4BY4A

Crystal structure of drosophila frq2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
178
structure length
171
Chain Sequence
SKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQNTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRMVQALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FI18190P1
publication title The Guanine-Exchange Factor Ric8A Binds to the Ca2+ Sensor Ncs-1 to Regulate Synapse Number and Neurotransmitter Release.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Calcium-binding protein
total genus 64
structure length 171
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4by4A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4by4A02
3DD4A 4C0JA 1QXPA 2KSPA 2I7AA 3SJSA 3EVVA 2Y4QA 1TN4A 2F3ZA 2NLNA 1TIZA 4MZKA 5D7FA 5AXIA 1JC2A 2K8MB 2AAOA 4JQ0D 2L50A 1Y1XA 3BQ3A 3I5IB 3VRNA 3PN7C 4AQJA 3NXAA 3E3RA 1QLSA 2LNKA 1E8AA 2JC2A 2LVIA 1HT9A 1OE9B 1XYDA 3SIAA 2BL0B 2JZIA 4PE0A 1BU3A 3M0WA 3OB1B 1RK9A 3A8RA 4CPVA 4NQGA 1H8BA 1CMGA 5I2LA 1KK8C 2LCPA 4OV2A 3DVJA 3JVTB 2L4HA 1FBVA 1FW4A 1SL9A 1JF2A 3IQOA 5CSFA 1K90D 2RGIA 4DUQA 4ZCVA 1CMFA 4M2QA 4N5XA 1M45A 2OTGC 2O60A 1DT7B 1OZOA 2Q91A 4N1GA 1XVJA 4GNKB 3OX5A 2ZKMX 4AQIA 5CSJA 2GGMA 1J7RA 2LM5A 1V1FA 4U8DA 3DVKA 4MRXA 1DJIA 4M2PA 2JT8A 4OKHA 1TTXA 3TDIA 1B8RA 1DJWA 1SL7A 2K0JA 3TZ1A 1GGZA 1RECA 4OCIA 5AERA 1M31A 1NX0A 3PALA 1FPWA 1XO5A 2E30A 2JTZA 1NWDA 1SK6D 3NSLA 1BF5A 2CT9A 1CM1A 2LE9B 4WQ3A 4E68A 3PN7B 1IRJA 3NSIA 4PCWA 2JT3A 1XFYO 1XFXO 1YVLA 4AOMA 1IH0A 1WLMA 2LP2A 2E6WA 1QJTA 4YBHB 3SG3A 2D8NA 3FIAA 4IL1A 2KAYA 5CPVA 1NSHA 3PM8A 1TNWA 3GK1A 5CSIA 1S3PA 1F70A 2LP3A 3NSKA 3LCPC 4I5JA 2OTGB 1SPYA 3EVRA 4YGCB 3CR4X 3ICBA 2KYCA 3BUMB 3QRXA 2M3WA 2JTTA 1S5GZ 4R1EA 1GQMA 1K94A 2CBLA 3BXKA 4FTGA 1J7QA 2TN4A 1R6PA 1AHRA 1UP5A 1F8HA 2ISDA 1CNPA 4HSZA 1OZSA 1A03A 2CTNA 5CSNA 1KQVA 4QJ4B 2COLB 3TDUA 2L51A 1K9PA 1WLZA 1IQ3A 2FOTA 1XFUO 1BG1A 1ZFSA 2K2AA 1QX2A 2KFHA 1DTLA 4ICBA 1OSAA 1S26D 1SMGA 2BCXA 3SG7A 1MF8B 5HKYA 1S6JA 2EHBA 2M8UA 4PHJA 1YX7A 1SL8A 2LHIA 4MZLA 4QJ5B 4PALA 1RJVA 2GGZA 4WQ2A 2KI6C 4JPZB 1TNXA 2EGDA 2F2PA 1YUSA 1QTXA 1IKUA 2AMIA 2FCDA 3I5HB 1XFVO 4GGNA 2BE4A 2KQ6A 4N1FA 1KCYA 4I5KA 3FS7A 1EH2A 2ZRTA 2HF5A 2HQWA 4CLNA 1YRUB 1AJ5A 3KF9A 3FWBA 3OX6A 1UURA 1A29A 2QACA 2BE6A 2I18A 2WORA 1SCVA 1K8UA 4YGAA 1J1EA 1A2XA 3DF0B 1AJ4A 5D69A 2WCFA 1S6IA 2NCOA 1ALWA 1UHIA 2FCEA 3EKJA 3WHUB 4BY4A 1JBAA 2MLFC 2KYFA 1M39A 2PALA 1KK7Z 4YGBB 3MSEB 3O4YA 5F6TA 2LUCA 1Q80A 2KDHA 1QS7A 1BODA 4NDDA 3KHEA 2ZFDA 3I5FC 4QJ3B 1UUSA 1J7PA 1CDMA 3RLZA 1G4YR 1KSOA 1JF0A 1S5GY 4FQOA 3TDZA 1C7VA 1RTP1 1IWQA 5HKWA 2SCPA 1EXRA 1NCXA 2MHHA 3K21A 1WRZA 3OP0A 1CFFA 2KI4C 1EG3A 1Y6WA 3VGOA 1UHNA 5B8IB 1SYMA 3AKBA 2KFGA 1CM4A 2LUXA 1CKKA 1DMOA 2PMYA 1B4CA 4MN0A 2MBXA 1QATA 5FYXA 4GPLB 4OVNF 1B47A 4YGDB 2K61A 5HKZA 2FJUB 1KSMA 5HLVA 4PE4A 4PE7A 1KFXL 1XFZO 1F4OA 1QIVA 4MEWA 1YVHA 1CFPA 2KGRA 1YX8A 2F33A 2LLSA 2LV7A 3D0YB 5DKQA 2B1UA 2ZNDA 1DGVA 2JNXA 1FI6A 2L5XB 1HQVA 2LAPA 2WCEA 1DJZA 1QX5B 2Y5IA 1XFWO 4YI8A 1LXFC 2M49B 2M7NA 1R2UA 1BR1B 5KSZA 1CDPA 2QPTA 4GGFA 1ZOTB 3OHMB 2JQ6A 2H61A 1TCOB 1KK8B 1M63B 4OR9B 5I2QA 2KI4B 1DF0B 1MQ1A 1NIWA 1DVIA 1WRLA 2BKHB 4BY5A 1GGWA 2DOQA 1NYAA 4PE1A 4L9MA 3D0YA 1TOPA 5ER5A 1LINA 1K9UA 1AVSA 1A4PA 2Y1MA 2OS8C 5G08A 1CFCA 1KK7Y 1JSAA 1X02A 3I5GC 1U5IB 4GFTA 4DCKA 3SIBA 4C0LA 2LVJA 1SCMC 1CLMA 1N2DA 1H4BA 2H2KA 5KTYA 1FF1A 3NSOA 1WDCC 1DF0A 1ZMZA 4PHMA 4YRUA 2M1KB 4GAOA 2MJWB 1B8CA 2MA2A 1SRAA 1UHHA 3LK0A 5JJGA 1MUXA 2KGBC 1XK4C 2F8PA 2IS9A 4MSPA 4F0ZB 2LANA 1NP8A 1PSBA 2HETA 1L7ZA 1C7WA 2L0PA 1K93D 3BOWB 2MRDA 1MR8A 3O6BA 2PVBA 2LMVA 2M0RA 1U5IA 1YURA 1DJGA 4MRYA 2KAXA 2P6BB 3SG4A 2SASA 2JPTA 2I94A 4HRHA 4XYNA 3RM1A 3SG2A 4D1EA 3EK7A 5I2OA 2O5GA 3I5GB 3PFVA 1CDNA 2WOSA 2EC6C 1EL4A 2AUCA 5HYDA 2JT0A 2PRUA 1F4QA 5DKRA 5GQQC 2NZ0A 3BOWA 1Y1AA 2JULA 4ORCB 1WDCB 3IQQA 1N0YA 3BYAA 3OB2B 1OMVA 2K2FA 5AEQA 2M97A 1MWNA 1Y1UA 1BR4B 3CGAA 4C0KA 2PSRA 1JUOA 1KFXS 1PSRA 2VRGA 2L98A 4CIDA 1XA5A 2BBNA 4MLWA 1F54A 1KFUL 1BT6A 1RROA 3JVTC 2L4IA 1N65A 2K7OA 1KQMC 1QVIZ 4DIRA 2GV5A 4DRWA 1IJ5A 4PHKA 3H4SE 1WRKA 3EK8A 3SG5A 4ORBB 1PVAA 5K89A 1K2HA 3BUWB 4PHNA 2JRFA 3CZTX 3DF0A 1J1DA 3AAKA 3VRQA 5ER4X 1F55A 1SKTA 1G33A 2HQ8A 3IF7A 5BPJA 3WNXB 1G8IA 4CFRA 1ALVA 3JTDC 3CR5X 1RFJA 1TCFA 3D10A 2LLTA 1RWYA 3FWCA 1BMOA 1MXLC 2CXJA 3SG6A 4YGEB 2A4JA 2NCPA 1QASA 3TUYC 2I2RE 1J55A 4PDZA 5JOLA 1S1EA 4JWQA 2LVKA 3ZWHA 2R2IA 5HLOA 1MHOA 5J3XA 3BUNB 2HPSA 1MXEA 2KHNA 3BUOB 1NX1A 1F71A 2MAZA 2PASA 1M46A 2BCBA 1QV0A 2KBIA 1B8LA 1CB1A 1JFJA 3I5FB 1OMDA 1KQMB 4GBAA 3CS1A 4XJKB 1AP4A 1OOJA 1B7TZ 1TNPA 1YTZC 4I5LB 2KNEA 1KWOC 1QLKA 4TNCA 1SBJA 1EJ3A 3VRRA 1B9AA 1DJXA 1LA3A 3LK1A 3PSRA 3CWGA 1BLQA 5TNCA 2JWWA 5AANA 1JFKA 4MZJA 2ZNEA 1C07A 1V1GA 1Y0VH 3JTDB 2NXQA 1K95A 2BBMA 1AUIB 3ZNIA 1DJHA 1BJFA 3TUYB 1PULA 3VRPA 4XJKA 5DKNA 3TS5C 2OPOA 2G2BA 2LC5A 3WHTB 3EVUA 3HX4A 2ZN9A 3A4UB 1D1OA 1EG4A 1QVIY 2WCBA 1NX3A 4GUKA 1OMRA 2JOJA 2JXCA 2M7LA 1DGUA 2BCAA 3C1VA 2ZN8A 3GK4X 4HRGA 1NX2A 1KWOB 1SW8A 1SR6C 4USLA 1CLBA 4YI9A 1A75B 3I5HC 4I5NB 2Q4UA 4NDCA 4A4CA 1WY9A 1IJ6A 2WC8A 2LLUA 2LVVA 1K96A 2BECA 5AFPA 1W7JB 3EK4A 1GJYA 1KFUS 2K7BA 3GK2A 4DS7A 1OQPA 4ETOA 1AK8A 3O78A 1J7OA 3LLEA 3PATA 1LKJA 1CFDA 1QIWA 3CTNA 3CLNA 2CCMA 3EKHA 1TNQA 1L2OC 2JNFA 3AAJA 1NPQA 1PVBA 2F3YA 2LMTA 1JWDA 2KBMA 3KO0A 4UPGA 2OS8B 1IGVA 3DVEA 4MBEA 1S6CA 4MVFA 2V53A 3PLFB 5PALA 3TS5B 3F45A 1NUBA 1FI5A 2JXLA 1YUUA 1CTRA 2Y1NA 1A75A 2WNDA 1QV1A 1YRTB 3DVMA 1BOCA 2ZRSA 1SCMB 3GOFA 3LL8B 4P2YB 2KFFA 1B7TY 4P5OE 4WRIA 1VRKA 1K9KA 2KOTA 1CDLA 1PALA 1QX7A 1NCZA 4A4BA 3I5IC 3CR2A 1ZUZA 2JU0A 2K7DA 1NCYA 1SR6B 2L2EA 3WXAA 1YUTA 2F2OA 2KI6D 2LHLA 1IQ5A 2BL0C 2CNPA 2M29A 1SNLA 2LMUA 5I8NA 4HREE 2G9BA 2M9GA 1UHJA 1W7IB 3O2PA 3BUXB 1TRFA 3KEVA 1ZACA 2KQYA 2KAVA 4CFQA 3VROA 2K7CA 4Q04A 1CLLA 4ZCUA 5IBWA 1S36A 1ODBA 1UHKA 1LA0A 1UWOA 1L2OB 3HCMA 1PK0D 1B1GA 4GGFC 2M1UA 2BKIB 5KU1A 1PRWA 1YR5A 2H61C 1IG5A 1LVCD 1SY9A 3KPXA 4NDBA 4ORAB 2MLEC 1DJYA 3AKAA 1XK4A 4M2OA 2EC6B
