JA 2H61C 1JWDA 2NLNA 3JTDB 1BF5A 3S0DA 1BG1A 2BECA 1IGVA 1K9UA 2JNXA 3EVUA 2KPHA 2MLFC 4M2OA 3D78A 4PALA 5CSJA 1B8RA 3B6XA 3KPXA 4N1FA 1M63B 3TDUA 1LINA 1WRKA 1YUSA 2LLTA 1OMRA 2JNFA 2ISDA 4PE0A 1N2DA 2K2AA 1NX2A 1OOIX 2LVJA 2PRUA 2WCLA 1OOHA 1TNWA 1LS8A 5DKNA 1Y6WA 5TNCA 1NSHA 4MLWA 1X02A 1EG4A 1K2HA 2KFFA 1DJXA 4YI9A 2OPOA 3D73A 1QV0A 3FIAA 3RLZA 3BOWB 3O2PA 4I5JA 4YGAA 1N0YA 3O78A 2I94A 2Y4QA 2WC6A 1WRLA 2LP3A 5FI2A 1KFXS 3R1OA 1UWOA 4MVFA 3DY9A 4ORAB 3CR5X 4TNCA 1RK9A 3PN7B 3AAKA 2KGRA 5I2QA 3O6BA 3A4UB 3D75A 1NX0A 1OQPA 2WCJA 3CABA 2NCOA 2L2EA 2I18A 1S6CA 1CFDA 1J7RA 1SMGA 2K60A 3QRXA 2KI4B 3D10A 1H8BA 4MZLA 2K61A 1SCVA 1GQMA 1KQMC 1ODBA 1MR8A 1TNQA 2KAXA 4YGCB 5PALA 4CFQA 1OW4A 2WNDA 3CTNA 3DVEA 2BCXA 1S1EA 1KK8B 1UUSA 1TN4A 1WDCB 1XK4C 2LM5A 1M39A 3SG5A 1W7JB 5KTYA 3WHUB 1J7PA 2CCMA 3CYZA 4OZDA 4HRGA 3LLEA 2JC2A 1IJ6A 1A2XA 4U8DA 4PHJA 3B88A 1JSAA 1DT7B 1S6IA 1QLKA 2H61A 3I5HB 1MQ1A 1LVCD 1YX7A 1BMOA 2NZ0A 3EG5B 5HL1A 3SG6A 1FBVA 2Q91A 1RROA 3FS7A 3PN7C 3RM1A 3CZ2A 1JC2A 1ZUZA 1J1DA 3SIBA 1KFUL 3SG7A 2ZNDA 4JQ0D 2M7NA 2QEHA 3GOFA 3GK2A 1DJIA 1ZOTB 2M1UA 2WCKA 2LMVA 2KI6C 2MHHA 1TCFA 4C0LA 4GGNA 3EK8A 4UPGA 2QACA 4DUQA 1KK8C 1QIVA 1WDCC 1YRUB 2JXLA 3EK7A 1SW8A 2BKHB 1Q80A 1IJ5A 2JRFA 1IQ3A 1DGUA 2LUXA 3BUNB 1Y1XA 1RECA 4ZCUA 5AEQA 1EH2A 3I5HC 3VRNA 1XFRA 2M97A 3DXLA 3FWBA 1BR1B 2MJWB 1DJZA 2KQ6A 1GJYA 1J55A 1QJTA 1TUJA 2WCEA 5HLOA 2WCHA 3SG3A 2WORA 4PE4A 1C7VA 1SYMA 2GV5A 1K95A 4YGEB 1PVBA 1CMFA 4D1EA 1SKTA 1BT6A 1AUIB 1ZFSA 1DJWA 3N7HA 1FPWA 2LV7A 3CGAA 3B87A 4CIDA 1DTLA 2LUCA 1OMVA 1XK4A 3FE6A 4OCIA 2I2RE 2M8UA 5HKYA 1CMGA 4GBAA 4MZKA 1SCMB 4HRHA 3NHTA 5DKQA 1S3PA 2L5XB 3PLFB 2K2FA 2KGBC 2BL0B 3EVRA 1NUBA 3NSKA 1A75B 4YBHB 1CDNA 3VGOA 1LKJA 4PE7A 2QDIA 3E3RA 1YUUA 2B1UA 4PDZA 4QJ3B 3H4SE 2KQYA 4QJ5B 1FF1A 4FQOA 3SS5A 3NSLA 1DVIA 5I8NA 5AFPA 3TS5B 2JWWA 4JWQA 2H8VA 2KBMA 1WY9A 3I5GB 4ZCVA 1YVHA 4P5OE 1MWNA 1CLLA 1CDLA 5D7FA 2KBIA 3PALA 2LHLA 1QX5B 3K21A 1NX1A 2M7LA 2JPTA 4PCWA 1IRJA 1E8AA 1ZACA 1KQMB 2CT9A 3PM2A 1LA0A 3FWCA 1MXEA 2CXJA 1PALA 4MSPA 1QWVA 5GQQC 3D0YB 3WNXB 4XJKB 1QX2A 2WC8A 1SCMC 3BFBA 3PATA 1KFXL 2WC5A 2JPOA 4AOMA 1AP4A 1K9KA 1B47A 2MBXA 5KSZA 1K9PA 1CB1A 4GUKA 2BL0C 2F8PA 2V53A 3DVJA 3KEVA 1UHKA 1DJHA 1AHRA 3AAJA 2QEBA 2BE6A 4GFTA 4C0JA 2D8NA 1LXFC 2K7DA 1CM1A 1TWOA 2L51A 4I5LB 2Y1MA 2WCMA 3SJSA 5I2LA 3IF7A 4USLA 1JF0A 1MHOA 4CLNA 1DJYA 3F45A 4DIRA 1ALWA 3TS5C 3BJHA 4HREE 1MF8B 3VRQA 3I5GC 3RZSA 4F7FA 1UHJA 2RGIA 4YGDB 3UNWA 1G8IA 4N5XA 1B1GA 3BQ3A 3O4XA 2Q4UA 1W9ZA 1A4PA 1S6JA 2FJYA 2KHNA 1K8UA 1JFKA 3EKHA 3IQOA 3KF9A 1RTP1 3JVTC 3OB2B 4INXA 4NDBA 3ICBA 4GAOA 2ERBA 2NXQA 2M3WA 3CWGA 1F8HA 1SNLA 4ORBB 1SR6C 2LNKA 1EXRA 2ZKMX 4JPZB 5FI7A 5AXIA 1PRWA 1B4CA 1NIWA 1DF0B 2GTEA 1J7OA 4M2QA 5JOLA 1YTZC 1SY9A 2QEVA 1QATA 3HCMA 4ORCB 3R1VA 1F4QA 2LVVA 4MZJA 1CFCA 2LANA 2L5YA 4PHKA 1NWDA 1WLZA 3BFAA 1C7WA 1TRFA 3S0FA 4MBEA 4C0KA 1XFYO 2GGZA 1B8CA 5I94A 1OOFA 3DF0B 2F33A 4YGBB 2JQ6A 3R1PA 1IWQA 3CS1A 2G2BA 1YVLA 3PM8A 4FQTA 2G9BA 2M49B 1CDPA 5DKRA 4MRXA 1XYDA 2K8MB 1L2OB 1QIWA 3VRRA 3K1EA 2HQ8A 3NSOA 2L4IA 1XA5A 3OBVA 4OVNF 1UP5A 2WOSA 1A75A 1RWYA 2BKIB 1QV1A 5JJGA 1CKKA 1SPYA 3OB1B 4GNKB 1XFVO 1A03A 4A4BA 2FOTA 2MAZA 3SS4A 2L0PA 2KSPA 1NCYA 3ZWHA 2JULA 1QX7A 2Y5IA 3BUMB 2AUCA 3GK1A 3C1VA 1EJ3A 3GK4X 2KYCA 1KWOB 2FJUB 1WRZA 1BJFA 1CDMA 1CNPA 3PSRA 2LHIA 1TNPA 1DGVA 3VRPA 2LMTA 1V1GA 3CZ0A 1IG5A 1Y0VH 2QEOA 5K89A 2ZRTA 1G33A 1OZSA 3LL8B 4ICBA 4I5NB 1F55A 1IQ5A 3D0YA 2L2CA 3NHIA 4XJKA 1L2OC 3DVMA 1M45A 1M46A 2LLUA 4R1EA 2M9GA 1DJGA 4WQ3A 2YGUA 1KQVA 3L4LA 4CPVA 1OE9B 1B7TY 2R2IA 3OX6A 2P70A 1CFFA 1YRTB 1W7IB 1SBJA 2M1KB 2LP2A 1QTXA 2F3ZA 2BCAA 1ALVA 2ZNEA 2IS9A 3M0WA 1PSRA 3BYAA 5IBWA 2SCPA 1PK0D 2LCPA 3SIAA 2F3YA 2I7AA 3OX5A 1JBAA 1B7TZ 3UO9A 2JU0A 2LMUA 2JOJA 1M31A 1PVAA 3IVTA 2WCFA 2LAPA 3TZ1A 5ER5A 3S0EA 3HX4A 4I5KA 4YI8A 3S0AA 1QVIY 1KWOC 4GPLB 3L47A 2KLDA 4GGFC 4L9MA 4MRYA 3OHMB 1FI5A 1XFXO 1K94A 1KCYA 1F4OA 1Y1UA 1OZOA 2CTNA 2QPTA 3NXAA 1QVIZ 2JT3A 2M0RA 4MN0A 4DRWA 1WLMA 3JVTB 2MRDA 4FTGA 1GM0A 2K7CA 4E68A 3IQQA 4CFRA 1UURA 1SRAA 1SR6B 2Y1NA 1DF0A 1K90D 2JZIA 1J1EA 4KYNA 1R6PA 5FI6A 5HLVA 4YRUA 2AMIA 3TUYB 5HKWA 4AQIA 1D1OA 4ETOA 1DELA 2O60A 3EK4A 1ORGA 3I5FB 2L50A 1K93D 5CSNA 2LLSA 2MLEC 3BFHA 1DC1A 1Z4HA 1J7QA 3CDNA 2M29A 1TIZA 2KLEA 3CLNA 2F2OA 3DF0A 1IIOA 2KYFA 5KU1A 4OR9B 1XFZO 1YR5A 2L4HA 2P6BB 2KFHA 4PHNA 3PJIA 1P28A 3NSIA
