4F7FA

Structure of anopheles gambiae odorant binding protein 20
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
119
structure length
119
Chain Sequence
TVEQMMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKELKCYVNCVMEMMQTMKKGKLNYDASVKQIDTIMPDELAGPMRAALDICRTVADGIKNNCDAAYVLLQCLSKNNPKFIFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGAP005208-PA
publication title A novel mechanism of ligand binding and release in the odorant binding protein 20 from the malaria mosquito Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Odorant-binding protein
total genus 42
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4f7fA00
3D77A 3D76A 3CYZA 3S0GA 4F7FA 3L4LA 1TWOA 1LS8A 4INWA 1OOGA 3FE8A 3Q8IA 1OOFA 3QMEA 1P28A 3BFAA 4INXA 1TUJA 3VB1A 1OOHA 4PT1A 2WCMA 3B87A 1XFRA 2JPOA 2QDIA 5DICA 3NGVA 1C3YA 2KPHA 1T14A 3D78A 4OZDA 3CABA 3NHIA 3S0DA 3NHTA 3S0EA 3DYEA 3PJIA 3FE6A 3B7AA 3S0BA 2FJYA 2PQLA 1DQEA 3L4AA 2QEBA 3L47A 3BFHA 3BJHA 3CZ2A 1OOIX 5EL2A 2QEOA 3N7HA 3DZTA 3DXLA 2P71A 1ORGA 2QEVA 2P70A 3B88A 3OGNA 3R1VA 3CDNA 3CZ0A 2QEHA 3RZSA 2WC6A 3D75A 3V2LA 3BFBA 3D74A 3CZ1A 3R1PA 1GM0A 3DY9A 1C3ZA 4JD9A 2WCJA 3R1OA 4FQTA 3S0FA 3R72A 3D73A 3S0AA 3B6XA 2L2CA 3K1EA 2WC5A 3FE9A 2WCLA 2WCHA 1OW4A 1QWVA 2GTEA 2ERBA 2H8VA 3B86A 2WCKA
chains in the Genus database with same CATH superfamily
4N1GA 4PDZA 1VRKA 3SS3A 1J7OA 1J55A 3PSRA 2DOQA 1F71A 5D3OA 1CMGA 1FI6A 3L4LA 2KHNA 1DF0B 3C1VA 1CDPA 5HLOA 2R2IA 1DJHA 3EVVA 1CFPA 1Y1XA 1CTRA 1OOGA 1QIVA 2WNDA 3O2PA 2Y1NA 1OOFA 4INXA 4PHMA 2BNXA 3RLZA 1XVJA 3EK8A 3I5FB 3WHTB 3CZTX 1HT9A 1IRJA 1Z4HA 2FCDA 1K90D 2FJUB 1UHKA 2JXCA 3AKBA 4ORAB 4D1EA 1NYAA 2KSPA 5HKWA 5IBWA 3FWCA 1QATA 4C0KA 4MEWA 2MLEC 1DT7B 2MAZA 2ZKMX 3NGVA 1XFWO 3TZ1A 3PLFB 2KPHA 5PALA 4JKTA 1ALVA 3CR5X 2GGZA 1G8IA 2JTTA 3CGAA 4MZLA 5FI7A 3S0EA 1UUSA 3PJIA 4WRIA 3SG4A 1OE9B 1CNPA 5D7FA 2LE9B 1DELA 2BL0B 4PE1A 1YURA 2LV7A 3OX6A 3B7AA 1KFUS 3BUMB 4PCWA 3K21A 1QJTA 4AQJA 4A4CA 1B4CA 2OPOA 2LP2A 4YI8A 2KQ6A 5KSZA 3VRRA 1DQEA 1FW4A 2M7LA 3PFVA 5CSNA 3L4AA 1K96A 1F54A 2KI6C 3JTDB 2QEBA 2JNXA 1Z2CB 2EC6C 3BJHA 3ZWHA 1C7WA 1QASA 4N5XA 1W7JB 5B8IB 3BQ3A 3DVMA 2JULA 3PALA 2K0JA 1B9AA 1CDMA 3DZTA 1XFXO 4C0JA 3DXLA 3O6BA 1RWYA 1NUBA 1SK6D 1WRZA 3OB2B 4ORCB 3VRNA 2P70A 3D0YA 3IF7A 1CFDA 4AQIA 3JVTC 3PM2A 4OCIA 1JC2A 4DRWA 3E3RA 1TN4A 1ZUZA 2BECA 1EG3A 2K2AA 3CLNA 1KFXL 4OV2A 3TS5C 1KK7Y 2BBNA 1SR6B 1UHNA 2L0PA 3V2LA 1QS7A 