3OX5A

Crystal structure of the calcium sensor calcium-binding protein 1 (cabp1)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
153
Chain Sequence
MDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Calcium-binding protein 1
publication title Structural Basis for the Differential Effects of CaBP1 and Calmodulin on Ca(V)1.2 Calcium-Dependent Inactivation.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ox5A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ox5A02
1TTXA 2O60A 2JC2A 1UHIA 1NPQA 3C1VA 3DVKA 1JFKA 4ICBA 4PHJA 3ZNIA 1AK8A 2MLEC 2BBNA 4M2QA 1TOPA 1CLMA 1GGWA 1SYMA 5DKNA 4YGCB 2LP2A 3OX5A 1BR1B 4XJKA 1A2XA 1KK7Z 1YRTB 3LCPC 4MN0A 3VRNA 2BE6A 1YTZC 2L50A 2KAYA 1UHJA 5HKYA 2MAZA 5CPVA 3RM1A 2K2AA 3D0YB 4CLNA 1RWYA 2JU0A 2KQ6A 1ZUZA 4GBAA 2RGIA 1NUBA 2IS9A 3GK4X 4P2YB 2LLTA 1CDLA 1WRKA 1JFJA 1LINA 1QLKA 4BY4A 1XYDA 3WXAA 3I5GC 1F8HA 3IF7A 1TRFA 2JTTA 1TCOB 4UPGA 3BOWA 3JTDB 3WHUB 1EG4A 2H61A 2L98A 4I5LB 1TN4A 1KFUL 5DKRA 1NSHA 1F70A 3EKJA 1UHKA 3DF0B 1AP4A 2KNEA 1IKUA 3JVTB 2LVKA 1CFPA 3EKHA 4DUQA 1QLSA 4ORBB 2ZKMX 1TNXA 3I5FB 3HCMA 1B4CA 1IJ5A 4ORAB 3PSRA 2KHNA 2LMTA 3OP0A 1Y1UA 5CSJA 5HYDA 1S6JA 1SCMB 2E6WA 3VRQA 2M49B 2BKIB 1A75A 1XA5A 1EG3A 1S3PA 1V1GA 5HLVA 1QATA 2M0RA 3VGOA 4FQOA 1XK4A 5F6TA 2Y4QA 2ZRSA 2HPSA 1RTP1 1CTRA 2E30A 1J7PA 1QASA 2Q4UA 4A4BA 1K96A 1K9UA 1J7QA 4NDDA 1KK8C 4YGEB 1K90D 1PRWA 1QVIZ 2I7AA 3EVUA 4L9MA 1U5IA 4YRUA 2SCPA 4MEWA 3I5IC 1SY9A 4MSPA 3O4YA 4Q04A 2PMYA 1G4YR 1QJTA 3PN7B 1S36A 2Y1NA 2K61A 1R6PA 3SG3A 2BL0B 2MJWB 1KCYA 2BE4A 3O6BA 2KSPA 3DVJA 2ISDA 4N1FA 5G08A 2COLB 3LL8B 1LKJA 2PALA 2I18A 1WDCB 1JF2A 4C0LA 1DVIA 1LA3A 1NX3A 1WY9A 2F3YA 5AERA 3TS5C 1BR4B 2HQ8A 3E3RA 3M0WA 4HREE 1K2HA 1KQMC 4PE1A 1FI5A 1MXLC 1F4QA 3CWGA 3OB2B 1FI6A 4R1EA 1M45A 1F55A 1AJ5A 2WCEA 4I5JA 4WQ2A 1DJYA 3MSEB 4PE4A 4JQ0D 1M39A 3CR5X 5D69A 3FS7A 1IWQA 1KWOB 3KPXA 1XFYO 2EHBA 4M2OA 1OSAA 4PE0A 1DF0B 2JT3A 2KI4C 2BKHB 4ZCUA 4OR9B 3BUOB 1XVJA 2H2KA 1ALWA 1VRKA 5AANA 2MA2A 