chains in the Genus database with same CATH topology
1C07A 1R2UA 2LVIA 1XFWO 1L7ZA 4IL1A 1EG3A 2HQWA 1BODA 2F2PA 2HPSA 1NP8A 1CTRA 2OS8B 1UHHA 1NCXA 3TDZA 1NCZA 3SG4A 5HKZA 1S26D 2PMYA 4P2YB 3AKBA 1RFJA 4WQ2A 1CFPA 5CSFA 3TUYC 1QS7A 3JTDC 1BOCA 3LCPC 4NDCA 3I5FC 1H4BA 1ZMZA 3ZNIA 4N1GA 3MSEB 1V1FA 2CBLA 4GGFA 1LA3A 1AVSA 5B8IB 3VROA 2LC5A 2E6WA 1MUXA 1UHNA 2PVBA 5AANA 2JTZA 1QLSA 1S36A 2BCBA 2JT0A 2EHBA 2PASA 3EKJA 3KHEA 3OP0A 3BUOB 4BY5A 1OSAA 4WRIA 2LE9B 2PSRA 4M2PA 1TOPA 2FCDA 2CNPA 2E30A 3LK1A 2AAOA 4F0ZB 1VRKA 5AERA 3SG2A 4PHMA 1CLMA 1B9AA 1S5GY 3BUWB 2BBMA 1TTXA 2EC6B 2EGDA 2OS8C 1OMDA 3DVKA 5D69A 3WHTB 1KK7Y 1IH0A 3PFVA 3KO0A 2L98A 5F6TA 1DMOA 2KI6D 1HT9A 1AK8A 1SK6D 1SL9A 1S5GZ 2ZFDA 1CLBA 2KAYA 2KDHA 1KK7Z 1OOJA 2VRGA 4DS7A 1JFJA 1FI6A 2PALA 1MXLC 5CPVA 1HQVA 1CM4A 1GGZA 1JUOA 2LVKA 4Q04A 2KFGA 3BXKA 2KI4C 1Y1AA 3I5IB 2NCPA 1U5IA 4MEWA 1QASA 1F70A 1KFUS 2OTGB 5ER4X 2JT8A 4A4CA 2H2KA 2WCBA 1BU3A 4AQJA 2KAVA 1RJVA 4DCKA 1BR4B 1NPQA 3AKAA 2JXCA 4XYNA 1B8LA 3A8RA 1YX8A 4BY4A 3CZTX 2EC6C 2MA2A 5G08A 1A29A 2SASA 5BPJA 1FW4A 2ZN8A 1TNXA 3BUXB 1SL8A 1XVJA 1KSOA 3DD4A 4OKHA 1AJ5A 2K0JA 3CR4X 5HYDA 3LK0A 1XO5A 1YURA 1JF2A 2TN4A 1QXPA 1G4YR 5FYXA 1BLQA 2JTTA 2ZRSA 1PULA 2FCEA 3TDIA 1F54A 2O5GA 1YUTA 1N65A 1IKUA 2DOQA 2KNEA 4HSZA 3I5IC 4QJ4B 2ZN9A 1SL7A 3CR2A 1F71A 3WXAA 2BBNA 3EVVA 5CSIA 2OTGC 1EL4A 1U5IB 5J3XA 5I2OA 1NYAA 3BOWA 2KOTA 2HF5A 1XFUO 1KSMA 1NX3A 1UHIA 2BE4A 2K7BA 4NDDA 1TCOB 1AJ4A 2K7OA 3O4YA 2COLB 1K96A 1GGWA 4NQGA 4PE1A 2HETA 4OV2A 2GGMA 1PSBA 2A4JA 2H61C 1JWDA 2NLNA 3JTDB 1BF5A 1BG1A 2BECA 1IGVA 1K9UA 2JNXA 3EVUA 2MLFC 4M2OA 4PALA 5CSJA 1B8RA 3KPXA 4N1FA 1M63B 3TDUA 1LINA 1WRKA 1YUSA 2LLTA 1OMRA 2JNFA 2ISDA 4PE0A 1N2DA 2K2AA 1NX2A 2LVJA 2PRUA 1TNWA 5DKNA 1Y6WA 5TNCA 1NSHA 4MLWA 1X02A 1EG4A 1K2HA 2KFFA 1DJXA 4YI9A 2OPOA 3FIAA 1QV0A 3RLZA 3BOWB 3O2PA 4I5JA 4YGAA 1N0YA 3O78A 2I94A 2Y4QA 1WRLA 2LP3A 1KFXS 1UWOA 4MVFA 4ORAB 3CR5X 4TNCA 1RK9A 3PN7B 3AAKA 2KGRA 5I2QA 3O6BA 3A4UB 1NX0A 1OQPA 2NCOA 2L2EA 2I18A 1S6CA 1CFDA 1J7RA 1SMGA 3QRXA 2KI4B 3D10A 1H8BA 4MZLA 2K61A 1SCVA 1GQMA 1KQMC 1ODBA 1MR8A 1TNQA 2KAXA 4YGCB 5PALA 4CFQA 3CTNA 2WNDA 3DVEA 2BCXA 1S1EA 1KK8B 1UUSA 1TN4A 1WDCB 1XK4C 2LM5A 1M39A 3SG5A 1W7JB 5KTYA 3WHUB 1J7PA 2CCMA 4HRGA 3LLEA 2JC2A 1IJ6A 1A2XA 4U8DA 4PHJA 1JSAA 1DT7B 1S6IA 1QLKA 2H61A 3I5HB 1MQ1A 1LVCD 1YX7A 1BMOA 2NZ0A 3SG6A 1FBVA 2Q91A 1RROA 3FS7A 3PN7C 3RM1A 1JC2A 1ZUZA 1J1DA 3SIBA 1KFUL 3SG7A 2ZNDA 4JQ0D 2M7NA 3GOFA 3GK2A 1DJIA 1ZOTB 2M1UA 2LMVA 2KI6C 2MHHA 1TCFA 4C0LA 4GGNA 3EK8A 4UPGA 2QACA 4DUQA 1KK8C 1QIVA 1WDCC 1YRUB 2JXLA 3EK7A 1SW8A 2BKHB 1Q80A 1IJ5A 2JRFA 1IQ3A 1DGUA 2LUXA 3BUNB 1Y1XA 1RECA 4ZCUA 5AEQA 1EH2A 3I5HC 3VRNA 2M97A 3FWBA 1BR1B 2MJWB 1DJZA 2KQ6A 1GJYA 1J55A 1QJTA 2WCEA 5HLOA 3SG3A 2WORA 4PE4A 1C7VA 1SYMA 2GV5A 1K95A 4YGEB 1PVBA 1CMFA 4D1EA 1SKTA 1BT6A 1AUIB 1ZFSA 1DJWA 1FPWA 2LV7A 3CGAA 4CIDA 1DTLA 2LUCA 1OMVA 1XK4A 4OCIA 5HKYA 2I2RE 2M8UA 1CMGA 4GBAA 4MZKA 1SCMB 4HRHA 5DKQA 1S3PA 2L5XB 3PLFB 2K2FA 2KGBC 2BL0B 3EVRA 1NUBA 3NSKA 1A75B 4YBHB 1CDNA 3VGOA 1LKJA 4PE7A 3E3RA 1YUUA 2B1UA 4PDZA 4QJ3B 3H4SE 2KQYA 4QJ5B 1FF1A 4FQOA 3NSLA 1DVIA 5I8NA 5AFPA 3TS5B 2JWWA 4JWQA 2KBMA 1WY9A 3I5GB 4ZCVA 1YVHA 4P5OE 1MWNA 1CLLA 1CDLA 5D7FA 2KBIA 3PALA 2LHLA 1QX5B 3K21A 1NX1A 2M7LA 2JPTA 4PCWA 1IRJA 2CT9A 1E8AA 1KQMB 1ZACA 4MSPA 1LA0A 3FWCA 1MXEA 2CXJA 1PALA 5GQQC 3D0YB 3WNXB 4XJKB 1QX2A 2WC8A 1SCMC 3PATA 1KFXL 4AOMA 1AP4A 1K9KA 1B47A 2MBXA 5KSZA 1K9PA 1CB1A 4GUKA 2BL0C 2F8PA 2V53A 3DVJA 3KEVA 1UHKA 1DJHA 1AHRA 3AAJA 2BE6A 4GFTA 4C0JA 2D8NA 1LXFC 2K7DA 1CM1A 2L51A 4I5LB 2Y1MA 3SJSA 5I2LA 3IF7A 4USLA 1JF0A 1MHOA 4CLNA 1DJYA 3F45A 4DIRA 1ALWA 3TS5C 4HREE 1MF8B 3VRQA 3I5GC 1UHJA 2RGIA 4YGDB 1G8IA 4N5XA 1B1GA 3BQ3A 2Q4UA 1A4PA 1S6JA 2KHNA 1K8UA 1JFKA 3EKHA 3IQOA 3KF9A 1RTP1 3JVTC 3OB2B 4NDBA 3ICBA 4GAOA 2NXQA 2M3WA 3CWGA 1F8HA 1SNLA 4ORBB 1SR6C 2LNKA 1EXRA 2ZKMX 4JPZB 5AXIA 1PRWA 1B4CA 1NIWA 1DF0B 1J7OA 4M2QA 5JOLA 1YTZC 1SY9A 3HCMA 1QATA 4ORCB 1CFCA 1F4QA 2LVVA 4MZJA 2LANA 4PHKA 1NWDA 1WLZA 1C7WA 1TRFA 4MBEA 4C0KA 1XFYO 2GGZA 1B8CA 3DF0B 2F33A 4YGBB 2JQ6A 1IWQA 3CS1A 2G2BA 1YVLA 3PM8A 2G9BA 2M49B 1CDPA 5DKRA 4MRXA 1XYDA 2K8MB 1L2OB 1QIWA 3VRRA 2HQ8A 3NSOA 2L4IA 1XA5A 4OVNF 1UP5A 2WOSA 1A75A 1RWYA 2BKIB 1QV1A 5JJGA 1CKKA 1SPYA 3OB1B 4GNKB 1XFVO 1A03A 4A4BA 2FOTA 2MAZA 2L0PA 2KSPA 1NCYA 3ZWHA 2JULA 1QX7A 