chains in the Genus database with same CATH superfamily
3DD4A 4C0JA 1QXPA 2KSPA 2I7AA 3SJSA 3EVVA 2Y4QA 1TN4A 4PT1A 2F3ZA 2NLNA 1TIZA 4MZKA 5D7FA 5AXIA 1JC2A 2K8MB 2AAOA 2WCHA 4JQ0D 2L50A 1Y1XA 3BQ3A 3I5IB 3VRNA 3PN7C 4AQJA 3NXAA 3E3RA 5I94A 1QLSA 2LNKA 1E8AA 2JC2A 2LVIA 1HT9A 1OE9B 1XYDA 3SIAA 2BL0B 2JZIA 3IVTA 4PE0A 2KLDA 4JKTA 1BU3A 3M0WA 3OB1B 1RK9A 3A8RA 4CPVA 4NQGA 1H8BA 1CMGA 5I2LA 1KK8C 2LCPA 4OV2A 3S0FA 3BFBA 3DVJA 3JVTB 2L4HA 1FBVA 1FW4A 1SL9A 1JF2A 3IQOA 5CSFA 1K90D 2RGIA 4DUQA 4ZCVA 1CMFA 4M2QA 4N5XA 1M45A 2OTGC 2O60A 1DT7B 1OZOA 2Q91A 4N1GA 1XVJA 4OZDA 4GNKB 3OX5A 2ZKMX 3QMEA 4AQIA 5CSJA 2GGMA 1J7RA 2LM5A 1V1FA 1OOGA 4U8DA 3DVKA 2QEVA 4MRXA 1DJIA 4M2PA 2JT8A 4OKHA 1TTXA 3TDIA 1B8RA 1DJWA 1SL7A 2K0JA 3TZ1A 1GGZA 1RECA 4OCIA 5AERA 1M31A 1NX0A 3PALA 1FPWA 1XO5A 2E30A 2JTZA 1NWDA 3N7HA 1SK6D 3NSLA 1BF5A 2CT9A 1CM1A 2LE9B 4WQ3A 4E68A 1Z2CB 3PN7B 1IRJA 3NSIA 4PCWA 2JT3A 1XFYO 1C3YA 1XFXO 1YVLA 4AOMA 1IH0A 1WLMA 2LP2A 1DC1A 2E6WA 1QJTA 3R72A 4YBHB 3SG3A 2D8NA 3FIAA 4IL1A 2KAYA 5CPVA 1NSHA 4FQTA 3PM8A 1TNWA 3GK1A 5CSIA 1S3PA 1F70A 2LP3A 3NSKA 3LCPC 1ORGA 4I5JA 2OTGB 3R1OA 1SPYA 3EVRA 4YGCB 1C3ZA 3CR4X 3ICBA 2WC6A 1Z4HA 2KYCA 3BUMB 3QRXA 2M3WA 2JTTA 1S5GZ 2K60A 4R1EA 3DYEA 1GQMA 3B86A 1K94A 2CBLA 3D76A 1JBAA 3BXKA 4FTGA 1J7QA 1P28A 2TN4A 1R6PA 1AHRA 1UP5A 1F8HA 2ISDA 1CNPA 4HSZA 1OZSA 1A03A 2CTNA 2P71A 5CSNA 1KQVA 4QJ4B 2COLB 3TDUA 2L51A 1K9PA 1WLZA 1IQ3A 3L4LA 2FOTA 1XFUO 1BG1A 1ZFSA 2K2AA 1QX2A 2KFHA 1DEKA 1DTLA 4ICBA 1OSAA 1S26D 1SMGA 2BCXA 3B88A 3SG7A 1MF8B 5HKYA 1S6JA 2EHBA 2QEOA 2BAPA 2M8UA 4PHJA 1YX7A 1SL8A 2LHIA 4MZLA 4QJ5B 4PALA 1RJVA 2GGZA 4WQ2A 4KYNA 2KI6C 3OBVA 4JPZB 1TNXA 2EGDA 2F2PA 1YUSA 3D74A 1QTXA 3RZSA 1IKUA 2AMIA 2FCDA 3I5HB 1XFVO 4GGNA 2BE4A 2KQ6A 4N1FA 1KCYA 4I5KA 3FS7A 1EH2A 2ZRTA 2HF5A 2HQWA 5DICA 4CLNA 3VB1A 1YRUB 1AJ5A 3KF9A 1GM0A 3FWBA 3OX6A 1UURA 1A29A 2QACA 2BE6A 2I18A 2WORA 1SCVA 1K8UA 4YGAA 1J1EA 2WC5A 1A2XA 3Q8IA 2WCLA 3DF0B 1AJ4A 5D69A 2WCFA 1S6IA 2NCOA 1ALWA 1UHIA 2FCEA 3EKJA 3L4AA 3WHUB 4BY4A 2MLFC 2KYFA 1M39A 2PALA 1KK7Z 4YGBB 3MSEB 3O4YA 5F6TA 2LUCA 1Q80A 2KDHA 1QS7A 1BODA 4NDDA 3KHEA 2ZFDA 3I5FC 5HL1A 3CZ2A 4QJ3B 1UUSA 1J7PA 4F7FA 5EL2A 1CDMA 3RLZA 1G4YR 1KSOA 3FE9A 1JF0A 1S5GY 4FQOA 3TDZA 1C7VA 1RTP1 1IWQA 5HKWA 2SCPA 2FJYA 1EXRA 1NCXA 1SSEB 2MHHA 3BJHA 3K21A 1WRZA 3OP0A 3UO9A 1CFFA 2KI4C 1EG3A 3CDNA 1Y6WA 3VGOA 1UHNA 5B8IB 1SYMA 3AKBA 2KFGA 1CM4A 2LUXA 1CKKA 1DMOA 2PMYA 1B4CA 4MN0A 1OOIX 2MBXA 1QATA 5FYXA 4GPLB 4OVNF 1B47A 4YGDB 2K61A 5HKZA 2H8VA 1W9ZA 2FJUB 1KSMA 5HLVA 4PE4A 4PE7A 1KFXL 1XFZO 1F4OA 1QIVA 4MEWA 1YVHA 3B87A 1CFPA 2KGRA 1YX8A 2F33A 2LLSA 2LV7A 3D77A 3D0YB 3D78A 5DKQA 4INWA 2B1UA 2ZNDA 1DGVA 2JNXA 3EG5B 1FI6A 3S0BA 2L5XB 1HQVA 2LAPA 2WCEA 1DJZA 1QX5B 2Y5IA 1XFWO 4YI8A 1LXFC 2M49B 2M7NA 1R2UA 1BR1B 5KSZA 1CDPA 2QPTA 4GGFA 1ZOTB 3DZTA 2WCJA 2JQ6A 3OHMB 4JD9A 2H61A 1TCOB 1KK8B 1M63B 3O4XA 4OR9B 5I2QA 2KI4B 1DF0B 1MQ1A 1NIWA 1DVIA 1WRLA 2BKHB 3S0EA 4BY5A 1GGWA 2BNXA 2DOQA 1NYAA 3SS5A 3CZ1A 4PE1A 4L9MA 3D0YA 1TOPA 2L2CA 3BFHA 5ER5A 1LINA 1K9UA 1AVSA 1A4PA 2Y1MA 2OS8C 3SS3A 1TWOA 5G08A 1CFCA 1KK7Y 1JSAA 1X02A 3I5GC 4INXA 1U5IB 4GFTA 4DCKA 3SIBA 2ERBA 4C0LA 2LVJA 1SCMC 1CLMA 1N2DA 1H4BA 3NGVA 2H2KA 3PM2A 5KTYA 1FF1A 3NSOA 1WDCC 1DF0A 1ZMZA 4PHMA 4YRUA 3CABA 2M1KB 4GAOA 2MJWB 1B8CA 2MA2A 1SRAA 1UHHA 1LS8A 3LK0A 5JJGA 1MUXA 2KGBC 1XK4C 2F8PA 2IS9A 4MSPA 3V2LA 4F0ZB 2LANA 1NP8A 2PYQA 3UNWA 1PSBA 2HETA 1L7ZA 1C7WA 2L0PA 1K93D 3BOWB 2MRDA 1MR8A 3B6XA 3O6BA 2PVBA 2LMVA 2M0RA 1U5IA 1YURA 1DJGA 4MRYA 2KAXA 2P6BB 3SG4A 2SASA 2JPTA 2I94A 4HRHA 4XYNA 3RM1A 3SG2A 3SS4A 4D1EA 2KLEA 3EK7A 5I2OA 1XFRA 2O5GA 3I5GB 3PFVA 1CDNA 2WOSA 2EC6C 1EL4A 2AUCA 5HYDA 2JT0A 2PRUA 1F4QA 5DKRA 5GQQC 2NZ0A 3BOWA 3L47A 1Y1AA 2JULA 1TUJA 1WDCB 4IJ7A 4ORCB 2L5YA 3IQQA 1N0YA 3BYAA 3OB2B 1OMVA 2K2FA 5AEQA 2M97A 1MWNA 1Y1UA 1BR4B 3CGAA 1OW4A 4C0KA 3S0AA 2PSRA 1JUOA 1KFXS 1PSRA 2VRGA 2L98A 4CIDA 1XA5A 2BBNA 3CYZA 4MLWA 1F54A 3FE8A 1KFUL 1BT6A 1RROA 3JVTC 3D73A 2L4IA 1N65A 2K7OA 1KQMC 1QVIZ 4DIRA 2GV5A 4DRWA 1IJ5A 2QEHA 1TUZA 3H4SE 4PHKA 1WRKA 3EK8A 3SG5A 3B7AA 4ORBB 1PVAA 5K89A 1K2HA 3BUWB 4PHNA 2JRFA 3CZTX 3DF0A 3R1PA 1J1DA 3AAKA 3VRQA 5ER4X 1F55A 1SKTA 1G33A 2HQ8A 3IF7A 5BPJA 3WNXB 1G8IA 4CFRA 1ALVA 3JTDC 3CR5X 1RFJA 1TCFA 3D10A 2LLTA 1RWYA 3FWCA 1BMOA 1MXLC 2CXJA 3SG6A 4YGEB 2KPHA 2A4JA 2NCPA 1QASA 3TUYC 2I2RE 1J55A 4PDZA 5JOLA 1S1EA 4JWQA 2LVKA 3PJIA 2R2IA 3ZWHA 5HLOA 1MHOA 5J3XA 3BUNB 5FI7A 3NHIA 2HPSA 1MXEA 2KHNA 3BUOB 1NX1A 1F71A 2MAZA 2PASA 1M46A 2BCBA 1QV0A 2KBIA 1B8LA 1CB1A 1JFJA 3I5FB 1OMDA 1KQMB 4GBAA 3CS1A 4XJKB 1AP4A 1OOJA 1B7TZ 1TNPA 1YTZC 4I5LB 2KNEA 1KWOC 1DQEA 1QLKA 4TNCA 1SBJA 3DY9A 3D75A 1EJ3A 3VRRA 1B9AA 1DJXA 1LA3A 