3A4UB

Crystal structure of mcfd2 in complex with carbohydrate recognition domain of ergic-53
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
65
Chain Sequence
b'EMSPQELQLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Structural basis for the cooperative interplay between the two causative gene products of combined factor V and factor VIII deficiency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 23
structure length 65
sequence length 78
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3a4uB00
2HQ8A 2KYCA 4GFTA 2M9GA 1LXFC 5HKYA 3TS5B 1BF5A 1CDNA 5JOLA 1WRLA 1RFJA 2LC5A 1KQMB 1QLKA 2EHBA 2JQ6A 3GK1A 4GAOA 3O2PA 2ZNEA 2JNFA 3SG4A 1AK8A 1D1OA 5DKQA 1GGZA 1SCMC 1SL7A 5JJGA 3GOFA 3CR4X 1DJXA 2WNDA 2ZNDA 5CSFA 5CPVA 2E30A 2L2EA 5HKZA 3A4UB 3NSKA 5AEQA 2KQ6A 4MZKA 1CKKA 4CFQA 2ZRSA 1ZACA 1Y0VH 3CR5X 1EL4A 2WCEA 4ZCVA 5TNCA 4OKHA 2LUXA 1SYMA 4GBAA 3JTDB 1NPQA 4MEWA 2LMUA 1RWYA 1TNQA 3EK4A 3I5FB 2L50A 2KFHA 3HCMA 3SG7A 4ORAB 1YUTA 1A29A 1ODBA 3E3RA 4F0ZB 1XFWO 2MRDA 3NSLA 4NQGA 1CB1A 1LA0A 1PALA 2KYFA 1OOJA 1QV0A 3EVVA 4GGNA 1QVIZ 1CM4A 1MUXA 2K2FA 1CDPA 1A2XA 1K94A 1DJGA 1SBJA 2LP2A 1XK4C 3KO0A 1MQ1A 4OVNF 2LVJA 2CXJA 2PALA 2H61C 4M2QA 4PHNA 5PALA 1KWOC 1G33A 3KPXA 3FIAA 3O78A 1WLZA 2LE9B 1WDCC 2ZN9A 3BOWB 2KOTA 3TDZA 4D1EA 2KGBC 5ER4X 4CIDA 1GJYA 2I7AA 3EK7A 3LCPC 1GQMA 3PFVA 5HLOA 1IKUA 2R2IA 2BCBA 3CGAA 3ZNIA 1RK9A 2WOSA 2PMYA 2WCBA 1CTRA 1NX0A 2K7OA 3AKAA 2QACA 3BYAA 2F3ZA 1XVJA 1OMVA 1UHHA 1TCFA 1ZUZA 4DUQA 2A4JA 2HQWA 1FI5A 1RJVA 4PHKA 4GGFA 2SCPA 1C7WA 1J55A 3I5IC 4MRXA 1SL8A 3SIBA 2Y1NA 4XYNA 1JFKA 1YRUB 3I5HC 1Q80A 2I94A 2EC6C 3IQQA 1E8AA 2NLNA 2LNKA 3BOWA 2M49B 1SKTA 2L0PA 1DJYA 1KSMA 2JTTA 4JQ0D 1RTP1 3O4YA 1ZOTB 2M3WA 3KF9A 4MZJA 2ZRTA 1V1GA 1MWNA 2F33A 3M0WA 2KI6C 1PK0D 4YGCB 1YX7A 2F2PA 2JT3A 5BPJA 4MRYA 4ORBB 3EK8A 2BCAA 2LAPA 1J7RA 1M31A 1FW4A 1S5GY 4NDBA 1DTLA 4M2PA 1B1GA 3IQOA 1CFPA 1K9UA 2JWWA 3PALA 2D8NA 4QJ4B 1NCZA 1IJ5A 1JWDA 1DMOA 1DVIA 1CMFA 3BUOB 1QIVA 1B9AA 2BBMA 2GV5A 2LHIA 4E68A 1SPYA 1SR6B 1NSHA 2AMIA 2K0JA 4TNCA 1XFZO 1TIZA 5I2OA 2FOTA 3I5GB 5KU1A 1PRWA 2OTGB 1BR4B 1MHOA 4NDCA 3CTNA 1M46A 1NCYA 2JRFA 4PE0A 3O6BA 4USLA 4NDDA 2KBIA 2BCXA 2M29A 3AKBA 1HT9A 1QJTA 4I5JA 2JTZA 1AJ5A 1G4YR 2L98A 3DVKA 3QRXA 1QS7A 3TZ1A 3PLFB 1K8UA 2JXLA 2MA2A 2Q91A 1CLBA 2V53A 3BUNB 5ER5A 1S6IA 2OS8B 1YTZC 5IBWA 1SCVA 1K9PA 1GGWA 2BKHB 2JZIA 2MLEC 2ZFDA 5GQQC 4DCKA 1S3PA 2KQYA 1XA5A 1F4QA 2F8PA 4MSPA 4I5NB 1UUSA 2I2RE 2ZN8A 4GNKB 4PCWA 3TDIA 2AUCA 1WLMA 3ICBA 1PSRA 3D0YA 4PE4A 1H4BA 1DGUA 2LCPA 4A4BA 1AVSA 1CDLA 2JNXA 1K95A 1F70A 1LA3A 1X02A 2WC8A 1JSAA 1W7JB 1S36A 2CCMA 2KGRA 4PDZA 1BR1B 1TNPA 1G8IA 2NCPA 1SL9A 4L9MA 2KBMA 1OE9B 2EGDA 1B8CA 1NUBA 2LV7A 2P6BB 1L2OB 1SNLA 5D7FA 3JVTC 1MXEA 1OZSA 5B8IB 1IJ6A 1K90D 1AP4A 1B4CA 1U5IB 1CMGA 2M1KB 2BE6A 3BXKA 5AERA 2KI4C 2AAOA 2TN4A 1ALVA 2PRUA 5CSJA 2ISDA 3A8RA 1K96A 1QLSA 1S1EA 4OV2A 3NSOA 1KK7Y 1QTXA 3DVJA 1NIWA 1QXPA 2H61A 3GK4X 2Y1MA 3BUMB 5I8NA 2JXCA 3K21A 1QIWA 1A75B 1JC2A 2Y4QA 3TDUA 4I5LB 4AQIA 1MR8A 1DJIA 4MZLA 2JT0A 1KFUL 1QX5B 3CWGA 1N65A 1RROA 2LLTA 1B8LA 1IH0A 1M45A 2L4IA 1XO5A 4CFRA 3OB1B 3OB2B 2JOJA 2KAYA 4DRWA 1IGVA 3NXAA 3PATA 1DJHA 1HQVA 4JPZB 1KFXL 1PVAA 4YGBB 1U5IA 1BG1A 4AOMA 2NXQA 1B7TY 1KK8B 1XFYO 3I5FC 2K8MB 1CLLA 1CFFA 2M0RA 4HSZA 1EXRA 1F54A 2JPTA 4DIRA 1XFVO 5KTYA 2LMVA 1R6PA 3F45A 1EJ3A 1CDMA 2LMTA 3CZTX 3FS7A 1YVLA 4CPVA 1LKJA 3AAKA 4DS7A 3H4SE 1A75A 4P5OE 1UHJA 1SY9A 1TOPA 2GGMA 1YUSA 2L5XB 4ZCUA 3VGOA 1UWOA 1FI6A 1S26D 2JT8A 2JC2A 2MJWB 2JU0A 5CSNA 3DF0B 1QASA 1XFUO 5F6TA 1SRAA 3TUYC 1BODA 4BY4A 1IWQA 4MLWA 2BL0B 1EG4A 2HPSA 2NZ0A 5KSZA 4QJ5B 4HRHA 4N5XA 3SG6A 1DJZA 4OR9B 5HKWA 1AUIB 3FWBA 4C0KA 1QX2A 3OX6A 1N2DA 3RM1A 3VRQA 1K9KA 1WRZA 4MVFA 1QATA 1KSOA 1S5GZ 3EVUA 2L4HA 1SCMB 2HETA 2BKIB 1F55A 1B8RA 3D0YB 2VRGA 3OX5A 1YVHA 3BQ3A 4I5KA 1MXLC 1YURA 5D69A 1UP5A 2CNPA 1ZMZA 1WY9A 4P2YB 2KDHA 1J1EA 1TRFA 2LLUA 2WCFA 1BU3A 3PN7C 1AHRA 3DF0A 4YRUA 1J7OA 2G2BA 2L51A 3PSRA 2K7DA 2LVVA 4GPLB 1QV1A 2SASA 4CLNA 1JUOA 2H2KA 1PSBA 3KHEA 4PE7A 1IQ3A 1TNWA 3JVTB 1BT6A 4A4CA 1JF2A 1L7ZA 3MSEB 5DKNA 4HRGA 1NCXA 2LLSA 1UURA 2F2OA 2OPOA 1UHNA 3SG3A 3WHTB 2CBLA 2I18A 2KI4B 3LK1A 1NP8A 1CNPA 4IL1A 2BE4A 1KWOB 2LVIA 3IF7A 1SMGA 5CSIA 4UPGA 1OMRA 1J7PA 1SK6D 1WDCB 5AFPA 1UHKA 1BJFA 2KNEA 1Y1AA 1QX7A 1C07A 1PULA 3SIAA 3KEVA 2KAVA 3DVEA 1CLMA 1Y1UA 5HLVA 1TTXA 3WNXB 3EVRA 3CS1A 1R2UA 1SR6C 3LK0A 1S6CA 2CT9A 3I5GC 3SJSA 1NX1A 2QPTA 2PSRA 2OTGC 1FPWA 2PASA 1A03A 2Y5IA 4WQ2A 3BUXB 1KFUS 1UHIA 4WQ3A 2M7LA 3WHUB 1W7IB 1WRKA 1NX2A 1XK4A 1YX8A 1KFXS 2KFFA 3I5IB 2LHLA 4YGEB 4C0JA 2KSPA 1QVIY 4YI8A 1NX3A 2LVKA 1B47A 3I5HB 4ICBA 4YI9A 1XFXO 3DD4A 1EG3A 2EC6B 1EH2A 2LUCA 2NCOA 3TS5C 1H8BA 1OZOA 1KQMC 1JFJA 2OS8C 4GUKA 5AANA 3VRRA 2O60A 3EKHA 5K89A 4R1EA 1K93D 1KK7Z 2KFGA 1FBVA 4QJ3B 1KQVA 1RECA 4OCIA 1DF0B 1CFCA 3OHMB 1BOCA 3FWCA 2MLFC 3VRNA 3TUYB 3D10A 1DT7B 2O5GA 4FQOA 3JTDC 2MBXA 2KHNA 4PHJA 1PVBA 2FCDA 3AAJA 1TN4A 3NSIA 2WORA 1ALWA 2E6WA 1Y1XA 3VROA 2MAZA 5J3XA 4XJKB 1J7QA 3OP0A 5I2QA 1B7TZ 2KI6D 2F3YA 4M2OA 1L2OC 3WXAA 2CTNA 5HYDA 1OQPA 1C7VA 1IG5A 2FJUB 1OMDA 2LANA 2IS9A 4GGFC 4JWQA 3GK2A 1TCOB 4C0LA 4ETOA 1FF1A 3EKJA 1A4PA 2BECA 4MN0A 1DF0A 1YRTB 1DGVA 2M7NA 1V1FA 2Q4UA 2PVBA 2HF5A 3DVMA 3PN7B 5G08A 1CM1A 4PE1A 1JF0A 3CLNA 2ZKMX 2M97A 2BBNA 1F8HA 3LLEA 2K2AA 4AQJA 1ZFSA 1DJWA 2G9BA 3C1VA 1M39A 2K7BA 2DOQA 1VRKA 1NWDA 4YBHB 1YUUA 3SG5A 1JBAA 5AXIA 1OSAA 1MF8B 4FTGA 4XJKA 1Y6WA 3LL8B 1S6JA 1LVCD 5FYXA 1LINA 2K7CA 4PHMA 5I2LA 3HX4A 2COLB 1BLQA 4BY5A 3RLZA 4PALA 1M63B 3BUWB 4YGDB 1KK8C 4MBEA 4N1GA 4HREE 1KCYA 2LP3A 1NYAA 3VRPA 2MHHA 1XYDA 3ZWHA 2M1UA 4ORCB 2JULA 5DKRA 4YGAA 3CR2A 2M8UA 2RGIA 2B1UA 1AJ4A 4WRIA 1IQ5A 1SW8A 4Q04A 4N1FA 1K2HA 2GGZA 1BMOA 1N0YA 4U8DA 2KAXA 2LM5A 1TNXA 2FCEA 3PM8A 1J1DA 2BL0C 1F4OA 1CFDA 1IRJA 3SG2A 1F71A 2K61A 1YR5A