3BUWB 2L4IA 4NQGA 2LANA 5J3XA 1LVCD 1RROA 2SASA 3RLZA 4AQJA 2V53A 4WQ3A 1NX0A 1K8UA 1SRAA 2HETA 3KF9A 2JPTA 1R2UA 1EXRA 2FCEA 2I94A 1JF0A 2LMVA 2WCFA 2TN4A 1KFUS 4MBEA 1DJHA 2CCMA 1CFDA 3SG2A 3VROA 1WLMA 1SPYA 1OZOA 2F3ZA 2JWWA 4MZLA 1BLQA 3BUXB 4GUKA 5BPJA 1S5GY 2BCAA 2JQ6A 2BBMA 2PVBA 4FTGA 1RECA 1DMOA 1J55A 2KFFA 1UURA 3BUNB 3VRRA 1DJWA 1A29A 4GNKB 5HLOA 1K95A 2ZN8A 1UHNA 1QS7A 1DJZA 5KU1A 4YGDB 1B8LA 1TCFA 2JOJA 3LLEA 3NSKA 2JTZA 4QJ5B 1W7JB 1KSMA 2K0JA 4XYNA 1WRLA 2Q91A 1B8CA 2LVJA 1SCVA 1JWDA 2ZNEA 2Y1MA 1OQPA 2LE9B 4QJ3B 2MBXA 3LK0A 3FWBA 1A03A 4F0ZB 1PALA 1L7ZA 1D1OA 4E68A 4PCWA 3SG7A 5I2OA 1B47A 4HRHA 1CMGA 1C7VA 4PHKA 2JT0A 3SG6A 1BODA 5D7FA 1J1DA 1NYAA 2LVIA 4CFRA 1QV0A 3I5FC 3K21A 2NXQA 2JXLA 2M3WA 1CNPA 2ZNDA 2F2PA 2LM5A 1CLLA 1M63B 2CNPA 2LCPA 1SCMC 2OPOA 1QV1A 2A4JA 3I5HB 4N1GA 2I2RE 3AKBA 1IQ3A 2PASA 1JBAA 2MRDA 2AAOA 4NDBA 1DJIA 1CDMA 1AVSA 1XFUO 2M1KB 1AUIB 4XJKB 1YVHA 1G33A 4YI8A 1DT7B 3O2PA 1K93D 1FW4A 3KEVA 3NSIA 1GJYA 2LP3A 4HSZA 4I5KA 1BJFA 4MRYA 4MVFA 1G8IA 4DIRA 1PVAA 1QXPA 2LUXA 1B8RA 1J7OA 1OMVA 2JT8A 5HKWA 3EVVA 2K7BA 1H4BA 4AQIA 1YVLA 1YUUA 4MZJA 2EC6B 3A8RA 4DS7A 3PN7C 1FPWA 1N65A 3BOWB 1GQMA 1EJ3A 2KAXA 2OTGB 1OMRA 2PSRA 2BL0C 2LVVA 2HQWA 2CT9A 2KGRA 3QRXA 4GGNA 4ETOA 1JC2A 1K9KA 1WDCC 4PDZA 5I2QA 1FF1A 3AKAA 2CBLA 4GGFC 1QX2A 3PM8A 1XFZO 2K8MB 3EK7A 1DTLA 2F8PA 4IL1A 1XFWO 2CXJA 2FCDA 3GOFA 2M1UA 2F33A 1EL4A 2P6BB 3BYAA 5HKZA 1ZOTB 4BY5A 2KAVA 4P5OE 1B9AA 2NZ0A 2F2OA 1X02A 1PVBA 3TUYB 1F54A 1A75B 1IG5A 1TIZA 2K7CA 5ER5A 1HQVA 1KWOC 1H8BA 1NP8A 2KBIA 1Y1XA 3BXKA 1OZSA 3CGAA 1MWNA 1OOJA 2JULA 1IGVA 1S26D 4N5XA 1L2OB 1V1FA 2LHLA 1IQ5A 4JPZB 1YUSA 2AUCA 1U5IB 3LK1A 4NDCA 1SKTA 5CSIA 1NCYA 1CFCA 2KGBC 2PRUA 4DRWA 1B7TY 1KQMB 1J1EA 1OE9B 2AMIA 1CM4A 4C0JA 3WHTB 2EGDA 1QX5B 2OS8B 2K7OA 4YGBB 3D0YA 1LXFC 4U8DA 3VRPA 2LHIA 2GGMA 3AAJA 5GQQC 1CKKA 1CM1A 2QACA 2KI6D 1S5GZ 1K9PA 2LC5A 3H4SE 1DGVA 1MUXA 1TNWA 1QIVA 3D10A 1SK6D 1B1GA 4ORCB 1KFXL 4DCKA 4TNCA 1CDNA 1RJVA 3SG5A 