3LK1A 3PSRA 3CWGA 1BLQA 5TNCA 2JWWA 5AANA 1JFKA 4MZJA 2ZNEA 1C07A 1V1GA 1Y0VH 5D3OA 3JTDB 3S0GA 2NXQA 1K95A 2BBMA 1AUIB 3ZNIA 1DJHA 1BJFA 3TUYB 1PULA 3VRPA 4XJKA 5DKNA 3TS5C 3CZ0A 2OPOA 1OOHA 2G2BA 2LC5A 3WHTB 3EVUA 3HX4A 2ZN9A 3A4UB 1D1OA 3R1VA 1EG4A 1QVIY 2WCMA 3S0DA 2WCBA 1NX3A 4GUKA 1OMRA 2JOJA 2JXCA 2M7LA 1DGUA 2BCAA 3C1VA 1DELA 2ZN8A 3GK4X 4HRGA 2P70A 1NX2A 1KWOB 1SW8A 1SR6C 4USLA 1CLBA 4YI9A 1A75B 3I5HC 4I5NB 2Q4UA 4NDCA 2YGUA 5FI2A 4A4CA 1WY9A 1IJ6A 2WC8A 2LLUA 2LVVA 1K96A 2BECA 3NHTA 5AFPA 1W7JB 3EK4A 1GJYA 1KFUS 2K7BA 3DXLA 3GK2A 1OQPA 4DS7A 4ETOA 1AK8A 3O78A 5FI6A 1J7OA 3LLEA 3PATA 1LKJA 1CFDA 1QIWA 3CTNA 3CLNA 2CCMA 3EKHA 1TNQA 2PQLA 1L2OC 2JNFA 3AAJA 1NPQA 1PVBA 2F3YA 2LMTA 1JWDA 2KBMA 3KO0A 4UPGA 2OS8B 1IGVA 3DVEA 4MBEA 1S6CA 4MVFA 2V53A 3PLFB 5PALA 3TS5B 3F45A 1T14A 1NUBA 1FI5A 2GTEA 2JXLA 1YUUA 1CTRA 2Y1NA 1A75A 2WNDA 1QV1A 1YRTB 3DVMA 3FE6A 2ZRSA 1SCMB 1BOCA 1OOFA 3GOFA 3LL8B 4P2YB 2KFFA 3OGNA 1B7TY 4P5OE 4WRIA 1VRKA 1K9KA 2KOTA 1CDLA 1PALA 1QX7A 1NCZA 4A4BA 3I5IC 3CR2A 1ZUZA 2JU0A 2K7DA 1NCYA 1SR6B 2L2EA 2JPOA 1YUTA 2F2OA 2KI6D 2LHLA 3WXAA 1IQ5A 2BL0C 2CNPA 2M29A 2QEBA 3BFAA 1SNLA 3K1EA 2LMUA 5I8NA 4HREE 2G9BA 2M9GA 1UHJA 1W7IB 3O2PA 3BUXB 1TRFA 3KEVA 1QWVA 1ZACA 2KQYA 2KAVA 2QDIA 4CFQA 3VROA 2K7CA 4Q04A 1CLLA 4ZCUA 5IBWA 1S36A 1IIOA 1ODBA 1UHKA 1LA0A 1UWOA 1L2OB 3HCMA 1PK0D 2WCKA 1B1GA 4GGFC 2M1UA 2BKIB 5KU1A 1PRWA 1YR5A 2H61C 1IG5A 1LVCD 1SY9A 3KPXA 4NDBA 4ORAB 2MLEC 1DJYA 3AKAA 1XK4A 4M2OA 2EC6B
chains in the Genus database with same CATH topology
3DD4A 4C0JA 1QXPA 2KSPA 2I7AA 3SJSA 3EVVA 2Y4QA 1TN4A 2F3ZA 2NLNA 1TIZA 4MZKA 5D7FA 5AXIA 1JC2A 2K8MB 2AAOA 4JQ0D 2L50A 1Y1XA 3BQ3A 3I5IB 3VRNA 3PN7C 4AQJA 3NXAA 3E3RA 1QLSA 2LNKA 1E8AA 2JC2A 2LVIA 1HT9A 1OE9B 1XYDA 3SIAA 2BL0B 2JZIA 4PE0A 1BU3A 3M0WA 3OB1B 1RK9A 3A8RA 4CPVA 4NQGA 1H8BA 1CMGA 5I2LA 1KK8C 2LCPA 4OV2A 3DVJA 3JVTB 2L4HA 1FBVA 1FW4A 1SL9A 1JF2A 3IQOA 5CSFA 1K90D 2RGIA 4DUQA 4ZCVA 1CMFA 4M2QA 4N5XA 1M45A 2OTGC 2O60A 1DT7B 1OZOA 2Q91A 4N1GA 1XVJA 4GNKB 3OX5A 2ZKMX 4AQIA 5CSJA 2GGMA 1J7RA 2LM5A 1V1FA 4U8DA 3DVKA 4MRXA 1DJIA 4M2PA 2JT8A 4OKHA 1TTXA 3TDIA 1B8RA 1DJWA 1SL7A 2K0JA 3TZ1A 1GGZA 1RECA 4OCIA 5AERA 1M31A 1NX0A 3PALA 1FPWA 1XO5A 2E30A 2JTZA 1NWDA 1SK6D 3NSLA 1BF5A 2CT9A 1CM1A 2LE9B 4WQ3A 4E68A 3PN7B 1IRJA 3NSIA 4PCWA 2JT3A 1XFYO 1XFXO 1YVLA 4AOMA 1IH0A 1WLMA 2LP2A 2E6WA 1QJTA 4YBHB 3SG3A 2D8NA 3FIAA 4IL1A 2KAYA 5CPVA 1NSHA 3PM8A 1TNWA 3GK1A 5CSIA 1S3PA 1F70A 2LP3A 3NSKA 3LCPC 4I5JA 2OTGB 1SPYA 3EVRA 4YGCB 3CR4X 3ICBA 2KYCA 3BUMB 3QRXA 2M3WA 2JTTA 1S5GZ 4R1EA 1GQMA 1K94A 2CBLA 3BXKA 4FTGA 1J7QA 2TN4A 1R6PA 1AHRA 1UP5A 1F8HA 2ISDA 1CNPA 4HSZA 1OZSA 1A03A 2CTNA 5CSNA 1KQVA 4QJ4B 2COLB 3TDUA 2L51A 1K9PA 1WLZA 1IQ3A 2FOTA 1XFUO 1BG1A 1ZFSA 2K2AA 1QX2A 2KFHA 1DTLA 4ICBA 1OSAA 1S26D 1SMGA 2BCXA 3SG7A 1MF8B 5HKYA 1S6JA 2EHBA 2M8UA 4PHJA 1YX7A 1SL8A 2LHIA 4MZLA 4QJ5B 4PALA 1RJVA 2GGZA 4WQ2A 2KI6C 4JPZB 1TNXA 2EGDA 2F2PA 1YUSA 1QTXA 1IKUA 2AMIA 2FCDA 3I5HB 1XFVO 4GGNA 2BE4A 2KQ6A 4N1FA 1KCYA 4I5KA 3FS7A 1EH2A 2ZRTA 2HF5A 2HQWA 4CLNA 1YRUB 1AJ5A 3KF9A 3FWBA 3OX6A 1UURA 1A29A 2QACA 2BE6A 2I18A 2WORA 1SCVA 1K8UA 4YGAA 1J1EA 1A2XA 3DF0B 1AJ4A 5D69A 2WCFA 1S6IA 2NCOA 1ALWA 1UHIA 2FCEA 3EKJA 3WHUB 4BY4A 1JBAA 2MLFC 2KYFA 1M39A 2PALA 1KK7Z 4YGBB 3MSEB 3O4YA 5F6TA 2LUCA 1Q80A 2KDHA 1QS7A 1BODA 4NDDA 3KHEA 2ZFDA 3I5FC 4QJ3B 1UUSA 1J7PA 1CDMA 3RLZA 1G4YR 1KSOA 1JF0A 1S5GY 4FQOA 3TDZA 1C7VA 1RTP1 1IWQA 5HKWA 2SCPA 1EXRA 1NCXA 2MHHA 3K21A 1WRZA 3OP0A 1CFFA 2KI4C 1EG3A 1Y6WA 3VGOA 1UHNA 5B8IB 1SYMA 3AKBA 2KFGA 1CM4A 2LUXA 1CKKA 1DMOA 2PMYA 1B4CA 4MN0A 2MBXA 1QATA 5FYXA 4GPLB 4OVNF 1B47A 4YGDB 2K61A 5HKZA 2FJUB 1KSMA 5HLVA 4PE4A 4PE7A 1KFXL 1XFZO 1F4OA 1QIVA 4MEWA 1YVHA 1CFPA 2KGRA 1YX8A 2F33A 2LLSA 2LV7A 3D0YB 5DKQA 2B1UA 2ZNDA 1DGVA 2JNXA 1FI6A 2L5XB 1HQVA 2LAPA 2WCEA 1DJZA 1QX5B 2Y5IA 1XFWO 4YI8A 1LXFC 2M49B 2M7NA 1R2UA 1BR1B 5KSZA 1CDPA 2QPTA 4GGFA 1ZOTB 3OHMB 2JQ6A 2H61A 1TCOB 1KK8B 1M63B 4OR9B 5I2QA 2KI4B 1DF0B 1MQ1A 1NIWA 1DVIA 1WRLA 2BKHB 4BY5A 1GGWA 2DOQA 1NYAA 4PE1A 4L9MA 3D0YA 1TOPA 5ER5A 1LINA 1K9UA 1AVSA 1A4PA 2Y1MA 2OS8C 5G08A 1CFCA 1KK7Y 1JSAA 1X02A 3I5GC 1U5IB 4GFTA 4DCKA 3SIBA 4C0LA 2LVJA 1SCMC 1CLMA 1N2DA 1H4BA 2H2KA 5KTYA 1FF1A 3NSOA 1WDCC 1DF0A 1ZMZA 4PHMA 4YRUA 2M1KB 4GAOA 2MJWB 1B8CA 2MA2A 1SRAA 1UHHA 3LK0A 5JJGA 1MUXA 2KGBC 1XK4C 2F8PA 2IS9A 4MSPA 4F0ZB 2LANA 1NP8A 1PSBA 2HETA 1L7ZA 1C7WA 2L0PA 1K93D 3BOWB 2MRDA 1MR8A 3O6BA 2PVBA 2LMVA 2M0RA 1U5IA 1YURA 1DJGA 4MRYA 2KAXA 2P6BB 3SG4A 2SASA 2JPTA 2I94A 4HRHA 4XYNA 3RM1A 3SG2A 4D1EA 3EK7A 5I2OA 2O5GA 3I5GB 3PFVA 1CDNA 2WOSA 2EC6C 1EL4A 2AUCA 5HYDA 2JT0A 2PRUA 1F4QA 5DKRA 5GQQC 2NZ0A 3BOWA 1Y1AA 2JULA 4ORCB 1WDCB 3IQQA 1N0YA 3BYAA 3OB2B 1OMVA 2K2FA 5AEQA 2M97A 1MWNA 1Y1UA 1BR4B 3CGAA 4C0KA 2PSRA 1JUOA 1KFXS 1PSRA 2VRGA 2L98A 4CIDA 1XA5A 2BBNA 4MLWA 1F54A 1KFUL 1BT6A 1RROA 3JVTC 2L4IA 1N65A 2K7OA 1KQMC 1QVIZ 4DIRA 2GV5A 4DRWA 1IJ5A 4PHKA 3H4SE 1WRKA 3EK8A 3SG5A 4ORBB 1PVAA 5K89A 1K2HA 3BUWB 4PHNA 2JRFA 3CZTX 3DF0A 1J1DA 3AAKA 3VRQA 5ER4X 1F55A 1SKTA 1G33A 2HQ8A 3IF7A 5BPJA 3WNXB 1G8IA 4CFRA 1ALVA 3JTDC 3CR5X 1RFJA 1TCFA 3D10A 2LLTA 1RWYA 3FWCA 1BMOA 1MXLC 2CXJA 3SG6A 4YGEB 2A4JA 2NCPA 1QASA 3TUYC 2I2RE 1J55A 4PDZA 5JOLA 1S1EA 4JWQA 2LVKA 3ZWHA 2R2IA 5HLOA 1MHOA 5J3XA 3BUNB 2HPSA 1MXEA 2KHNA 3BUOB 1NX1A 1F71A 2MAZA 2PASA 1M46A 2BCBA 1QV0A 