2Y5IA 3BUMB 2AUCA 3GK1A 3C1VA 1EJ3A 3GK4X 2KYCA 1KWOB 2FJUB 1WRZA 1BJFA 1CDMA 1CNPA 3PSRA 2LHIA 1TNPA 1DGVA 3VRPA 2LMTA 1V1GA 1IG5A 1Y0VH 5K89A 2ZRTA 1G33A 1OZSA 3LL8B 4ICBA 4I5NB 1F55A 1IQ5A 3D0YA 4XJKA 1L2OC 3DVMA 1M45A 1M46A 2LLUA 4R1EA 2M9GA 1DJGA 4WQ3A 1KQVA 4CPVA 1OE9B 1B7TY 2R2IA 3OX6A 1CFFA 1YRTB 1W7IB 1SBJA 2M1KB 2LP2A 1QTXA 2F3ZA 2BCAA 1ALVA 2ZNEA 2IS9A 3M0WA 1PSRA 3BYAA 5IBWA 2SCPA 1PK0D 2LCPA 3SIAA 2F3YA 2I7AA 3OX5A 1JBAA 1B7TZ 2JU0A 2LMUA 2JOJA 1M31A 1PVAA 2WCFA 2LAPA 3TZ1A 5ER5A 3HX4A 4I5KA 4YI8A 1QVIY 1KWOC 4GPLB 4GGFC 4L9MA 4MRYA 3OHMB 1FI5A 1XFXO 1K94A 1KCYA 1F4OA 1Y1UA 1OZOA 2CTNA 2QPTA 3NXAA 1QVIZ 2JT3A 2M0RA 4MN0A 4DRWA 1WLMA 3JVTB 2MRDA 4FTGA 2K7CA 4E68A 3IQQA 4CFRA 1UURA 1SRAA 1SR6B 2Y1NA 1DF0A 1K90D 2JZIA 1J1EA 1R6PA 5HLVA 4YRUA 2AMIA 3TUYB 5HKWA 4AQIA 1D1OA 4ETOA 2O60A 3EK4A 3I5FB 2L50A 1K93D 5CSNA 2LLSA 2MLEC 1J7QA 2M29A 1TIZA 3CLNA 2F2OA 3DF0A 2KYFA 5KU1A 4OR9B 1XFZO 1YR5A 2L4HA 2P6BB 2KFHA 4PHNA 3NSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C07 A;  1R2U A;  2LVI A;  1XFW O;  1L7Z A;  4IL1 A;  1EG3 A;  2HQW A;  1BOD A;  2F2P A;  2HPS A;  1NP8 A;  1CTR A;  2OS8 B;  1UHH A;  1NCX A;  3TDZ A;  1NCZ A;  3SG4 A;  5HKZ A;  1S26 D;  2PMY A;  4P2Y B;  3AKB A;  1RFJ A;  4WQ2 A;  1CFP A;  5CSF A;  3TUY C;  1QS7 A;  3JTD C;  1BOC A;  3LCP C;  4NDC A;  3I5F C;  1H4B A;  1ZMZ A;  3ZNI A;  4N1G A;  3MSE B;  1V1F A;  2CBL A;  4GGF A;  1LA3 A;  1AVS A;  5B8I B;  3VRO A;  2LC5 A;  2E6W A;  1MUX A;  1UHN A;  2PVB A;  5AAN A;  2JTZ A;  1QLS A;  1S36 A;  2BCB A;  2JT0 A;  2EHB A;  2PAS A;  3EKJ A;  3KHE A;  3OP0 A;  3BUO B;  4BY5 A;  1OSA A;  4WRI A;  2LE9 B;  2PSR A;  4M2P A;  1TOP A;  2FCD A;  2CNP A;  2E30 A;  3LK1 A;  2AAO A;  4F0Z B;  1VRK A;  5AER A;  3SG2 A;  4PHM A;  1CLM A;  1B9A A;  1S5G Y;  3BUW B;  2BBM A;  1TTX A;  2EC6 B;  2EGD A;  2OS8 C;  1OMD A;  3DVK A;  5D69 A;  3WHT B;  1KK7 Y;  1IH0 A;  3PFV A;  3KO0 A;  2L98 A;  5F6T A;  1DMO A;  2KI6 D;  1HT9 A;  1AK8 A;  1SK6 D;  1SL9 A;  1S5G Z;  2ZFD A;  1CLB A;  2KAY A;  2KDH A;  1KK7 Z;  1OOJ A;  2VRG A;  4DS7 A;  1JFJ A;  1FI6 A;  2PAL A;  1MXL C;  5CPV A;  1HQV A;  1CM4 A;  1GGZ A;  1JUO A;  2LVK A;  4Q04 A;  2KFG A;  3BXK A;  2KI4 C;  1Y1A A;  3I5I B;  2NCP A;  1U5I A;  4MEW A;  1QAS A;  1F70 A;  1KFU S;  2OTG B;  5ER4 X;  2JT8 A;  4A4C A;  2H2K A;  2WCB A;  1BU3 A;  4AQJ A;  2KAV A;  1RJV A;  4DCK A;  1BR4 B;  1NPQ A;  3AKA A;  2JXC A;  4XYN A;  1B8L A;  3A8R A;  1YX8 A;  4BY4 A;  3CZT X;  2EC6 C;  2MA2 A;  5G08 A;  1A29 A;  2SAS A;  5BPJ A;  1FW4 A;  2ZN8 A;  1TNX A;  3BUX B;  1SL8 A;  1XVJ A;  1KSO A;  3DD4 A;  4OKH A;  1AJ5 A;  2K0J A;  3CR4 X;  5HYD A;  3LK0 A;  1XO5 A;  1YUR A;  1JF2 A;  2TN4 A;  1QXP A;  1G4Y R;  5FYX A;  1BLQ A;  2JTT A;  2ZRS A;  1PUL A;  2FCE A;  3TDI A;  1F54 A;  2O5G A;  1YUT A;  1N65 A;  1IKU A;  2DOQ A;  2KNE A;  4HSZ A;  3I5I C;  4QJ4 B;  2ZN9 A;  1SL7 A;  3CR2 A;  1F71 A;  3WXA A;  2BBN A;  3EVV A;  5CSI A;  2OTG C;  1EL4 A;  1U5I B;  5J3X A;  5I2O A;  1NYA A;  3BOW A;  2KOT A;  2HF5 A;  1XFU O;  1KSM A;  1NX3 A;  1UHI A;  2BE4 A;  2K7B A;  4NDD A;  1TCO B;  1AJ4 A;  2K7O A;  3O4Y A;  2COL B;  1K96 A;  1GGW A;  4NQG A;  4PE1 A;  2HET A;  4OV2 A;  2GGM A;  1PSB A;  2A4J A;  2H61 C;  1JWD A;  2NLN A;  3JTD B;  1BF5 A;  1BG1 A;  2BEC A;  1IGV A;  1K9U A;  2JNX A;  3EVU A;  2MLF C;  4M2O A;  4PAL A;  5CSJ A;  1B8R A;  3KPX A;  4N1F A;  1M63 B;  3TDU A;  1LIN A;  1WRK A;  1YUS A;  2LLT A;  1OMR A;  2JNF A;  2ISD A;  4PE0 A;  1N2D A;  2K2A A;  1NX2 A;  2LVJ A;  2PRU A;  1TNW A;  5DKN A;  1Y6W A;  5TNC A;  1NSH A;  4MLW A;  1X02 A;  1EG4 A;  1K2H A;  2KFF A;  1DJX A;  4YI9 A;  2OPO A;  3FIA A;  1QV0 A;  3RLZ A;  3BOW B;  3O2P A;  4I5J A;  4YGA A;  1N0Y A;  3O78 A;  2I94 A;  2Y4Q A;  1WRL A;  2LP3 A;  1KFX S;  1UWO A;  4MVF A;  4ORA B;  3CR5 X;  4TNC A;  1RK9 A;  3PN7 B;  3AAK A;  2KGR A;  5I2Q A;  3O6B A;  3A4U B;  1NX0 A;  1OQP A;  2NCO A;  2L2E A;  2I18 A;  1S6C A;  1CFD A;  1J7R A;  1SMG A;  3QRX A;  2KI4 B;  3D10 A;  1H8B A;  4MZL A;  2K61 A;  1SCV A;  1GQM A;  1KQM C;  1ODB A;  1MR8 A;  1TNQ A;  2KAX A;  4YGC B;  5PAL A;  4CFQ A;  3CTN A;  2WND A;  3DVE A;  2BCX A;  1S1E A;  1KK8 B;  1UUS A;  1TN4 A;  1WDC B;  1XK4 C;  2LM5 A;  1M39 A;  3SG5 A;  1W7J B;  5KTY A;  3WHU B;  1J7P A;  2CCM A;  4HRG A;  3LLE A;  2JC2 A;  1IJ6 A;  1A2X A;  