3ZWHA 4I5NB 3CR4X 1MR8A 1FBVA 1SR6B 1SBJA 1YR5A 1Y1AA 1SMGA 3DF0A 1UHHA 3IQOA 3PALA 2LAPA 1SL8A 4USLA 5CSFA 3PATA 1PSRA 1S1EA 2BCBA 1IH0A 4OKHA 1YURA 2QPTA 1S6CA 4GAOA 2KYFA 3JTDC 1C7WA 2NCOA 2FJUB 1NIWA 3CLNA 1LA0A 1XFVO 3CTNA 3DD4A 4ZCVA 5JOLA 5K89A 1PSBA 1KK7Y 3JVTC 1QTXA 2KOTA 4A4CA 1OMDA 2WORA 4OV2A 1BG1A 1K94A 2KFHA 5IBWA 3KHEA 1ZACA 4CIDA 5AFPA 1Q80A 2M9GA 2M29A 3SIAA 3I5HC 2JRFA 2MLFC 1IJ6A 3TZ1A 1M31A 3ICBA 4MZKA 3OX6A 1PULA 3IQQA 2M7NA 2KYCA 1KQVA 2KFGA 2FOTA 3I5GB 2WC8A 1AJ4A 3TDZA 1QIWA 1WLZA 2BECA 3CS1A 1SNLA 3EK8A 1YUTA 1M46A 2LMUA 2WOSA 3OB1B 1KSOA 2MHHA 2CTNA 3AAKA 4PHNA 1MHOA 2WCBA 1YX7A 4CFQA 5KSZA 2LLUA 2B1UA 4GGFA 2JZIA 4M2PA 1BOCA 1CFFA 2EC6C 4MLWA 1NX2A 3FWCA 1CLBA 4C0KA 4CPVA 2JXCA 1PK0D 2ZFDA 1NWDA 2OTGC 1ALVA 1UWOA 1A4PA 2H61C 1SL9A 2GGZA 1CMFA 3PLFB 5TNCA 1JUOA 4AOMA 2KI6C 5AEQA 1GGZA 2L4HA 3PFVA 3BUMB 2LNKA 1MXEA 1RK9A 3GK1A 3KO0A 1DF0A 3SG4A 1XO5A 2WNDA 4YBHB 2KQYA 2LLSA 1S6IA 2HF5A 2L5XB 4MRXA 1QVIY 1SW8A 2VRGA 2R2IA 1KK8B 1NCXA 1TNPA 5ER4X 3TUYC 1TNQA 1JSAA 1DGUA 1Y0VH 1BT6A 3GK2A 2ZN9A 1WRZA 1C07A 5DKQA 3I5IB 1XK4C 2K2FA 1KFXS 4GFTA 4D1EA 5KTYA 2NCPA 1F71A 2LV7A 1L2OC 1N2DA 3OHMB 2L51A 2K7DA 3WNXB 4HRGA 4YI9A 3TDUA 2Y5IA 1ZMZA 3EK4A 4JWQA 2L0PA 2L2EA 3NSLA 2M8UA 3NXAA 1EH2A 1SL7A 1E8AA 1NCZA 4OVNF 3F45A 2ZRTA 2D8NA 3O78A 3TS5B 2G2BA 1RFJA 2G9BA 3BQ3A 3DVEA 5JJGA 1BMOA 2M97A 1B7TZ 1HT9A 1XFXO 3CR2A 1AHRA 2OS8C 3HX4A 4GPLB 1BF5A 1W7IB 5I2LA 2KBMA 5CSNA 5PALA 1N0YA 1YRUB 2BCXA 3EVRA 1ZFSA 4QJ4B 2M7LA 2NLNA 1DJXA 3CZTX 2JNXA 3TDIA 1BU3A 2KI4B 1DJGA 1NX1A 1UUSA 1YX8A 3SIBA 2DOQA 5FYXA 2GV5A 1J7RA 1IRJA 1CDPA 1F4OA 1Y6WA 5AXIA 2LUCA 3DVMA 3NSOA 5B8IB 4WRIA 4PE7A 1SR6C 2JNFA 5I8NA 4YGAA 1MF8B 3SJSA 2O5GA 1CB1A 1UP5A 4OCIA 3A4UB 4PALA 3FIAA 2KDHA 1QX7A 4PHMA 1MQ1A 1ODBA
chains in the Genus database with same CATH superfamily