chains in the Genus database with same CATH superfamily
2HQ8A 2KYCA 2WCJA 4GFTA 2M9GA 1LXFC 5HKYA 3TS5B 1BF5A 1CDNA 5JOLA 1WRLA 1RFJA 2LC5A 1KQMB 4JD9A 1QLKA 2EHBA 2JQ6A 3GK1A 4GAOA 3O2PA 2ZNEA 2JNFA 3SG4A 1AK8A 1D1OA 5DKQA 1GGZA 1ORGA 1SCMC 1SL7A 5JJGA 3GOFA 3CR4X 1DJXA 2WNDA 2ZNDA 5CSFA 5CPVA 2E30A 2L2EA 3BFHA 3A4UB 5HKZA 3NSKA 5AEQA 2KQ6A 4MZKA 1CKKA 4CFQA 2ZRSA 1ZACA 1Y0VH 1LS8A 1EL4A 3CR5X 2WCEA 3BFAA 4ZCVA 5TNCA 4OKHA 2LUXA 1SYMA 4GBAA 3JTDB 1NPQA 4MEWA 2LMUA 1RWYA 1TNQA 3EK4A 3I5FB 2WCHA 2L50A 1TUZA 2KFHA 3HCMA 3SG7A 4ORAB 1YUTA 1A29A 1ODBA 3E3RA 4F0ZB 1XFWO 3IVTA 2MRDA 3NSLA 4NQGA 1CB1A 1LA0A 1PALA 2KYFA 1OOJA 1QV0A 3EVVA 4GGNA 3CZ1A 1QVIZ 1CM4A 1MUXA 2K2FA 3DXLA 1CDPA 1A2XA 1K94A 1DJGA 1SBJA 2LP2A 2QEOA 3FE9A 4KYNA 1XK4C 3KO0A 1MQ1A 4OVNF 1DQEA 2LVJA 2CXJA 2KLEA 2PALA 3D78A 2H61C 4M2QA 4PHNA 5PALA 1KWOC 5I94A 1G33A 3KPXA 3FIAA 3O78A 1WLZA 2LE9B 1WDCC 2ZN9A 3BOWB 2KOTA 3TDZA 4D1EA 2KGBC 5ER4X 4CIDA 1GJYA 2I7AA 3EK7A 3LCPC 2QDIA 1GQMA 3PFVA 5HLOA 1IKUA 2P70A 2R2IA 2BCBA 3CGAA 3ZNIA 1RK9A 2WOSA 2PMYA 2WCBA 1CTRA 1NX0A 2K7OA 3AKAA 2QACA 5DICA 3BYAA 2F3ZA 1XVJA 1OMVA 1UHHA 1TCFA 1ZUZA 2BAPA 3R1VA 4DUQA 3BFBA 1Z4HA 2A4JA 2HQWA 1FI5A 1RJVA 4PHKA 4GGFA 2SCPA 1C7WA 1J55A 3I5IC 4MRXA 1SL8A 2YGUA 3SIBA 2Y1NA 4XYNA 1JFKA 1YRUB 1OOFA 3I5HC 1Q80A 2I94A 2EC6C 3IQQA 1E8AA 2NLNA 3D73A 3CYZA 3QMEA 3B86A 2LNKA 3BOWA 2M49B 3CZ0A 1SKTA 2L0PA 1DJYA 1KSMA 2JTTA 3R72A 1RTP1 1TWOA 4JQ0D 3FE8A 3O4YA 1ZOTB 2M3WA 3KF9A 4MZJA 2ZRTA 1V1GA 1MWNA 2F33A 3M0WA 2KI6C 1PK0D 4YGCB 1YX7A 2F2PA 2JT3A 5BPJA 4MRYA 4ORBB 3EK8A 2BCAA 2LAPA 1J7RA 1M31A 1FW4A 3VB1A 1S5GY 4NDBA 1DTLA 4M2PA 1B1GA 3IQOA 1CFPA 1K9UA 2JWWA 3PALA 2D8NA 4QJ4B 1NCZA 1IJ5A 1JWDA 1DMOA 1DVIA 1QWVA 3BUOB 1CMFA 1QIVA 1B9AA 2BBMA 2GV5A 2LHIA 4E68A 1SPYA 1SR6B 1NSHA 2AMIA 2K0JA 4TNCA 1XFZO 1TIZA 5I2OA 2FOTA 3I5GB 5KU1A 1PRWA 2OTGB 1BR4B 1MHOA 4NDCA 3CTNA 1M46A 1NCYA 2JRFA 4PE0A 3O6BA 4USLA 4NDDA 2KBIA 2BCXA 2M29A 3AKBA 1HT9A 1QJTA 4I5JA 2JTZA 1AJ5A 1G4YR 2L98A 3DVKA 3QRXA 1QS7A 3TZ1A 3PLFB 1K8UA 2JXLA 2MA2A 2Q91A 1CLBA 2V53A 3BUNB 5ER5A 2KLDA 3OBVA 1S6IA 2OS8B 1YTZC 5IBWA 1SCVA 1K9PA 1GGWA 2BKHB 2JZIA 2MLEC 2ZFDA 5GQQC 4DCKA 1C3YA 1S3PA 1DC1A 2KQYA 1XA5A 1F4QA 2F8PA 4MSPA 4I5NB 1UUSA 2I2RE 2ZN8A 4GNKB 4PCWA 3TDIA 2WCKA 2AUCA 1WLMA 3ICBA 1PSRA 3D0YA 4PE4A 3CABA 1H4BA 1DGUA 2LCPA 4A4BA 1AVSA 1CDLA 2JNXA 1TUJA 1K95A 4JKTA 1F70A 1LA3A 1X02A 2ERBA 2WC8A 1W7JB 3UO9A 1S36A 2CCMA 2KGRA 3NHTA 4PDZA 1BR1B 1TNPA 1G8IA 3DY9A 2NCPA 1SL9A 4L9MA 2KBMA 1OE9B 1T14A 2EGDA 1B8CA 1NUBA 2LV7A 2P6BB 1L2OB 1SNLA 5D7FA 3RZSA 3JVTC 1MXEA 1OZSA 5B8IB 1IJ6A 1JSAA 1K90D 1AP4A 1B4CA 1U5IB 1CMGA 2M1KB 2BE6A 3BXKA 3L4AA 5AERA 2KI4C 2WCLA 2AAOA 2TN4A 1ALVA 2PRUA 3B87A 5CSJA 2ISDA 3A8RA 1K96A 1QLSA 1S1EA 4OV2A 3NSOA 1KK7Y 1QTXA 3DVJA 1NIWA 1QXPA 2H61A 2WC6A 2Y1MA 3BUMB 3GK4X 2JXCA 5I8NA 3K21A 2WCMA 1C3ZA 1QIWA 4PT1A 1A75B 5EL2A 1JC2A 2Y4QA 3TDUA 4I5LB 4AQIA 1MR8A 1DJIA 3PM2A 4MZLA 2JT0A 1KFUL 1QX5B 3CWGA 1N65A 1RROA 2LLTA 1B8LA 1IH0A 1M45A 2L4IA 1XO5A 4CFRA 3OB1B 3OB2B 2JOJA 2KAYA 2QEVA 4DRWA 1IGVA 3NXAA 3PATA 3BJHA 1DJHA 1HQVA 1SSEB 4JPZB 1KFXL 1PVAA 4YGBB 1U5IA 1BG1A 2K60A 4AOMA 2BNXA 2NXQA 1B7TY 1KK8B 1XFYO 3I5FC 2K8MB 1CLLA 1CFFA 2M0RA 4HSZA 1EXRA 1F54A 2JPTA 4DIRA 1XFVO 5KTYA 2LMVA 1R6PA 3F45A 1EJ3A 1CDMA 2LMTA 3CDNA 1P28A 1YVLA 3CZTX 3FS7A 3N7HA 1LKJA 4CPVA 3AAKA 3S0BA 4DS7A 3H4SE 1A75A 4P5OE 1UHJA 1SY9A 1TOPA 2GGMA 1YUSA 2L5XB 4ZCUA 3SS3A 3VGOA 1UWOA 1FI6A 1S26D 2JT8A 2JC2A 2MJWB 2JU0A 5CSNA 1Z2CB 3DF0B 1QASA 1XFUO 5F6TA 1SRAA 3TUYC 1BODA 4BY4A 1IWQA 4MLWA 3S0GA 2BL0B 1EG4A 2HPSA 2NZ0A 5KSZA 4QJ5B 4HRHA 4N5XA 3SG6A 1DJZA 4INWA 4F7FA 4OR9B 5HKWA 1AUIB 3FWBA 4C0KA 1QX2A 3OX6A 1N2DA 3RM1A 3VRQA 1K9KA 1WRZA 4MVFA 1QATA 2L2CA 1KSOA 1S5GZ 3EVUA 3S0AA 2L4HA 1SCMB 2HETA 2BKIB 3S0FA 3B88A 1F55A 3D75A 1B8RA 3D0YB 2VRGA 3OX5A 1YVHA 1XFRA 3BQ3A 4I5KA 1MXLC 1YURA 5D69A 1UP5A 2CNPA 1ZMZA 5FI2A 1WY9A 4P2YB 2KDHA 3OGNA 1J1EA 3D74A 1TRFA 2LLUA 2WCFA 1BU3A 3PN7C 1AHRA 3DF0A 4YRUA 1J7OA 2G2BA 2H8VA 2L51A 3B6XA 3PSRA 2K7DA 2LVVA 4GPLB 5HL1A 1QV1A 2SASA 4CLNA 1JUOA 3L47A 2H2KA 1PSBA 3KHEA 4PE7A 2PYQA 1IQ3A 1TNWA 3JVTB 1BT6A 4A4CA 2WC5A 2GTEA 1JF2A 1L7ZA 3MSEB 3DZTA 5DKNA 4HRGA 1NCXA 2L5YA 2LLSA 1UURA 2F2OA 2OPOA 1UHNA 3B7AA 3SG3A 3WHTB 2CBLA 2I18A 2KI4B 3LK1A 1NP8A 1CNPA 4IL1A 2BE4A 1KWOB 2LVIA 3IF7A 1SMGA 5CSIA 4UPGA 3Q8IA 1OMRA 1J7PA 1SK6D 1WDCB 5AFPA 1UHKA 1BJFA 2KNEA 1Y1AA 1QX7A 2QEHA 1PULA 1C07A 3SIAA 3KEVA 2KAVA 3DVEA 1CLMA 1Y1UA 5HLVA 1TTXA 3WNXB 3EVRA 3CS1A 4OZDA 1R2UA 1SR6C 2P71A 1S6CA 3LK0A 3V2LA 2CT9A 1DELA 3I5GC 3SJSA 1NX1A 2QPTA 2PSRA 2OTGC 1FPWA 2PASA 1A03A 2Y5IA 4WQ2A 3BUXB 1KFUS 3PJIA 1UHIA 4WQ3A 1OOHA 2M7LA 3WHUB 1IIOA 1OOIX 1W7IB 1WRKA 1NX2A 1GM0A 1XK4A 1YX8A 1KFXS 2KFFA 3I5IB 2LHLA 4YGEB 4C0JA 1DEKA 2KSPA 1QVIY 4YI8A 1NX3A 2LVKA 1B47A 3I5HB 3NHIA 4ICBA 1XFXO 3DD4A 