2NCPA 2LVIA 2K61A 3BOWB 2L51A 4GBAA 1IQ3A 2ZN8A 2FCEA 4QJ3B 1EXRA 1PALA 2V53A 4MZJA 2HETA 2BCBA 5G08A 1F8HA 1A2XA 2WCJA 3PM8A 3S0FA 2LHIA 2BAPA 1OZSA 3D73A 1RK9A 2MBXA 1SW8A 1QTXA 4OR9B 1IWQA 3SIAA 5BPJA 1H4BA 3NSIA 4MLWA 4XYNA 3A4UB 4USLA 2LM5A 2PMYA 2WCHA 2KYFA 1YRUB 2Y5IA 1B8LA 3I5GB 1J7QA 2LMTA 2MJWB 1MXEA 2AAOA 1KK8B 1LA3A 1X02A 2ERBA 1QV1A 2H8VA 1F70A 1KFXS 2Y1MA 1TOPA 1AJ4A 1XFVO 1YX7A 2H2KA 4CLNA 4Q04A 5I8NA 1V1FA 2LVVA 3O4YA 2WCFA 1TNXA 4R1EA 2NXQA 4DIRA 1KQMB 2O60A 4IL1A 3S0GA 1DTLA 3FIAA 1DGVA 1BR4B 2EGDA 2M1UA 1OSAA 3NSKA 2KYCA 1EH2A 1U5IB 2I7AA 1NPQA 4NDBA 2PSRA 1KSOA 2KI6D 1Y0VH 1ALWA 1UURA 1TUJA 2O5GA 1YVLA 3VB1A 1MQ1A 1S6CA 4CPVA 1LKJA 1DEKA 5KTYA 1CLMA 5K89A 2JT3A 2L50A 4BY4A 4M2OA 4YGBB 3WNXB 2M9GA 1XFRA 1AHRA 1UHHA 2JWWA 4MZKA 1FBVA 4ZCUA 2JOJA 3PN7C 3OB1B 3D78A 2LCPA 1DVIA 2M1KB 2WORA 3KEVA 4HRGA 3CABA 2AUCA 2M7NA 4I5LB 3S0DA 3VRPA 1PULA 4PE4A 2BL0C 2OTGB 2WCEA 3WHUB 1SKTA 1CFCA 3EVRA 1BG1A 1QX7A 1ZFSA 3GK4X 1DF0A 3S0BA 2JT0A 2KAXA 1KFUL 3AKAA 2TN4A 2ZNDA 4MRYA 1XA5A 1SYMA 1LXFC 1UP5A 3LL8B 1LA0A 2F3ZA 3SS4A 2PQLA 1MHOA 2LVKA 1LINA 1S3PA 3NSOA 4YRUA 1B7TZ 1KWOB 1QXPA 3WXAA 1N2DA 1DJGA 3A8RA 3CTNA 3O78A 2AMIA 2LAPA 2WC8A 3CZ2A 2KLEA 3EG5B 1G33A 5CSJA 5FYXA 1YUUA 4F0ZB 1C7VA 1TCFA 2P71A 5JOLA 1JBAA 2Y4QA 4XJKB 1GGWA 2KBMA 2CXJA 2COLB 3NSLA 1J1DA 3DVJA 1OMVA 1B7TY 5J3XA 3HCMA 2QACA 3SG3A 3CDNA 1WDCC 1F55A 2LC5A 3BXKA 4PE7A 2KI4B 1K94A 4I5JA 1AK8A 1BODA 1PSRA 3OBVA 3RZSA 2JNFA 1QV0A 2GV5A 1A75B 2JQ6A 1QX5B 1JSAA 1IQ5A 1JF0A 1K95A 3BFBA 3FWBA 3GK2A 3H4SE 3CZ1A 4NDDA 3CS1A 2JZIA 5ER5A 1K9PA 4YGAA 1PVBA 2G2BA 1NP8A 1IG5A 1YX8A 2L98A 2SCPA 3EVUA 2FOTA 2K8MB 4GUKA 4JD9A 1SL7A 4L9MA 5HLVA 4QJ4B 2I18A 4YBHB 2L2CA 3K1EA 3I5IB 3FE9A 1BF5A 4AOMA 2JT8A 1DJYA 1QIWA 1NCYA 1KK8C 1OW4A 1FI5A 2KDHA 1NCZA 3KHEA 2ZRTA 2Q91A 2P6BB 1XO5A 1TNPA 2KAYA 4GGFC 3D77A 3RM1A 3EKJA 3D76A 5CPVA 2QPTA 2K60A 2NLNA 5DKRA 4M2PA 1SCMC 3VRQA 1CMFA 1Y1UA 1SL8A 3SG7A 1NX3A 1SY9A 4F7FA 3I5HB 5GQQC 4JPZB 3UNWA 1IKUA 2F2PA 3TDZA 3F45A 4GFTA 1PK0D 3O4XA 3BOWA 4JWQA 1TCOB 1IH0A 4U8DA 2LUXA 4HREE 2B1UA 2I2RE 3FE8A 2BKHB 4GAOA 4NDCA 2ISDA 3QMEA 3BFAA 3VGOA 1DJWA 1K9KA 2JXLA 2MHHA 2NZ0A 5HL1A 1OZOA 1LVCD 4PE0A 3SG5A 2PVBA 1OOHA 4GPLB 1IGVA 1NWDA 4PT1A 1ZMZA 5DKQA 1SMGA 1E8AA 2QDIA 5DICA 2OS8B 2BE4A 2GGMA 2H61C 2K7OA 4JQ0D 2KFFA 4CIDA 3QRXA 1C3YA 5HKYA 1Y1AA 3CWGA 1OMDA 1SCVA 1MR8A 5AEQA 2OTGC 3NHIA 3NHTA 4P2YB 2KAVA 3DYEA 4GGFA 2M97A 3IQQA 1FF1A 2M8UA 2EHBA 1A4PA 2L4HA 1DJIA 5AERA 4ZCVA 3AAKA 1CM1A 1M31A 2MA2A 2L5YA 3I5FC 3TUYB 1MXLC 2LVJA 3JVTB 3GK1A 2BBMA 4HSZA 1NIWA 1RJVA 1TTXA 4I5KA 2KQYA 4MN0A 2WOSA 5F6TA 3SG6A 2G9BA 2LMUA 5AFPA 1TNQA 3KPXA 1DC1A 4YGCB 1CDLA 3SS5A 2ZNEA 3DF0B 1EL4A 1YRTB 1K9UA 4PHJA 4CFRA 4BY5A 3BFHA 3VROA 2KGRA 2CCMA 2QEOA 1V1GA 1ZACA 1BT6A 3N7HA 3LCPC 1RROA 4M2QA 2LLUA 1TUZA 2CTNA 2H61A 2QEVA 1MF8B 3B88A 1AVSA 1SL9A 2KI4C 2L5XB 1UHIA 5D69A 3SG2A 1B8RA 1M46A 1SNLA 1YR5A 2HQ8A 2QEHA 3CZ0A 4WQ3A 1B8CA 1QX2A 2F3YA 2WC6A 1DJXA 3D75A 2L4IA 2K7BA 1C07A 1KCYA 1MUXA 2VRGA 3D74A 4YGEB 3HX4A 4UPGA 1L2OB 4KYNA 3R1PA 5KU1A 3OP0A 3JTDC 4IJ7A 2PASA 3DY9A 2KFGA 2MRDA 1A29A 2BCAA 4YI9A 1S6JA 1YVHA 2MLFC 1AUIB 4FQTA 3R1OA 2JC2A 3I5IC 2F33A 3NXAA 1ZOTB 3B6XA 3EK7A 1HQVA 1YTZC 3DVEA 1IJ5A 4CFQA 2LANA 2KGBC 2K7CA 1CKKA 2Q4UA 1K2HA 1BOCA 2LNKA 2I94A 3PATA 1F4QA 2K7DA 5AANA 2ZN9A 5FI6A 2WCBA 1S1EA 1NSHA 1SR6C 3B86A 3CR2A 1D1OA 1H8BA 2WCKA 1S6IA 4XJKA 1K8UA 1SSEB 2ZRSA 1SBJA 3EKHA 5DKNA 3I5HC 1QLSA 3CYZA 5ER4X 1KQVA 3IQOA 4OVNF 1GJYA 1XFUO 3OHMB 3PN7B 4MVFA 1N0YA 1TWOA 1WLMA 1LS8A 4PALA 4E68A 1CDNA 4INWA 1A75A 3TDUA 2E30A 3M0WA 1RFJA 2BKIB 2IS9A 1CB1A 3I5GC 3AAJA 3Q8IA 1SPYA 1KSMA 1IIOA 1QLKA 1P28A 2KFHA 2M0RA 1B1GA 2L2EA 4HRHA 1G4YR 1MWNA 2E6WA 1DJZA 2ZFDA 2PRUA 2PALA 1BLQA 1UHJA 3LK1A 3DVKA 4QJ5B 4MRXA 2OS8C 3TDIA 2WCMA 1CLBA 1L7ZA 1Y6WA 1GGZA 3KO0A 3B87A 4FTGA 1S36A 2JPOA 2SASA 1M63B 2PYQA 1KQMC 3BUOB 2KNEA 1S26D 1WLZA 3LK0A 4GGNA 1T14A 3D0YB 5HKZA 1OQPA 1TRFA 1XK4C 1KK7Z 1M39A 4OZDA 1NCXA 1DMOA 1R6PA 3SIBA 2YGUA 1F4OA 1YUTA 1CM4A 2LLTA 5TNCA 1W9ZA 3UO9A 1SRAA 1M45A 1R2UA 2K2FA 4ICBA 3TUYC 2RGIA 3FE6A 2BE6A 2LHLA 1WRKA 1J1EA 1BJFA 5HYDA 2CBLA 3BUXB 4P5OE 1S5GZ 2M3WA 1NX2A 1YUSA 1A03A 3MSEB 1WDCB 1FPWA 1Q80A 1JWDA 2KLDA 1BU3A 2FJYA 5CSIA 1OOJA 1DGUA 1WY9A 3D10A 5JJGA 1JFJA 2HF5A 2D8NA 4C0LA 1BMOA 1NX0A 4MSPA 5CSFA 4ORBB 3ZNIA 1JFKA 1AJ5A 1PRWA 4FQOA 3L47A 1S5GY 4N1FA 1AP4A 3ICBA 1XYDA 1J7PA 3BYAA 3SJSA 1NX1A 1OOIX 2EC6B 2KBIA 3OX5A 4I5NB 5EL2A 3BUNB 4DS7A 4TNCA 4YGDB 3GOFA 2JPTA 3BUWB 1ORGA 4GNKB 2M49B 3OGNA 1TIZA 3EK4A 4PHKA 3R1VA 1J7RA 1RTP1 4NQGA 1QVIZ 2JTZA 1ODBA 2LUCA 1TNWA 3FS7A 2F8PA 1XK4A 5I2OA 5I2QA 1U5IA 1BR1B 1OMRA 2LLSA 1N65A 3TS5B 1CLLA 1L2OC 1RECA 1XFYO 2CNPA 2NCOA 2HPSA 1PVAA 1IJ6A 1JUOA 1EG4A 1KWOC 1XFZO 2KOTA 1SCMB 2BCXA 2JU0A 2LMVA 1GM0A 5FI2A 4WQ2A 1C3ZA 1W7IB 4DCKA 1QVIY 1CFFA 2LP3A 4ETOA 3R72A 3S0AA 4PHNA 2CT9A 3LLEA 3KF9A 4OKHA 1K93D 1B47A 1WRLA 2WC5A 2F2OA 2JRFA 2M29A 2WCLA 3DF0A 2A4JA 3DD4A 1GQMA 4MBEA 1QWVA 4A4BA 1JF2A 1PSBA 2GTEA 1EJ3A 3CR4X 4DUQA 5AXIA 2HQWA 1UWOA 3IVTA 5I94A 5I2LA