2KBIA 1B8LA 1CB1A 1JFJA 3I5FB 1OMDA 1KQMB 4GBAA 3CS1A 4XJKB 1AP4A 1OOJA 1B7TZ 1TNPA 1YTZC 4I5LB 2KNEA 1KWOC 1QLKA 4TNCA 1SBJA 1EJ3A 3VRRA 1B9AA 1DJXA 1LA3A 3LK1A 3PSRA 3CWGA 1BLQA 5TNCA 2JWWA 5AANA 1JFKA 4MZJA 2ZNEA 1C07A 1V1GA 1Y0VH 3JTDB 2NXQA 1K95A 2BBMA 1AUIB 3ZNIA 1DJHA 1BJFA 3TUYB 1PULA 3VRPA 4XJKA 5DKNA 3TS5C 2OPOA 2G2BA 2LC5A 3WHTB 3EVUA 3HX4A 2ZN9A 3A4UB 1D1OA 1EG4A 1QVIY 2WCBA 1NX3A 4GUKA 1OMRA 2JOJA 2JXCA 2M7LA 1DGUA 2BCAA 3C1VA 2ZN8A 3GK4X 4HRGA 1NX2A 1KWOB 1SW8A 1SR6C 4USLA 1CLBA 4YI9A 1A75B 3I5HC 4I5NB 2Q4UA 4NDCA 4A4CA 1WY9A 1IJ6A 2WC8A 2LLUA 2LVVA 1K96A 2BECA 5AFPA 1W7JB 3EK4A 1GJYA 1KFUS 2K7BA 3GK2A 4DS7A 1OQPA 4ETOA 1AK8A 3O78A 1J7OA 3LLEA 3PATA 1LKJA 1CFDA 1QIWA 3CTNA 3CLNA 2CCMA 3EKHA 1TNQA 1L2OC 2JNFA 3AAJA 1NPQA 1PVBA 2F3YA 2LMTA 1JWDA 2KBMA 3KO0A 4UPGA 2OS8B 1IGVA 3DVEA 4MBEA 1S6CA 4MVFA 2V53A 3PLFB 5PALA 3TS5B 3F45A 1NUBA 1FI5A 2JXLA 1YUUA 1CTRA 2Y1NA 1A75A 2WNDA 1QV1A 1YRTB 3DVMA 1BOCA 2ZRSA 1SCMB 3GOFA 3LL8B 4P2YB 2KFFA 1B7TY 4P5OE 4WRIA 1VRKA 1K9KA 2KOTA 1CDLA 1PALA 1QX7A 1NCZA 4A4BA 3I5IC 3CR2A 1ZUZA 2JU0A 2K7DA 1NCYA 1SR6B 2L2EA 3WXAA 1YUTA 2F2OA 2KI6D 2LHLA 1IQ5A 2BL0C 2CNPA 2M29A 1SNLA 2LMUA 5I8NA 4HREE 2G9BA 2M9GA 1UHJA 1W7IB 3O2PA 3BUXB 1TRFA 3KEVA 1ZACA 2KQYA 2KAVA 4CFQA 3VROA 2K7CA 4Q04A 1CLLA 4ZCUA 5IBWA 1S36A 1ODBA 1UHKA 1LA0A 1UWOA 1L2OB 3HCMA 1PK0D 1B1GA 4GGFC 2M1UA 2BKIB 5KU1A 1PRWA 1YR5A 2H61C 1IG5A 1LVCD 1SY9A 3KPXA 4NDBA 4ORAB 2MLEC 1DJYA 3AKAA 1XK4A 4M2OA 2EC6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD4 A;  4C0J A;  1QXP A;  2KSP A;  2I7A A;  3SJS A;  3EVV A;  2Y4Q A;  1TN4 A;  2F3Z A;  2NLN A;  1TIZ A;  4MZK A;  5D7F A;  5AXI A;  1JC2 A;  2K8M B;  2AAO A;  4JQ0 D;  2L50 A;  1Y1X A;  3BQ3 A;  3I5I B;  3VRN A;  3PN7 C;  4AQJ A;  3NXA A;  3E3R A;  1QLS A;  2LNK A;  1E8A A;  2JC2 A;  2LVI A;  1HT9 A;  1OE9 B;  1XYD A;  3SIA A;  2BL0 B;  2JZI A;  4PE0 A;  1BU3 A;  3M0W A;  3OB1 B;  1RK9 A;  3A8R A;  4CPV A;  4NQG A;  1H8B A;  1CMG A;  5I2L A;  1KK8 C;  2LCP A;  4OV2 A;  3DVJ A;  3JVT B;  2L4H A;  1FBV A;  1FW4 A;  1SL9 A;  1JF2 A;  3IQO A;  5CSF A;  1K90 D;  2RGI A;  4DUQ A;  4ZCV A;  1CMF A;  4M2Q A;  4N5X A;  1M45 A;  2OTG C;  2O60 A;  1DT7 B;  1OZO A;  2Q91 A;  4N1G A;  1XVJ A;  4GNK B;  3OX5 A;  2ZKM X;  4AQI A;  5CSJ A;  2GGM A;  1J7R A;  2LM5 A;  1V1F A;  4U8D A;  3DVK A;  4MRX A;  1DJI A;  4M2P A;  2JT8 A;  4OKH A;  1TTX A;  3TDI A;  1B8R A;  1DJW A;  1SL7 A;  2K0J A;  3TZ1 A;  1GGZ A;  1REC A;  4OCI A;  5AER A;  1M31 A;  1NX0 A;  3PAL A;  1FPW A;  1XO5 A;  2E30 A;  2JTZ A;  1NWD A;  1SK6 D;  3NSL A;  1BF5 A;  2CT9 A;  1CM1 A;  2LE9 B;  4WQ3 A;  4E68 A;  3PN7 B;  1IRJ A;  3NSI A;  4PCW A;  2JT3 A;  1XFY O;  1XFX O;  1YVL A;  4AOM A;  1IH0 A;  1WLM A;  2LP2 A;  2E6W A;  1QJT A;  4YBH B;  3SG3 A;  2D8N A;  3FIA A;  4IL1 A;  2KAY A;  5CPV A;  1NSH A;  3PM8 A;  1TNW A;  3GK1 A;  5CSI A;  1S3P A;  1F70 A;  2LP3 A;  3NSK A;  3LCP C;  4I5J A;  2OTG B;  1SPY A;  3EVR A;  4YGC B;  3CR4 X;  3ICB A;  2KYC A;  3BUM B;  3QRX A;  2M3W A;  2JTT A;  1S5G Z;  4R1E A;  1GQM A;  1K94 A;  2CBL A;  3BXK A;  4FTG A;  1J7Q A;  2TN4 A;  1R6P A;  1AHR A;  1UP5 A;  1F8H A;  2ISD A;  1CNP A;  4HSZ A;  1OZS A;  1A03 A;  2CTN A;  5CSN A;  1KQV A;  4QJ4 B;  2COL B;  3TDU A;  2L51 A;  1K9P A;  1WLZ A;  1IQ3 A;  2FOT A;  1XFU O;  1BG1 A;  1ZFS A;  2K2A A;  1QX2 A;  2KFH A;  1DTL A;  4ICB A;  1OSA A;  1S26 D;  1SMG A;  2BCX A;  3SG7 A;  1MF8 B;  5HKY A;  1S6J A;  2EHB A;  2M8U A;  4PHJ A;  1YX7 A;  1SL8 A;  2LHI A;  4MZL A;  4QJ5 B;  4PAL A;  1RJV A;  2GGZ A;  4WQ2 A;  2KI6 C;  4JPZ B;  1TNX A;  2EGD A;  2F2P A;  1YUS A;  1QTX A;  1IKU A;  2AMI A;  2FCD A;  3I5H B;  1XFV O;  4GGN A;  2BE4 A;  2KQ6 A;  4N1F A;  1KCY A;  4I5K A;  3FS7 A;  1EH2 A;  2ZRT A;  2HF5 A;  2HQW A;  4CLN A;  1YRU B;  1AJ5 A;  3KF9 A;  3FWB A;  3OX6 A;  1UUR A;  1A29 A;  2QAC A;  2BE6 A;  2I18 A;  2WOR A;  1SCV A;  1K8U A;  4YGA A;  1J1E A;  1A2X A;  3DF0 B;  1AJ4 A;  5D69 A;  2WCF A;  1S6I A;  2NCO A;  1ALW A;  1UHI A;  2FCE A;  3EKJ A;  3WHU B;  4BY4 A;  1JBA A;  2MLF C;  2KYF A;  1M39 A;  2PAL A;  1KK7 Z;  4YGB B;  3MSE B;  3O4Y A;  5F6T A;  2LUC A;  1Q80 A;  2KDH A;  1QS7 A;  1BOD A;  4NDD A;  3KHE A;  2ZFD A;  3I5F C;  4QJ3 B;  1UUS A;  1J7P A;  1CDM A;  3RLZ A;  1G4Y R;  1KSO A;  1JF0 A;  1S5G Y;  4FQO A;  3TDZ A;  1C7V A;  1RTP 1;  1IWQ A;  5HKW A;  2SCP A;  1EXR A;  1NCX A;  2MHH A;  3K21 A;  1WRZ A;  3OP0 A;  1CFF A;  2KI4 C;  1EG3 A;  1Y6W A;  3VGO A;  1UHN A;  5B8I B;  1SYM A;  3AKB A;  2KFG A;  1CM4 A;  2LUX A;  1CKK A;  1DMO A;  2PMY A;  1B4C A;  4MN0 A;  2MBX A;  1QAT A;  5FYX A;  4GPL B;  4OVN F;  1B47 A;  4YGD B;  2K61 A;  5HKZ A;  2FJU B;  1KSM A;  5HLV A;  4PE4 A;  4PE7 A;  1KFX L;  1XFZ O;  1F4O A;  1QIV A;  4MEW A;  1YVH A;  1CFP A;  2KGR A;  1YX8 A;  2F33 A;  2LLS A;  2LV7 A;  3D0Y B;  5DKQ A;  2B1U A;  2ZND A;  1DGV A;  2JNX A;  1FI6 A;  2L5X B;  1HQV A;  2LAP A;  2WCE A;  1DJZ A;  1QX5 B;  2Y5I A;  1XFW O;  4YI8 A;  1LXF C;  2M49 B;  2M7N A;  1R2U A;  1BR1 B;  5KSZ A;  1CDP A;  2QPT A;  4GGF A;  1ZOT B;  3OHM B;  2JQ6 A;  2H61 A;  1TCO B;  1KK8 B;  1M63 B;  4OR9 B;  5I2Q A;  2KI4 B;  1DF0 B;  1MQ1 A;  1NIW A;  1DVI A;  1WRL A;  2BKH B;  4BY5 A;  1GGW A;  2DOQ A;  1NYA A;  4PE1 A;  4L9M A;  3D0Y A;  1TOP A;  5ER5 A;  1LIN A;  1K9U A;  1AVS A;  