4F7FA

Structure of anopheles gambiae odorant binding protein 20
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
TVEQMMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKELKCYVNCVMEMMQTMKKGKLNYDASVKQIDTIMPDELAGPMRAALDICRTVADGIKNNCDAAYVLLQCLSKNNPKFIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Odorant-binding protein
molecule keywords AGAP005208-PA
publication title A novel mechanism of ligand binding and release in the odorant binding protein 20 from the malaria mosquito Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 42
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4f7fA00
3D76A 3N7HA 3K1EA 2P71A 1LS8A 1XFRA 3NHIA 3OGNA 3CABA 2GTEA 2P70A 1TUJA 3L4LA 2PQLA 3CZ2A 3BFBA 3DZTA 3VB1A 3R72A 1QWVA 2JPOA 3NHTA 3S0FA 2ERBA 3BFHA 4PT1A 3BJHA 3S0EA 3D74A 3FE6A 3PJIA 1P28A 2QEBA 4INXA 3R1VA 1TWOA 3B88A 3CZ1A 2QEOA 3R1PA 3BFAA 3V2LA 3DYEA 3Q8IA 3S0DA 1OOHA 2FJYA 3NGVA 1OOFA 2H8VA 3CYZA 3S0BA 1ORGA 3L47A 2WCKA 2WCJA 1C3ZA 1OOGA 2QDIA 5DICA 2WCLA 3S0AA 4JD9A 1DQEA 1C3YA 3L4AA 2WC6A 3QMEA 4OZDA 3B7AA 4INWA 2QEVA 3CDNA 3FE9A 3DY9A 3R1OA 3B86A 2WCMA 1OW4A 3D75A 2KPHA 3B87A 4F7FA 3D73A 5EL2A 3D78A 1OOIX 2QEHA 1T14A 2WCHA 3RZSA 3D77A 1GM0A 3S0GA 4FQTA 3B6XA 3CZ0A 3DXLA 2WC5A 2L2CA 3FE8A
chains in the Genus database with same CATH superfamily
2Y5IA 1CB1A 4DUQA 1CDLA 1IGVA 3VRQA 3CR5X 5ER4X 1IRJA 2KI6D 2B1UA 2M1UA 4I5KA 1OMRA 4YGBB 2P71A 1M31A 4AQJA 1GQMA 1IJ6A 4IJ7A 2ISDA 2MLEC 1A2XA 1K9KA 1IWQA 1EJ3A 2ZRTA 3O4XA 5HYDA 2BAPA 2LUXA 1BODA 3VROA 1F70A 1KWOB 1IH0A 1A03A 2LV7A 3IF7A 1L2OC 1GJYA 2DOQA 1BU3A 2HQ8A 2L98A 3BXKA 3SG2A 1N65A 1TCOB 3NSLA 3PATA 5CSIA 2PSRA 2ERBA 1JSAA 3KHEA 4PT1A 4JQ0D 1DJYA 2LLUA 4N1GA 2I18A 1EXRA 3PJIA 2OTGB 1SMGA 1YR5A 3I5HB 4INXA 3CGAA 3HX4A 3B88A 1J1EA 1S6CA 1UURA 1WLMA 3JTDC 1SNLA 2MJWB 2MA2A 1SCVA 1WY9A 2EC6C 2KFFA 1J7PA 3JVTC 3Q8IA 3S0DA 3I5GC 2Y4QA 2PRUA 1LA3A 1UHIA 4XJKA 5AEQA 4BY5A 2JXCA 1UHHA 2JQ6A 1TTXA 1UHNA 3WXAA 1FF1A 2BL0B 3OBVA 1DJGA 5TNCA 1L7ZA 1TNPA 2ZN9A 2K60A 2WCKA 3CS1A 1SRAA 1XFZO 4NDDA 3TZ1A 2KLDA 1B47A 4GGFC 1U5IB 1A75A 1NX2A 2KAVA 4PCWA 1Z2CB 1ALWA 3DF0B 1XFVO 3FIAA 3TUYB 4JD9A 1CM1A 4CPVA 2LM5A 4MZKA 4NDCA 4A4CA 3TS5C 3L4AA 1B7TY 1C7VA 2KI4C 2LP3A 1WRZA 2PMYA 2KBMA 4OZDA 1S26D 2M7NA 3B7AA 1WRLA 1MR8A 2Q4UA 1RFJA 4QJ5B 5K89A 1Z4HA 3R1OA 2WCMA 4C0LA 1DGVA 2JT0A 1KWOC 2CCMA 2JTTA 3NSIA 2LAPA 2ZNEA 4YGDB 1BOCA 1B7TZ 3GK1A 2KYFA 4GGFA 4P5OE 2HF5A 1NIWA 