1TTXA 2O60A 2JC2A 1UHIA 1NPQA 3S0AA 3C1VA 3DVKA 1JFKA 4ICBA 4PHJA 3ZNIA 1AK8A 2MLEC 2BBNA 4M2QA 3D76A 1TOPA 1CLMA 1GGWA 4KYNA 3L4AA 2QEVA 1SYMA 5DKNA 3Q8IA 1TUJA 4YGCB 2LP2A 3OX5A 1BR1B 4XJKA 1A2XA 1KK7Z 1YRTB 3LCPC 4MN0A 3VRNA 2BE6A 1YTZC 2L50A 2KAYA 1UHJA 5HKYA 2MAZA 5CPVA 3RM1A 2K2AA 3D0YB 4CLNA 1RWYA 2JU0A 2KQ6A 1ZUZA 4GBAA 2RGIA 1NUBA 2IS9A 3GK4X 4P2YB 2LLTA 1CDLA 3R1VA 1SSEB 1WRKA 3D75A 1JFJA 1LINA 1QLKA 4BY4A 1XYDA 3WXAA 3DYEA 3I5GC 1F8HA 3IF7A 1W9ZA 1TRFA 2JTTA 1TCOB 4UPGA 5FI2A 3BOWA 3JTDB 3WHUB 1EG4A 2H61A 2L98A 4I5LB 1TN4A 1KFUL 5DKRA 1NSHA 1F70A 3EKJA 1UHKA 3DF0B 1AP4A 2BNXA 2KNEA 1IKUA 3JVTB 2LVKA 1CFPA 2WCHA 3EKHA 4DUQA 1QLSA 4ORBB 2ZKMX 1TNXA 3I5FB 3HCMA 1B4CA 1IJ5A 4ORAB 3CZ1A 2KHNA 3PSRA 2LMTA 3OP0A 1Y1UA 5CSJA 5HYDA 1S6JA 1SCMB 2E6WA 3VRQA 2M49B 2BKIB 1A75A 3B88A 1XA5A 1EG3A 1S3PA 1V1GA 3K1EA 5HLVA 1QATA 3N7HA 3SS5A 2M0RA 3VGOA 4FQOA 1XK4A 5F6TA 2Y4QA 2ZRSA 2HPSA 1RTP1 1CTRA 2E30A 1J7PA 1QASA 2Q4UA 4A4BA 1K96A 1K9UA 1J7QA 4NDDA 1KK8C 1T14A 1K90D 1PRWA 1QVIZ 2I7AA 3EVUA 4L9MA 1U5IA 4YGEB 4YRUA 2QEHA 2SCPA 4MEWA 3I5IC 1SY9A 3B87A 2H8VA 4MSPA 3O4YA 4Q04A 2PMYA 1G4YR 1QJTA 3PN7B 1S36A 2Y1NA 2K61A 1R6PA 3SG3A 2BL0B 2MJWB 1KCYA 2BE4A 3O6BA 2KSPA 3DVJA 2ISDA 4N1FA 5G08A 2COLB 3LL8B 1LKJA 2PALA 2I18A 1WDCB 1JF2A 4C0LA 3D74A 1ORGA 1DVIA 1LA3A 1NX3A 1WY9A 2F3YA 5AERA 3TS5C 1BR4B 2HQ8A 3E3RA 3M0WA 4HREE 1K2HA 1KQMC 2QEOA 4PE1A 1FI5A 1MXLC 1F4QA 3CWGA 3OB2B 1FI6A 4R1EA 1M45A 1F55A 1AJ5A 2WCEA 4I5JA 4WQ2A 1DJYA 3MSEB 4PE4A 4JQ0D 1M39A 3CR5X 5D69A 3FS7A 1IWQA 1KWOB 3KPXA 1XFYO 2EHBA 4M2OA 1OSAA 4PE0A 3R1PA 1DF0B 2KLDA 2JT3A 2KI4C 2BKHB 4ZCUA 4OR9B 3BUOB 1XVJA 2H2KA 1ALWA 2WC5A 1OOHA 1VRKA 5AANA 3D77A 2MA2A 3BUWB 2L4IA 3CYZA 4NQGA 2LANA 5J3XA 1LVCD 1RROA 2SASA 3RLZA 4AQJA 2V53A 4WQ3A 1NX0A 1K8UA 1SRAA 2HETA 3KF9A 2JPTA 1R2UA 1EXRA 1DEKA 2FCEA 2WCMA 2I94A 3NHIA 1JF0A 2LMVA 2WCFA 2TN4A 1KFUS 4MBEA 5FI7A 1DJHA 2CCMA 1CFDA 3SG2A 3VROA 1WLMA 1SPYA 1OZOA 2F3ZA 2JWWA 4MZLA 1BLQA 3BUXB 4GUKA 2BAPA 1S5GY 4FQTA 5BPJA 2BCAA 2JQ6A 2P70A 2QDIA 2BBMA 2PVBA 4FTGA 1RECA 1DMOA 1J55A 2KFFA 3BFHA 1UURA 3BUNB 3VRRA 1DJWA 1A29A 4GNKB 5HLOA 1K95A 2ZN8A 1UHNA 