1A4P A;  2Y1M A;  2OS8 C;  5G08 A;  1CFC A;  1KK7 Y;  1JSA A;  1X02 A;  3I5G C;  1U5I B;  4GFT A;  4DCK A;  3SIB A;  4C0L A;  2LVJ A;  1SCM C;  1CLM A;  1N2D A;  1H4B A;  2H2K A;  5KTY A;  1FF1 A;  3NSO A;  1WDC C;  1DF0 A;  1ZMZ A;  4PHM A;  4YRU A;  2M1K B;  4GAO A;  2MJW B;  1B8C A;  2MA2 A;  1SRA A;  1UHH A;  3LK0 A;  5JJG A;  1MUX A;  2KGB C;  1XK4 C;  2F8P A;  2IS9 A;  4MSP A;  4F0Z B;  2LAN A;  1NP8 A;  1PSB A;  2HET A;  1L7Z A;  1C7W A;  2L0P A;  1K93 D;  3BOW B;  2MRD A;  1MR8 A;  3O6B A;  2PVB A;  2LMV A;  2M0R A;  1U5I A;  1YUR A;  1DJG A;  4MRY A;  2KAX A;  2P6B B;  3SG4 A;  2SAS A;  2JPT A;  2I94 A;  4HRH A;  4XYN A;  3RM1 A;  3SG2 A;  4D1E A;  3EK7 A;  5I2O A;  2O5G A;  3I5G B;  3PFV A;  1CDN A;  2WOS A;  2EC6 C;  1EL4 A;  2AUC A;  5HYD A;  2JT0 A;  2PRU A;  1F4Q A;  5DKR A;  5GQQ C;  2NZ0 A;  3BOW A;  1Y1A A;  2JUL A;  4ORC B;  1WDC B;  3IQQ A;  1N0Y A;  3BYA A;  3OB2 B;  1OMV A;  2K2F A;  5AEQ A;  2M97 A;  1MWN A;  1Y1U A;  1BR4 B;  3CGA A;  4C0K A;  2PSR A;  1JUO A;  1KFX S;  1PSR A;  2VRG A;  2L98 A;  4CID A;  1XA5 A;  2BBN A;  4MLW A;  1F54 A;  1KFU L;  1BT6 A;  1RRO A;  3JVT C;  2L4I A;  1N65 A;  2K7O A;  1KQM C;  1QVI Z;  4DIR A;  2GV5 A;  4DRW A;  1IJ5 A;  4PHK A;  3H4S E;  1WRK A;  3EK8 A;  3SG5 A;  4ORB B;  1PVA A;  5K89 A;  1K2H A;  3BUW B;  4PHN A;  2JRF A;  3CZT X;  3DF0 A;  1J1D A;  3AAK A;  3VRQ A;  5ER4 X;  1F55 A;  1SKT A;  1G33 A;  2HQ8 A;  3IF7 A;  5BPJ A;  3WNX B;  1G8I A;  4CFR A;  1ALV A;  3JTD C;  3CR5 X;  1RFJ A;  1TCF A;  3D10 A;  2LLT A;  1RWY A;  3FWC A;  1BMO A;  1MXL C;  2CXJ A;  3SG6 A;  4YGE B;  2A4J A;  2NCP A;  1QAS A;  3TUY C;  2I2R E;  1J55 A;  4PDZ A;  5JOL A;  1S1E A;  4JWQ A;  2LVK A;  3ZWH A;  2R2I A;  5HLO A;  1MHO A;  5J3X A;  3BUN B;  2HPS A;  1MXE A;  2KHN A;  3BUO B;  1NX1 A;  1F71 A;  2MAZ A;  2PAS A;  1M46 A;  2BCB A;  1QV0 A;  2KBI A;  1B8L A;  1CB1 A;  1JFJ A;  3I5F B;  1OMD A;  1KQM B;  4GBA A;  3CS1 A;  4XJK B;  1AP4 A;  1OOJ A;  1B7T Z;  1TNP A;  1YTZ C;  4I5L B;  2KNE A;  1KWO C;  1QLK A;  4TNC A;  1SBJ A;  1EJ3 A;  3VRR A;  1B9A A;  1DJX A;  1LA3 A;  3LK1 A;  3PSR A;  3CWG A;  1BLQ A;  5TNC A;  2JWW A;  5AAN A;  1JFK A;  4MZJ A;  2ZNE A;  1C07 A;  1V1G A;  1Y0V H;  3JTD B;  2NXQ A;  1K95 A;  2BBM A;  1AUI B;  3ZNI A;  1DJH A;  1BJF A;  3TUY B;  1PUL A;  3VRP A;  4XJK A;  5DKN A;  3TS5 C;  2OPO A;  2G2B A;  2LC5 A;  3WHT B;  3EVU A;  3HX4 A;  2ZN9 A;  3A4U B;  1D1O A;  1EG4 A;  1QVI Y;  2WCB A;  1NX3 A;  4GUK A;  1OMR A;  2JOJ A;  2JXC A;  2M7L A;  1DGU A;  2BCA A;  3C1V A;  2ZN8 A;  3GK4 X;  4HRG A;  1NX2 A;  1KWO B;  1SW8 A;  1SR6 C;  4USL A;  1CLB A;  4YI9 A;  1A75 B;  3I5H C;  4I5N B;  2Q4U A;  4NDC A;  4A4C A;  1WY9 A;  1IJ6 A;  2WC8 A;  2LLU A;  2LVV A;  1K96 A;  2BEC A;  5AFP A;  1W7J B;  3EK4 A;  1GJY A;  1KFU S;  2K7B A;  3GK2 A;  4DS7 A;  1OQP A;  4ETO A;  1AK8 A;  3O78 A;  1J7O A;  3LLE A;  3PAT A;  1LKJ A;  1CFD A;  1QIW A;  3CTN A;  3CLN A;  2CCM A;  3EKH A;  1TNQ A;  1L2O C;  2JNF A;  3AAJ A;  1NPQ A;  1PVB A;  2F3Y A;  2LMT A;  1JWD A;  2KBM A;  3KO0 A;  4UPG A;  2OS8 B;  1IGV A;  3DVE A;  4MBE A;  1S6C A;  4MVF A;  2V53 A;  3PLF B;  5PAL A;  3TS5 B;  3F45 A;  1NUB A;  1FI5 A;  2JXL A;  1YUU A;  1CTR A;  2Y1N A;  1A75 A;  2WND A;  1QV1 A;  1YRT B;  3DVM A;  1BOC A;  2ZRS A;  1SCM B;  3GOF A;  3LL8 B;  4P2Y B;  2KFF A;  1B7T Y;  4P5O E;  4WRI A;  1VRK A;  1K9K A;  2KOT A;  1CDL A;  1PAL A;  1QX7 A;  1NCZ A;  4A4B A;  3I5I C;  3CR2 A;  1ZUZ A;  2JU0 A;  2K7D A;  1NCY A;  1SR6 B;  2L2E A;  3WXA A;  1YUT A;  2F2O A;  2KI6 D;  2LHL A;  1IQ5 A;  2BL0 C;  2CNP A;  2M29 A;  1SNL A;  2LMU A;  5I8N A;  4HRE E;  2G9B A;  2M9G A;  1UHJ A;  1W7I B;  3O2P A;  3BUX B;  1TRF A;  3KEV A;  1ZAC A;  2KQY A;  2KAV A;  4CFQ A;  3VRO A;  2K7C A;  4Q04 A;  1CLL A;  4ZCU A;  5IBW A;  1S36 A;  1ODB A;  1UHK A;  1LA0 A;  1UWO A;  1L2O B;  3HCM A;  1PK0 D;  1B1G A;  4GGF C;  2M1U A;  2BKI B;  5KU1 A;  1PRW A;  1YR5 A;  2H61 C;  1IG5 A;  1LVC D;  1SY9 A;  3KPX A;  4NDB A;  4ORA B;  2MLE C;  1DJY A;  3AKA A;  1XK4 A;  4M2O A;  2EC6 B; 
#chains in the Genus database with same CATH topology
 3DD4 A;  4C0J A;  1QXP A;  2KSP A;  2I7A A;  3SJS A;  3EVV A;  2Y4Q A;  1TN4 A;  4PT1 A;  2F3Z A;  2NLN A;  1TIZ A;  4MZK A;  5D7F A;  5AXI A;  1JC2 A;  2K8M B;  2AAO A;  2WCH A;  4JQ0 D;  2L50 A;  1Y1X A;  3BQ3 A;  3I5I B;  3VRN A;  3PN7 C;  4AQJ A;  3NXA A;  3E3R A;  5I94 A;  1QLS A;  2LNK A;  1E8A A;  2JC2 A;  2LVI A;  1HT9 A;  1OE9 B;  1XYD A;  3SIA A;  2BL0 B;  2JZI A;  3IVT A;  4PE0 A;  2KLD A;  4JKT A;  1BU3 A;  3M0W A;  3OB1 B;  1RK9 A;  3A8R A;  4CPV A;  4NQG A;  1H8B A;  1CMG A;  5I2L A;  1KK8 C;  2LCP A;  4OV2 A;  3S0F A;  3BFB A;  3DVJ A;  3JVT B;  2L4H A;  1FBV A;  1FW4 A;  1SL9 A;  1JF2 A;  3IQO A;  5CSF A;  1K90 D;  2RGI A;  4DUQ A;  4ZCV A;  1CMF A;  4M2Q A;  4N5X A;  1M45 A;  2OTG C;  2O60 A;  1DT7 B;  1OZO A;  2Q91 A;  4N1G A;  1XVJ A;  4OZD A;  4GNK B;  3OX5 A;  2ZKM X;  3QME A;  4AQI A;  5CSJ A;  2GGM A;  1J7R A;  2LM5 A;  1V1F A;  1OOG A;  4U8D A;  3DVK A;  2QEV A;  4MRX A;  1DJI A;  4M2P A;  2JT8 A;  4OKH A;  1TTX A;  3TDI A;  1B8R A;  1DJW A;  1SL7 A;  2K0J A;  3TZ1 A;  1GGZ A;  1REC A;  4OCI A;  5AER A;  1M31 A;  1NX0 A;  3PAL A;  1FPW A;  1XO5 A;  2E30 A;  2JTZ A;  1NWD A;  3N7H A;  1SK6 D;  3NSL A;  1BF5 