1EG3A 2EC6B 4YI9A 1EH2A 2LUCA 2NCOA 3TS5C 1H8BA 1OZOA 1KQMC 1JFJA 2OS8C 3CZ2A 3DYEA 2QEBA 2O60A 4GUKA 5AANA 3VRRA 3EKHA 5K89A 4R1EA 1K93D 1KK7Z 2KFGA 1FBVA 4QJ3B 1KQVA 1RECA 4OCIA 1DF0B 1CFCA 3OHMB 1BOCA 3D76A 3FWCA 2MLFC 3VRNA 3O4XA 5FI7A 3TUYB 3D10A 1DT7B 2O5GA 4FQOA 3JTDC 2MBXA 2KHNA 4PHJA 1PVBA 2FCDA 2PQLA 3AAJA 4IJ7A 1TN4A 3NSIA 2WORA 1ALWA 2E6WA 1Y1XA 3VROA 2MAZA 3S0DA 5J3XA 4XJKB 1J7QA 3K1EA 3OP0A 3SS5A 5I2QA 1B7TZ 2KI6D 2F3YA 4M2OA 1L2OC 3WXAA 2CTNA 1OW4A 5HYDA 1OQPA 1C7VA 1IG5A 2FJUB 5D3OA 1OMDA 2LANA 2IS9A 4GGFC 4JWQA 3GK2A 1TCOB 4C0LA 4ETOA 1FF1A 3EKJA 1A4PA 2BECA 2JPOA 1DF0A 3L4LA 4MN0A 1YRTB 3SS4A 1DGVA 3UNWA 2M7NA 1V1FA 3R1PA 2Q4UA 2PVBA 2HF5A 3DVMA 3PN7B 5G08A 1CM1A 4PE1A 1JF0A 3CLNA 2ZKMX 2M97A 2BBNA 3D77A 3LLEA 1F8HA 2K2AA 4AQJA 1ZFSA 1DJWA 2G9BA 3C1VA 1M39A 2K7BA 2DOQA 1VRKA 1NWDA 4FQTA 4YBHB 1YUUA 3SG5A 1JBAA 5AXIA 1OSAA 1MF8B 4FTGA 4XJKA 1Y6WA 3LL8B 1S6JA 1LVCD 5FYXA 1LINA 2K7CA 4PHMA 5I2LA 4INXA 3HX4A 2COLB 1BLQA 4BY5A 3RLZA 4PALA 1M63B 2KPHA 3BUWB 3S0EA 1W9ZA 4YGDB 1KK8C 3EG5B 4MBEA 4N1GA 4HREE 1KCYA 2LP3A 1NYAA 3FE6A 3VRPA 2MHHA 1XYDA 3ZWHA 2M1UA 3R1OA 3NGVA 4ORCB 1OOGA 2JULA 5DKRA 4YGAA 3CR2A 2M8UA 5FI6A 2RGIA 2B1UA 1AJ4A 4WRIA 1IQ5A 1SW8A 4Q04A 4N1FA 1K2HA 2GGZA 1BMOA 1N0YA 4U8DA 2KAXA 2LM5A 1TNXA 2FCEA 3PM8A 2FJYA 1J1DA 1F4OA 1CFDA 2BL0C 1IRJA 3SG2A 1F71A 2K61A 1YR5A
chains in the Genus database with same CATH topology
2HQ8A 2KYCA 4GFTA 2M9GA 1LXFC 5HKYA 3TS5B 1BF5A 1CDNA 5JOLA 1WRLA 1RFJA 2LC5A 1KQMB 1QLKA 2EHBA 2JQ6A 3GK1A 4GAOA 3O2PA 2ZNEA 2JNFA 3SG4A 1AK8A 1D1OA 5DKQA 1GGZA 1SCMC 1SL7A 5JJGA 3GOFA 3CR4X 1DJXA 2WNDA 2ZNDA 5CSFA 5CPVA 2E30A 2L2EA 5HKZA 3A4UB 3NSKA 5AEQA 2KQ6A 4MZKA 1CKKA 4CFQA 2ZRSA 1ZACA 1Y0VH 3CR5X 1EL4A 2WCEA 4ZCVA 5TNCA 4OKHA 2LUXA 1SYMA 4GBAA 3JTDB 1NPQA 4MEWA 2LMUA 1RWYA 1TNQA 3EK4A 3I5FB 2L50A 2KFHA 3HCMA 3SG7A 4ORAB 1YUTA 1A29A 1ODBA 3E3RA 4F0ZB 1XFWO 2MRDA 3NSLA 4NQGA 1CB1A 1LA0A 1PALA 2KYFA 1OOJA 1QV0A 3EVVA 4GGNA 1QVIZ 1CM4A 1MUXA 2K2FA 1CDPA 1A2XA 1K94A 1DJGA 1SBJA 2LP2A 1XK4C 3KO0A 1MQ1A 4OVNF 2LVJA 2CXJA 2PALA 2H61C 4M2QA 4PHNA 5PALA 1KWOC 1G33A 3KPXA 3FIAA 3O78A 1WLZA 2LE9B 1WDCC 2ZN9A 3BOWB 2KOTA 3TDZA 4D1EA 2KGBC 5ER4X 4CIDA 1GJYA 2I7AA 3EK7A 3LCPC 1GQMA 3PFVA 5HLOA 1IKUA 2R2IA 2BCBA 3CGAA 3ZNIA 1RK9A 2WOSA 2PMYA 2WCBA 1CTRA 1NX0A 2K7OA 3AKAA 2QACA 3BYAA 2F3ZA 1XVJA 1OMVA 1UHHA 1TCFA 1ZUZA 4DUQA 2A4JA 2HQWA 1FI5A 1RJVA 4PHKA 4GGFA 2SCPA 1C7WA 1J55A 3I5IC 4MRXA 1SL8A 3SIBA 2Y1NA 4XYNA 1JFKA 1YRUB 3I5HC 1Q80A 2I94A 2EC6C 3IQQA 1E8AA 2NLNA 2LNKA 3BOWA 2M49B 1SKTA 2L0PA 1DJYA 1KSMA 2JTTA 4JQ0D 1RTP1 3O4YA 1ZOTB 2M3WA 3KF9A 4MZJA 2ZRTA 1V1GA 1MWNA 2F33A 3M0WA 2KI6C 1PK0D 4YGCB 1YX7A 2F2PA 2JT3A 5BPJA 4MRYA 4ORBB 3EK8A 2BCAA 2LAPA 1J7RA 1M31A 1FW4A 1S5GY 4NDBA 1DTLA 4M2PA 1B1GA 3IQOA 1CFPA 1K9UA 2JWWA 3PALA 2D8NA 4QJ4B 1NCZA 1IJ5A 1JWDA 1DMOA 1DVIA 1CMFA 3BUOB 1QIVA 1B9AA 2BBMA 2GV5A 2LHIA 4E68A 1SPYA 1SR6B 1NSHA 2AMIA 2K0JA 4TNCA 1XFZO 1TIZA 5I2OA 2FOTA 3I5GB 5KU1A 1PRWA 2OTGB 1BR4B 1MHOA 4NDCA 3CTNA 1M46A 1NCYA 2JRFA 4PE0A 3O6BA 4USLA 4NDDA 2KBIA 2BCXA 2M29A 3AKBA 1HT9A 1QJTA 4I5JA 2JTZA 1AJ5A 1G4YR 2L98A 3DVKA 3QRXA 1QS7A 3TZ1A 3PLFB 1K8UA 2JXLA 2MA2A 2Q91A 1CLBA 2V53A 3BUNB 5ER5A 1S6IA 2OS8B 1YTZC 5IBWA 1SCVA 1K9PA 1GGWA 2BKHB 2JZIA 2MLEC 2ZFDA 5GQQC 4DCKA 1S3PA 2KQYA 1XA5A 1F4QA 2F8PA 4MSPA 4I5NB 1UUSA 2I2RE 2ZN8A 4GNKB 4PCWA 3TDIA 2AUCA 1WLMA 3ICBA 1PSRA 3D0YA 4PE4A 1H4BA 1DGUA 2LCPA 4A4BA 1AVSA 1CDLA 2JNXA 1K95A 1F70A 1LA3A 1X02A 2WC8A 1JSAA 1W7JB 1S36A 2CCMA 2KGRA 4PDZA 1BR1B 1TNPA 1G8IA 2NCPA 1SL9A 4L9MA 2KBMA 1OE9B 2EGDA 1B8CA 1NUBA 2LV7A 2P6BB 1L2OB 1SNLA 5D7FA 3JVTC 1MXEA 1OZSA 5B8IB 1IJ6A 1K90D 1AP4A 1B4CA 1U5IB 1CMGA 2M1KB 2BE6A 3BXKA 5AERA 2KI4C 2AAOA 2TN4A 1ALVA 2PRUA 5CSJA 2ISDA 3A8RA 1K96A 1QLSA 1S1EA 4OV2A 3NSOA 1KK7Y 1QTXA 3DVJA 1NIWA 1QXPA 2H61A 3GK4X 2Y1MA 3BUMB 5I8NA 2JXCA 3K21A 1QIWA 1A75B 1JC2A 2Y4QA 3TDUA 4I5LB 4AQIA 1MR8A 1DJIA 4MZLA 2JT0A 1KFUL 1QX5B 3CWGA 1N65A 1RROA 2LLTA 1B8LA 1IH0A 1M45A 2L4IA 1XO5A 4CFRA 3OB1B 3OB2B 2JOJA 2KAYA 4DRWA 1IGVA 3NXAA 3PATA 1DJHA 1HQVA 4JPZB 1KFXL 1PVAA 4YGBB 1U5IA 1BG1A 4AOMA 2NXQA 1B7TY 1KK8B 1XFYO 3I5FC 2K8MB 1CLLA 1CFFA 2M0RA 4HSZA 1EXRA 1F54A 2JPTA 4DIRA 1XFVO 5KTYA 2LMVA 1R6PA 3F45A 1EJ3A 1CDMA 2LMTA 3CZTX 3FS7A 1YVLA 4CPVA 1LKJA 3AAKA 4DS7A 3H4SE 1A75A 4P5OE 1UHJA 1SY9A 1TOPA 2GGMA 1YUSA 2L5XB 4ZCUA 3VGOA 1UWOA 1FI6A 1S26D 2JT8A 2JC2A 2MJWB 2JU0A 5CSNA 3DF0B 1QASA 1XFUO 5F6TA 1SRAA 3TUYC 1BODA 4BY4A 1IWQA 4MLWA 2BL0B 1EG4A 2HPSA 2NZ0A 5KSZA 4QJ5B 4HRHA 4N5XA 3SG6A 1DJZA 4OR9B 5HKWA 1AUIB 3FWBA 4C0KA 1QX2A 3OX6A 1N2DA 3RM1A 3VRQA 1K9KA 1WRZA 4MVFA 1QATA 1KSOA 1S5GZ 3EVUA 2L4HA 1SCMB 2HETA 2BKIB 1F55A 1B8RA 3D0YB 2VRGA 3OX5A 1YVHA 3BQ3A 4I5KA 1MXLC 1YURA 5D69A 1UP5A 2CNPA 1ZMZA 1WY9A 4P2YB 2KDHA 1J1EA 1TRFA 2LLUA 2WCFA 1BU3A 3PN7C 1AHRA 3DF0A 4YRUA 1J7OA 2G2BA 2L51A 3PSRA 2K7DA 2LVVA 4GPLB 1QV1A 2SASA 4CLNA 1JUOA 2H2KA 1PSBA 3KHEA 4PE7A 1IQ3A 1TNWA 3JVTB 1BT6A 4A4CA 1JF2A 1L7ZA 3MSEB 5DKNA 4HRGA 1NCXA 2LLSA 1UURA 2F2OA 2OPOA 1UHNA 3SG3A 3WHTB 2CBLA 2I18A 2KI4B 3LK1A 1NP8A 1CNPA 4IL1A 2BE4A 1KWOB 2LVIA 3IF7A 1SMGA 5CSIA 4UPGA 1OMRA 1J7PA 1SK6D 1WDCB 5AFPA 1UHKA 1BJFA 2KNEA 1Y1AA 1QX7A 1C07A 1PULA 3SIAA 3KEVA 2KAVA 3DVEA 1CLMA 1Y1UA 5HLVA 1TTXA 3WNXB 3EVRA 3CS1A 1R2UA 1SR6C 3LK0A 1S6CA 2CT9A 3I5GC 3SJSA 1NX1A 2QPTA 2PSRA 2OTGC 