1QS7A 1DJZA 5KU1A 4YGDB 1B8LA 2FJYA 1TCFA 2JOJA 3CABA 3LLEA 3NSKA 2JTZA 4QJ5B 1W7JB 2JPOA 1KSMA 2K0JA 4XYNA 1WRLA 2Q91A 1B8CA 2ERBA 3DZTA 2LVJA 1SCVA 1JWDA 2ZNEA 2Y1MA 1OQPA 2LE9B 4QJ3B 2MBXA 3LK0A 3FWBA 3V2LA 1A03A 4F0ZB 1PALA 5FI6A 1L7ZA 1D1OA 4E68A 4PCWA 3SG7A 1OOFA 1B47A 4HRHA 5I2OA 1CMGA 1C7VA 2PYQA 4PHKA 2JT0A 3SG6A 3D78A 1BODA 5D7FA 1J1DA 1NYAA 2LVIA 4CFRA 1QV0A 3I5FC 3K21A 2NXQA 4F7FA 3DY9A 2JXLA 3CZ0A 2M3WA 3OBVA 1CNPA 2ZNDA 2F2PA 2LM5A 1CLLA 1M63B 2CNPA 2LCPA 1SCMC 2OPOA 1QV1A 2A4JA 3I5HB 4N1GA 2I2RE 3AKBA 1IQ3A 2PASA 1JBAA 3NHTA 2MRDA 2AAOA 4NDBA 3UO9A 1DJIA 1CDMA 1AVSA 1XFUO 2M1KB 1AUIB 3PJIA 4XJKB 1YVHA 1G33A 4YI8A 3BJHA 1DT7B 3O2PA 1K93D 1FW4A 3KEVA 3NSIA 1GJYA 2LP3A 4HSZA 4I5KA 1BJFA 4MRYA 4MVFA 1G8IA 4DIRA 1PVAA 1QXPA 2LUXA 1B8RA 1J7OA 1OMVA 3S0EA 2JT8A 5HKWA 3EVVA 2K7BA 3BFBA 1H4BA 3S0BA 4AQIA 1YVLA 1YUUA 4MZJA 2EC6B 3A8RA 3EG5B 4DS7A 3PN7C 2WCJA 1FPWA 3FE9A 1N65A 3BOWB 1GQMA 1EJ3A 2KAXA 2OTGB 1OMRA 2PSRA 2BL0C 2LVVA 4JD9A 2HQWA 2CT9A 2KGRA 3QRXA 4GGNA 4ETOA 1JC2A 1K9KA 1WDCC 4PDZA 5I2QA 1FF1A 3AKAA 2CBLA 4GGFC 1QX2A 3PM8A 1XFZO 2K8MB 2PQLA 3EK7A 1DTLA 2F8PA 4IL1A 1XFWO 2CXJA 3L47A 2FCDA 3GOFA 2M1UA 2F33A 1EL4A 2P6BB 3BYAA 5HKZA 1ZOTB 3UNWA 4BY5A 2KAVA 4P5OE 1B9AA 5D3OA 2NZ0A 2F2OA 1X02A 1PVBA 3TUYB 1F54A 1P28A 1A75B 1IG5A 1TIZA 2K7CA 5ER5A 1HQVA 1KWOC 1H8BA 1NP8A 2P71A 2KBIA 1Y1XA 3BXKA 1OZSA 3CGAA 1MWNA 3R72A 1OOJA 2JULA 2QEBA 1IGVA 1GM0A 1S26D 4N5XA 1L2OB 1V1FA 2LHLA 3B7AA 3CDNA 4JKTA 1IQ5A 4JPZB 1YUSA 2AUCA 1U5IB 3LK1A 4NDCA 1SKTA 2L2CA 5CSIA 1NCYA 1CFCA 2KGBC 2PRUA 4DRWA 1B7TY 1KQMB 4IJ7A 1J1EA 1OE9B 2AMIA 1Z4HA 1CM4A 1LS8A 4C0JA 3WHTB 2EGDA 1QX5B 2OS8B 2K7OA 4YGBB 3D0YA 1LXFC 4U8DA 3VRPA 2LHIA 2GGMA 3AAJA 5GQQC 1CKKA 1CM1A 2QACA 5EL2A 2KI6D 3IVTA 1S5GZ 1DELA 1K9PA 3L4LA 2LC5A 3H4SE 1DGVA 1MUXA 1QWVA 1TNWA 1QIVA 2L5YA 3D10A 1C3ZA 1SK6D 3FE8A 1B1GA 4ORCB 3PM2A 1KFXL 4DCKA 4TNCA 1CDNA 1RJVA 3SG5A 3ZWHA 4I5NB 3CR4X 1MR8A 1FBVA 1SR6B 1SBJA 1YR5A 1Y1AA 1SMGA 3DF0A 1UHHA 3IQOA 3PALA 