A;  2CT9 A;  1CM1 A;  2LE9 B;  4WQ3 A;  4E68 A;  1Z2C B;  3PN7 B;  1IRJ A;  3NSI A;  4PCW A;  2JT3 A;  1XFY O;  1C3Y A;  1XFX O;  1YVL A;  4AOM A;  1IH0 A;  1WLM A;  2LP2 A;  1DC1 A;  2E6W A;  1QJT A;  3R72 A;  4YBH B;  3SG3 A;  2D8N A;  3FIA A;  4IL1 A;  2KAY A;  5CPV A;  1NSH A;  4FQT A;  3PM8 A;  1TNW A;  3GK1 A;  5CSI A;  1S3P A;  1F70 A;  2LP3 A;  3NSK A;  3LCP C;  1ORG A;  4I5J A;  2OTG B;  3R1O A;  1SPY A;  3EVR A;  4YGC B;  1C3Z A;  3CR4 X;  3ICB A;  2WC6 A;  1Z4H A;  2KYC A;  3BUM B;  3QRX A;  2M3W A;  2JTT A;  1S5G Z;  2K60 A;  4R1E A;  3DYE A;  1GQM A;  3B86 A;  1K94 A;  2CBL A;  3D76 A;  1JBA A;  3BXK A;  4FTG A;  1J7Q A;  1P28 A;  2TN4 A;  1R6P A;  1AHR A;  1UP5 A;  1F8H A;  2ISD A;  1CNP A;  4HSZ A;  1OZS A;  1A03 A;  2CTN A;  2P71 A;  5CSN A;  1KQV A;  4QJ4 B;  2COL B;  3TDU A;  2L51 A;  1K9P A;  1WLZ A;  1IQ3 A;  3L4L A;  2FOT A;  1XFU O;  1BG1 A;  1ZFS A;  2K2A A;  1QX2 A;  2KFH A;  1DEK A;  1DTL A;  4ICB A;  1OSA A;  1S26 D;  1SMG A;  2BCX A;  3B88 A;  3SG7 A;  1MF8 B;  5HKY A;  1S6J A;  2EHB A;  2QEO A;  2BAP A;  2M8U A;  4PHJ A;  1YX7 A;  1SL8 A;  2LHI A;  4MZL A;  4QJ5 B;  4PAL A;  1RJV A;  2GGZ A;  4WQ2 A;  4KYN A;  2KI6 C;  3OBV A;  4JPZ B;  1TNX A;  2EGD A;  2F2P A;  1YUS A;  3D74 A;  1QTX A;  3RZS A;  1IKU A;  2AMI A;  2FCD A;  3I5H B;  1XFV O;  4GGN A;  2BE4 A;  2KQ6 A;  4N1F A;  1KCY A;  4I5K A;  3FS7 A;  1EH2 A;  2ZRT A;  2HF5 A;  2HQW A;  5DIC A;  4CLN A;  3VB1 A;  1YRU B;  1AJ5 A;  3KF9 A;  1GM0 A;  3FWB A;  3OX6 A;  1UUR A;  1A29 A;  2QAC A;  2BE6 A;  2I18 A;  2WOR A;  1SCV A;  1K8U A;  4YGA A;  1J1E A;  2WC5 A;  1A2X A;  3Q8I A;  2WCL A;  3DF0 B;  1AJ4 A;  5D69 A;  2WCF A;  1S6I A;  2NCO A;  1ALW A;  1UHI A;  2FCE A;  3EKJ A;  3L4A A;  3WHU B;  4BY4 A;  2MLF C;  2KYF A;  1M39 A;  2PAL A;  1KK7 Z;  4YGB B;  3MSE B;  3O4Y A;  5F6T A;  2LUC A;  1Q80 A;  2KDH A;  1QS7 A;  1BOD A;  4NDD A;  3KHE A;  2ZFD A;  3I5F C;  5HL1 A;  3CZ2 A;  4QJ3 B;  1UUS A;  1J7P A;  4F7F A;  5EL2 A;  1CDM A;  3RLZ A;  1G4Y R;  1KSO A;  3FE9 A;  1JF0 A;  1S5G Y;  4FQO A;  3TDZ A;  1C7V A;  1RTP 1;  1IWQ A;  5HKW A;  2SCP A;  2FJY A;  1EXR A;  1NCX A;  1SSE B;  2MHH A;  3BJH A;  3K21 A;  1WRZ A;  3OP0 A;  3UO9 A;  1CFF A;  2KI4 C;  1EG3 A;  3CDN A;  1Y6W A;  3VGO A;  1UHN A;  5B8I B;  1SYM A;  3AKB A;  2KFG A;  1CM4 A;  2LUX A;  1CKK A;  1DMO A;  2PMY A;  1B4C A;  4MN0 A;  1OOI X;  2MBX A;  1QAT A;  5FYX A;  4GPL B;  4OVN F;  1B47 A;  4YGD B;  2K61 A;  5HKZ A;  2H8V A;  1W9Z A;  2FJU B;  1KSM A;  5HLV A;  4PE4 A;  4PE7 A;  1KFX L;  1XFZ O;  1F4O A;  1QIV A;  4MEW A;  1YVH A;  3B87 A;  1CFP A;  2KGR A;  1YX8 A;  2F33 A;  2LLS A;  2LV7 A;  3D77 A;  3D0Y B;  3D78 A;  5DKQ A;  4INW A;  2B1U A;  2ZND A;  1DGV A;  2JNX A;  3EG5 B;  1FI6 A;  3S0B A;  2L5X B;  1HQV A;  2LAP A;  2WCE A;  1DJZ A;  1QX5 B;  2Y5I A;  1XFW O;  4YI8 A;  1LXF C;  2M49 B;  2M7N A;  1R2U A;  1BR1 B;  5KSZ A;  1CDP A;  2QPT A;  4GGF A;  1ZOT B;  3DZT A;  2WCJ A;  2JQ6 A;  3OHM B;  4JD9 A;  2H61 A;  1TCO B;  1KK8 B;  1M63 B;  3O4X A;  4OR9 B;  5I2Q A;  2KI4 B;  1DF0 B;  1MQ1 A;  1NIW A;  1DVI A;  1WRL A;  2BKH B;  3S0E A;  4BY5 A;  1GGW A;  2BNX A;  2DOQ A;  1NYA A;  3SS5 A;  3CZ1 A;  4PE1 A;  4L9M A;  3D0Y A;  1TOP A;  2L2C A;  3BFH A;  5ER5 A;  1LIN A;  1K9U A;  1AVS A;  1A4P A;  2Y1M A;  2OS8 C;  3SS3 A;  1TWO A;  5G08 A;  1CFC A;  1KK7 Y;  1JSA A;  1X02 A;  3I5G C;  4INX A;  1U5I B;  4GFT A;  4DCK A;  3SIB A;  2ERB A;  4C0L A;  2LVJ A;  1SCM C;  1CLM A;  1N2D A;  1H4B A;  3NGV A;  2H2K A;  3PM2 A;  5KTY A;  1FF1 A;  3NSO A;  1WDC C;  1DF0 A;  1ZMZ A;  4PHM A;  4YRU A;  3CAB A;  2M1K B;  4GAO A;  2MJW B;  1B8C A;  2MA2 A;  1SRA A;  1UHH A;  1LS8 A;  3LK0 A;  5JJG A;  1MUX A;  2KGB C;  1XK4 C;  2F8P A;  2IS9 A;  4MSP A;  3V2L A;  4F0Z B;  2LAN A;  1NP8 A;  2PYQ A;  3UNW A;  1PSB A;  2HET A;  1L7Z A;  1C7W A;  2L0P A;  1K93 D;  3BOW B;  2MRD A;  1MR8 A;  3B6X A;  3O6B A;  2PVB A;  2LMV A;  2M0R A;  1U5I A;  1YUR A;  1DJG A;  4MRY A;  2KAX A;  2P6B B;  3SG4 A;  2SAS A;  2JPT A;  2I94 A;  4HRH A;  4XYN A;  3RM1 A;  3SG2 A;  3SS4 A;  4D1E A;  2KLE A;  3EK7 A;  5I2O A;  1XFR A;  2O5G A;  3I5G B;  3PFV A;  1CDN A;  2WOS A;  2EC6 C;  1EL4 A;  2AUC A;  5HYD A;  2JT0 A;  2PRU A;  1F4Q A;  5DKR A;  5GQQ C;  2NZ0 A;  3BOW A;  3L47 A;  1Y1A A;  2JUL A;  1TUJ A;  1WDC B;  4IJ7 A;  4ORC B;  2L5Y A;  3IQQ A;  1N0Y A;  3BYA A;  3OB2 B;  1OMV A;  2K2F A;  5AEQ A;  2M97 A;  1MWN A;  1Y1U A;  1BR4 B;  3CGA A;  1OW4 A;  4C0K A;  3S0A A;  2PSR A;  1JUO A;  1KFX S;  1PSR A;  2VRG A;  2L98 A;  4CID A;  1XA5 A;  2BBN A;  3CYZ A;  4MLW A;  1F54 A;  3FE8 A;  1KFU L;  1BT6 A;  1RRO A;  3JVT C;  3D73 A;  2L4I A;  1N65 A;  2K7O A;  1KQM C;  1QVI Z;  4DIR A;  2GV5 A;  4DRW A;  1IJ5 A;  2QEH A;  1TUZ A;  3H4S E;  4PHK A;  1WRK A;  3EK8 A;  3SG5 A;  3B7A A;  4ORB B;  1PVA A;  5K89 A;  1K2H A;  3BUW B;  4PHN A;  2JRF A;  3CZT X;  3DF0 A;  3R1P A;  1J1D A;  3AAK A;  3VRQ A;  5ER4 X;  1F55 A;  1SKT A;  1G33 A;  2HQ8 A;  3IF7 A;  5BPJ A;  3WNX B;  1G8I A;  4CFR A;  1ALV A;  3JTD C;  3CR5 X;  1RFJ A;  1TCF A;  3D10 A;  2LLT A;  1RWY A;  3FWC A;  1BMO A;  1MXL C;  2CXJ A;  3SG6 A;  4YGE B;  2KPH A;  2A4J A;  2NCP A;  1QAS A;  3TUY C;  2I2R E;  1J55 A;  4PDZ A;  5JOL A;  1S1E A;  4JWQ A;  2LVK A;  3PJI A;  2R2I A;  3ZWH A;  5HLO