4F7FA 1NCXA 1B8RA 2M0RA 2F8PA 4DCKA 1Y1AA 3GOFA 1EG4A 1RWYA 2M9GA 2KDHA 3OB1B 5DKNA 1NX1A 2KBIA 3SG4A 1B4CA 2KQYA 1JWDA 1WRKA 3PM2A 1AK8A 2CBLA 1OOIX 2WCHA 2M1KB 4N1FA 4MVFA 1PSRA 3LL8B 4ZCUA 4CFRA 2LMTA 1OMVA 3EK8A 2M7LA 4YGCB 5D7FA 3D77A 1GGWA 1OE9B 2JT8A 2BCBA 3KPXA 4UPGA 1CMGA 1DTLA 3FE8A 2LNKA 2Y1NA 3JTDB 1JFKA 3LK0A 4YBHB 2EC6B 1TNXA 1NWDA 3IQQA 2BL0C 2I94A 1KK8C 3I5GB 1KFUS 1CM4A 1B9AA 2E30A 1BMOA 2KQ6A 2PALA 3A8RA 2K7BA 3NSKA 3NHIA 3WHTB 2GTEA 1OMDA 2GGZA 3CLNA 2BBNA 4HRGA 5KU1A 4PHMA 1KQVA 1CMFA 1JBAA 1LXFC 2LCPA 1NP8A 2BNXA 3A4UB 4IL1A 1FI6A 3CR4X 3AAJA 1XK4A 1XYDA 1A29A 1CDPA 3I5IC 1KQMB 3PALA 4GUKA 4WQ2A 3BFBA 1M39A 4I5NB 2LC5A 2PYQA 4TNCA 4PHNA 1JUOA 2JRFA 5I2LA 2E6WA 2WC8A 2L0PA 2WNDA 2COLB 2KI6C 2LVKA 3BJHA 3D74A 3DD4A 2SASA 3TDUA 2KYCA 4I5LB 3FE6A 2KAXA 3KF9A 3LLEA 1P28A 4YRUA 4PE7A 1OSAA 4A4BA 3TS5B 1OOJA 2KI4B 2L51A 3PM8A 2QEOA 3R1PA 5HLVA 1S36A 3BYAA 2KNEA 5D69A 1OOHA 2M3WA 2H61A 2FJYA 4NDBA 1DC1A 1U5IA 2KAYA 3EKHA 3DF0A 2K2FA 1AJ4A 3S0BA 1W7IB 1J7RA 1HT9A 3FWCA 2JT3A 1MWNA 3C1VA 3MSEB 1C3ZA 2WOSA 3BOWB 1LINA 1MHOA 2L4HA 5JJGA 2K0JA 4PE0A 2WCLA 1G33A 1DJWA 4HREE 3BUWB 2D8NA 1CFDA 1DJZA 1TCFA 1G8IA 2HQWA 2PASA 1QVIY 3D10A 2F2PA 4FQOA 2JOJA 5HKYA 1W7JB 1KSOA 4AQIA 1C3YA 2L5YA 1AP4A 4ZCVA 1PVAA 2L5XB 1Y0VH 1S5GZ 4OV2A 1MXLC 3QMEA 2WCEA 3K21A 5BPJA 3CDNA 3FE9A 3QRXA 1F55A 3CZTX 3DY9A 1XFYO 4NQGA 1J7OA 1KK8B 1QVIZ 3B86A 1D1OA 4JKTA 2MRDA 5I2QA 1OW4A 3RM1A 2ZKMX 2LHLA 2QPTA 3D75A 1J1DA 1UWOA 4PHJA 3OX5A 4MRXA 1K96A 1KQMC 1LVCD 2KPHA 3O2PA 1AJ5A 1SBJA 2LE9B 3B87A 3GK4X 2JU0A 5CSNA 2KFHA 1FBVA 1TOPA 1UHJA 1KK7Y 1RJVA 3I5IB 2SCPA 5GQQC 1YVHA 5CSJA 3ZNIA 3BUNB 5I8NA 5EL2A 1BLQA 2LMUA 2V53A 4MSPA 1NYAA 3IQOA 1XFWO 2M49B 1AUIB 4QJ4B 2RGIA 2EHBA 1EH2A 5CPVA 5I94A 4USLA 4PE1A 1M45A 1KK7Z 4FQTA 1DVIA 3DXLA 4JWQA 1TRFA 1RTP1 2L2CA 1SL7A 1DELA 2MAZA 2JNXA 3D76A 2KGBC 4MRYA 4F0ZB 2BCAA 2K8MB 2L50A 3N7HA 3I5FB 1KCYA 1K94A 1QLKA 3K1EA 3M0WA 3OP0A 1M63B 5JOLA 1XVJA 2HETA 1XFRA 3OGNA 1XA5A 1CFPA 2LHIA 2P70A 4YGAA 2JULA 1K2HA 1B8LA 1K90D 2O5GA 2CTNA 1K95A 1ODBA 1SKTA 3L4LA 3O78A 2PQLA 2CT9A 2LVVA 1QX2A 3CZ2A 1DT7B 2GGMA 1JC2A 1JF0A 2IS9A 4KYNA 5HKWA 1QV1A 3VB1A 3KEVA 4PHKA 1BF5A 4WRIA 4PDZA 3NHTA 2BKHB 3OX6A 4MZLA 2KGRA 1YVLA 3S0FA 2NCOA 3BFHA 1UHKA 4MBEA 5D3OA 1PVBA 1DJIA 2JPTA 5FI7A 1YRUB 2K7DA 4YI8A 1KFXS 2QEBA 4XJKB 1J55A 1SCMB 3R1VA 4GBAA 4OKHA 1IIOA 1KFUL 1QTXA 1R6PA 1S1EA 2ZN8A 3BOWA 4MZJA 2MHHA 