1FPWA 2PASA 1A03A 2Y5IA 4WQ2A 3BUXB 1KFUS 1UHIA 4WQ3A 2M7LA 3WHUB 1W7IB 1WRKA 1NX2A 1XK4A 1YX8A 1KFXS 2KFFA 3I5IB 2LHLA 4YGEB 4C0JA 2KSPA 1QVIY 4YI8A 1NX3A 2LVKA 1B47A 3I5HB 4ICBA 4YI9A 1XFXO 3DD4A 1EG3A 2EC6B 1EH2A 2LUCA 2NCOA 3TS5C 1H8BA 1OZOA 1KQMC 1JFJA 2OS8C 4GUKA 5AANA 3VRRA 2O60A 3EKHA 5K89A 4R1EA 1K93D 1KK7Z 2KFGA 1FBVA 4QJ3B 1KQVA 1RECA 4OCIA 1DF0B 1CFCA 3OHMB 1BOCA 3FWCA 2MLFC 3VRNA 3TUYB 3D10A 1DT7B 2O5GA 4FQOA 3JTDC 2MBXA 2KHNA 4PHJA 1PVBA 2FCDA 3AAJA 1TN4A 3NSIA 2WORA 1ALWA 2E6WA 1Y1XA 3VROA 2MAZA 5J3XA 4XJKB 1J7QA 3OP0A 5I2QA 1B7TZ 2KI6D 2F3YA 4M2OA 1L2OC 3WXAA 2CTNA 5HYDA 1OQPA 1C7VA 1IG5A 2FJUB 1OMDA 2LANA 2IS9A 4GGFC 4JWQA 3GK2A 1TCOB 4C0LA 4ETOA 1FF1A 3EKJA 1A4PA 2BECA 4MN0A 1DF0A 1YRTB 1DGVA 2M7NA 1V1FA 2Q4UA 2PVBA 2HF5A 3DVMA 3PN7B 5G08A 1CM1A 4PE1A 1JF0A 3CLNA 2ZKMX 2M97A 2BBNA 1F8HA 3LLEA 2K2AA 4AQJA 1ZFSA 1DJWA 2G9BA 3C1VA 1M39A 2K7BA 2DOQA 1VRKA 1NWDA 4YBHB 1YUUA 3SG5A 1JBAA 5AXIA 1OSAA 1MF8B 4FTGA 4XJKA 1Y6WA 3LL8B 1S6JA 1LVCD 5FYXA 1LINA 2K7CA 4PHMA 5I2LA 3HX4A 2COLB 1BLQA 4BY5A 3RLZA 4PALA 1M63B 3BUWB 4YGDB 1KK8C 4MBEA 4N1GA 4HREE 1KCYA 2LP3A 1NYAA 3VRPA 2MHHA 1XYDA 3ZWHA 2M1UA 4ORCB 2JULA 5DKRA 4YGAA 3CR2A 2M8UA 2RGIA 2B1UA 1AJ4A 4WRIA 1IQ5A 1SW8A 4Q04A 4N1FA 1K2HA 2GGZA 1BMOA 1N0YA 4U8DA 2KAXA 2LM5A 1TNXA 2FCEA 3PM8A 1J1DA 2BL0C 1F4OA 1CFDA 1IRJA 3SG2A 1F71A 2K61A 1YR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQ8 A;  2KYC A;  4GFT A;  2M9G A;  1LXF C;  5HKY A;  3TS5 B;  1BF5 A;  1CDN A;  5JOL A;  1WRL A;  1RFJ A;  2LC5 A;  1KQM B;  1QLK A;  2EHB A;  2JQ6 A;  3GK1 A;  4GAO A;  3O2P A;  2ZNE A;  2JNF A;  3SG4 A;  1AK8 A;  1D1O A;  5DKQ A;  1GGZ A;  1SCM C;  1SL7 A;  5JJG A;  3GOF A;  3CR4 X;  1DJX A;  2WND A;  2ZND A;  5CSF A;  5CPV A;  2E30 A;  2L2E A;  5HKZ A;  3A4U B;  3NSK A;  5AEQ A;  2KQ6 A;  4MZK A;  1CKK A;  4CFQ A;  2ZRS A;  1ZAC A;  1Y0V H;  3CR5 X;  1EL4 A;  2WCE A;  4ZCV A;  5TNC A;  4OKH A;  2LUX A;  1SYM A;  4GBA A;  3JTD B;  1NPQ A;  4MEW A;  2LMU A;  1RWY A;  1TNQ A;  3EK4 A;  3I5F B;  2L50 A;  2KFH A;  3HCM A;  3SG7 A;  4ORA B;  1YUT A;  1A29 A;  1ODB A;  3E3R A;  4F0Z B;  1XFW O;  2MRD A;  3NSL A;  4NQG A;  1CB1 A;  1LA0 A;  1PAL A;  2KYF A;  1OOJ A;  1QV0 A;  3EVV A;  4GGN A;  1QVI Z;  1CM4 A;  1MUX A;  2K2F A;  1CDP A;  1A2X A;  1K94 A;  1DJG A;  1SBJ A;  2LP2 A;  1XK4 C;  3KO0 A;  1MQ1 A;  4OVN F;  2LVJ A;  2CXJ A;  2PAL A;  2H61 C;  4M2Q A;  4PHN A;  5PAL A;  1KWO C;  1G33 A;  3KPX A;  3FIA A;  3O78 A;  1WLZ A;  2LE9 B;  1WDC C;  2ZN9 A;  3BOW B;  2KOT A;  3TDZ A;  4D1E A;  2KGB C;  5ER4 X;  4CID A;  1GJY A;  2I7A A;  3EK7 A;  3LCP C;  1GQM A;  3PFV A;  5HLO A;  1IKU A;  2R2I A;  2BCB A;  3CGA A;  3ZNI A;  1RK9 A;  2WOS A;  2PMY A;  2WCB A;  1CTR A;  1NX0 A;  2K7O A;  3AKA A;  2QAC A;  3BYA A;  2F3Z A;  1XVJ A;  1OMV A;  1UHH A;  1TCF A;  1ZUZ A;  4DUQ A;  2A4J A;  2HQW A;  1FI5 A;  1RJV A;  4PHK A;  4GGF A;  2SCP A;  1C7W A;  1J55 A;  3I5I C;  4MRX A;  1SL8 A;  3SIB A;  2Y1N A;  4XYN A;  1JFK A;  1YRU B;  3I5H C;  1Q80 A;  2I94 A;  2EC6 C;  3IQQ A;  1E8A A;  2NLN A;  2LNK A;  3BOW A;  2M49 B;  1SKT A;  2L0P A;  1DJY A;  1KSM A;  2JTT A;  4JQ0 D;  1RTP 1;  3O4Y A;  1ZOT B;  2M3W A;  3KF9 A;  4MZJ A;  2ZRT A;  1V1G A;  1MWN A;  2F33 A;  3M0W A;  2KI6 C;  1PK0 D;  4YGC B;  1YX7 A;  2F2P A;  2JT3 A;  5BPJ A;  4MRY A;  4ORB B;  3EK8 A;  2BCA A;  2LAP A;  1J7R A;  1M31 A;  1FW4 A;  1S5G Y;  4NDB A;  1DTL A;  4M2P A;  1B1G A;  3IQO A;  1CFP A;  1K9U A;  2JWW A;  3PAL A;  2D8N A;  4QJ4 B;  1NCZ A;  1IJ5 A;  1JWD A;  1DMO A;  1DVI A;  1CMF A;  3BUO B;  1QIV A;  1B9A A;  2BBM A;  2GV5 A;  2LHI A;  4E68 A;  1SPY A;  1SR6 B;  1NSH A;  2AMI A;  2K0J A;  4TNC A;  1XFZ O;  1TIZ A;  5I2O A;  2FOT A;  3I5G B;  5KU1 A;  1PRW A;  2OTG B;  1BR4 B;  1MHO A;  4NDC A;  3CTN A;  1M46 A;  1NCY A;  2JRF A;  4PE0 A;  3O6B A;  4USL A;  4NDD A;  2KBI A;  2BCX A;  2M29 A;  3AKB A;  1HT9 A;  1QJT A;  4I5J A;  2JTZ A;  1AJ5 A;  1G4Y R;  2L98 A;  3DVK A;  3QRX A;  1QS7 A;  3TZ1 A;  3PLF B;  1K8U A;  2JXL A;  2MA2 A;  2Q91 A;  1CLB A;  2V53 A;  3BUN B;  5ER5 A;  1S6I A;  2OS8 B;  1YTZ C;  5IBW A;  1SCV A;  1K9P A;  1GGW A;  2BKH B;  2JZI A;  2MLE C;  2ZFD A;  5GQQ C;  4DCK A;  1S3P A;  2KQY A;  1XA5 A;  1F4Q A;  2F8P A;  4MSP A;  4I5N B;  1UUS A;  2I2R E;  2ZN8 A;  4GNK B;  4PCW A;  3TDI A;  2AUC A;  1WLM A;  3ICB A;  1PSR A;  3D0Y A;  4PE4 A;  1H4B A;  1DGU A;  2LCP A;  4A4B A;  1AVS A;  1CDL A;  2JNX A;  1K95 A;  1F70 A;  1LA3 A;  1X02 A;  2WC8 A;  1JSA A;  1W7J B;  1S36 A;  2CCM A;  2KGR A;  4PDZ A;  1BR1 B;  1TNP A;  1G8I A;  2NCP A;  1SL9 A;  4L9M A;  2KBM A;  1OE9 B;  2EGD A;  1B8C A;  1NUB A;  2LV7 A;  2P6B B;  1L2O B;  1SNL A;  5D7F A;  3JVT C;  1MXE A;  1OZS A;  5B8I B;  1IJ6 A;  1K90 D;  1AP4 A;  1B4C A;  1U5I B;  1CMG A;  2M1K B;  2BE6 A;  3BXK A;  5AER A;  2KI4 C;  2AAO A;  2TN4 A;  1ALV A;  2PRU A;  5CSJ A;  2ISD A;  3A8R A;  1K96 A;  1QLS A;  1S1E A;  4OV2 A;  3NSO A;  1KK7 Y;  1QTX A;  3DVJ A;  1NIW A;  1QXP A;  2H61 A;  3GK4 X;  2Y1M A;  3BUM B;  5I8N A;  2JXC A;  3K21 A;  1QIW A;  1A75 B;  1JC2 A;  2Y4Q A;  3TDU A;  4I5L B;  4AQI A;  1MR8 A;  1DJI A;  4MZL A;  2JT0 A;  1KFU L;  1QX5 B;  3CWG A;  1N65 A;  1RRO A;  2LLT A;  1B8L A;  1IH0 A;  1M45 A;  2L4I A;  1XO5 A;  4CFR A;  3OB1 B;  3OB2 B;  2JOJ A;  2KAY A;  4DRW A;  1IGV A;  3NXA A;  3PAT A;  1DJH A;  1HQV A;  4JPZ B;  1KFX L;  1PVA A;  4YGB B;  1U5I A;  1BG1 A;  4AOM A;  2NXQ A;  1B7T Y;  1KK8 B;  1XFY O;  3I5F C;  2K8M B;  1CLL A;  1CFF A;  2M0R A;  4HSZ A;  1EXR A;  1F54 A;  2JPT A;  4DIR A;  1XFV O;  5KTY A;  2LMV A;  1R6P A;  3F45 A;  1EJ3 A;  1CDM A;  2LMT A;  3CZT X;  3FS7 A;  1YVL A;  4CPV A;  1LKJ A;  3AAK A;  4DS7 A;  3H4S E;  1A75 A;  4P5O E;  1UHJ A;  1SY9 A;  1TOP A;  2GGM A;  1YUS A;  2L5X B;  4ZCU A;  3VGO A;  1UWO A;  1FI6 A;  1S26 D;  2JT8 A;  2JC2 A;  2MJW B;  2JU0 A;  5CSN A;  3DF0 B;  1QAS A;  1XFU O;  5F6T A;  1SRA A;  3TUY C;  1BOD A;  4BY4 A;  1IWQ A;  4MLW A;  2BL0 B;  1EG4 A;  2HPS A;  2NZ0 A;  5KSZ A;  4QJ5 B;  4HRH A;  4N5X A;  3SG6 A;  1DJZ A;  4OR9 B;  5HKW A;  1AUI B;  3FWB A;  4C0K A;  1QX2 A;  3OX6 A;  1N2D A;  3RM1 A;  3VRQ A;  1K9K A;  1WRZ A;  4MVF A;  1QAT A;  1KSO A;  1S5G Z;  3EVU A;  2L4H A;  1SCM B;  2HET A;  2BKI B;  1F55 A;  1B8R A;  3D0Y B;  2VRG A;  3OX5 A;  1YVH A;  3BQ3 A;  4I5K A;  1MXL C;  1YUR A;  5D69 A;  1UP5 A;  2CNP A;  1ZMZ A;  1WY9 A;  4P2Y B;  2KDH A;  1J1E A;  1TRF A;  2LLU A;  2WCF A;  1BU3 A;  3PN7 C;  1AHR A;  3DF0 A;  4YRU A;  1J7O A;  2G2B A;  2L51 A;  3PSR A;  2K7D A;  2LVV A;  4GPL B;  1QV1 A;  2SAS A;  4CLN A;  1JUO A;  2H2K A;  1PSB A;  3KHE A;  4PE7 A;  1IQ3 A;  1TNW A;  3JVT B;  1BT6 A;  4A4C A;  1JF2 A;  1L7Z A;  3MSE B;  5DKN A;  4HRG A;  1NCX A;  2LLS A;  1UUR A;  2F2O A;  2OPO A;  1UHN A;  3SG3 A;  3WHT B;  2CBL A;  2I18 A;  2KI4 B;  3LK1 A;  1NP8 A;  1CNP A;  4IL1 A;  2BE4 A;  1KWO B;  2LVI A;  3IF7 A;  1SMG A;  5CSI A;  4UPG A;  1OMR A;  1J7P A;  1SK6 D;  1WDC B;  5AFP A;  1UHK A;  1BJF A;  2KNE A;  1Y1A A;  1QX7 A;  1C07 A;  1PUL A;  3SIA A;  3KEV A;  2KAV A;  3DVE A;  1CLM A;  1Y1U A;  5HLV A;  1TTX A;  3WNX B;  3EVR A;  3CS1 A;  1R2U A;  1SR6 C;  3LK0 A;  1S6C A;  2CT9 A;  3I5G C;  3SJS A;  1NX1 A;  2QPT A;  2PSR A;  2OTG C;  1FPW A;  2PAS A;  1A03 A;  2Y5I A;  4WQ2 A;  3BUX B;  1KFU S;  1UHI A;  4WQ3 A;  2M7L A;  3WHU B;  1W7I B;  1WRK A;  1NX2 A;  1XK4 A;  1YX8 A;  1KFX S;  2KFF A;  3I5I B;  2LHL A;  4YGE B;  4C0J A;  2KSP A;  1QVI Y;  4YI8 A;  1NX3 A;  2LVK A;  1B47 A;  3I5H B;  4ICB A;  4YI9 A;  1XFX O;  3DD4 A;  1EG3 A;  2EC6 B;  1EH2 A;  2LUC A;  2NCO A;  3TS5 C;  1H8B A;  1OZO A;  1KQM C;  1JFJ A;  2OS8 C;  4GUK A;  5AAN A;  3VRR A;  2O60 A;  3EKH A;  5K89 A;  4R1E A;  1K93 D;  1KK7 Z;  2KFG A;  1FBV A;  4QJ3 B;  1KQV A;  1REC A;  4OCI A;  1DF0 B;  1CFC A;  3OHM B;  1BOC A;  3FWC A;  2MLF C;  3VRN A;  3TUY B;  3D10 A;  1DT7 B;  2O5G A;  4FQO A;  3JTD C;  2MBX A;  2KHN A;  4PHJ A;  1PVB A;  2FCD A;  3AAJ A;  1TN4 A;  3NSI A;  2WOR A;  1ALW A;  2E6W A;  1Y1X A;  3VRO A;  2MAZ A;  5J3X A;  4XJK B;  1J7Q A;  3OP0 A;  5I2Q A;  1B7T Z;  2KI6 D;  2F3Y A;  4M2O A;  1L2O C;  3WXA A;  2CTN A;  5HYD A;  1OQP A;  1C7V A;  1IG5 A;  2FJU B;  1OMD A;  2LAN A;  2IS9 A;  4GGF C;  4JWQ A;  3GK2 A;  1TCO B;  4C0L A;  4ETO A;  1FF1 A;  3EKJ A;  1A4P A;  2BEC A;  4MN0 A;  1DF0 A;  1YRT B;  1DGV A;  2M7N A;  1V1F A;  2Q4U A;  2PVB A;  2HF5 A;  3DVM A;  3PN7 B;  5G08 A;  1CM1 A;  4PE1 A;  1JF0 A;  3CLN A;  2ZKM X;  2M97 A;  2BBN A;  1F8H A;  3LLE A;  2K2A A;  4AQJ A;  1ZFS A;  1DJW A;  2G9B A;  3C1V A;  1M39 A;  2K7B A;  2DOQ A;  1VRK A;  1NWD A;  4YBH B;  1YUU A;  3SG5 A;  1JBA A;  5AXI A;  1OSA A;  1MF8 B;  4FTG A;  4XJK A;  1Y6W A;  3LL8 B;  1S6J A;  1LVC D;  5FYX A;  1LIN A;  2K7C A;  4PHM A;  5I2L A;  3HX4 A;  2COL B;  1BLQ A;  4BY5 A;  3RLZ A;  4PAL A;  1M63 B;  3BUW B;  4YGD B;  1KK8 C;  4MBE A;  4N1G A;  4HRE E;  1KCY A;  2LP3 A;  1NYA A;  3VRP A;  2MHH A;  1XYD A;  3ZWH A;  2M1U A;  4ORC B;  2JUL A;  5DKR A;  4YGA A;  3CR2 A;  2M8U A;  2RGI A;  2B1U A;  1AJ4 A;  4WRI A;  1IQ5 A;  1SW8 A;  4Q04 A;  4N1F A;  1K2H A;  2GGZ A;  1BMO A;  1N0Y A;  4U8D A;  2KAX A;  2LM5 A;  1TNX A;  2FCE A;  3PM8 A;  1J1D A;  2BL0 C;  1F4O A;  1CFD A;  1IRJ A;  3SG2 A;  1F71 A;  2K61 A;  1YR5 A; 
#chains in the Genus database with same CATH topology
 2HQ8 A;  2KYC A;  2WCJ A;  4GFT A;  2M9G A;  1LXF C;  5HKY A;  3TS5 B;  1BF5 A;  1CDN A;  5JOL A;  1WRL A;  1RFJ A;  2LC5 A;  1KQM B;  4JD9 A;  1QLK A;  2EHB A;  2JQ6 A;  3GK1 A;  4GAO A;  3O2P A;  2ZNE A;  2JNF A;  3SG4 A;  1AK8 A;  1D1O A;  5DKQ A;  1GGZ A;  1ORG A;  1SCM C;  1SL7 A;  5JJG A;  3GOF A;  3CR4 X;  1DJX A;  2WND A;  2ZND A;  5CSF A;  5CPV A;  2E30 A;  2L2E A;  3BFH A;  3A4U B;  5HKZ A;  3NSK A;  5AEQ A;  2KQ6 A;  4MZK A;  1CKK A;  4CFQ A;  2ZRS A;  1ZAC A;  1Y0V H;  1LS8 A;  1EL4 A;  3CR5 X;  2WCE A;  3BFA A;  4ZCV A;  5TNC A;  4OKH A;  2LUX A;  1SYM A;  4GBA A;  3JTD B;  1NPQ A;  4MEW A;  2LMU A;  1RWY A;  1TNQ A;  3EK4 A;  3I5F B;  2WCH A;  2L50 A;  1TUZ A;  2KFH A;  3HCM A;  3SG7 A;  4ORA B;  1YUT A;  1A29 A;  1ODB A;  3E3R A;  4F0Z B;  1XFW O;  3IVT A;  2MRD A;  3NSL A;  4NQG A;  1CB1 A;  1LA0 A;  1PAL A;  2KYF A;  1OOJ A;  1QV0 A;  3EVV A;  4GGN A;  3CZ1 A;  1QVI Z;  1CM4 A;  1MUX A;  2K2F A;  3DXL A;  1CDP A;  1A2X A;  1K94 A;  1DJG A;  1SBJ A;  2LP2 A;  2QEO A;  3FE9 A;  4KYN A;  1XK4 C;  3KO0 A;  1MQ1 A;  4OVN F;  1DQE A;  2LVJ A;  2CXJ A;  2KLE A;  2PAL A;  3D78 A;  2H61 C;  4M2Q A;  4PHN A;  5PAL A;  1KWO C;  5I94 A;  1G33 A;  3KPX A;  3FIA A;  3O78 A;  1WLZ A;  2LE9 B;  1WDC C;  2ZN9 A;  3BOW B;  2KOT A;  3TDZ A;  4D1E A;  2KGB C;  5ER4 X;  4CID A;  1GJY A;  2I7A A;  3EK7 A;  3LCP C;  2QDI A;  1GQM A;  3PFV A;  5HLO A;  1IKU A;  2P70 A;  2R2I A;  2BCB A;  3CGA A;  3ZNI A;  1RK9 A;  2WOS A;  2PMY A;  2WCB A;  1CTR A;  1NX0 A;  2K7O A;  3AKA A;  2QAC A;  5DIC A;  3BYA A;  2F3Z A;  1XVJ A;  1OMV A;  1UHH A;  1TCF A;  1ZUZ A;  2BAP A;  3R1V A;  4DUQ A;  3BFB A;  1Z4H A;  2A4J A;  2HQW A;  1FI5 A;  1RJV A;  4PHK A;  4GGF A;  2SCP A;  1C7W A;  1J55 A;  3I5I C;  4MRX A;  1SL8 A;  2YGU A;  3SIB A;  2Y1N A;  4XYN A;  1JFK A;  1YRU B;  1OOF A;  3I5H C;  1Q80 A;  2I94 A;  2EC6 C;  3IQQ A;  1E8A A;  2NLN A;  3D73 A;  3CYZ A;  3QME A;  3B86 A;  2LNK A;  3BOW A;  2M49 B;  3CZ0 A;  1SKT A;  2L0P A;  1DJY A;  1KSM A;  2JTT A;  3R72 A;  1RTP 1;  1TWO A;  4JQ0 D;  3FE8 A;  3O4Y A;  1ZOT B;  2M3W A;  3KF9 A;  4MZJ A;  2ZRT A;  1V1G A;  1MWN A;  2F33 A;  3M0W A;  2KI6 C;  1PK0 D;  4YGC B;  1YX7 A;  2F2P A;  2JT3 A;  5BPJ A;  4MRY A;  4ORB B;  3EK8 A;  2BCA A;  2LAP A;  1J7R A;  1M31 A;  1FW4 A;  3VB1 A;  1S5G Y;  4NDB A;  1DTL A;  4M2P A;  1B1G A;  3IQO A;  1CFP A;  1K9U A;  2JWW A;  3PAL A;  2D8N A;  4QJ4 B;  1NCZ A;  1IJ5 A;  1JWD A;  1DMO A;  1DVI A;  1QWV A;  3BUO B;  1CMF A;  1QIV A;  1B9A A;  2BBM A;  2GV5 A;  2LHI A;  4E68 A;  1SPY A;  1SR6 B;  1NSH A;  2AMI A;  2K0J A;  4TNC A;  1XFZ O;  1TIZ A;  5I2O A;  2FOT A;  3I5G B;  5KU1 A;  1PRW A;  2OTG B;  1BR4 B;  1MHO A;  4NDC A;  3CTN A;  1M46 A;  1NCY A;  2JRF A;  4PE0 A;  3O6B A;  4USL A;  4NDD A;  2KBI A;  2BCX A;  2M29 A;  3AKB A;  1HT9 A;  1QJT A;  4I5J A;  2JTZ A;  1AJ5 A;  1G4Y R;  2L98 A;  3DVK A;  3QRX A;  1QS7 A;  3TZ1 A;  3PLF B;  1K8U A;  2JXL A;  2MA2 A;  2Q91 A;  1CLB A;  2V53 A;  3BUN B;  5ER5 A;  2KLD A;  3OBV A;  1S6I A;  2OS8 B;  1YTZ C;  5IBW A;  1SCV A;  1K9P A;  1GGW A;  2BKH B;  2JZI A;  2MLE C;  2ZFD A;  5GQQ C;  4DCK A;  1C3Y A;  1S3P A;  1DC1 A;  2KQY A;  1XA5 A;  1F4Q A;  2F8P A;  4MSP A;  4I5N B;  1UUS A;  2I2R E;  2ZN8 A;  4GNK B;  4PCW A;  3TDI A;  2WCK A;  2AUC A;  1WLM A;  3ICB A;  1PSR A;  3D0Y A;  4PE4 A;  3CAB A;  1H4B A;  1DGU A;  2LCP A;  4A4B A;  1AVS A;  1CDL A;  2JNX A;  1TUJ A;  1K95 A;  4JKT A;  1F70 A;  1LA3 A;  1X02 A;  2ERB A;  2WC8 A;  1W7J B;  3UO9 A;  1S36 A;  2CCM A;  2KGR A;  3NHT A;  4PDZ A;  1BR1 B;  1TNP A;  1G8I A;  3DY9 A;  2NCP A;  1SL9 A;  4L9M A;  2KBM A;  1OE9 B;  1T14 A;  2EGD A;  1B8C A;  1NUB A;  2LV7 A;  2P6B B;  1L2O B;  1SNL A;  5D7F A;  3RZS A;  3JVT C;  1MXE A;  1OZS A;  5B8I B;  1IJ6 A;  1JSA A;  1K90 D;  1AP4 A;  1B4C A;  1U5I B;  1CMG A;  2M1K B;  2BE6 A;  3BXK A;  3L4A A;  5AER A;  2KI4 C;  2WCL A;  2AAO A;  2TN4 A;  1ALV A;  2PRU A;  3B87 A;  5CSJ A;  2ISD A;  3A8R A;  1K96 A;  1QLS A;  1S1E A;  4OV2 A;  3NSO A;  1KK7 Y;  1QTX A;  3DVJ A;  1NIW A;  1QXP A;  2H61 A;  2WC6 A;  2Y1M A;  3BUM B;  3GK4 X;  2JXC A;  5I8N A;  3K21 A;  2WCM A;  1C3Z A;  1QIW A;  4PT1 A;  1A75 B;  5EL2 A;  1JC2 A;  2Y4Q A;  3TDU A;  4I5L B;  4AQI A;  1MR8 A;  1DJI A;  3PM2 A;  4MZL A;  2JT0 A;  1KFU L;  1QX5 B;  3CWG A;  1N65 A;  1RRO A;  2LLT A;  1B8L A;  1IH0 A;  1M45 A;  2L4I A;  1XO5 A;  4CFR A;  3OB1 B;  3OB2 B;  2JOJ A;  2KAY A;  2QEV A;  4DRW A;  1IGV A;  3NXA A;  3PAT A;  3BJH A;  1DJH A;  1HQV A;  1SSE B;  4JPZ B;  1KFX L;  1PVA A;  4YGB B;  1U5I A;  1BG1 A;  2K60 A;  4AOM A;  2BNX A;  2NXQ A;  1B7T Y;  1KK8 B;  1XFY O;  3I5F C;  2K8M B;  1CLL A;  1CFF A;  2M0R A;  4HSZ A;  1EXR A;  1F54 A;  2JPT A;  4DIR A;  1XFV O;  5KTY A;  2LMV A;  1R6P A;  3F45 A;  1EJ3 A;  1CDM A;  2LMT A;  3CDN A;  1P28 A;  1YVL A;  3CZT X;  3FS7 A;  3N7H A;  1LKJ A;  4CPV A;  3AAK A;  3S0B A;  4DS7 A;  3H4S E;  1A75 A;  4P5O E;  1UHJ A;  1SY9 A;  1TOP A;  2GGM A;  1YUS A;  2L5X B;  4ZCU A;  3SS3 A;  3VGO A;  1UWO A;  1FI6 A;  1S26 D;  2JT8 A;  2JC2 A;  2MJW B;  2JU0 A;  5CSN A;  1Z2C B;  3DF0 B;  1QAS A;  1XFU O;  5F6T A;  1SRA A;  3TUY C;  1BOD A;  4BY4 A;  1IWQ A;  4MLW A;  3S0G A;  2BL0 B;  1EG4 A;  2HPS A;  2NZ0 A;  5KSZ A;  4QJ5 B;  4HRH A;  4N5X A;  3SG6 A;  1DJZ A;  4INW A;  4F7F A;  4OR9 B;  5HKW A;  1AUI B;  3FWB A;  4C0K A;  1QX2 A;  3OX6 A;  1N2D A;  3RM1 A;  3VRQ A;  1K9K A;  1WRZ A;  4MVF A;  1QAT A;  2L2C A;  1KSO A;  1S5G Z;  3EVU A;  3S0A A;  2L4H A;  1SCM B;  2HET A;  2BKI B;  3S0F A;  3B88 A;  1F55 A;  3D75 A;  1B8R A;  3D0Y B;  2VRG A;  3OX5 A;  1YVH A;  1XFR A;  3BQ3 A;  4I5K A;  1MXL C;  1YUR A;  5D69 A;  1UP5 A;  2CNP A;  1ZMZ A;  5FI2 A;  1WY9 A;  4P2Y B;  2KDH A;  3OGN A;  1J1E A;  3D74 A;  1TRF A;  2LLU A;  2WCF A;  1BU3 A;  3PN7 C;  1AHR A;  3DF0 A;  4YRU A;  1J7O A;  2G2B A;  2H8V A;  2L51 A;  3B6X A;  3PSR A;  2K7D A;  2LVV A;  4GPL B;  5HL1 A;  1QV1 A;  2SAS A;  4CLN A;  1JUO A;  3L47 A;  2H2K A;  1PSB A;  3KHE A;  4PE7 A;  2PYQ A;  1IQ3 A;  1TNW A;  3JVT B;  1BT6 A;  4A4C A;  2WC5 A;  2GTE A;  1JF2 A;  1L7Z A;  3MSE B;  3DZT A;  5DKN A;  4HRG A;  1NCX A;  2L5Y A;  2LLS A;  1UUR A;  2F2O A;  2OPO A;  1UHN A;  3B7A A;  3SG3 A;  3WHT B;  2CBL A;  2I18 A;  2KI4 B;  3LK1 A;  1NP8 A;  1CNP A;  4IL1 A;  2BE4 A;  1KWO B;  2LVI A;  3IF7 A;  1SMG A;  5CSI A;  4UPG A;  3Q8I A;  1OMR A;  1J7P A;  1SK6 D;  1WDC B;  5AFP A;  1UHK A;  1BJF A;  2KNE A;  1Y1A A;  1QX7 A;  2QEH A;  1PUL A;  1C07 A;  3SIA A;  3KEV A;  2KAV A;  