2LAPA 1SL8A 4USLA 1OW4A 5CSFA 3PATA 1PSRA 1S1EA 2BCBA 5I94A 3VB1A 1IH0A 3OGNA 4OKHA 1YURA 2QPTA 1S6CA 4GAOA 2KYFA 3JTDC 1C7WA 2NCOA 2FJUB 2KPHA 1NIWA 3CLNA 1LA0A 1XFVO 3BFAA 3CTNA 3DD4A 4ZCVA 5JOLA 5K89A 1PSBA 1KK7Y 3JVTC 3S0GA 3SS3A 1QTXA 2KOTA 4A4CA 1OMDA 2WORA 4OV2A 3SS4A 1BG1A 1K94A 2KFHA 5IBWA 2YGUA 3KHEA 1ZACA 4CIDA 5AFPA 1Q80A 2M9GA 2M29A 3SIAA 3I5HC 3S0DA 2JRFA 2MLFC 1IJ6A 3TZ1A 1M31A 3ICBA 4MZKA 3D73A 1TUZA 3OX6A 1PULA 2WCKA 3IQQA 2M7NA 2KYCA 1KQVA 2KFGA 5HL1A 2FOTA 3I5GB 2WC8A 3R1OA 1AJ4A 2WCLA 3TDZA 1QIWA 1WLZA 2BECA 3CS1A 1SNLA 3EK8A 1YUTA 1M46A 2LMUA 2WOSA 3OB1B 1KSOA 2MHHA 2CTNA 3AAKA 4PHNA 1MHOA 2WCBA 1YX7A 4CFQA 5KSZA 2LLUA 2B1UA 4GGFA 2JZIA 4M2PA 1IIOA 1BOCA 1CFFA 2EC6C 4MLWA 1NX2A 3FWCA 1CLBA 4C0KA 4CPVA 2JXCA 1PK0D 2ZFDA 1NWDA 2OTGC 1ALVA 1UWOA 1A4PA 2H61C 1SL9A 2GGZA 1CMFA 3CZ2A 3PLFB 5TNCA 1JUOA 4AOMA 2KI6C 5AEQA 1GGZA 2L4HA 2GTEA 3BUMB 3PFVA 2LNKA 1MXEA 1RK9A 3GK1A 3QMEA 3KO0A 1C3YA 1DC1A 1DF0A 3SG4A 1XO5A 2WNDA 4YBHB 2KQYA 2K60A 2LLSA 1S6IA 2HF5A 2L5XB 3O4XA 4MRXA 1QVIY 1SW8A 2VRGA 2R2IA 1KK8B 1NCXA 1TNPA 5ER4X 3TUYC 1TNQA 4PT1A 1JSAA 1DGUA 1Y0VH 1BT6A 3GK2A 2ZN9A 4INXA 1WRZA 1C07A 5DKQA 3I5IB 1XK4C 2K2FA 1KFXS 4GFTA 4D1EA 5KTYA 1TWOA 2NCPA 1F71A 2LV7A 3RZSA 4OZDA 1L2OC 1N2DA 3OHMB 2L51A 2K7DA 3WNXB 4HRGA 4YI9A 3TDUA 2Y5IA 1ZMZA 3EK4A 4JWQA 2L0PA 2L2EA 3NSLA 2M8UA 3S0FA 1OOGA 3NXAA 1EH2A 1SL7A 1E8AA 1NCZA 4OVNF 3F45A 2ZRTA 2D8NA 3O78A 3TS5B 2G2BA 1RFJA 2G9BA 3BQ3A 3DVEA 5JJGA 1BMOA 1XFRA 2M97A 1B7TZ 1HT9A 1XFXO 3NGVA 2WC6A 3CR2A 1AHRA 2OS8C 3HX4A 4GPLB 1BF5A 1W7IB 5I2LA 2KBMA 5CSNA 5PALA 1N0YA 1YRUB 1Z2CB 2BCXA 3FE6A 3EVRA 1OOIX 1ZFSA 4QJ4B 2M7LA 2NLNA 1DJXA 3CZTX 2JNXA 3B86A 1BU3A 3TDIA 5DICA 2KI4B 1DJGA 1NX1A 1DQEA 1UUSA 1YX8A 3SIBA 2DOQA 5FYXA 2GV5A 1J7RA 1IRJA 1CDPA 1F4OA 1Y6WA 3DXLA 2LUCA 3DVMA 5AXIA 2KLEA 3NSOA 5B8IB 4WRIA 4PE7A 1SR6C 2JNFA 5I8NA 4YGAA 1MF8B 3SJSA 2O5GA 1CB1A 1UP5A 4INWA 4OCIA 3A4UB 4PALA 3FIAA 2KDHA 3B6XA 1QX7A 4PHMA 1MQ1A 1ODBA