1Y1XA 1YUSA 3DYEA 5CSFA 4CIDA 1PRWA 3SJSA 5HL1A 3SIAA 1DJHA 3F45A 3CR2A 4ORAB 3EVVA 5HLOA 1AVSA 1JF2A 4JPZB 2A4JA 3D0YB 2BE4A 4C0KA 1BJFA 2JNFA 2M8UA 3FS7A 1BG1A 1S6JA 2H8VA 1ZOTB 2H2KA 1IJ5A 1NUBA 3ICBA 1XFXO 1A75B 1ORGA 2BE6A 3RLZA 3L47A 1LA0A 3TDZA 2WCJA 3SG3A 1K8UA 1ZUZA 1IQ5A 1OOGA 1ZFSA 3BUOB 1RROA 3UO9A 2LLTA 1G4YR 1K9UA 1BR4B 2FOTA 2LANA 3PN7C 2ZFDA 4P2YB 2Y1MA 4ORCB 1OZSA 2P6BB 1IQ3A 2F33A 1TN4A 2R2IA 4D1EA 2NXQA 2HPSA 2LLSA 2YGUA 1JFJA 1TNQA 3GK2A 2KHNA 5KTYA 1N2DA 5AANA 2TN4A 3I5FC 2CXJA 2WC6A 4MEWA 2L2EA 1PK0D 1QLSA 4M2OA 2BBMA 2JZIA 2F2OA 2KSPA 1X02A 4INWA 2AAOA 4WQ3A 1CDMA 3PSRA 1QX5B 1DF0B 1YUTA 3SIBA 1YX8A 4PE4A 4DRWA 2NZ0A 3SS5A 1SY9A 1F54A 1OQPA 1A4PA 1K9PA 1YURA 4M2PA 1SSEB 3D73A 1S5GY 1QIWA 3EK4A 1CDNA 1PALA 2GV5A 5AFPA 1KSMA 3D78A 4HRHA 4GNKB 4DS7A 2FCEA 2BCXA 4GFTA 4YGEB 1T14A 1DJXA 2K7OA 3O6BA 2MBXA 1SCMC 2M97A 2OS8C 1GM0A 4HSZA 3VRPA 1TIZA 5FYXA 1UP5A 5PALA 1XFUO 4PALA 1H4BA 1ZMZA 2WC5A 1SR6B 1MXEA 1S3PA 1H8BA 1SYMA 1Y6WA 1EG3A 1QJTA 3OB2B 4YI9A 2JXLA 2ZNDA 5J3XA 3LCPC 4CFQA 1ZACA 1MQ1A 3EVRA 5AERA 1WLZA 1DEKA 1NCYA 2OPOA 2M29A 3SG5A 4L9MA 1LS8A 2CNPA 3VGOA 3SS4A 3CABA 2LUCA 1NCZA 2KLEA 1YX7A 1C07A 1BR1B 2Q91A 1TUJA 2K61A 2K2AA 1V1GA 1CKKA 4QJ3B 2KOTA 5ER5A 5HKZA 1WDCB 3EG5B 5AXIA 1XO5A 3SS3A 5B8IB 2NLNA 1FW4A 1S6IA 2JWWA 1TUZA 3DZTA 3R72A 1QWVA 2QACA 4GGNA 2JPOA 2O60A 3PN7B 1J7QA 4DIRA 4MN0A 4GPLB 1SL8A 5DKRA 2AMIA 1V1FA 3S0EA 3E3RA 1DMOA 2FCDA 3D0YA 4R1EA 1RK9A 1MF8B 1UUSA 3EK7A 3OHMB 1QASA 2G2BA 5FI2A 1E8AA 2G9BA 4ETOA 4OVNF 1TWOA 2LMVA 2MLFC 1QV0A 5IBWA 3CZ1A 1CTRA 3SG7A 1QX7A 3BUXB 1SPYA 1F71A 1CLBA 2WORA 3BFAA 2BECA 3V2LA 2PVBA 1SL9A 1YRTB 1B8CA 1PULA 1RECA 3NGVA 4Q04A 3AAKA 5FI6A 5G08A 3NSOA 1SW8A 4I5JA 4C0JA 5I2OA 1LKJA 2BKIB 1OOFA 1N0YA 2JTZA 3CYZA 2F3ZA 3HCMA 2EGDA 1YTZC 2WCBA 1NX3A 2QDIA 1Q80A 4FTGA 5DICA 3IVTA 1NX0A 4XYNA 3UNWA 3WNXB 5F6TA 3DVMA 1DF0A 1EL4A 1QXPA 1SK6D 2L4IA 1K93D 2K7CA 1QS7A 1L2OB 1SR6C 3ZWHA 4OR9B 2OS8B 4AOMA 1KFXL 1NSHA 4OCIA 4CLNA 3BUMB 1F8HA 3S0AA 4N5XA 1F4QA 3KO0A 1NPQA 1VRKA 3VRRA 1CNPA 2OTGC 1DQEA 3FWBA 3I5HC 4MLWA 3VRNA 3CTNA 1XK4C 1AHRA 3EVUA 2I2RE 3PLFB 1M46A 2QEVA 3PFVA 1FPWA 1IG5A 1CLMA 3AKAA 1CFCA 3SG6A 1IKUA 1C7WA 2AUCA 1WDCC 1F4OA 3O4YA 1BT6A 2NCPA 3LK1A 4BY4A 4ICBA 4M2QA 3JVTB 1Y1UA 5KSZA 2VRGA 1FI5A 2ZRSA 5DKQA 2KFGA 3H4SE 1GGZA 1CFFA 1R2UA 4ORBB 2JC2A 2LVIA 2WCFA 3DVEA 4GAOA 1PSBA 3TDIA 3AKBA 3BQ3A 2H61C 3RZSA 2QEHA 1QIVA 3EKJA 3NXAA 1TNWA 2LP2A 1B1GA 1W9ZA 3WHUB 2F3YA 1HQVA 1QATA 3TUYC 3DVKA 2I7AA 3S0GA 2LVJA 1OZOA 3B6XA 3CWGA 2FJUB 3CZ0A 1CLLA 1ALVA 1DGUA 3DVJA 1YUUA 4U8DA 1MUXA 4E68A