chains in the Genus database with same CATH topology
3D77A 3D76A 3CYZA 3S0GA 4F7FA 3L4LA 1TWOA 1LS8A 4INWA 1OOGA 3FE8A 3Q8IA 1OOFA 3QMEA 1P28A 3BFAA 4INXA 1TUJA 3VB1A 1OOHA 4PT1A 2WCMA 3B87A 1XFRA 2JPOA 2QDIA 5DICA 3NGVA 1C3YA 2KPHA 1T14A 3D78A 4OZDA 3CABA 3NHIA 3S0DA 3NHTA 3S0EA 3DYEA 3PJIA 3FE6A 3B7AA 3S0BA 2FJYA 2PQLA 1DQEA 3L4AA 2QEBA 3L47A 3BFHA 3BJHA 3CZ2A 1OOIX 5EL2A 2QEOA 3N7HA 3DZTA 3DXLA 2P71A 1ORGA 2QEVA 2P70A 3B88A 3OGNA 3R1VA 3CDNA 3CZ0A 2QEHA 3RZSA 2WC6A 3D75A 3V2LA 3BFBA 3D74A 3CZ1A 3R1PA 1GM0A 3DY9A 1C3ZA 4JD9A 2WCJA 3R1OA 4FQTA 3S0FA 3R72A 3D73A 3S0AA 3B6XA 2L2CA 3K1EA 2WC5A 3FE9A 2WCLA 2WCHA 1OW4A 1QWVA 2GTEA 2ERBA 2H8VA 3B86A 2WCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D77 A;  3D76 A;  3CYZ A;  3S0G A;  4F7F A;  3L4L A;  1TWO A;  1LS8 A;  4INW A;  1OOG A;  3FE8 A;  3Q8I A;  1OOF A;  3QME A;  1P28 A;  3BFA A;  4INX A;  1TUJ A;  3VB1 A;  1OOH A;  4PT1 A;  2WCM A;  3B87 A;  1XFR A;  2JPO A;  2QDI A;  5DIC A;  3NGV A;  1C3Y A;  2KPH A;  1T14 A;  3D78 A;  4OZD A;  3CAB A;  3NHI A;  3S0D A;  3NHT A;  3S0E A;  3DYE A;  3PJI A;  3FE6 A;  3B7A A;  3S0B A;  2FJY A;  2PQL A;  1DQE A;  3L4A A;  2QEB A;  3L47 A;  3BFH A;  3BJH A;  3CZ2 A;  1OOI X;  5EL2 A;  2QEO A;  3N7H A;  3DZT A;  3DXL A;  2P71 A;  1ORG A;  2QEV A;  2P70 A;  3B88 A;  3OGN A;  3R1V A;  3CDN A;  3CZ0 A;  2QEH A;  3RZS A;  2WC6 A;  3D75 A;  3V2L A;  3BFB A;  3D74 A;  3CZ1 A;  3R1P A;  1GM0 A;  3DY9 A;  1C3Z A;  4JD9 A;  2WCJ A;  3R1O A;  4FQT A;  3S0F A;  3R72 A;  3D73 A;  3S0A A;  3B6X A;  2L2C A;  3K1E A;  2WC5 A;  3FE9 A;  2WCL A;  2WCH A;  1OW4 A;  1QWV A;  2GTE A;  2ERB A;  2H8V A;  3B86 A;  2WCK A; 
#chains in the Genus database with same CATH topology
 4N1G A;  4PDZ A;  1VRK A;  3SS3 A;  1J7O A;  1J55 A;  3PSR A;  2DOQ A;  1F71 A;  5D3O A;  1CMG A;  1FI6 A;  3L4L A;  2KHN A;  1DF0 B;  3C1V A;  1CDP A;  5HLO A;  2R2I A;  1DJH A;  3EVV A;  1CFP A;  1Y1X A;  1CTR A;  1OOG A;  1QIV A;  2WND A;  3O2P A;  2Y1N A;  1OOF A;  4INX A;  4PHM A;  2BNX A;  3RLZ A;  1XVJ A;  3EK8 A;  3I5F B;  3WHT B;  3CZT X;  1HT9 A;  1IRJ A;  1Z4H A;  2FCD A;  1K90 D;  2FJU B;  1UHK A;  2JXC A;  3AKB A;  4ORA B;  4D1E A;  1NYA A;  2KSP A;  5HKW A;  5IBW A;  3FWC A;  1QAT