4U8D A;  4PHJ A;  1JSA A;  1DT7 B;  1S6I A;  1QLK A;  2H61 A;  3I5H B;  1MQ1 A;  1LVC D;  1YX7 A;  1BMO A;  2NZ0 A;  3SG6 A;  1FBV A;  2Q91 A;  1RRO A;  3FS7 A;  3PN7 C;  3RM1 A;  1JC2 A;  1ZUZ A;  1J1D A;  3SIB A;  1KFU L;  3SG7 A;  2ZND A;  4JQ0 D;  2M7N A;  3GOF A;  3GK2 A;  1DJI A;  1ZOT B;  2M1U A;  2LMV A;  2KI6 C;  2MHH A;  1TCF A;  4C0L A;  4GGN A;  3EK8 A;  4UPG A;  2QAC A;  4DUQ A;  1KK8 C;  1QIV A;  1WDC C;  1YRU B;  2JXL A;  3EK7 A;  1SW8 A;  2BKH B;  1Q80 A;  1IJ5 A;  2JRF A;  1IQ3 A;  1DGU A;  2LUX A;  3BUN B;  1Y1X A;  1REC A;  4ZCU A;  5AEQ A;  1EH2 A;  3I5H C;  3VRN A;  2M97 A;  3FWB A;  1BR1 B;  2MJW B;  1DJZ A;  2KQ6 A;  1GJY A;  1J55 A;  1QJT A;  2WCE A;  5HLO A;  3SG3 A;  2WOR A;  4PE4 A;  1C7V A;  1SYM A;  2GV5 A;  1K95 A;  4YGE B;  1PVB A;  1CMF A;  4D1E A;  1SKT A;  1BT6 A;  1AUI B;  1ZFS A;  1DJW A;  1FPW A;  2LV7 A;  3CGA A;  4CID A;  1DTL A;  2LUC A;  1OMV A;  1XK4 A;  4OCI A;  5HKY A;  2I2R E;  2M8U A;  1CMG A;  4GBA A;  4MZK A;  1SCM B;  4HRH A;  5DKQ A;  1S3P A;  2L5X B;  3PLF B;  2K2F A;  2KGB C;  2BL0 B;  3EVR A;  1NUB A;  3NSK A;  1A75 B;  4YBH B;  1CDN A;  3VGO A;  1LKJ A;  4PE7 A;  3E3R A;  1YUU A;  2B1U A;  4PDZ A;  4QJ3 B;  3H4S E;  2KQY A;  4QJ5 B;  1FF1 A;  4FQO A;  3NSL A;  1DVI A;  5I8N A;  5AFP A;  3TS5 B;  2JWW A;  4JWQ A;  2KBM A;  1WY9 A;  3I5G B;  4ZCV A;  1YVH A;  4P5O E;  1MWN A;  1CLL A;  1CDL A;  5D7F A;  2KBI A;  3PAL A;  2LHL A;  1QX5 B;  3K21 A;  1NX1 A;  2M7L A;  2JPT A;  4PCW A;  1IRJ A;  2CT9 A;  1E8A A;  1KQM B;  1ZAC A;  4MSP A;  1LA0 A;  3FWC A;  1MXE A;  2CXJ A;  1PAL A;  5GQQ C;  3D0Y B;  3WNX B;  4XJK B;  1QX2 A;  2WC8 A;  1SCM C;  3PAT A;  1KFX L;  4AOM A;  1AP4 A;  1K9K A;  1B47 A;  2MBX A;  5KSZ A;  1K9P A;  1CB1 A;  4GUK A;  2BL0 C;  2F8P A;  2V53 A;  3DVJ A;  3KEV A;  1UHK A;  1DJH A;  1AHR A;  3AAJ A;  2BE6 A;  4GFT A;  4C0J A;  2D8N A;  1LXF C;  2K7D A;  1CM1 A;  2L51 A;  4I5L B;  2Y1M A;  3SJS A;  5I2L A;  3IF7 A;  4USL A;  1JF0 A;  1MHO A;  4CLN A;  1DJY A;  3F45 A;  4DIR A;  1ALW A;  3TS5 C;  4HRE E;  1MF8 B;  3VRQ A;  3I5G C;  1UHJ A;  2RGI A;  4YGD B;  1G8I A;  4N5X A;  1B1G A;  3BQ3 A;  2Q4U A;  1A4P A;  1S6J A;  2KHN A;  1K8U A;  1JFK A;  3EKH A;  3IQO A;  3KF9 A;  1RTP 1;  3JVT C;  3OB2 B;  4NDB A;  3ICB A;  4GAO A;  2NXQ A;  2M3W A;  3CWG A;  1F8H A;  1SNL A;  4ORB B;  1SR6 C;  2LNK A;  1EXR A;  2ZKM X;  4JPZ B;  5AXI A;  1PRW A;  1B4C A;  1NIW A;  1DF0 B;  1J7O A;  4M2Q A;  5JOL A;  1YTZ C;  1SY9 A;  3HCM A;  1QAT A;  4ORC B;  1CFC A;  1F4Q A;  2LVV A;  4MZJ A;  2LAN A;  4PHK A;  1NWD A;  1WLZ A;  1C7W A;  1TRF A;  4MBE A;  4C0K A;  1XFY O;  2GGZ A;  1B8C A;  3DF0 B;  2F33 A;  4YGB B;  2JQ6 A;  1IWQ A;  3CS1 A;  2G2B A;  1YVL A;  3PM8 A;  2G9B A;  2M49 B;  1CDP A;  5DKR A;  4MRX A;  1XYD A;  2K8M B;  1L2O B;  1QIW A;  3VRR A;  2HQ8 A;  3NSO A;  2L4I A;  1XA5 A;  4OVN F;  1UP5 A;  2WOS A;  1A75 A;  1RWY A;  2BKI B;  1QV1 A;  5JJG A;  1CKK A;  1SPY A;  3OB1 B;  4GNK B;  1XFV O;  1A03 A;  4A4B A;  2FOT A;  2MAZ A;  2L0P A;  2KSP A;  1NCY A;  3ZWH A;  2JUL A;  1QX7 A;  2Y5I A;  3BUM B;  2AUC A;  3GK1 A;  3C1V A;  1EJ3 A;  3GK4 X;  2KYC A;  1KWO B;  2FJU B;  1WRZ A;  1BJF A;  1CDM A;  1CNP A;  3PSR A;  2LHI A;  1TNP A;  1DGV A;  3VRP A;  2LMT A;  1V1G A;  1IG5 A;  1Y0V H;  5K89 A;  2ZRT A;  1G33 A;  1OZS A;  3LL8 B;  4ICB A;  4I5N B;  1F55 A;  1IQ5 A;  3D0Y A;  4XJK A;  1L2O C;  3DVM A;  1M45 A;  1M46 A;  2LLU A;  4R1E A;  2M9G A;  1DJG A;  4WQ3 A;  1KQV A;  4CPV A;  1OE9 B;  1B7T Y;  2R2I A;  3OX6 A;  1CFF A;  1YRT B;  1W7I B;  1SBJ A;  2M1K B;  2LP2 A;  1QTX A;  2F3Z A;  2BCA A;  1ALV A;  2ZNE A;  2IS9 A;  3M0W A;  1PSR A;  3BYA A;  5IBW A;  2SCP A;  1PK0 D;  2LCP A;  3SIA A;  2F3Y A;  2I7A A;  3OX5 A;  1JBA A;  1B7T Z;  2JU0 A;  2LMU A;  2JOJ A;  1M31 A;  1PVA A;  2WCF A;  2LAP A;  3TZ1 A;  5ER5 A;  3HX4 A;  4I5K A;  4YI8 A;  1QVI Y;  1KWO C;  4GPL B;  4GGF C;  4L9M A;  4MRY A;  3OHM B;  1FI5 A;  1XFX O;  1K94 A;  1KCY A;  1F4O A;  1Y1U A;  1OZO A;  2CTN A;  2QPT A;  3NXA A;  1QVI Z;  2JT3 A;  2M0R A;  4MN0 A;  4DRW A;  1WLM A;  3JVT B;  2MRD A;  4FTG A;  2K7C A;  4E68 A;  3IQQ A;  4CFR A;  1UUR A;  1SRA A;  1SR6 B;  2Y1N A;  1DF0 A;  1K90 D;  2JZI A;  1J1E A;  1R6P A;  5HLV A;  4YRU A;  2AMI A;  3TUY B;  5HKW A;  4AQI A;  1D1O A;  4ETO A;  2O60 A;  3EK4 A;  3I5F B;  2L50 A;  1K93 D;  5CSN A;  2LLS A;  2MLE C;  1J7Q A;  2M29 A;  1TIZ A;  3CLN A;  2F2O A;  3DF0 A;  2KYF A;  5KU1 A;  4OR9 B;  1XFZ O;  1YR5 A;  2L4H A;  2P6B B;  2KFH A;  4PHN A;  3NSI A; 