chains in the Genus database with same CATH topology
3D76A 3N7HA 3K1EA 2P71A 1LS8A 1XFRA 3NHIA 3OGNA 3CABA 2GTEA 2P70A 1TUJA 3L4LA 2PQLA 3CZ2A 3BFBA 3DZTA 3VB1A 3R72A 1QWVA 2JPOA 3NHTA 3S0FA 2ERBA 3BFHA 4PT1A 3BJHA 3S0EA 3D74A 3FE6A 3PJIA 1P28A 2QEBA 4INXA 3R1VA 1TWOA 3B88A 3CZ1A 2QEOA 3R1PA 3BFAA 3V2LA 3DYEA 3Q8IA 3S0DA 1OOHA 2FJYA 3NGVA 1OOFA 2H8VA 3CYZA 3S0BA 1ORGA 3L47A 2WCKA 2WCJA 1C3ZA 1OOGA 2QDIA 5DICA 2WCLA 3S0AA 4JD9A 1DQEA 1C3YA 3L4AA 2WC6A 3QMEA 4OZDA 3B7AA 4INWA 2QEVA 3CDNA 3FE9A 3DY9A 3R1OA 3B86A 2WCMA 1OW4A 3D75A 2KPHA 3B87A 4F7FA 3D73A 5EL2A 3D78A 1OOIX 2QEHA 1T14A 2WCHA 3RZSA 3D77A 1GM0A 3S0GA 4FQTA 3B6XA 3CZ0A 3DXLA 2WC5A 2L2CA 3FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D76 A;  3N7H A;  3K1E A;  2P71 A;  1LS8 A;  1XFR A;  3NHI A;  3OGN A;  3CAB A;  2GTE A;  2P70 A;  1TUJ A;  3L4L A;  2PQL A;  3CZ2 A;  3BFB A;  3DZT A;  3VB1 A;  3R72 A;  1QWV A;  2JPO A;  3NHT A;  3S0F A;  2ERB A;  3BFH A;  4PT1 A;  3BJH A;  3S0E A;  3D74 A;  3FE6 A;  3PJI A;  1P28 A;  2QEB A;  4INX A;  3R1V A;  1TWO A;  3B88 A;  3CZ1 A;  2QEO A;  3R1P A;  3BFA A;  3V2L A;  3DYE A;  3Q8I A;  3S0D A;  1OOH A;  2FJY A;  3NGV A;  1OOF A;  2H8V A;  3CYZ A;  3S0B A;  1ORG A;  3L47 A;  2WCK A;  2WCJ A;  1C3Z A;  1OOG A;  2QDI A;  5DIC A;  2WCL A;  3S0A A;  4JD9 A;  1DQE A;  1C3Y A;  3L4A A;  2WC6 A;  3QME A;  4OZD A;  3B7A A;  4INW A;  2QEV A;  3CDN A;  3FE9 A;  3DY9 A;  3R1O A;  3B86 A;  2WCM A;  1OW4 A;  3D75 A;  2KPH A;  3B87 A;  4F7F A;  3D73 A;  5EL2 A;  3D78 A;  1OOI X;  2QEH A;  1T14 A;  2WCH A;  3RZS A;  3D77 A;  1GM0 A;  3S0G A;  4FQT A;  3B6X A;  3CZ0 A;  3DXL A;  2WC5 A;  2L2C A;  3FE8 A; 
#chains in the Genus database with same CATH topology
 2Y5I A;  1CB1 A;  4DUQ A;  1CDL A;  1IGV A;  3VRQ A;  3CR5 X;  5ER4 X;  1IRJ A;  2KI6 D;  2B1U A;  2M1U A;  4I5K A;  1OMR A;  4YGB B;  2P71 A;  1M31 A;  4AQJ A;  1GQM A;  1IJ6 A;  4IJ7 A;  2ISD A;  2MLE C;  1A2X A;  1K9K A;  1IWQ A;  1EJ3 A;  2ZRT A;  3O4X A;  5HYD A;  2BAP A;  2LUX A;  1BOD A;  3VRO A;  1F70 A;  1KWO B;  1IH0 A;  1A03 A;  2LV7 A;  3IF7 A;  1L2O C;  1GJY A;  2DOQ A;  1BU3 A;  2HQ8 A;  2L98 A;  3BXK A;  3SG2 A;  1N65 A;  1TCO B;  3NSL A;  3PAT A;  5CSI A;  2PSR A;  2ERB A;  1JSA A;  3KHE A;  