chains in the Genus database with same CATH topology
1TTXA 2O60A 2JC2A 1UHIA 1NPQA 3C1VA 3DVKA 1JFKA 4ICBA 4PHJA 3ZNIA 1AK8A 2MLEC 2BBNA 4M2QA 1TOPA 1CLMA 1GGWA 1SYMA 5DKNA 4YGCB 2LP2A 3OX5A 1BR1B 4XJKA 1A2XA 1KK7Z 1YRTB 3LCPC 4MN0A 3VRNA 2BE6A 1YTZC 2L50A 2KAYA 1UHJA 5HKYA 2MAZA 5CPVA 3RM1A 2K2AA 3D0YB 4CLNA 1RWYA 2JU0A 2KQ6A 1ZUZA 4GBAA 2RGIA 1NUBA 2IS9A 3GK4X 4P2YB 2LLTA 1CDLA 1WRKA 1JFJA 1LINA 1QLKA 4BY4A 1XYDA 3WXAA 3I5GC 1F8HA 3IF7A 1TRFA 2JTTA 1TCOB 4UPGA 3BOWA 3JTDB 3WHUB 1EG4A 2H61A 2L98A 4I5LB 1TN4A 1KFUL 5DKRA 1NSHA 1F70A 3EKJA 1UHKA 3DF0B 1AP4A 2KNEA 1IKUA 3JVTB 2LVKA 1CFPA 3EKHA 4DUQA 1QLSA 4ORBB 2ZKMX 1TNXA 3I5FB 3HCMA 1B4CA 1IJ5A 4ORAB 3PSRA 2KHNA 2LMTA 3OP0A 1Y1UA 5CSJA 5HYDA 1S6JA 1SCMB 2E6WA 3VRQA 2M49B 2BKIB 1A75A 1XA5A 1EG3A 1S3PA 1V1GA 5HLVA 1QATA 2M0RA 3VGOA 4FQOA 1XK4A 5F6TA 2Y4QA 2ZRSA 2HPSA 1RTP1 1CTRA 2E30A 1J7PA 1QASA 2Q4UA 4A4BA 1K96A 1K9UA 1J7QA 4NDDA 1KK8C 4YGEB 1K90D 1PRWA 1QVIZ 2I7AA 3EVUA 4L9MA 1U5IA 4YRUA 2SCPA 4MEWA 3I5IC 1SY9A 4MSPA 3O4YA 4Q04A 2PMYA 1G4YR 1QJTA 3PN7B 1S36A 2Y1NA 2K61A 1R6PA 3SG3A 2BL0B 2MJWB 1KCYA 2BE4A 3O6BA 2KSPA 3DVJA 2ISDA 4N1FA 5G08A 2COLB 3LL8B 1LKJA 2PALA 2I18A 1WDCB 1JF2A 4C0LA 1DVIA 1LA3A 1NX3A 1WY9A 2F3YA 5AERA 3TS5C 1BR4B 2HQ8A 3E3RA 3M0WA 4HREE 1K2HA 1KQMC 4PE1A 1FI5A 1MXLC 1F4QA 3CWGA 3OB2B 1FI6A 4R1EA 1M45A 1F55A 1AJ5A 2WCEA 4I5JA 4WQ2A 1DJYA 3MSEB 4PE4A 4JQ0D 1M39A 3CR5X 5D69A 3FS7A 1IWQA 1KWOB 3KPXA 1XFYO 2EHBA 4M2OA 1OSAA 4PE0A 1DF0B 2JT3A 2KI4C 2BKHB 4ZCUA 4OR9B 3BUOB 1XVJA 2H2KA 1ALWA 1VRKA 5AANA 2MA2A 3BUWB 2L4IA 4NQGA 2LANA 5J3XA 1LVCD 1RROA 2SASA 3RLZA 4AQJA 2V53A 4WQ3A 1NX0A 1K8UA 1SRAA 2HETA 3KF9A 2JPTA 1R2UA 1EXRA 2FCEA 2I94A 1JF0A 2LMVA 2WCFA 2TN4A 1KFUS 4MBEA 1DJHA 2CCMA 1CFDA 3SG2A 3VROA 1WLMA 1SPYA 1OZOA 2F3ZA 2JWWA 4MZLA 1BLQA 3BUXB 4GUKA 5BPJA 1S5GY 2BCAA 2JQ6A 2BBMA 2PVBA 4FTGA 1RECA 1DMOA 1J55A 2KFFA 1UURA 3BUNB 3VRRA 1DJWA 1A29A 4GNKB 5HLOA 1K95A 2ZN8A 1UHNA 1QS7A 1DJZA 5KU1A 4YGDB 1B8LA 1TCFA 2JOJA 3LLEA 3NSKA 2JTZA 4QJ5B 1W7JB 