#chains in the Genus database with same CATH topology
 1FI6 A;  1C07 A;  1R2U A;  1DEK A;  3Q8I A;  2LVI A;  1XFW O;  1L7Z A;  3QME A;  4IL1 A;  1EG3 A;  2HQW A;  3FE9 A;  1BOD A;  2F2P A;  2HPS A;  3S0G A;  1NP8 A;  1CTR A;  3SS3 A;  2OS8 B;  1UHH A;  1NCX A;  3TDZ A;  3OGN A;  1NCZ A;  3SG4 A;  5HKZ A;  1S26 D;  2PMY A;  4P2Y B;  3AKB A;  1RFJ A;  3D77 A;  4WQ2 A;  1CFP A;  5CSF A;  3TUY C;  1QS7 A;  3JTD C;  1BOC A;  3LCP C;  3R72 A;  4NDC A;  3I5F C;  1H4B A;  1ZMZ A;  3ZNI A;  4N1G A;  3MSE B;  1V1F A;  2CBL A;  4GGF A;  1LA3 A;  1AVS A;  5B8I B;  3VRO A;  2LC5 A;  2E6W A;  1MUX A;  1UHN A;  2PVB A;  5AAN A;  1C3Z A;  2JTZ A;  1QLS A;  1S36 A;  2BCB A;  2JT0 A;  2EHB A;  2PAS A;  3EKJ A;  3KHE A;  3OP0 A;  3BUO B;  4BY5 A;  1OSA A;  4WRI A;  4JKT A;  2LE9 B;  2PSR A;  4M2P A;  1TOP A;  2FCD A;  2CNP A;  2E30 A;  3LK1 A;  2AAO A;  4F0Z B;  3VB1 A;  1VRK A;  2PQL A;  5AER A;  1T14 A;  3SG2 A;  3FE8 A;  4PHM A;  1CLM A;  1B9A A;  4IJ7 A;  1S5G Y;  3BUW B;  2BBM A;  1TTX A;  2EC6 B;  4JD9 A;  2EGD A;  2OS8 C;  1OMD A;  1Z2C B;  3DVK A;  5D69 A;  1KK7 Y;  3WHT B;  1IH0 A;  3PFV A;  3KO0 A;  2L98 A;  4PT1 A;  5F6T A;  2KI6 D;  1DMO A;  1HT9 A;  1AK8 A;  1SK6 D;  1SL9 A;  1S5G Z;  2ZFD A;  3D74 A;  1CLB A;  2KAY A;  2KDH A;  1KK7 Z;  1OOJ A;  2VRG A;  4DS7 A;  1JFJ A;  3B86 A;  2PYQ A;  2PAL A;  1MXL C;  1OOG A;  3V2L A;  5CPV A;  1HQV A;  1CM4 A;  1GGZ A;  1JUO A;  2LVK A;  3NGV A;  3D76 A;  4Q04 A;  2KFG A;  3BXK A;  2KI4 C;  1Y1A A;  3I5I B;  1TUZ A;  2NCP A;  2P71 A;  1U5I A;  5EL2 A;  4MEW A;  1QAS A;  1F70 A;  1KFU S;  2OTG B;  5ER4 X;  2JT8 A;  4A4C A;  2H2K A;  2WCB A;  1BU3 A;  4AQJ A;  2KAV A;  1RJV A;  4DCK A;  1BR4 B;  1NPQ A;  3AKA A;  2JXC A;  4XYN A;  1B8L A;  4INW A;  3A8R A;  1YX8 A;  4BY4 A;  3CZT X;  2BNX A;  2EC6 C;  2MA2 A;  3DYE A;  2BAP A;  5G08 A;  1SSE B;  1A29 A;  2SAS A;  5BPJ A;  1FW4 A;  2ZN8 A;  1TNX A;  3BUX B;  1SL8 A;  1XVJ A;  1DQE A;  1KSO A;  3DD4 A;  4OKH A;  1AJ5 A;  2K0J A;  3CR4 X;  5HYD A;  3LK0 A;  1C3Y A;  1XO5 A;  1YUR A;  1JF2 A;  2TN4 A;  1QXP A;  1G4Y R;  5FYX A;  1BLQ A;  2JTT A;  2ZRS A;  1PUL A;  2FCE A;  3TDI A;  1F54 A;  2O5G A;  1YUT A;  3S0B A;  1N65 A;  1IKU A;  2DOQ A;  2KNE A;  4HSZ A;  3I5I C;  4QJ4 B;  2ZN9 A;  1SL7 A;  3B7A A;  3CR2 A;  1F71 A;  3WXA A;  2BBN A;  3EVV A;  5CSI A;  2OTG C;  1EL4 A;  1U5I B;  5J3X A;  5I2O A;  3DZT A;  1NYA A;  3BOW A;  2KOT A;  2HF5 A;  1XFU O;  3L4A A;  1KSM A;  1NX3 A;  3CZ1 A;  1UHI A;  2BE4 A;  2K7B A;  4NDD A;  5D3O A;  1TCO B;  1AJ4 A;  2K7O A;  3O4Y A;  2COL B;  1K96 A;  5DIC A;  1GGW A;  4NQG A;  4PE1 A;  2HET A;  4OV2 A;  2GGM A;  1PSB A;  2A4J A;  2H61 C;  1JWD A;  2NLN A;  3JTD B;  1BF5 A;  3S0D A;  1BG1 A;  2BEC A;  1IGV A;  1K9U A;  2JNX A;  3EVU A;  2KPH A;  2MLF C;  4M2O A;  3D78 A;  4PAL A;  5CSJ A;  1B8R A;  3B6X A;  3KPX A;  4N1F A;  1M63 B;  3TDU A;  1LIN A;  1WRK A;  1YUS A;  2LLT A;  1OMR A;  2JNF A;  2ISD A;  4PE0 A;  1N2D A;  2K2A A;  1NX2 A;  1OOI X;  2LVJ A;  2PRU A;  2WCL A;  1OOH A;  1TNW A;  1LS8 A;  5DKN A;  1Y6W A;  5TNC A;  1NSH A;  4MLW A;  1X02 A;  1EG4 A;  1K2H A;  2KFF A;  1DJX A;  4YI9 A;  2OPO A;  3D73 A;  1QV0 A;  3FIA A;  3RLZ A;  3BOW B;  3O2P A;  4I5J A;  4YGA A;  1N0Y A;  3O78 A;  2I94 A;  2Y4Q A;  2WC6 A;  1WRL A;  2LP3 A;  5FI2 A;  1KFX S;  3R1O A;  1UWO A;  4MVF A;  3DY9 A;  4ORA B;  3CR5 X;  4TNC A;  1RK9 A;  3PN7 B;  3AAK A;  2KGR A;  5I2Q A;  3O6B A;  3A4U B;  3D75 A;  1NX0 A;  1OQP A;  2WCJ A;  3CAB A;  2NCO A;  2L2E A;  2I18 A;  1S6C A;  1CFD A;  1J7R A;  1SMG A;  2K60 A;  3QRX A;  2KI4 B;  3D10 A;  1H8B A;  4MZL A;  2K61 A;  1SCV A;  1GQM A;  1KQM C;  1ODB A;  1MR8 A;  1TNQ A;  2KAX A;  4YGC B;  5PAL A;  4CFQ A;  1OW4 A;  2WND A;  3CTN A;  3DVE A;  2BCX A;  1S1E A;  1KK8 B;  1UUS A;  1TN4 A;  1WDC B;  1XK4 C;  2LM5 A;  1M39 A;  3SG5 A;  1W7J B;  5KTY A;  3WHU B;  1J7P A;  2CCM A;  3CYZ A;  4OZD A;  4HRG A;  3LLE A;  2JC2 A;  1IJ6 A;  1A2X A;  4U8D A;  4PHJ A;  3B88 A;  1JSA A;  1DT7 B;  1S6I A;  1QLK A;  2H61 A;  3I5H B;  1MQ1 A;  1LVC D;  1YX7 A;  1BMO A;  2NZ0 A;  3EG5 B;  5HL1 A;  3SG6 A;  1FBV A;  2Q91 A;  