4PT1 A;  4JQ0 D;  1DJY A;  2LLU A;  4N1G A;  2I18 A;  1EXR A;  3PJI A;  2OTG B;  1SMG A;  1YR5 A;  3I5H B;  4INX A;  3CGA A;  3HX4 A;  3B88 A;  1J1E A;  1S6C A;  1UUR A;  1WLM A;  3JTD C;  1SNL A;  2MJW B;  2MA2 A;  1SCV A;  1WY9 A;  2EC6 C;  2KFF A;  1J7P A;  3JVT C;  3Q8I A;  3S0D A;  3I5G C;  2Y4Q A;  2PRU A;  1LA3 A;  1UHI A;  4XJK A;  5AEQ A;  4BY5 A;  2JXC A;  1UHH A;  2JQ6 A;  1TTX A;  1UHN A;  3WXA A;  1FF1 A;  2BL0 B;  3OBV A;  1DJG A;  5TNC A;  1L7Z A;  1TNP A;  2ZN9 A;  2K60 A;  2WCK A;  3CS1 A;  1SRA A;  1XFZ O;  4NDD A;  3TZ1 A;  2KLD A;  1B47 A;  4GGF C;  1U5I B;  1A75 A;  1NX2 A;  2KAV A;  4PCW A;  1Z2C B;  1ALW A;  3DF0 B;  1XFV O;  3FIA A;  3TUY B;  4JD9 A;  1CM1 A;  4CPV A;  2LM5 A;  4MZK A;  4NDC A;  4A4C A;  3TS5 C;  3L4A A;  1B7T Y;  1C7V A;  2KI4 C;  2LP3 A;  1WRZ A;  2PMY A;  2KBM A;  4OZD A;  1S26 D;  2M7N A;  3B7A A;  1WRL A;  1MR8 A;  2Q4U A;  1RFJ A;  4QJ5 B;  5K89 A;  1Z4H A;  3R1O A;  2WCM A;  4C0L A;  1DGV A;  2JT0 A;  1KWO C;  2CCM A;  2JTT A;  3NSI A;  2LAP A;  2ZNE A;  4YGD B;  1BOC A;  1B7T Z;  3GK1 A;  2KYF A;  4GGF A;  4P5O E;  2HF5 A;  1NIW A;  4F7F A;  1NCX A;  1B8R A;  2M0R A;  2F8P A;  4DCK A;  1Y1A A;  3GOF A;  1EG4 A;  1RWY A;  2M9G A;  2KDH A;  3OB1 B;  5DKN A;  1NX1 A;  2KBI A;  3SG4 A;  1B4C A;  2KQY A;  1JWD A;  1WRK A;  3PM2 A;  1AK8 A;  2CBL A;  1OOI X;  2WCH A;  2M1K B;  4N1F A;  4MVF A;  1PSR A;  3LL8 B;  4ZCU A;  4CFR A;  2LMT A;  1OMV A;  3EK8 A;  2M7L A;  4YGC B;  5D7F A;  3D77 A;  1GGW A;  1OE9 B;  2JT8 A;  2BCB A;  3KPX A;  4UPG A;  1CMG A;  1DTL A;  3FE8 A;  2LNK A;  2Y1N A;  3JTD B;  1JFK A;  3LK0 A;  4YBH B;  2EC6 B;  1TNX A;  1NWD A;  3IQQ A;  2BL0 C;  2I94 A;  1KK8 C;  3I5G B;  1KFU S;  1CM4 A;  1B9A A;  2E30 A;  1BMO A;  2KQ6 A;  2PAL A;  3A8R A;  2K7B A;  3NSK A;  3NHI A;  3WHT B;  2GTE A;  1OMD A;  2GGZ A;  3CLN A;  2BBN A;  4HRG A;  5KU1 A;  4PHM A;  1KQV A;  1CMF A;  1JBA A;  1LXF C;  2LCP A;  1NP8 A;  2BNX A;  3A4U B;  4IL1 A;  1FI6 A;  3CR4 X;  3AAJ A;  1XK4 A;  1XYD A;  1A29 A;  1CDP A;  3I5I C;  1KQM B;  3PAL A;  4GUK A;  4WQ2 A;  3BFB A;  1M39 A;  4I5N B;  2LC5 A;  2PYQ A;  4TNC A;  4PHN A;  1JUO A;  2JRF A;  5I2L A;  2E6W A;  2WC8 A;  2L0P A;  2WND A;  2COL B;  2KI6 C;  2LVK A;  3BJH A;  3D74 A;  3DD4 A;  2SAS A;  3TDU A;  2KYC A;  4I5L B;  3FE6 A;  2KAX A;  3KF9 A;  3LLE A;  1P28 A;  4YRU A;  4PE7 A;  1OSA A;  4A4B A;  3TS5 B;  1OOJ A;  2KI4 B;  2L51 A;  3PM8 A;  2QEO A;  3R1P A;  5HLV A;  1S36 A;  3BYA A;  2KNE A;  5D69 A;  1OOH A;  2M3W A;  2H61 A;  2FJY A;  4NDB A;  1DC1 A;  1U5I A;  2KAY A;  3EKH A;  3DF0 A;  2K2F A;  1AJ4 A;  3S0B A;  1W7I B;  1J7R A;  1HT9 A;  3FWC A;  2JT3 A;  1MWN A;  3C1V A;  3MSE B;  1C3Z A;  2WOS A;  3BOW B;  1LIN A;  1MHO A;  2L4H A;  5JJG A;  2K0J A;  4PE0 A;  2WCL A;  1G33 A;  1DJW A;  4HRE E;  3BUW B;  2D8N A;  1CFD A;  1DJZ A;  1TCF A;  1G8I A;  2HQW A;  2PAS A;  1QVI Y;  3D10 A;  2F2P A;  4FQO A;  2JOJ A;  5HKY A;  1W7J B;  1KSO A;  4AQI A;  1C3Y A;  2L5Y A;  1AP4 A;  4ZCV A;  1PVA A;  2L5X B;  1Y0V H;  1S5G Z;  4OV2 A;  1MXL C;  3QME A;  2WCE A;  3K21 A;  5BPJ A;  3CDN A;  3FE9 A;  3QRX A;  1F55 A;  3CZT X;  3DY9 A;  1XFY O;  4NQG A;  1J7O A;  1KK8 B;  1QVI Z;  3B86 A;  1D1O A;  4JKT A;  2MRD A;  5I2Q A;  1OW4 A;  3RM1 A;  2ZKM X;  2LHL A;  2QPT A;  3D75 A;  1J1D A;  1UWO A;  4PHJ A;  3OX5 A;  4MRX A;  1K96 A;  1KQM C;  1LVC D;  2KPH A;  3O2P A;  1AJ5 A;  1SBJ A;  2LE9 B;  3B87 A;  3GK4 X;  2JU0 A;  5CSN A;  2KFH A;  1FBV A;  1TOP A;  1UHJ A;  1KK7 Y;  1RJV A;  3I5I B;  2SCP A;  5GQQ C;  1YVH A;  5CSJ A;  3ZNI A;  3BUN B;  5I8N A;  5EL2 A;  1BLQ A;  2LMU A;  2V53 A;  4MSP A;  1NYA A;  3IQO A;  1XFW O;  2M49 B;  1AUI B;  4QJ4 B;  2RGI A;  2EHB A;  1EH2 A;  5CPV A;  5I94 A;  4USL A;  4PE1 A;  1M45 A;  1KK7 Z;  4FQT A;  1DVI A;  3DXL A;  4JWQ A;  1TRF A;  1RTP 1;  2L2C A;  1SL7 A;  1DEL A;  2MAZ A;  2JNX A;  3D76 A;  2KGB C;  4MRY A;  4F0Z B;  2BCA A;  2K8M B;  2L50 A;  3N7H A;  3I5F B;  1KCY A;  1K94 A;  1QLK A;  3K1E A;  3M0W A;  3OP0 A;  1M63 B;  5JOL A;  1XVJ A;  2HET A;  1XFR A;  3OGN A;  1XA5 A;  1CFP A;  2LHI A;  2P70 A;  4YGA A;  2JUL A;  1K2H A;  1B8L A;  1K90 D;  2O5G A;  2CTN A;  1K95 A;  1ODB A;  1SKT A;  3L4L A;  3O78 A;  2PQL A;  2CT9 A;  2LVV A;  1QX2 A;  3CZ2 A;  1DT7 B;  2GGM A;  1JC2 A;  1JF0 A;  2IS9 A;  4KYN A;  5HKW A;  1QV1 A;  3VB1 A;  3KEV A;  4PHK A;  1BF5 A;  4WRI A;  4PDZ A;  3NHT A;  2BKH B;  3OX6 A;  4MZL A;  2KGR A;  1YVL A;  3S0F A;  2NCO A;  3BFH A;  1UHK A;  4MBE A;  5D3O A;  1PVB A;  1DJI A;  2JPT A;  5FI7 A;  1YRU B;  2K7D A;  4YI8 A;  1KFX S;  2QEB A;  4XJK B;  1J55 A;  1SCM B;  3R1V A;  4GBA A;  4OKH A;  1IIO A;  1KFU L;  1QTX A;  1R6P A;  1S1E A;  2ZN8 A;  3BOW A;  4MZJ A;  2MHH A;  1Y1X A;  1YUS A;  3DYE A;  5CSF A;  4CID A;  1PRW A;  3SJS A;  5HL1 A;  3SIA A;  