A;  1MHO A;  5J3X A;  3BUN B;  5FI7 A;  3NHI A;  2HPS A;  1MXE A;  2KHN A;  3BUO B;  1NX1 A;  1F71 A;  2MAZ A;  2PAS A;  1M46 A;  2BCB A;  1QV0 A;  2KBI A;  1B8L A;  1CB1 A;  1JFJ A;  3I5F B;  1OMD A;  1KQM B;  4GBA A;  3CS1 A;  4XJK B;  1AP4 A;  1OOJ A;  1B7T Z;  1TNP A;  1YTZ C;  4I5L B;  2KNE A;  1KWO C;  1DQE A;  1QLK A;  4TNC A;  1SBJ A;  3DY9 A;  3D75 A;  1EJ3 A;  3VRR A;  1B9A A;  1DJX A;  1LA3 A;  3LK1 A;  3PSR A;  3CWG A;  1BLQ A;  5TNC A;  2JWW A;  5AAN A;  1JFK A;  4MZJ A;  2ZNE A;  1C07 A;  1V1G A;  1Y0V H;  5D3O A;  3JTD B;  3S0G A;  2NXQ A;  1K95 A;  2BBM A;  1AUI B;  3ZNI A;  1DJH A;  1BJF A;  3TUY B;  1PUL A;  3VRP A;  4XJK A;  5DKN A;  3TS5 C;  3CZ0 A;  2OPO A;  1OOH A;  2G2B A;  2LC5 A;  3WHT B;  3EVU A;  3HX4 A;  2ZN9 A;  3A4U B;  1D1O A;  3R1V A;  1EG4 A;  1QVI Y;  2WCM A;  3S0D A;  2WCB A;  1NX3 A;  4GUK A;  1OMR A;  2JOJ A;  2JXC A;  2M7L A;  1DGU A;  2BCA A;  3C1V A;  1DEL A;  2ZN8 A;  3GK4 X;  4HRG A;  2P70 A;  1NX2 A;  1KWO B;  1SW8 A;  1SR6 C;  4USL A;  1CLB A;  4YI9 A;  1A75 B;  3I5H C;  4I5N B;  2Q4U A;  4NDC A;  2YGU A;  5FI2 A;  4A4C A;  1WY9 A;  1IJ6 A;  2WC8 A;  2LLU A;  2LVV A;  1K96 A;  2BEC A;  3NHT A;  5AFP A;  1W7J B;  3EK4 A;  1GJY A;  1KFU S;  2K7B A;  3DXL A;  3GK2 A;  1OQP A;  4DS7 A;  4ETO A;  1AK8 A;  3O78 A;  5FI6 A;  1J7O A;  3LLE A;  3PAT A;  1LKJ A;  1CFD A;  1QIW A;  3CTN A;  3CLN A;  2CCM A;  3EKH A;  1TNQ A;  2PQL A;  1L2O C;  2JNF A;  3AAJ A;  1NPQ A;  1PVB A;  2F3Y A;  2LMT A;  1JWD A;  2KBM A;  3KO0 A;  4UPG A;  2OS8 B;  1IGV A;  3DVE A;  4MBE A;  1S6C A;  4MVF A;  2V53 A;  3PLF B;  5PAL A;  3TS5 B;  3F45 A;  1T14 A;  1NUB A;  1FI5 A;  2GTE A;  2JXL A;  1YUU A;  1CTR A;  2Y1N A;  1A75 A;  2WND A;  1QV1 A;  1YRT B;  3DVM A;  3FE6 A;  2ZRS A;  1SCM B;  1BOC A;  1OOF A;  3GOF A;  3LL8 B;  4P2Y B;  2KFF A;  3OGN A;  1B7T Y;  4P5O E;  4WRI A;  1VRK A;  1K9K A;  2KOT A;  1CDL A;  1PAL A;  1QX7 A;  1NCZ A;  4A4B A;  3I5I C;  3CR2 A;  1ZUZ A;  2JU0 A;  2K7D A;  1NCY A;  1SR6 B;  2L2E A;  2JPO A;  1YUT A;  2F2O A;  2KI6 D;  2LHL A;  3WXA A;  1IQ5 A;  2BL0 C;  2CNP A;  2M29 A;  2QEB A;  3BFA A;  1SNL A;  3K1E A;  2LMU A;  5I8N A;  4HRE E;  2G9B A;  2M9G A;  1UHJ A;  1W7I B;  3O2P A;  3BUX B;  1TRF A;  3KEV A;  1QWV A;  1ZAC A;  2KQY A;  2KAV A;  2QDI A;  4CFQ A;  3VRO A;  2K7C A;  4Q04 A;  1CLL A;  4ZCU A;  5IBW A;  1S36 A;  1IIO A;  1ODB A;  1UHK A;  1LA0 A;  1UWO A;  1L2O B;  3HCM A;  1PK0 D;  2WCK A;  1B1G A;  4GGF C;  2M1U A;  2BKI B;  5KU1 A;  1PRW A;  1YR5 A;  2H61 C;  1IG5 A;  1LVC D;  1SY9 A;  3KPX A;  4NDB A;  4ORA B;  2MLE C;  1DJY A;  3AKA A;  1XK4 A;  4M2O A;  2EC6 B; 
#chains in the Genus database with same CATH homology
 3DD4 A;  4C0J A;  1QXP A;  2KSP A;  2I7A A;  3SJS A;  3EVV A;  2Y4Q A;  1TN4 A;  2F3Z A;  2NLN A;  1TIZ A;  4MZK A;  5D7F A;  5AXI A;  1JC2 A;  2K8M B;  2AAO A;  4JQ0 D;  2L50 A;  1Y1X A;  3BQ3 A;  3I5I B;  3VRN A;  3PN7 C;  4AQJ A;  3NXA A;  3E3R A;  1QLS A;  2LNK A;  1E8A A;  2JC2 A;  2LVI A;  1HT9 A;  1OE9 B;  1XYD A;  3SIA A;  2BL0 B;  2JZI A;  4PE0 A;  1BU3 A;  3M0W A;  3OB1 B;  1RK9 A;  3A8R A;  4CPV A;  4NQG A;  1H8B A;  1CMG A;  5I2L A;  1KK8 C;  2LCP A;  4OV2 A;  3DVJ A;  3JVT B;  2L4H A;  1FBV A;  1FW4 A;  1SL9 A;  1JF2 A;  3IQO A;  5CSF A;  1K90 D;  2RGI A;  4DUQ A;  4ZCV A;  1CMF A;  4M2Q A;  4N5X A;  1M45 A;  2OTG C;  2O60 A;  1DT7 B;  1OZO A;  2Q91 A;  4N1G A;  1XVJ A;  4GNK B;  3OX5 A;  2ZKM X;  4AQI A;  5CSJ A;  2GGM A;  1J7R A;  2LM5 A;  1V1F A;  4U8D A;  3DVK A;  4MRX A;  1DJI A;  4M2P A;  2JT8 A;  4OKH A;  1TTX A;  3TDI A;  1B8R A;  1DJW A;  1SL7 A;  2K0J A;  3TZ1 A;  1GGZ A;  1REC A;  4OCI A;  5AER A;  1M31 A;  1NX0 A;  3PAL A;  1FPW A;  1XO5 A;  2E30 A;  2JTZ A;  1NWD A;  1SK6 D;  3NSL A;  1BF5 A;  2CT9 A;  1CM1 A;  2LE9 B;  4WQ3 A;  4E68 A;  3PN7 B;  1IRJ A;  3NSI A;  4PCW A;  2JT3 A;  1XFY O;  1XFX O;  1YVL A;  4AOM A;  1IH0 A;  1WLM A;  2LP2 A;  2E6W A;  1QJT A;  4YBH B;  3SG3 A;  2D8N A;  3FIA A;  4IL1 A;  2KAY A;  5CPV A;  1NSH A;  3PM8 A;  1TNW A;  3GK1 A;  5CSI A;  1S3P A;  1F70 A;  2LP3 A;  3NSK A;  3LCP C;  4I5J A;  2OTG B;  1SPY A;  3EVR A;  4YGC B;  3CR4 X;  3ICB A;  2KYC A;  3BUM B;  3QRX A;  2M3W A;  2JTT A;  1S5G Z;  4R1E A;  1GQM A;  1K94 A;  2CBL A;  3BXK A;  4FTG A;  1J7Q A;  2TN4 A;  1R6P A;  1AHR A;  1UP5 A;  1F8H A;  2ISD A;  1CNP A;  4HSZ A;  1OZS A;  1A03 A;  2CTN A;  5CSN A;  1KQV A;  4QJ4 B;  2COL B;  3TDU A;  2L51 A;  1K9P A;  1WLZ A;  1IQ3 A;  2FOT A;  1XFU O;  1BG1 A;  1ZFS A;  2K2A A;  1QX2 A;  2KFH A;  1DTL A;  4ICB A;  1OSA A;  1S26 D;  1SMG A;  2BCX A;  3SG7 A;  1MF8 B;  5HKY A;  1S6J A;  2EHB A;  2M8U A;  4PHJ A;  1YX7 A;  1SL8 A;  2LHI A;  4MZL A;  4QJ5 B;  4PAL A;  1RJV A;  2GGZ A;  4WQ2 A;  2KI6 C;  4JPZ B;  1TNX A;  2EGD A;  2F2P A;  1YUS A;  1QTX A;  1IKU A;  2AMI A;  2FCD A;  3I5H B;  1XFV O;  4GGN A;  2BE4 A;  2KQ6 A;  4N1F A;  1KCY A;  4I5K A;  3FS7 A;  1EH2 A;  2ZRT A;  2HF5 A;  2HQW A;  4CLN A;  1YRU B;  1AJ5 A;  3KF9 A;  3FWB A;  3OX6 A;  1UUR A;  1A29 A;  2QAC A;  2BE6 A;  2I18 A;  2WOR A;  1SCV A;  1K8U A;  4YGA A;  1J1E A;  1A2X A;  3DF0 B;  1AJ4 A;  5D69 A;  2WCF A;  1S6I A;  2NCO A;  1ALW A;  1UHI A;  2FCE A;  3EKJ A;  3WHU B;  4BY4 A;  1JBA A;  2MLF C;  2KYF A;  1M39 A;  2PAL A;  1KK7 Z;  4YGB B;  3MSE B;  3O4Y A;  5F6T