3DVE A;  1CLM A;  1Y1U A;  5HLV A;  1TTX A;  3WNX B;  3EVR A;  3CS1 A;  4OZD A;  1R2U A;  1SR6 C;  2P71 A;  1S6C A;  3LK0 A;  3V2L A;  2CT9 A;  1DEL A;  3I5G C;  3SJS A;  1NX1 A;  2QPT A;  2PSR A;  2OTG C;  1FPW A;  2PAS A;  1A03 A;  2Y5I A;  4WQ2 A;  3BUX B;  1KFU S;  3PJI A;  1UHI A;  4WQ3 A;  1OOH A;  2M7L A;  3WHU B;  1IIO A;  1OOI X;  1W7I B;  1WRK A;  1NX2 A;  1GM0 A;  1XK4 A;  1YX8 A;  1KFX S;  2KFF A;  3I5I B;  2LHL A;  4YGE B;  4C0J A;  1DEK A;  2KSP A;  1QVI Y;  4YI8 A;  1NX3 A;  2LVK A;  1B47 A;  3I5H B;  3NHI A;  4ICB A;  1XFX O;  3DD4 A;  1EG3 A;  2EC6 B;  4YI9 A;  1EH2 A;  2LUC A;  2NCO A;  3TS5 C;  1H8B A;  1OZO A;  1KQM C;  1JFJ A;  2OS8 C;  3CZ2 A;  3DYE A;  2QEB A;  2O60 A;  4GUK A;  5AAN A;  3VRR A;  3EKH A;  5K89 A;  4R1E A;  1K93 D;  1KK7 Z;  2KFG A;  1FBV A;  4QJ3 B;  1KQV A;  1REC A;  4OCI A;  1DF0 B;  1CFC A;  3OHM B;  1BOC A;  3D76 A;  3FWC A;  2MLF C;  3VRN A;  3O4X A;  5FI7 A;  3TUY B;  3D10 A;  1DT7 B;  2O5G A;  4FQO A;  3JTD C;  2MBX A;  2KHN A;  4PHJ A;  1PVB A;  2FCD A;  2PQL A;  3AAJ A;  4IJ7 A;  1TN4 A;  3NSI A;  2WOR A;  1ALW A;  2E6W A;  1Y1X A;  3VRO A;  2MAZ A;  3S0D A;  5J3X A;  4XJK B;  1J7Q A;  3K1E A;  3OP0 A;  3SS5 A;  5I2Q A;  1B7T Z;  2KI6 D;  2F3Y A;  4M2O A;  1L2O C;  3WXA A;  2CTN A;  1OW4 A;  5HYD A;  1OQP A;  1C7V A;  1IG5 A;  2FJU B;  5D3O A;  1OMD A;  2LAN A;  2IS9 A;  4GGF C;  4JWQ A;  3GK2 A;  1TCO B;  4C0L A;  4ETO A;  1FF1 A;  3EKJ A;  1A4P A;  2BEC A;  2JPO A;  1DF0 A;  3L4L A;  4MN0 A;  1YRT B;  3SS4 A;  1DGV A;  3UNW A;  2M7N A;  1V1F A;  3R1P A;  2Q4U A;  2PVB A;  2HF5 A;  3DVM A;  3PN7 B;  5G08 A;  1CM1 A;  4PE1 A;  1JF0 A;  3CLN A;  2ZKM X;  2M97 A;  2BBN A;  3D77 A;  3LLE A;  1F8H A;  2K2A A;  4AQJ A;  1ZFS A;  1DJW A;  2G9B A;  3C1V A;  1M39 A;  2K7B A;  2DOQ A;  1VRK A;  1NWD A;  4FQT A;  4YBH B;  1YUU A;  3SG5 A;  1JBA A;  5AXI A;  1OSA A;  1MF8 B;  4FTG A;  4XJK A;  1Y6W A;  3LL8 B;  1S6J A;  1LVC D;  5FYX A;  1LIN A;  2K7C A;  4PHM A;  5I2L A;  4INX A;  3HX4 A;  2COL B;  1BLQ A;  4BY5 A;  3RLZ A;  4PAL A;  1M63 B;  2KPH A;  3BUW B;  3S0E A;  1W9Z A;  4YGD B;  1KK8 C;  3EG5 B;  4MBE A;  4N1G A;  4HRE E;  1KCY A;  2LP3 A;  1NYA A;  3FE6 A;  3VRP A;  2MHH A;  1XYD A;  3ZWH A;  2M1U A;  3R1O A;  3NGV A;  4ORC B;  1OOG A;  2JUL A;  5DKR A;  4YGA A;  3CR2 A;  2M8U A;  5FI6 A;  2RGI A;  2B1U A;  1AJ4 A;  4WRI A;  1IQ5 A;  1SW8 A;  4Q04 A;  4N1F A;  1K2H A;  2GGZ A;  1BMO A;  1N0Y A;  4U8D A;  2KAX A;  2LM5 A;  1TNX A;  2FCE A;  3PM8 A;  2FJY A;  1J1D A;  1F4O A;  1CFD A;  2BL0 C;  1IRJ A;  3SG2 A;  1F71 A;  2K61 A;  1YR5 A; 
#chains in the Genus database with same CATH homology
 2HQ8 A;  2KYC A;  4GFT A;  2M9G A;  1LXF C;  5HKY A;  3TS5 B;  1BF5 A;  1CDN A;  5JOL A;  1WRL A;  1RFJ A;  2LC5 A;  1KQM B;  1QLK A;  2EHB A;  2JQ6 A;  3GK1 A;  4GAO A;  3O2P A;  2ZNE A;  2JNF A;  3SG4 A;  1AK8 A;  1D1O A;  5DKQ A;  1GGZ A;  1SCM C;  1SL7 A;  5JJG A;  3GOF A;  3CR4 X;  1DJX A;  2WND A;  2ZND A;  5CSF A;  5CPV A;  2E30 A;  2L2E A;  5HKZ A;  3A4U B;  3NSK A;  5AEQ A;  2KQ6 A;  4MZK A;  1CKK A;  4CFQ A;  2ZRS A;  1ZAC A;  1Y0V H;  3CR5 X;  1EL4 A;  2WCE A;  4ZCV A;  5TNC A;  4OKH A;  2LUX A;  1SYM A;  4GBA A;  3JTD B;  1NPQ A;  4MEW A;  2LMU A;  1RWY A;  1TNQ A;  3EK4 A;  3I5F B;  2L50 A;  2KFH A;  3HCM A;  3SG7 A;  4ORA B;  1YUT A;  1A29 A;  1ODB A;  3E3R A;  4F0Z B;  1XFW O;  2MRD A;  3NSL A;  4NQG A;  1CB1 A;  1LA0 A;  1PAL A;  2KYF A;  1OOJ A;  1QV0 A;  3EVV A;  4GGN A;  1QVI Z;  1CM4 A;  1MUX A;  2K2F A;  1CDP A;  1A2X A;  1K94 A;  1DJG A;  1SBJ A;  2LP2 A;  1XK4 C;  3KO0 A;  1MQ1 A;  4OVN F;  2LVJ A;  2CXJ A;  2PAL A;  2H61 C;  4M2Q A;  4PHN A;  5PAL A;  1KWO C;  1G33 A;  3KPX A;  3FIA A;  3O78 A;  1WLZ A;  2LE9 B;  1WDC C;  2ZN9 A;  3BOW B;  2KOT A;  3TDZ A;  4D1E A;  2KGB C;  5ER4 X;  4CID A;  1GJY A;  2I7A A;  3EK7 A;  3LCP C;  1GQM A;  3PFV A;  5HLO A;  1IKU A;  2R2I A;  2BCB A;  3CGA A;  3ZNI A;  1RK9 A;  2WOS A;  2PMY A;  2WCB A;  1CTR A;  1NX0 A;  2K7O A;  3AKA A;  2QAC A;  3BYA A;  2F3Z A;  1XVJ A;  1OMV A;  1UHH A;  1TCF A;  1ZUZ A;  4DUQ A;  2A4J A;  2HQW A;  1FI5 A;  1RJV A;  4PHK A;  4GGF A;  2SCP A;  1C7W A;  1J55 A;  3I5I C;  4MRX A;  1SL8 A;  3SIB A;  2Y1N A;  4XYN A;  1JFK A;  1YRU B;  3I5H C;  1Q80 A;  2I94 A;  2EC6 C;  3IQQ A;  1E8A A;  2NLN A;  2LNK A;  3BOW A;  2M49 B;  1SKT A;  2L0P A;  1DJY A;  1KSM A;  2JTT A;  4JQ0 D;  1RTP 1;  3O4Y A;  1ZOT B;  2M3W A;  3KF9 A;  4MZJ A;  2ZRT A;  1V1G A;  1MWN A;  2F33 A;  3M0W A;  2KI6 C;  1PK0 D;  4YGC B;  1YX7 A;  2F2P A;  2JT3 A;  5BPJ A;  4MRY A;  4ORB B;  3EK8 A;  2BCA A;  2LAP A;  1J7R A;  1M31 A;  1FW4 A;  1S5G Y;  4NDB A;  1DTL A;  4M2P A;  1B1G A;  3IQO A;  1CFP A;  1K9U A;  2JWW A;  3PAL A;  2D8N A;  4QJ4 B;  1NCZ A;  1IJ5 A;  1JWD A;  1DMO A;  1DVI A;  1CMF A;  3BUO B;  1QIV A;  1B9A A;  2BBM A;  2GV5 A;  2LHI A;  4E68 A;  1SPY A;  1SR6 B;  1NSH A;  2AMI A;  2K0J A;  4TNC A;  1XFZ O;  1TIZ A;  5I2O A;  2FOT A;  3I5G B;  5KU1 A;  1PRW A;  2OTG B;  1BR4 B;  1MHO A;  4NDC A;  3CTN A;  1M46 A;  1NCY A;  2JRF A;  4PE0 A;  3O6B A;  4USL A;  4NDD A;  2KBI A;  2BCX A;  2M29 A;  3AKB A;  1HT9 A;  1QJT A;  4I5J A;  2JTZ A;  1AJ5 A;  1G4Y R;  2L98 A;  3DVK A;  3QRX A;  1QS7 A;  3TZ1 A;  3PLF B;  1K8U A;  2JXL A;  2MA2 A;  2Q91 