1DJH A;  3F45 A;  3CR2 A;  4ORA B;  3EVV A;  5HLO A;  1AVS A;  1JF2 A;  4JPZ B;  2A4J A;  3D0Y B;  2BE4 A;  4C0K A;  1BJF A;  2JNF A;  2M8U A;  3FS7 A;  1BG1 A;  1S6J A;  2H8V A;  1ZOT B;  2H2K A;  1IJ5 A;  1NUB A;  3ICB A;  1XFX O;  1A75 B;  1ORG A;  2BE6 A;  3RLZ A;  3L47 A;  1LA0 A;  3TDZ A;  2WCJ A;  3SG3 A;  1K8U A;  1ZUZ A;  1IQ5 A;  1OOG A;  1ZFS A;  3BUO B;  1RRO A;  3UO9 A;  2LLT A;  1G4Y R;  1K9U A;  1BR4 B;  2FOT A;  2LAN A;  3PN7 C;  2ZFD A;  4P2Y B;  2Y1M A;  4ORC B;  1OZS A;  2P6B B;  1IQ3 A;  2F33 A;  1TN4 A;  2R2I A;  4D1E A;  2NXQ A;  2HPS A;  2LLS A;  2YGU A;  1JFJ A;  1TNQ A;  3GK2 A;  2KHN A;  5KTY A;  1N2D A;  5AAN A;  2TN4 A;  3I5F C;  2CXJ A;  2WC6 A;  4MEW A;  2L2E A;  1PK0 D;  1QLS A;  4M2O A;  2BBM A;  2JZI A;  2F2O A;  2KSP A;  1X02 A;  4INW A;  2AAO A;  4WQ3 A;  1CDM A;  3PSR A;  1QX5 B;  1DF0 B;  1YUT A;  3SIB A;  1YX8 A;  4PE4 A;  4DRW A;  2NZ0 A;  3SS5 A;  1SY9 A;  1F54 A;  1OQP A;  1A4P A;  1K9P A;  1YUR A;  4M2P A;  1SSE B;  3D73 A;  1S5G Y;  1QIW A;  3EK4 A;  1CDN A;  1PAL A;  2GV5 A;  5AFP A;  1KSM A;  3D78 A;  4HRH A;  4GNK B;  4DS7 A;  2FCE A;  2BCX A;  4GFT A;  4YGE B;  1T14 A;  1DJX A;  2K7O A;  3O6B A;  2MBX A;  1SCM C;  2M97 A;  2OS8 C;  1GM0 A;  4HSZ A;  3VRP A;  1TIZ A;  5FYX A;  1UP5 A;  5PAL A;  1XFU O;  4PAL A;  1H4B A;  1ZMZ A;  2WC5 A;  1SR6 B;  1MXE A;  1S3P A;  1H8B A;  1SYM A;  1Y6W A;  1EG3 A;  1QJT A;  3OB2 B;  4YI9 A;  2JXL A;  2ZND A;  5J3X A;  3LCP C;  4CFQ A;  1ZAC A;  1MQ1 A;  3EVR A;  5AER A;  1WLZ A;  1DEK A;  1NCY A;  2OPO A;  2M29 A;  3SG5 A;  4L9M A;  1LS8 A;  2CNP A;  3VGO A;  3SS4 A;  3CAB A;  2LUC A;  1NCZ A;  2KLE A;  1YX7 A;  1C07 A;  1BR1 B;  2Q91 A;  1TUJ A;  2K61 A;  2K2A A;  1V1G A;  1CKK A;  4QJ3 B;  2KOT A;  5ER5 A;  5HKZ A;  1WDC B;  3EG5 B;  5AXI A;  1XO5 A;  3SS3 A;  5B8I B;  2NLN A;  1FW4 A;  1S6I A;  2JWW A;  1TUZ A;  3DZT A;  3R72 A;  1QWV A;  2QAC A;  4GGN A;  2JPO A;  2O60 A;  3PN7 B;  1J7Q A;  4DIR A;  4MN0 A;  4GPL B;  1SL8 A;  5DKR A;  2AMI A;  1V1F A;  3S0E A;  3E3R A;  1DMO A;  2FCD A;  3D0Y A;  4R1E A;  1RK9 A;  1MF8 B;  1UUS A;  3EK7 A;  3OHM B;  1QAS A;  2G2B A;  5FI2 A;  1E8A A;  2G9B A;  4ETO A;  4OVN F;  1TWO A;  2LMV A;  2MLF C;  1QV0 A;  5IBW A;  3CZ1 A;  1CTR A;  3SG7 A;  1QX7 A;  3BUX B;  1SPY A;  1F71 A;  1CLB A;  2WOR A;  3BFA A;  2BEC A;  3V2L A;  2PVB A;  1SL9 A;  1YRT B;  1B8C A;  1PUL A;  1REC A;  