1RRO A;  3FS7 A;  3PN7 C;  3RM1 A;  3CZ2 A;  1JC2 A;  1ZUZ A;  1J1D A;  3SIB A;  1KFU L;  3SG7 A;  2ZND A;  4JQ0 D;  2M7N A;  2QEH A;  3GOF A;  3GK2 A;  1DJI A;  1ZOT B;  2M1U A;  2WCK A;  2LMV A;  2KI6 C;  2MHH A;  1TCF A;  4C0L A;  4GGN A;  3EK8 A;  4UPG A;  2QAC A;  4DUQ A;  1KK8 C;  1QIV A;  1WDC C;  1YRU B;  2JXL A;  3EK7 A;  1SW8 A;  2BKH B;  1Q80 A;  1IJ5 A;  2JRF A;  1IQ3 A;  1DGU A;  2LUX A;  3BUN B;  1Y1X A;  1REC A;  4ZCU A;  5AEQ A;  1EH2 A;  3I5H C;  3VRN A;  1XFR A;  2M97 A;  3DXL A;  3FWB A;  1BR1 B;  2MJW B;  1DJZ A;  2KQ6 A;  1GJY A;  1J55 A;  1QJT A;  1TUJ A;  2WCE A;  5HLO A;  2WCH A;  3SG3 A;  2WOR A;  4PE4 A;  1C7V A;  1SYM A;  2GV5 A;  1K95 A;  4YGE B;  1PVB A;  1CMF A;  4D1E A;  1SKT A;  1BT6 A;  1AUI B;  1ZFS A;  1DJW A;  3N7H A;  1FPW A;  2LV7 A;  3CGA A;  3B87 A;  4CID A;  1DTL A;  2LUC A;  1OMV A;  1XK4 A;  3FE6 A;  4OCI A;  2I2R E;  2M8U A;  5HKY A;  1CMG A;  4GBA A;  4MZK A;  1SCM B;  4HRH A;  3NHT A;  5DKQ A;  1S3P A;  2L5X B;  3PLF B;  2K2F A;  2KGB C;  2BL0 B;  3EVR A;  1NUB A;  3NSK A;  1A75 B;  4YBH B;  1CDN A;  3VGO A;  1LKJ A;  4PE7 A;  2QDI A;  3E3R A;  1YUU A;  2B1U A;  4PDZ A;  4QJ3 B;  3H4S E;  2KQY A;  4QJ5 B;  1FF1 A;  4FQO A;  3SS5 A;  3NSL A;  1DVI A;  5I8N A;  5AFP A;  3TS5 B;  2JWW A;  4JWQ A;  2H8V A;  2KBM A;  1WY9 A;  3I5G B;  4ZCV A;  1YVH A;  4P5O E;  1MWN A;  1CLL A;  1CDL A;  5D7F A;  2KBI A;  3PAL A;  2LHL A;  1QX5 B;  3K21 A;  1NX1 A;  2M7L A;  2JPT A;  4PCW A;  1IRJ A;  1E8A A;  1ZAC A;  1KQM B;  2CT9 A;  3PM2 A;  1LA0 A;  3FWC A;  1MXE A;  2CXJ A;  1PAL A;  4MSP A;  1QWV A;  5GQQ C;  3D0Y B;  3WNX B;  4XJK B;  1QX2 A;  2WC8 A;  1SCM C;  3BFB A;  3PAT A;  1KFX L;  2WC5 A;  2JPO A;  4AOM A;  1AP4 A;  1K9K A;  1B47 A;  2MBX A;  5KSZ A;  1K9P A;  1CB1 A;  4GUK A;  2BL0 C;  2F8P A;  2V53 A;  3DVJ A;  3KEV A;  1UHK A;  1DJH A;  1AHR A;  3AAJ A;  2QEB A;  2BE6 A;  4GFT A;  4C0J A;  2D8N A;  1LXF C;  2K7D A;  1CM1 A;  1TWO A;  2L51 A;  4I5L B;  2Y1M A;  2WCM A;  3SJS A;  5I2L A;  3IF7 A;  4USL A;  1JF0 A;  1MHO A;  4CLN A;  1DJY A;  3F45 A;  4DIR A;  1ALW A;  3TS5 C;  3BJH A;  4HRE E;  1MF8 B;  3VRQ A;  3I5G C;  3RZS A;  4F7F A;  1UHJ A;  2RGI A;  4YGD B;  3UNW A;  1G8I A;  4N5X A;  1B1G A;  3BQ3 A;  3O4X A;  2Q4U A;  1W9Z A;  1A4P A;  1S6J A;  2FJY A;  2KHN A;  1K8U A;  1JFK A;  3EKH A;  3IQO A;  3KF9 A;  1RTP 1;  3JVT C;  3OB2 B;  4INX A;  4NDB A;  3ICB A;  4GAO A;  2ERB A;  2NXQ A;  2M3W A;  3CWG A;  1F8H A;  1SNL A;  4ORB B;  1SR6 C;  2LNK A;  1EXR A;  2ZKM X;  4JPZ B;  5FI7 A;  5AXI A;  1PRW A;  1B4C A;  1NIW A;  1DF0 B;  2GTE A;  1J7O A;  4M2Q A;  5JOL A;  1YTZ C;  1SY9 A;  2QEV A;  1QAT A;  3HCM A;  4ORC B;  3R1V A;  1F4Q A;  2LVV A;  4MZJ A;  1CFC A;  2LAN A;  2L5Y A;  4PHK A;  1NWD A;  1WLZ A;  3BFA A;  1C7W A;  1TRF A;  3S0F A;  4MBE A;  4C0K A;  1XFY O;  2GGZ A;  1B8C A;  5I94 A;  1OOF A;  3DF0 B;  2F33 A;  4YGB B;  2JQ6 A;  3R1P A;  1IWQ A;  3CS1 A;  2G2B A;  1YVL A;  3PM8 A;  4FQT A;  2G9B A;  2M49 B;  1CDP A;  5DKR A;  4MRX A;  1XYD A;  2K8M B;  1L2O B;  1QIW A;  3VRR A;  3K1E A;  2HQ8 A;  3NSO A;  2L4I A;  1XA5 A;  3OBV A;  4OVN F;  1UP5 A;  2WOS A;  1A75 A;  1RWY A;  2BKI B;  1QV1 A;  5JJG A;  1CKK A;  1SPY A;  3OB1 B;  4GNK B;  1XFV O;  1A03 A;  4A4B A;  2FOT A;  2MAZ A;  3SS4 A;  2L0P A;  2KSP A;  1NCY A;  3ZWH A;  2JUL A;  1QX7 A;  2Y5I A;  3BUM B;  2AUC A;  3GK1 A;  3C1V A;  1EJ3 A;  3GK4 X;  2KYC A;  1KWO B;  2FJU B;  1WRZ A;  1BJF A;  1CDM A;  1CNP A;  3PSR A;  2LHI A;  1TNP A;  1DGV A;  3VRP A;  2LMT A;  1V1G A;  3CZ0 A;  1IG5 A;  1Y0V H;  2QEO A;  5K89 A;  2ZRT A;  1G33 A;  1OZS A;  3LL8 B;  4ICB A;  4I5N B;  1F55 A;  1IQ5 A;  3D0Y A;  2L2C A;  3NHI A;  4XJK A;  1L2O C;  3DVM A;  1M45 A;  1M46 A;  2LLU A;  4R1E A;  2M9G A;  1DJG A;  4WQ3 A;  2YGU A;  1KQV A;  3L4L A;  4CPV A;  1OE9 B;  1B7T Y;  2R2I A;  3OX6 A;  2P70 A;  1CFF A;  1YRT B;  1W7I B;  1SBJ A;  2M1K B;  2LP2 A;  1QTX A;  2F3Z A;  2BCA A;  1ALV A;  2ZNE A;  2IS9 A;  3M0W A;  1PSR A;  3BYA A;  5IBW A;  2SCP A;  1PK0 D;  2LCP A;  3SIA A;  2F3Y A;  2I7A A;  3OX5 A;  1JBA A;  1B7T Z;  3UO9 A;  2JU0 A;  2LMU A;  2JOJ A;  1M31 A;  1PVA A;  3IVT A;  2WCF A;  2LAP A;  3TZ1 A;  5ER5 A;  3S0E A;  3HX4 A;  4I5K A;  4YI8 A;  3S0A A;  1QVI Y;  1KWO C;  4GPL B;  3L47 A;  2KLD A;  4GGF C;  4L9M A;  4MRY A;  3OHM B;  1FI5 