A;  4C0K A;  4MEW A;  2MLE C;  1DT7 B;  2MAZ A;  2ZKM X;  3NGV A;  1XFW O;  3TZ1 A;  3PLF B;  2KPH A;  5PAL A;  4JKT A;  1ALV A;  3CR5 X;  2GGZ A;  1G8I A;  2JTT A;  3CGA A;  4MZL A;  5FI7 A;  3S0E A;  1UUS A;  3PJI A;  4WRI A;  3SG4 A;  1OE9 B;  1CNP A;  5D7F A;  2LE9 B;  1DEL A;  2BL0 B;  4PE1 A;  1YUR A;  2LV7 A;  3OX6 A;  3B7A A;  1KFU S;  3BUM B;  4PCW A;  3K21 A;  1QJT A;  4AQJ A;  4A4C A;  1B4C A;  2OPO A;  2LP2 A;  4YI8 A;  2KQ6 A;  5KSZ A;  3VRR A;  1DQE A;  1FW4 A;  2M7L A;  3PFV A;  5CSN A;  3L4A A;  1K96 A;  1F54 A;  2KI6 C;  3JTD B;  2QEB A;  2JNX A;  1Z2C B;  2EC6 C;  3BJH A;  3ZWH A;  1C7W A;  1QAS A;  4N5X A;  1W7J B;  5B8I B;  3BQ3 A;  3DVM A;  2JUL A;  3PAL A;  2K0J A;  1B9A A;  1CDM A;  3DZT A;  1XFX O;  4C0J A;  3DXL A;  3O6B A;  1RWY A;  1NUB A;  1SK6 D;  1WRZ A;  3OB2 B;  4ORC B;  3VRN A;  2P70 A;  3D0Y A;  3IF7 A;  1CFD A;  4AQI A;  3JVT C;  3PM2 A;  4OCI A;  1JC2 A;  4DRW A;  3E3R A;  1TN4 A;  1ZUZ A;  2BEC A;  1EG3 A;  2K2A A;  3CLN A;  1KFX L;  4OV2 A;  3TS5 C;  1KK7 Y;  2BBN A;  1SR6 B;  1UHN A;  2L0P A;  3V2L A;  1QS7 A;  2NCP A;  2LVI A;  2K61 A;  3BOW B;  2L51 A;  4GBA A;  1IQ3 A;  2ZN8 A;  2FCE A;  4QJ3 B;  1EXR A;  1PAL A;  2V53 A;  4MZJ A;  2HET A;  2BCB A;  5G08 A;  1F8H A;  1A2X A;  2WCJ A;  3PM8 A;  3S0F A;  2LHI A;  2BAP A;  1OZS A;  3D73 A;  1RK9 A;  2MBX A;  1SW8 A;  1QTX A;  4OR9 B;  1IWQ A;  3SIA A;  5BPJ A;  1H4B A;  3NSI A;  4MLW A;  4XYN A;  3A4U B;  4USL A;  2LM5 A;  2PMY A;  2WCH A;  2KYF A;  1YRU B;  2Y5I A;  1B8L A;  3I5G B;  1J7Q A;  2LMT A;  2MJW B;  1MXE A;  2AAO A;  1KK8 B;  1LA3 A;  1X02 A;  2ERB A;  1QV1 A;  2H8V A;  1F70 A;  1KFX S;  2Y1M A;  1TOP A;  1AJ4 A;  1XFV O;  1YX7 A;  2H2K A;  4CLN A;  4Q04 A;  5I8N A;  1V1F A;  2LVV A;  3O4Y A;  2WCF A;  1TNX A;  4R1E A;  2NXQ A;  4DIR A;  1KQM B;  2O60 A;  4IL1 A;  3S0G A;  1DTL A;  3FIA A;  1DGV A;  1BR4 B;  2EGD A;  2M1U A;  1OSA A;  3NSK A;  2KYC A;  1EH2 A;  1U5I B;  2I7A A;  1NPQ A;  4NDB A;  2PSR A;  1KSO A;  2KI6 D;  1Y0V H;  1ALW A;  1UUR A;  1TUJ A;  2O5G A;  1YVL A;  3VB1 A;  1MQ1 A;  1S6C A;  4CPV A;  1LKJ A;  1DEK A;  5KTY A;  1CLM A;  5K89 A;  2JT3 A;  2L50 A;  4BY4 A;  4M2O A;  4YGB B;  3WNX B;  2M9G A;  1XFR A;  1AHR A;  1UHH A;  2JWW A;  4MZK A;  1FBV A;  4ZCU A;  2JOJ A;  3PN7 C;  3OB1 B;  3D78 A;  2LCP A;  1DVI A;  2M1K B;  2WOR A;  3KEV A;  4HRG A;  3CAB A;  2AUC A;  2M7N A;  4I5L B;  