A;  1CLB A;  2V53 A;  3BUN B;  5ER5 A;  1S6I A;  2OS8 B;  1YTZ C;  5IBW A;  1SCV A;  1K9P A;  1GGW A;  2BKH B;  2JZI A;  2MLE C;  2ZFD A;  5GQQ C;  4DCK A;  1S3P A;  2KQY A;  1XA5 A;  1F4Q A;  2F8P A;  4MSP A;  4I5N B;  1UUS A;  2I2R E;  2ZN8 A;  4GNK B;  4PCW A;  3TDI A;  2AUC A;  1WLM A;  3ICB A;  1PSR A;  3D0Y A;  4PE4 A;  1H4B A;  1DGU A;  2LCP A;  4A4B A;  1AVS A;  1CDL A;  2JNX A;  1K95 A;  1F70 A;  1LA3 A;  1X02 A;  2WC8 A;  1JSA A;  1W7J B;  1S36 A;  2CCM A;  2KGR A;  4PDZ A;  1BR1 B;  1TNP A;  1G8I A;  2NCP A;  1SL9 A;  4L9M A;  2KBM A;  1OE9 B;  2EGD A;  1B8C A;  1NUB A;  2LV7 A;  2P6B B;  1L2O B;  1SNL A;  5D7F A;  3JVT C;  1MXE A;  1OZS A;  5B8I B;  1IJ6 A;  1K90 D;  1AP4 A;  1B4C A;  1U5I B;  1CMG A;  2M1K B;  2BE6 A;  3BXK A;  5AER A;  2KI4 C;  2AAO A;  2TN4 A;  1ALV A;  2PRU A;  5CSJ A;  2ISD A;  3A8R A;  1K96 A;  1QLS A;  1S1E A;  4OV2 A;  3NSO A;  1KK7 Y;  1QTX A;  3DVJ A;  1NIW A;  1QXP A;  2H61 A;  3GK4 X;  2Y1M A;  3BUM B;  5I8N A;  2JXC A;  3K21 A;  1QIW A;  1A75 B;  1JC2 A;  2Y4Q A;  3TDU A;  4I5L B;  4AQI A;  1MR8 A;  1DJI A;  4MZL A;  2JT0 A;  1KFU L;  1QX5 B;  3CWG A;  1N65 A;  1RRO A;  2LLT A;  1B8L A;  1IH0 A;  1M45 A;  2L4I A;  1XO5 A;  4CFR A;  3OB1 B;  3OB2 B;  2JOJ A;  2KAY A;  4DRW A;  1IGV A;  3NXA A;  3PAT A;  1DJH A;  1HQV A;  4JPZ B;  1KFX L;  1PVA A;  4YGB B;  1U5I A;  1BG1 A;  4AOM A;  2NXQ A;  1B7T Y;  1KK8 B;  1XFY O;  3I5F C;  2K8M B;  1CLL A;  1CFF A;  2M0R A;  4HSZ A;  1EXR A;  1F54 A;  2JPT A;  4DIR A;  1XFV O;  5KTY A;  2LMV A;  1R6P A;  3F45 A;  1EJ3 A;  1CDM A;  2LMT A;  3CZT X;  3FS7 A;  1YVL A;  4CPV A;  1LKJ A;  3AAK A;  4DS7 A;  3H4S E;  1A75 A;  4P5O E;  1UHJ A;  1SY9 A;  1TOP A;  2GGM A;  1YUS A;  2L5X B;  4ZCU A;  3VGO A;  1UWO A;  1FI6 A;  1S26 D;  2JT8 A;  2JC2 A;  2MJW B;  2JU0 A;  5CSN A;  3DF0 B;  1QAS A;  1XFU O;  5F6T A;  1SRA A;  3TUY C;  1BOD A;  4BY4 A;  1IWQ A;  4MLW A;  2BL0 B;  1EG4 A;  2HPS A;  2NZ0 A;  5KSZ A;  4QJ5 B;  4HRH A;  4N5X A;  3SG6 A;  1DJZ A;  4OR9 B;  5HKW A;  1AUI B;  3FWB A;  4C0K A;  1QX2 A;  3OX6 A;  1N2D A;  3RM1 A;  3VRQ A;  1K9K A;  1WRZ A;  4MVF A;  1QAT A;  1KSO A;  1S5G Z;  3EVU A;  2L4H A;  1SCM B;  2HET A;  2BKI B;  1F55 A;  1B8R A;  3D0Y B;  2VRG A;  3OX5 A;  1YVH A;  3BQ3 A;  4I5K A;  1MXL C;  1YUR A;  5D69 A;  1UP5 A;  2CNP A;  1ZMZ A;  1WY9 A;  4P2Y B;  2KDH A;  1J1E A;  1TRF A;  2LLU A;  2WCF A;  1BU3 A;  3PN7 C;  1AHR A;  3DF0 A;  4YRU A;  1J7O A;  2G2B A;  2L51 A;  3PSR A;  2K7D A;  2LVV A;  4GPL B;  1QV1 A;  2SAS A;  4CLN A;  1JUO A;  2H2K A;  1PSB A;  3KHE A;  4PE7 A;  1IQ3 A;  1TNW A;  3JVT B;  1BT6 A;  4A4C A;  1JF2 A;  1L7Z A;  3MSE B;  5DKN A;  4HRG A;  1NCX A;  2LLS A;  1UUR A;  2F2O A;  2OPO A;  1UHN A;  3SG3 A;  3WHT B;  2CBL A;  2I18 A;  2KI4 B;  3LK1 A;  1NP8 A;  1CNP A;  4IL1 A;  2BE4 A;  1KWO B;  2LVI A;  3IF7 A;  1SMG A;  5CSI A;  4UPG A;  1OMR A;  1J7P A;  1SK6 D;  1WDC B;  5AFP A;  1UHK A;  1BJF A;  2KNE A;  1Y1A A;  1QX7 A;  1C07 A;  1PUL A;  3SIA A;  3KEV A;  2KAV A;  3DVE A;  1CLM A;  1Y1U A;  5HLV A;  1TTX A;  3WNX B;  3EVR A;  3CS1 A;  1R2U A;  1SR6 C;  3LK0 A;  1S6C A;  2CT9 A;  3I5G C;  3SJS A;  1NX1 A;  2QPT A;  2PSR A;  2OTG C;  1FPW A;  2PAS A;  1A03 A;  2Y5I A;  4WQ2 A;  3BUX B;  1KFU S;  1UHI A;  4WQ3 A;  2M7L A;  3WHU B;  1W7I B;  1WRK A;  1NX2 A;  1XK4 A;  1YX8 A;  1KFX S;  2KFF A;  3I5I B;  2LHL A;  4YGE B;  4C0J A;  2KSP A;  1QVI Y;  4YI8 A;  1NX3 A;  2LVK A;  1B47 A;  3I5H B;  4ICB A;  4YI9 A;  1XFX O;  3DD4 A;  1EG3 A;  2EC6 B;  1EH2 A;  2LUC A;  2NCO A;  3TS5 C;  1H8B A;  1OZO A;  1KQM C;  1JFJ A;  2OS8 C;  4GUK A;  5AAN A;  3VRR A;  2O60 A;  3EKH A;  5K89 A;  4R1E A;  1K93 D;  1KK7 Z;  2KFG A;  1FBV A;  4QJ3 B;  1KQV A;  1REC A;  4OCI A;  1DF0 B;  1CFC A;  3OHM B;  1BOC A;  3FWC A;  2MLF C;  3VRN A;  3TUY B;  3D10 A;  1DT7 B;  2O5G A;  4FQO A;  3JTD C;  2MBX A;  2KHN A;  4PHJ A;  1PVB A;  2FCD A;  3AAJ A;  1TN4 A;  3NSI A;  2WOR A;  1ALW A;  2E6W A;  1Y1X A;  3VRO A;  2MAZ A;  5J3X A;  4XJK B;  1J7Q A;  3OP0 A;  5I2Q A;  1B7T Z;  2KI6 D;  2F3Y A;  4M2O A;  1L2O C;  3WXA A;  2CTN A;  5HYD A;  1OQP A;  1C7V A;  1IG5 A;  2FJU B;  1OMD A;  2LAN A;  2IS9 A;  4GGF C;  4JWQ A;  3GK2 A;  1TCO B;  4C0L A;  4ETO A;  1FF1 A;  3EKJ A;  1A4P A;  2BEC A;  4MN0 A;  1DF0 A;  1YRT B;  1DGV A;  2M7N A;  1V1F A;  2Q4U A;  2PVB A;  2HF5 A;  3DVM A;  3PN7 B;  5G08 A;  1CM1 A;  4PE1 A;  1JF0 A;  3CLN A;  2ZKM X;  2M97 A;  2BBN A;  1F8H A;  3LLE A;  2K2A A;  4AQJ A;  1ZFS A;  1DJW A;  2G9B A;  3C1V A;  1M39 A;  2K7B A;  2DOQ A;  1VRK A;  1NWD A;  4YBH B;  1YUU A;  3SG5 A;  1JBA A;  5AXI A;  1OSA A;  1MF8 B;  4FTG A;  4XJK A;  1Y6W A;  3LL8 B;  1S6J A;  1LVC D;  5FYX A;  1LIN A;  2K7C A;  4PHM A;  5I2L A;  3HX4 A;  2COL B;  1BLQ A;  4BY5 A;  3RLZ A;  4PAL A;  1M63 B;  3BUW B;  4YGD B;  1KK8 C;  4MBE A;  4N1G A;  4HRE E;  1KCY A;  2LP3 A;  1NYA A;  3VRP A;  2MHH A;  1XYD A;  3ZWH A;  2M1U A;  4ORC B;  2JUL A;  5DKR A;  4YGA A;  3CR2 A;  2M8U A;  2RGI A;  2B1U A;  1AJ4 A;  4WRI A;  1IQ5 A;  1SW8 A;  4Q04 A;  4N1F A;  1K2H A;  2GGZ A;  1BMO A;  1N0Y A;  4U8D A;  2KAX A;  2LM5 A;  1TNX A;  2FCE A;  3PM8 A;  1J1D A;  2BL0 C;  1F4O A;  1CFD A;  1IRJ A;  3SG2 A;  1F71 A;  2K61 A;  1YR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...