A;  1XFX O;  1K94 A;  1KCY A;  1F4O A;  1Y1U A;  1OZO A;  2CTN A;  2QPT A;  3NXA A;  1QVI Z;  2JT3 A;  2M0R A;  4MN0 A;  4DRW A;  1WLM A;  3JVT B;  2MRD A;  4FTG A;  1GM0 A;  2K7C A;  4E68 A;  3IQQ A;  4CFR A;  1UUR A;  1SRA A;  1SR6 B;  2Y1N A;  1DF0 A;  1K90 D;  2JZI A;  1J1E A;  4KYN A;  1R6P A;  5FI6 A;  5HLV A;  4YRU A;  2AMI A;  3TUY B;  5HKW A;  4AQI A;  1D1O A;  4ETO A;  1DEL A;  2O60 A;  3EK4 A;  1ORG A;  3I5F B;  2L50 A;  1K93 D;  5CSN A;  2LLS A;  2MLE C;  3BFH A;  1DC1 A;  1Z4H A;  1J7Q A;  3CDN A;  2M29 A;  1TIZ A;  2KLE A;  3CLN A;  2F2O A;  3DF0 A;  1IIO A;  2KYF A;  5KU1 A;  4OR9 B;  1XFZ O;  1YR5 A;  2L4H A;  2P6B B;  2KFH A;  4PHN A;  3PJI A;  1P28 A;  3NSI A; 
#chains in the Genus database with same CATH homology
 1C07 A;  1R2U A;  2LVI A;  1XFW O;  1L7Z A;  4IL1 A;  1EG3 A;  2HQW A;  1BOD A;  2F2P A;  2HPS A;  1NP8 A;  1CTR A;  2OS8 B;  1UHH A;  1NCX A;  3TDZ A;  1NCZ A;  3SG4 A;  5HKZ A;  1S26 D;  2PMY A;  4P2Y B;  3AKB A;  1RFJ A;  4WQ2 A;  1CFP A;  5CSF A;  3TUY C;  1QS7 A;  3JTD C;  1BOC A;  3LCP C;  4NDC A;  3I5F C;  1H4B A;  1ZMZ A;  3ZNI A;  4N1G A;  3MSE B;  1V1F A;  2CBL A;  4GGF A;  1LA3 A;  1AVS A;  5B8I B;  3VRO A;  2LC5 A;  2E6W A;  1MUX A;  1UHN A;  2PVB A;  5AAN A;  2JTZ A;  1QLS A;  1S36 A;  2BCB A;  2JT0 A;  2EHB A;  2PAS A;  3EKJ A;  3KHE A;  3OP0 A;  3BUO B;  4BY5 A;  1OSA A;  4WRI A;  2LE9 B;  2PSR A;  4M2P A;  1TOP A;  2FCD A;  2CNP A;  2E30 A;  3LK1 A;  2AAO A;  4F0Z B;  1VRK A;  5AER A;  3SG2 A;  4PHM A;  1CLM A;  1B9A A;  1S5G Y;  3BUW B;  2BBM A;  1TTX A;  2EC6 B;  2EGD A;  2OS8 C;  1OMD A;  3DVK A;  5D69 A;  3WHT B;  1KK7 Y;  1IH0 A;  3PFV A;  3KO0 A;  2L98 A;  5F6T A;  1DMO A;  2KI6 D;  1HT9 A;  1AK8 A;  1SK6 D;  1SL9 A;  1S5G Z;  2ZFD A;  1CLB A;  2KAY A;  2KDH A;  1KK7 Z;  1OOJ A;  2VRG A;  4DS7 A;  1JFJ A;  1FI6 A;  2PAL A;  1MXL C;  5CPV A;  1HQV A;  1CM4 A;  1GGZ A;  1JUO A;  2LVK A;  4Q04 A;  2KFG A;  3BXK A;  2KI4 C;  1Y1A A;  3I5I B;  2NCP A;  1U5I A;  4MEW A;  1QAS A;  1F70 A;  1KFU S;  2OTG B;  5ER4 X;  2JT8 A;  4A4C A;  2H2K A;  2WCB A;  1BU3 A;  4AQJ A;  2KAV A;  1RJV A;  4DCK A;  1BR4 B;  1NPQ A;  3AKA A;  2JXC A;  4XYN A;  1B8L A;  3A8R A;  1YX8 A;  4BY4 A;  3CZT X;  2EC6 C;  2MA2 A;  5G08 A;  1A29 A;  2SAS A;  5BPJ A;  1FW4 A;  2ZN8 A;  1TNX A;  3BUX B;  1SL8 A;  1XVJ A;  1KSO A;  3DD4 A;  4OKH A;  1AJ5 A;  2K0J A;  3CR4 X;  5HYD A;  3LK0 A;  1XO5 A;  1YUR A;  1JF2 A;  2TN4 A;  1QXP A;  1G4Y R;  5FYX A;  1BLQ A;  2JTT A;  2ZRS A;  1PUL A;  2FCE A;  3TDI A;  1F54 A;  2O5G A;  1YUT A;  1N65 A;  1IKU A;  2DOQ A;  2KNE A;  4HSZ A;  3I5I C;  4QJ4 B;  2ZN9 A;  1SL7 A;  3CR2 A;  1F71 A;  3WXA A;  2BBN A;  3EVV A;  5CSI A;  2OTG C;  1EL4 A;  1U5I B;  5J3X A;  5I2O A;  1NYA A;  3BOW A;  2KOT A;  2HF5 A;  1XFU O;  1KSM A;  1NX3 A;  1UHI A;  2BE4 A;  2K7B A;  4NDD A;  1TCO B;  1AJ4 A;  2K7O A;  3O4Y A;  2COL B;  1K96 A;  1GGW A;  4NQG A;  4PE1 A;  2HET A;  4OV2 A;  2GGM A;  1PSB A;  2A4J A;  2H61 C;  1JWD A;  2NLN A;  3JTD B;  1BF5 A;  1BG1 A;  2BEC A;  1IGV A;  1K9U A;  2JNX A;  3EVU A;  2MLF C;  4M2O A;  4PAL A;  5CSJ A;  1B8R A;  3KPX A;  4N1F A;  1M63 B;  3TDU A;  1LIN A;  1WRK A;  1YUS A;  2LLT A;  1OMR A;  2JNF A;  2ISD A;  4PE0 A;  1N2D A;  2K2A A;  1NX2 A;  2LVJ A;  2PRU A;  1TNW A;  5DKN A;  1Y6W A;  5TNC A;  1NSH A;  4MLW A;  1X02 A;  1EG4 A;  1K2H A;  2KFF A;  1DJX A;  4YI9 A;  2OPO A;  3FIA A;  1QV0 A;  3RLZ A;  3BOW B;  3O2P A;  4I5J A;  4YGA A;  1N0Y A;  3O78 A;  2I94 A;  2Y4Q A;  1WRL A;  2LP3 A;  1KFX S;  1UWO A;  4MVF A;  4ORA B;  3CR5 X;  4TNC A;  1RK9 A;  3PN7 B;  3AAK A;  2KGR A;  5I2Q A;  3O6B A;  3A4U B;  1NX0 A;  1OQP A;  2NCO A;  2L2E A;  2I18 A;  1S6C A;  1CFD A;  1J7R A;  1SMG A;  3QRX A;  2KI4 B;  3D10 A;  1H8B A;  4MZL A;  2K61 A;  1SCV A;  1GQM A;  1KQM C;  1ODB A;  1MR8 A;  1TNQ A;  2KAX A;  4YGC B;  5PAL A;  4CFQ A;  3CTN A;  2WND A;  3DVE A;  2BCX A;  1S1E A;  1KK8 B;  1UUS A;  1TN4 A;  1WDC B;  1XK4 C;  2LM5 A;  1M39 A;  3SG5 A;  1W7J B;  5KTY A;  3WHU B;  1J7P A;  2CCM A;  4HRG A;  3LLE A;  2JC2 A;  1IJ6 A;  1A2X A;  4U8D A;  4PHJ A;  1JSA A;  1DT7 B;  1S6I A;  1QLK A;  2H61 A;  3I5H B;  1MQ1 A;  1LVC D;  1YX7 A;  1BMO A;  2NZ0 A;  3SG6 A;  1FBV A;  2Q91 A;  1RRO A;  3FS7 A;  3PN7 C;  3RM1 A;  1JC2 A;  1ZUZ A;  1J1D A;  3SIB A;  1KFU L;  3SG7 A;  2ZND A;  