3S0D A;  3VRP A;  1PUL A;  4PE4 A;  2BL0 C;  2OTG B;  2WCE A;  3WHU B;  1SKT A;  1CFC A;  3EVR A;  1BG1 A;  1QX7 A;  1ZFS A;  3GK4 X;  1DF0 A;  3S0B A;  2JT0 A;  2KAX A;  1KFU L;  3AKA A;  2TN4 A;  2ZND A;  4MRY A;  1XA5 A;  1SYM A;  1LXF C;  1UP5 A;  3LL8 B;  1LA0 A;  2F3Z A;  3SS4 A;  2PQL A;  1MHO A;  2LVK A;  1LIN A;  1S3P A;  3NSO A;  4YRU A;  1B7T Z;  1KWO B;  1QXP A;  3WXA A;  1N2D A;  1DJG A;  3A8R A;  3CTN A;  3O78 A;  2AMI A;  2LAP A;  2WC8 A;  3CZ2 A;  2KLE A;  3EG5 B;  1G33 A;  5CSJ A;  5FYX A;  1YUU A;  4F0Z B;  1C7V A;  1TCF A;  2P71 A;  5JOL A;  1JBA A;  2Y4Q A;  4XJK B;  1GGW A;  2KBM A;  2CXJ A;  2COL B;  3NSL A;  1J1D A;  3DVJ A;  1OMV A;  1B7T Y;  5J3X A;  3HCM A;  2QAC A;  3SG3 A;  3CDN A;  1WDC C;  1F55 A;  2LC5 A;  3BXK A;  4PE7 A;  2KI4 B;  1K94 A;  4I5J A;  1AK8 A;  1BOD A;  1PSR A;  3OBV A;  3RZS A;  2JNF A;  1QV0 A;  2GV5 A;  1A75 B;  2JQ6 A;  1QX5 B;  1JSA A;  1IQ5 A;  1JF0 A;  1K95 A;  3BFB A;  3FWB A;  3GK2 A;  3H4S E;  3CZ1 A;  4NDD A;  3CS1 A;  2JZI A;  5ER5 A;  1K9P A;  4YGA A;  1PVB A;  2G2B A;  1NP8 A;  1IG5 A;  1YX8 A;  2L98 A;  2SCP A;  3EVU A;  2FOT A;  2K8M B;  4GUK A;  4JD9 A;  1SL7 A;  4L9M A;  5HLV A;  4QJ4 B;  2I18 A;  4YBH B;  2L2C A;  3K1E A;  3I5I B;  3FE9 A;  1BF5 A;  4AOM A;  2JT8 A;  1DJY A;  1QIW A;  1NCY A;  1KK8 C;  1OW4 A;  1FI5 A;  2KDH A;  1NCZ A;  3KHE A;  2ZRT A;  2Q91 A;  2P6B B;  1XO5 A;  1TNP A;  2KAY A;  4GGF C;  3D77 A;  3RM1 A;  3EKJ A;  3D76 A;  5CPV A;  2QPT A;  2K60 A;  2NLN A;  5DKR A;  4M2P A;  1SCM C;  3VRQ A;  1CMF A;  1Y1U A;  1SL8 A;  3SG7 A;  1NX3 A;  1SY9 A;  4F7F A;  3I5H B;  5GQQ C;  4JPZ B;  3UNW A;  1IKU A;  2F2P A;  3TDZ A;  3F45 A;  4GFT A;  1PK0 D;  3O4X A;  3BOW A;  4JWQ A;  1TCO B;  1IH0 A;  4U8D A;  2LUX A;  4HRE E;  2B1U A;  2I2R E;  3FE8 A;  2BKH B;  4GAO A;  4NDC A;  2ISD A;  3QME A;  3BFA A;  3VGO A;  1DJW A;  1K9K A;  2JXL A;  2MHH A;  2NZ0 A;  5HL1 A;  1OZO A;  1LVC D;  4PE0 A;  3SG5 A;  2PVB A;  1OOH A;  4GPL B;  1IGV A;  1NWD A;  4PT1 A;  1ZMZ A;  5DKQ A;  1SMG A;  1E8A A;  2QDI A;  5DIC A;  2OS8 B;  2BE4 A;  2GGM A;  2H61 C;  2K7O A;  4JQ0 D;  2KFF A;  4CID A;  3QRX A;  1C3Y A;  5HKY A;  1Y1A A;  3CWG A;  1OMD A;  1SCV A;  1MR8 A;  5AEQ A;  2OTG C;  3NHI A;  3NHT A;  4P2Y B;  2KAV A;  3DYE A;  4GGF A;  2M97 A;  3IQQ A;  1FF1 A;  2M8U A;  2EHB A;  1A4P A;  2L4H A;  1DJI A;  5AER A;  4ZCV A;  3AAK A;  1CM1 A;  1M31 A;  