3NGV A;  4Q04 A;  3AAK A;  5FI6 A;  5G08 A;  3NSO A;  1SW8 A;  4I5J A;  4C0J A;  5I2O A;  1LKJ A;  2BKI B;  1OOF A;  1N0Y A;  2JTZ A;  3CYZ A;  2F3Z A;  3HCM A;  2EGD A;  1YTZ C;  2WCB A;  1NX3 A;  2QDI A;  1Q80 A;  4FTG A;  5DIC A;  3IVT A;  1NX0 A;  4XYN A;  3UNW A;  3WNX B;  5F6T A;  3DVM A;  1DF0 A;  1EL4 A;  1QXP A;  1SK6 D;  2L4I A;  1K93 D;  2K7C A;  1QS7 A;  1L2O B;  1SR6 C;  3ZWH A;  4OR9 B;  2OS8 B;  4AOM A;  1KFX L;  1NSH A;  4OCI A;  4CLN A;  3BUM B;  1F8H A;  3S0A A;  4N5X A;  1F4Q A;  3KO0 A;  1NPQ A;  1VRK A;  3VRR A;  1CNP A;  2OTG C;  1DQE A;  3FWB A;  3I5H C;  4MLW A;  3VRN A;  3CTN A;  1XK4 C;  1AHR A;  3EVU A;  2I2R E;  3PLF B;  1M46 A;  2QEV A;  3PFV A;  1FPW A;  1IG5 A;  1CLM A;  3AKA A;  1CFC A;  3SG6 A;  1IKU A;  1C7W A;  2AUC A;  1WDC C;  1F4O A;  3O4Y A;  1BT6 A;  2NCP A;  3LK1 A;  4BY4 A;  4ICB A;  4M2Q A;  3JVT B;  1Y1U A;  5KSZ A;  2VRG A;  1FI5 A;  2ZRS A;  5DKQ A;  2KFG A;  3H4S E;  1GGZ A;  1CFF A;  1R2U A;  4ORB B;  2JC2 A;  2LVI A;  2WCF A;  3DVE A;  4GAO A;  1PSB A;  3TDI A;  3AKB A;  3BQ3 A;  2H61 C;  3RZS A;  2QEH A;  1QIV A;  3EKJ A;  3NXA A;  1TNW A;  2LP2 A;  1B1G A;  1W9Z A;  3WHU B;  2F3Y A;  1HQV A;  1QAT A;  3TUY C;  3DVK A;  2I7A A;  3S0G A;  2LVJ A;  1OZO A;  3B6X A;  3CWG A;  2FJU B;  3CZ0 A;  1CLL A;  1ALV A;  1DGU A;  3DVJ A;  1YUU A;  4U8D A;  1MUX A;  4E68 A; 
#chains in the Genus database with same CATH homology
 3D76 A;  3N7H A;  3K1E A;  2P71 A;  1LS8 A;  1XFR A;  3NHI A;  3OGN A;  3CAB A;  2GTE A;  2P70 A;  1TUJ A;  3L4L A;  2PQL A;  3CZ2 A;  3BFB A;  3DZT A;  3VB1 A;  3R72 A;  1QWV A;  2JPO A;  3NHT A;  3S0F A;  2ERB A;  3BFH A;  4PT1 A;  3BJH A;  3S0E A;  3D74 A;  3FE6 A;  3PJI A;  1P28 A;  2QEB A;  4INX A;  3R1V A;  1TWO A;  3B88 A;  3CZ1 A;  2QEO A;  3R1P A;  3BFA A;  3V2L A;  3DYE A;  3Q8I A;  3S0D A;  1OOH A;  2FJY A;  3NGV A;  1OOF A;  2H8V A;  3CYZ A;  3S0B A;  1ORG A;  3L47 A;  2WCK A;  2WCJ A;  1C3Z A;  1OOG A;  2QDI A;  5DIC A;  2WCL A;  3S0A A;  4JD9 A;  1DQE A;  1C3Y A;  3L4A A;  2WC6 A;  3QME A;  4OZD A;  3B7A A;  4INW A;  2QEV A;  3CDN A;  3FE9 A;  3DY9 A;  3R1O A;  3B86 A;  2WCM A;  1OW4 A;  3D75 A;  2KPH A;  3B87 A;  4F7F A;  3D73 A;  5EL2 A;  3D78 A;  1OOI X;  2QEH A;  1T14 A;  2WCH A;  3RZS A;  3D77 A;  1GM0 A;  3S0G A;  4FQT A;  3B6X A;  3CZ0 A;  3DXL A;  2WC5 A;  2L2C A;  3FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...