4JQ0 D;  2M7N A;  3GOF A;  3GK2 A;  1DJI A;  1ZOT B;  2M1U A;  2LMV A;  2KI6 C;  2MHH A;  1TCF A;  4C0L A;  4GGN A;  3EK8 A;  4UPG A;  2QAC A;  4DUQ A;  1KK8 C;  1QIV A;  1WDC C;  1YRU B;  2JXL A;  3EK7 A;  1SW8 A;  2BKH B;  1Q80 A;  1IJ5 A;  2JRF A;  1IQ3 A;  1DGU A;  2LUX A;  3BUN B;  1Y1X A;  1REC A;  4ZCU A;  5AEQ A;  1EH2 A;  3I5H C;  3VRN A;  2M97 A;  3FWB A;  1BR1 B;  2MJW B;  1DJZ A;  2KQ6 A;  1GJY A;  1J55 A;  1QJT A;  2WCE A;  5HLO A;  3SG3 A;  2WOR A;  4PE4 A;  1C7V A;  1SYM A;  2GV5 A;  1K95 A;  4YGE B;  1PVB A;  1CMF A;  4D1E A;  1SKT A;  1BT6 A;  1AUI B;  1ZFS A;  1DJW A;  1FPW A;  2LV7 A;  3CGA A;  4CID A;  1DTL A;  2LUC A;  1OMV A;  1XK4 A;  4OCI A;  5HKY A;  2I2R E;  2M8U A;  1CMG A;  4GBA A;  4MZK A;  1SCM B;  4HRH A;  5DKQ A;  1S3P A;  2L5X B;  3PLF B;  2K2F A;  2KGB C;  2BL0 B;  3EVR A;  1NUB A;  3NSK A;  1A75 B;  4YBH B;  1CDN A;  3VGO A;  1LKJ A;  4PE7 A;  3E3R A;  1YUU A;  2B1U A;  4PDZ A;  4QJ3 B;  3H4S E;  2KQY A;  4QJ5 B;  1FF1 A;  4FQO A;  3NSL A;  1DVI A;  5I8N A;  5AFP A;  3TS5 B;  2JWW A;  4JWQ A;  2KBM A;  1WY9 A;  3I5G B;  4ZCV A;  1YVH A;  4P5O E;  1MWN A;  1CLL A;  1CDL A;  5D7F A;  2KBI A;  3PAL A;  2LHL A;  1QX5 B;  3K21 A;  1NX1 A;  2M7L A;  2JPT A;  4PCW A;  1IRJ A;  2CT9 A;  1E8A A;  1KQM B;  1ZAC A;  4MSP A;  1LA0 A;  3FWC A;  1MXE A;  2CXJ A;  1PAL A;  5GQQ C;  3D0Y B;  3WNX B;  4XJK B;  1QX2 A;  2WC8 A;  1SCM C;  3PAT A;  1KFX L;  4AOM A;  1AP4 A;  1K9K A;  1B47 A;  2MBX A;  5KSZ A;  1K9P A;  1CB1 A;  4GUK A;  2BL0 C;  2F8P A;  2V53 A;  3DVJ A;  3KEV A;  1UHK A;  1DJH A;  1AHR A;  3AAJ A;  2BE6 A;  4GFT A;  4C0J A;  2D8N A;  1LXF C;  2K7D A;  1CM1 A;  2L51 A;  4I5L B;  2Y1M A;  3SJS A;  5I2L A;  3IF7 A;  4USL A;  1JF0 A;  1MHO A;  4CLN A;  1DJY A;  3F45 A;  4DIR A;  1ALW A;  3TS5 C;  4HRE E;  1MF8 B;  3VRQ A;  3I5G C;  1UHJ A;  2RGI A;  4YGD B;  1G8I A;  4N5X A;  1B1G A;  3BQ3 A;  2Q4U A;  1A4P A;  1S6J A;  2KHN A;  1K8U A;  1JFK A;  3EKH A;  3IQO A;  3KF9 A;  1RTP 1;  3JVT C;  3OB2 B;  4NDB A;  3ICB A;  4GAO A;  2NXQ A;  2M3W A;  3CWG A;  1F8H A;  1SNL A;  4ORB B;  1SR6 C;  2LNK A;  1EXR A;  2ZKM X;  4JPZ B;  5AXI A;  1PRW A;  1B4C A;  1NIW A;  1DF0 B;  1J7O A;  4M2Q A;  5JOL A;  1YTZ C;  1SY9 A;  3HCM A;  1QAT A;  4ORC B;  1CFC A;  1F4Q A;  2LVV A;  4MZJ A;  2LAN A;  4PHK A;  1NWD A;  1WLZ A;  1C7W A;  1TRF A;  4MBE A;  4C0K A;  1XFY O;  2GGZ A;  1B8C A;  3DF0 B;  2F33 A;  4YGB B;  2JQ6 A;  1IWQ A;  3CS1 A;  2G2B A;  1YVL A;  3PM8 A;  2G9B A;  2M49 B;  1CDP A;  5DKR A;  4MRX A;  1XYD A;  2K8M B;  1L2O B;  1QIW A;  3VRR A;  2HQ8 A;  3NSO A;  2L4I A;  1XA5 A;  4OVN F;  1UP5 A;  2WOS A;  1A75 A;  1RWY A;  2BKI B;  1QV1 A;  5JJG A;  1CKK A;  1SPY A;  3OB1 B;  4GNK B;  1XFV O;  1A03 A;  4A4B A;  2FOT A;  2MAZ A;  2L0P A;  2KSP A;  1NCY A;  3ZWH A;  2JUL A;  1QX7 A;  2Y5I A;  3BUM B;  2AUC A;  3GK1 A;  3C1V A;  1EJ3 A;  3GK4 X;  2KYC A;  1KWO B;  2FJU B;  1WRZ A;  1BJF A;  1CDM A;  1CNP A;  3PSR A;  2LHI A;  1TNP A;  1DGV A;  3VRP A;  2LMT A;  1V1G A;  1IG5 A;  1Y0V H;  5K89 A;  2ZRT A;  1G33 A;  1OZS A;  3LL8 B;  4ICB A;  4I5N B;  1F55 A;  1IQ5 A;  3D0Y A;  4XJK A;  1L2O C;  3DVM A;  1M45 A;  1M46 A;  2LLU A;  4R1E A;  2M9G A;  1DJG A;  4WQ3 A;  1KQV A;  4CPV A;  1OE9 B;  1B7T Y;  2R2I A;  3OX6 A;  1CFF A;  1YRT B;  1W7I B;  1SBJ A;  2M1K B;  2LP2 A;  1QTX A;  2F3Z A;  2BCA A;  1ALV A;  2ZNE A;  2IS9 A;  3M0W A;  1PSR A;  3BYA A;  5IBW A;  2SCP A;  1PK0 D;  2LCP A;  3SIA A;  2F3Y A;  2I7A A;  3OX5 A;  1JBA A;  1B7T Z;  2JU0 A;  2LMU A;  2JOJ A;  1M31 A;  1PVA A;  2WCF A;  2LAP A;  3TZ1 A;  5ER5 A;  3HX4 A;  4I5K A;  4YI8 A;  1QVI Y;  1KWO C;  4GPL B;  4GGF C;  4L9M A;  4MRY A;  3OHM B;  1FI5 A;  1XFX O;  1K94 A;  1KCY A;  1F4O A;  1Y1U A;  1OZO A;  2CTN A;  2QPT A;  3NXA A;  1QVI Z;  2JT3 A;  2M0R A;  4MN0 A;  4DRW A;  1WLM A;  3JVT B;  2MRD A;  4FTG A;  2K7C A;  4E68 A;  3IQQ A;  4CFR A;  1UUR A;  1SRA A;  1SR6 B;  2Y1N A;  1DF0 A;  1K90 D;  2JZI A;  1J1E A;  1R6P A;  5HLV A;  4YRU A;  2AMI A;  3TUY B;  5HKW A;  4AQI A;  1D1O A;  4ETO A;  2O60 A;  3EK4 A;  3I5F B;  2L50 A;  1K93 D;  5CSN A;  2LLS A;  2MLE C;  1J7Q A;  2M29 A;  1TIZ A;  3CLN A;  2F2O A;  3DF0 A;  2KYF A;  5KU1 A;  4OR9 B;  1XFZ O;  1YR5 A;  2L4H A;  2P6B B;  2KFH A;  4PHN A;  3NSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...