2MA2 A;  2L5Y A;  3I5F C;  3TUY B;  1MXL C;  2LVJ A;  3JVT B;  3GK1 A;  2BBM A;  4HSZ A;  1NIW A;  1RJV A;  1TTX A;  4I5K A;  2KQY A;  4MN0 A;  2WOS A;  5F6T A;  3SG6 A;  2G9B A;  2LMU A;  5AFP A;  1TNQ A;  3KPX A;  1DC1 A;  4YGC B;  1CDL A;  3SS5 A;  2ZNE A;  3DF0 B;  1EL4 A;  1YRT B;  1K9U A;  4PHJ A;  4CFR A;  4BY5 A;  3BFH A;  3VRO A;  2KGR A;  2CCM A;  2QEO A;  1V1G A;  1ZAC A;  1BT6 A;  3N7H A;  3LCP C;  1RRO A;  4M2Q A;  2LLU A;  1TUZ A;  2CTN A;  2H61 A;  2QEV A;  1MF8 B;  3B88 A;  1AVS A;  1SL9 A;  2KI4 C;  2L5X B;  1UHI A;  5D69 A;  3SG2 A;  1B8R A;  1M46 A;  1SNL A;  1YR5 A;  2HQ8 A;  2QEH A;  3CZ0 A;  4WQ3 A;  1B8C A;  1QX2 A;  2F3Y A;  2WC6 A;  1DJX A;  3D75 A;  2L4I A;  2K7B A;  1C07 A;  1KCY A;  1MUX A;  2VRG A;  3D74 A;  4YGE B;  3HX4 A;  4UPG A;  1L2O B;  4KYN A;  3R1P A;  5KU1 A;  3OP0 A;  3JTD C;  4IJ7 A;  2PAS A;  3DY9 A;  2KFG A;  2MRD A;  1A29 A;  2BCA A;  4YI9 A;  1S6J A;  1YVH A;  2MLF C;  1AUI B;  4FQT A;  3R1O A;  2JC2 A;  3I5I C;  2F33 A;  3NXA A;  1ZOT B;  3B6X A;  3EK7 A;  1HQV A;  1YTZ C;  3DVE A;  1IJ5 A;  4CFQ A;  2LAN A;  2KGB C;  2K7C A;  1CKK A;  2Q4U A;  1K2H A;  1BOC A;  2LNK A;  2I94 A;  3PAT A;  1F4Q A;  2K7D A;  5AAN A;  2ZN9 A;  5FI6 A;  2WCB A;  1S1E A;  1NSH A;  1SR6 C;  3B86 A;  3CR2 A;  1D1O A;  1H8B A;  2WCK A;  1S6I A;  4XJK A;  1K8U A;  1SSE B;  2ZRS A;  1SBJ A;  3EKH A;  5DKN A;  3I5H C;  1QLS A;  3CYZ A;  5ER4 X;  1KQV A;  3IQO A;  4OVN F;  1GJY A;  1XFU O;  3OHM B;  3PN7 B;  4MVF A;  1N0Y A;  1TWO A;  1WLM A;  1LS8 A;  4PAL A;  4E68 A;  1CDN A;  4INW A;  1A75 A;  3TDU A;  2E30 A;  3M0W A;  1RFJ A;  2BKI B;  2IS9 A;  1CB1 A;  3I5G C;  3AAJ A;  3Q8I A;  1SPY A;  1KSM A;  1IIO A;  1QLK A;  1P28 A;  2KFH A;  2M0R A;  1B1G A;  2L2E A;  4HRH A;  1G4Y R;  1MWN A;  2E6W A;  1DJZ A;  2ZFD A;  2PRU A;  2PAL A;  1BLQ A;  1UHJ A;  3LK1 A;  3DVK A;  4QJ5 B;  4MRX A;  2OS8 C;  3TDI A;  2WCM A;  1CLB A;  1L7Z A;  1Y6W A;  1GGZ A;  3KO0 A;  3B87 A;  4FTG A;  1S36 A;  2JPO A;  2SAS A;  1M63 B;  2PYQ A;  1KQM C;  3BUO B;  2KNE A;  1S26 D;  1WLZ A;  3LK0 A;  4GGN A;  1T14 A;  3D0Y B;  5HKZ A;  1OQP A;  1TRF A;  1XK4 C;  1KK7 Z;  1M39 A;  4OZD A;  1NCX A;  1DMO A;  1R6P A;  3SIB A;  2YGU A;  1F4O A;  1YUT A;  1CM4 A;  2LLT A;  5TNC A;  1W9Z A;  3UO9 A;  1SRA A;  1M45 A;  1R2U A;  2K2F A;  4ICB A;  3TUY C;  2RGI A;  3FE6 A;  2BE6 A;  2LHL A;  1WRK A;  1J1E A;  1BJF A;  5HYD A;  