A;  2LUC A;  1Q80 A;  2KDH A;  1QS7 A;  1BOD A;  4NDD A;  3KHE A;  2ZFD A;  3I5F C;  4QJ3 B;  1UUS A;  1J7P A;  1CDM A;  3RLZ A;  1G4Y R;  1KSO A;  1JF0 A;  1S5G Y;  4FQO A;  3TDZ A;  1C7V A;  1RTP 1;  1IWQ A;  5HKW A;  2SCP A;  1EXR A;  1NCX A;  2MHH A;  3K21 A;  1WRZ A;  3OP0 A;  1CFF A;  2KI4 C;  1EG3 A;  1Y6W A;  3VGO A;  1UHN A;  5B8I B;  1SYM A;  3AKB A;  2KFG A;  1CM4 A;  2LUX A;  1CKK A;  1DMO A;  2PMY A;  1B4C A;  4MN0 A;  2MBX A;  1QAT A;  5FYX A;  4GPL B;  4OVN F;  1B47 A;  4YGD B;  2K61 A;  5HKZ A;  2FJU B;  1KSM A;  5HLV A;  4PE4 A;  4PE7 A;  1KFX L;  1XFZ O;  1F4O A;  1QIV A;  4MEW A;  1YVH A;  1CFP A;  2KGR A;  1YX8 A;  2F33 A;  2LLS A;  2LV7 A;  3D0Y B;  5DKQ A;  2B1U A;  2ZND A;  1DGV A;  2JNX A;  1FI6 A;  2L5X B;  1HQV A;  2LAP A;  2WCE A;  1DJZ A;  1QX5 B;  2Y5I A;  1XFW O;  4YI8 A;  1LXF C;  2M49 B;  2M7N A;  1R2U A;  1BR1 B;  5KSZ A;  1CDP A;  2QPT A;  4GGF A;  1ZOT B;  3OHM B;  2JQ6 A;  2H61 A;  1TCO B;  1KK8 B;  1M63 B;  4OR9 B;  5I2Q A;  2KI4 B;  1DF0 B;  1MQ1 A;  1NIW A;  1DVI A;  1WRL A;  2BKH B;  4BY5 A;  1GGW A;  2DOQ A;  1NYA A;  4PE1 A;  4L9M A;  3D0Y A;  1TOP A;  5ER5 A;  1LIN A;  1K9U A;  1AVS A;  1A4P A;  2Y1M A;  2OS8 C;  5G08 A;  1CFC A;  1KK7 Y;  1JSA A;  1X02 A;  3I5G C;  1U5I B;  4GFT A;  4DCK A;  3SIB A;  4C0L A;  2LVJ A;  1SCM C;  1CLM A;  1N2D A;  1H4B A;  2H2K A;  5KTY A;  1FF1 A;  3NSO A;  1WDC C;  1DF0 A;  1ZMZ A;  4PHM A;  4YRU A;  2M1K B;  4GAO A;  2MJW B;  1B8C A;  2MA2 A;  1SRA A;  1UHH A;  3LK0 A;  5JJG A;  1MUX A;  2KGB C;  1XK4 C;  2F8P A;  2IS9 A;  4MSP A;  4F0Z B;  2LAN A;  1NP8 A;  1PSB A;  2HET A;  1L7Z A;  1C7W A;  2L0P A;  1K93 D;  3BOW B;  2MRD A;  1MR8 A;  3O6B A;  2PVB A;  2LMV A;  2M0R A;  1U5I A;  1YUR A;  1DJG A;  4MRY A;  2KAX A;  2P6B B;  3SG4 A;  2SAS A;  2JPT A;  2I94 A;  4HRH A;  4XYN A;  3RM1 A;  3SG2 A;  4D1E A;  3EK7 A;  5I2O A;  2O5G A;  3I5G B;  3PFV A;  1CDN A;  2WOS A;  2EC6 C;  1EL4 A;  2AUC A;  5HYD A;  2JT0 A;  2PRU A;  1F4Q A;  5DKR A;  5GQQ C;  2NZ0 A;  3BOW A;  1Y1A A;  2JUL A;  4ORC B;  1WDC B;  3IQQ A;  1N0Y A;  3BYA A;  3OB2 B;  1OMV A;  2K2F A;  5AEQ A;  2M97 A;  1MWN A;  1Y1U A;  1BR4 B;  3CGA A;  4C0K A;  2PSR A;  1JUO A;  1KFX S;  1PSR A;  2VRG A;  2L98 A;  4CID A;  1XA5 A;  2BBN A;  4MLW A;  1F54 A;  1KFU L;  1BT6 A;  1RRO A;  3JVT C;  2L4I A;  1N65 A;  2K7O A;  1KQM C;  1QVI Z;  4DIR A;  2GV5 A;  4DRW A;  1IJ5 A;  4PHK A;  3H4S E;  1WRK A;  3EK8 A;  3SG5 A;  4ORB B;  1PVA A;  5K89 A;  1K2H A;  3BUW B;  4PHN A;  2JRF A;  3CZT X;  3DF0 A;  1J1D A;  3AAK A;  3VRQ A;  5ER4 X;  1F55 A;  1SKT A;  1G33 A;  2HQ8 A;  3IF7 A;  5BPJ A;  3WNX B;  1G8I A;  4CFR A;  1ALV A;  3JTD C;  3CR5 X;  1RFJ A;  1TCF A;  3D10 A;  2LLT A;  1RWY A;  3FWC A;  1BMO A;  1MXL C;  2CXJ A;  3SG6 A;  4YGE B;  2A4J A;  2NCP A;  1QAS A;  3TUY C;  2I2R E;  1J55 A;  4PDZ A;  5JOL A;  1S1E A;  4JWQ A;  2LVK A;  3ZWH A;  2R2I A;  5HLO A;  1MHO A;  5J3X A;  3BUN B;  2HPS A;  1MXE A;  2KHN A;  3BUO B;  1NX1 A;  1F71 A;  2MAZ A;  2PAS A;  1M46 A;  2BCB A;  1QV0 A;  2KBI A;  1B8L A;  1CB1 A;  1JFJ A;  3I5F B;  1OMD A;  1KQM B;  4GBA A;  3CS1 A;  4XJK B;  1AP4 A;  1OOJ A;  1B7T Z;  1TNP A;  1YTZ C;  4I5L B;  2KNE A;  1KWO C;  1QLK A;  4TNC A;  1SBJ A;  1EJ3 A;  3VRR A;  1B9A A;  1DJX A;  1LA3 A;  3LK1 A;  3PSR A;  3CWG A;  1BLQ A;  5TNC A;  2JWW A;  5AAN A;  1JFK A;  4MZJ A;  2ZNE A;  1C07 A;  1V1G A;  1Y0V H;  3JTD B;  2NXQ A;  1K95 A;  2BBM A;  1AUI B;  3ZNI A;  1DJH A;  1BJF A;  3TUY B;  1PUL A;  3VRP A;  4XJK A;  5DKN A;  3TS5 C;  2OPO A;  2G2B A;  2LC5 A;  3WHT B;  3EVU A;  3HX4 A;  2ZN9 A;  3A4U B;  1D1O A;  1EG4 A;  1QVI Y;  2WCB A;  1NX3 A;  4GUK A;  1OMR A;  2JOJ A;  2JXC A;  2M7L A;  1DGU A;  2BCA A;  3C1V A;  2ZN8 A;  3GK4 X;  4HRG A;  1NX2 A;  1KWO B;  1SW8 A;  1SR6 C;  4USL A;  1CLB A;  4YI9 A;  1A75 B;  3I5H C;  4I5N B;  2Q4U A;  4NDC A;  4A4C A;  1WY9 A;  1IJ6 A;  2WC8 A;  2LLU A;  2LVV A;  1K96 A;  2BEC A;  5AFP A;  1W7J B;  3EK4 A;  1GJY A;  1KFU S;  2K7B A;  3GK2 A;  4DS7 A;  1OQP A;  4ETO A;  1AK8 A;  3O78 A;  1J7O A;  3LLE A;  3PAT A;  1LKJ A;  1CFD A;  1QIW A;  3CTN A;  3CLN A;  2CCM A;  3EKH A;  1TNQ A;  1L2O C;  2JNF A;  3AAJ A;  1NPQ A;  1PVB A;  2F3Y A;  2LMT A;  1JWD A;  2KBM A;  3KO0 A;  4UPG A;  2OS8 B;  1IGV A;  3DVE A;  4MBE A;  1S6C A;  4MVF A;  2V53 A;  3PLF B;  5PAL A;  3TS5 B;  3F45 A;  1NUB A;  1FI5 A;  2JXL A;  1YUU A;  1CTR A;  2Y1N A;  1A75 A;  2WND A;  1QV1 A;  1YRT B;  3DVM A;  1BOC A;  2ZRS A;  1SCM B;  3GOF A;  3LL8 B;  4P2Y B;  2KFF A;  1B7T Y;  4P5O E;  4WRI A;  1VRK A;  1K9K A;  2KOT A;  1CDL A;  1PAL A;  1QX7 A;  1NCZ A;  4A4B A;  3I5I C;  3CR2 A;  1ZUZ A;  2JU0 A;  2K7D A;  1NCY A;  1SR6 B;  2L2E A;  3WXA A;  1YUT A;  2F2O A;  2KI6 D;  2LHL A;  1IQ5 A;  2BL0 C;  2CNP A;  2M29 A;  1SNL A;  2LMU A;  5I8N A;  4HRE E;  2G9B A;  2M9G A;  1UHJ A;  1W7I B;  3O2P A;  3BUX B;  1TRF A;  3KEV A;  1ZAC A;  2KQY A;  2KAV A;  4CFQ A;  3VRO A;  2K7C A;  4Q04 A;  1CLL A;  4ZCU A;  5IBW A;  1S36 A;  1ODB A;  1UHK A;  1LA0 A;  1UWO A;  1L2O B;  3HCM A;  1PK0 D;  1B1G A;  4GGF C;  2M1U A;  2BKI B;  5KU1 A;  1PRW A;  1YR5 A;  2H61 C;  1IG5 A;  1LVC D;  1SY9 A;  3KPX A;  4NDB A;  4ORA B;  2MLE C;  1DJY A;  3AKA A;  1XK4 A;  4M2O A;  2EC6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...