2CBL A;  3BUX B;  4P5O E;  1S5G Z;  2M3W A;  1NX2 A;  1YUS A;  1A03 A;  3MSE B;  1WDC B;  1FPW A;  1Q80 A;  1JWD A;  2KLD A;  1BU3 A;  2FJY A;  5CSI A;  1OOJ A;  1DGU A;  1WY9 A;  3D10 A;  5JJG A;  1JFJ A;  2HF5 A;  2D8N A;  4C0L A;  1BMO A;  1NX0 A;  4MSP A;  5CSF A;  4ORB B;  3ZNI A;  1JFK A;  1AJ5 A;  1PRW A;  4FQO A;  3L47 A;  1S5G Y;  4N1F A;  1AP4 A;  3ICB A;  1XYD A;  1J7P A;  3BYA A;  3SJS A;  1NX1 A;  1OOI X;  2EC6 B;  2KBI A;  3OX5 A;  4I5N B;  5EL2 A;  3BUN B;  4DS7 A;  4TNC A;  4YGD B;  3GOF A;  2JPT A;  3BUW B;  1ORG A;  4GNK B;  2M49 B;  3OGN A;  1TIZ A;  3EK4 A;  4PHK A;  3R1V A;  1J7R A;  1RTP 1;  4NQG A;  1QVI Z;  2JTZ A;  1ODB A;  2LUC A;  1TNW A;  3FS7 A;  2F8P A;  1XK4 A;  5I2O A;  5I2Q A;  1U5I A;  1BR1 B;  1OMR A;  2LLS A;  1N65 A;  3TS5 B;  1CLL A;  1L2O C;  1REC A;  1XFY O;  2CNP A;  2NCO A;  2HPS A;  1PVA A;  1IJ6 A;  1JUO A;  1EG4 A;  1KWO C;  1XFZ O;  2KOT A;  1SCM B;  2BCX A;  2JU0 A;  2LMV A;  1GM0 A;  5FI2 A;  4WQ2 A;  1C3Z A;  1W7I B;  4DCK A;  1QVI Y;  1CFF A;  2LP3 A;  4ETO A;  3R72 A;  3S0A A;  4PHN A;  2CT9 A;  3LLE A;  3KF9 A;  4OKH A;  1K93 D;  1B47 A;  1WRL A;  2WC5 A;  2F2O A;  2JRF A;  2M29 A;  2WCL A;  3DF0 A;  2A4J A;  3DD4 A;  1GQM A;  4MBE A;  1QWV A;  4A4B A;  1JF2 A;  1PSB A;  2GTE A;  1EJ3 A;  3CR4 X;  4DUQ A;  5AXI A;  2HQW A;  1UWO A;  3IVT A;  5I94 A;  5I2L A; 
#chains in the Genus database with same CATH homology
 3D77 A;  3D76 A;  3CYZ A;  3S0G A;  4F7F A;  3L4L A;  1TWO A;  1LS8 A;  4INW A;  1OOG A;  3FE8 A;  3Q8I A;  1OOF A;  3QME A;  1P28 A;  3BFA A;  4INX A;  1TUJ A;  3VB1 A;  1OOH A;  4PT1 A;  2WCM A;  3B87 A;  1XFR A;  2JPO A;  2QDI A;  5DIC A;  3NGV A;  1C3Y A;  2KPH A;  1T14 A;  3D78 A;  4OZD A;  3CAB A;  3NHI A;  3S0D A;  3NHT A;  3S0E A;  3DYE A;  3PJI A;  3FE6 A;  3B7A A;  3S0B A;  2FJY A;  2PQL A;  1DQE A;  3L4A A;  2QEB A;  3L47 A;  3BFH A;  3BJH A;  3CZ2 A;  1OOI X;  5EL2 A;  2QEO A;  3N7H A;  3DZT A;  3DXL A;  2P71 A;  1ORG A;  2QEV A;  2P70 A;  3B88 A;  3OGN A;  3R1V A;  3CDN A;  3CZ0 A;  2QEH A;  3RZS A;  2WC6 A;  3D75 A;  3V2L A;  3BFB A;  3D74 A;  3CZ1 A;  3R1P A;  1GM0 A;  3DY9 A;  1C3Z A;  4JD9 A;  2WCJ A;  3R1O A;  4FQT A;  3S0F A;  3R72 A;  3D73 A;  3S0A A;  3B6X A;  2L2C A;  3K1E A;  2WC5 A;  3FE9 A;  2WCL A;  2WCH A;  1OW4 A;  1QWV A;  2GTE A;  2ERB A;  2H8V A;  3B86 A;  2WCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...