1KSMA 2K0JA 4XYNA 1WRLA 2Q91A 1B8CA 2LVJA 1SCVA 1JWDA 2ZNEA 2Y1MA 1OQPA 2LE9B 4QJ3B 2MBXA 3LK0A 3FWBA 1A03A 4F0ZB 1PALA 1L7ZA 1D1OA 4E68A 4PCWA 3SG7A 5I2OA 1B47A 4HRHA 1CMGA 1C7VA 4PHKA 2JT0A 3SG6A 1BODA 5D7FA 1J1DA 1NYAA 2LVIA 4CFRA 1QV0A 3I5FC 3K21A 2NXQA 2JXLA 2M3WA 1CNPA 2ZNDA 2F2PA 2LM5A 1CLLA 1M63B 2CNPA 2LCPA 1SCMC 2OPOA 1QV1A 2A4JA 3I5HB 4N1GA 2I2RE 3AKBA 1IQ3A 2PASA 1JBAA 2MRDA 2AAOA 4NDBA 1DJIA 1CDMA 1AVSA 1XFUO 2M1KB 1AUIB 4XJKB 1YVHA 1G33A 4YI8A 1DT7B 3O2PA 1K93D 1FW4A 3KEVA 3NSIA 1GJYA 2LP3A 4HSZA 4I5KA 1BJFA 4MRYA 4MVFA 1G8IA 4DIRA 1PVAA 1QXPA 2LUXA 1B8RA 1J7OA 1OMVA 2JT8A 5HKWA 3EVVA 2K7BA 1H4BA 4AQIA 1YVLA 1YUUA 4MZJA 2EC6B 3A8RA 4DS7A 3PN7C 1FPWA 1N65A 3BOWB 1GQMA 1EJ3A 2KAXA 2OTGB 1OMRA 2PSRA 2BL0C 2LVVA 2HQWA 2CT9A 2KGRA 3QRXA 4GGNA 4ETOA 1JC2A 1K9KA 1WDCC 4PDZA 5I2QA 1FF1A 3AKAA 2CBLA 4GGFC 1QX2A 3PM8A 1XFZO 2K8MB 3EK7A 1DTLA 2F8PA 4IL1A 1XFWO 2CXJA 2FCDA 3GOFA 2M1UA 2F33A 1EL4A 2P6BB 3BYAA 5HKZA 1ZOTB 4BY5A 2KAVA 4P5OE 1B9AA 2NZ0A 2F2OA 1X02A 1PVBA 3TUYB 1F54A 1A75B 1IG5A 1TIZA 2K7CA 5ER5A 1HQVA 1KWOC 1H8BA 1NP8A 2KBIA 1Y1XA 3BXKA 1OZSA 3CGAA 1MWNA 1OOJA 2JULA 1IGVA 1S26D 4N5XA 1L2OB 1V1FA 2LHLA 1IQ5A 4JPZB 1YUSA 2AUCA 1U5IB 3LK1A 4NDCA 1SKTA 5CSIA 1NCYA 1CFCA 2KGBC 2PRUA 4DRWA 1B7TY 1KQMB 1J1EA 1OE9B 2AMIA 1CM4A 4C0JA 3WHTB 2EGDA 1QX5B 2OS8B 2K7OA 4YGBB 3D0YA 1LXFC 4U8DA 3VRPA 2LHIA 2GGMA 3AAJA 5GQQC 1CKKA 1CM1A 2QACA 2KI6D 1S5GZ 1K9PA 2LC5A 3H4SE 1DGVA 1MUXA 1TNWA 1QIVA 3D10A 1SK6D 1B1GA 4ORCB 1KFXL 4DCKA 4TNCA 1CDNA 1RJVA 3SG5A 3ZWHA 4I5NB 3CR4X 1MR8A 1FBVA 1SR6B 1SBJA 1YR5A 1Y1AA 1SMGA 3DF0A 1UHHA 3IQOA 3PALA 2LAPA 1SL8A 4USLA 5CSFA 3PATA 1PSRA 1S1EA 2BCBA 1IH0A 4OKHA 1YURA 2QPTA 1S6CA 4GAOA 2KYFA 3JTDC 1C7WA 2NCOA 2FJUB 1NIWA 3CLNA 1LA0A 1XFVO 3CTNA 3DD4A 4ZCVA 5JOLA 5K89A 1PSBA 1KK7Y 3JVTC 1QTXA 2KOTA 4A4CA 1OMDA 2WORA 4OV2A 1BG1A 1K94A 2KFHA 5IBWA 3KHEA 1ZACA 4CIDA 5AFPA 1Q80A 2M9GA 2M29A 3SIAA 3I5HC 2JRFA 2MLFC 1IJ6A 3TZ1A 1M31A 3ICBA 4MZKA 3OX6A 1PULA 3IQQA 2M7NA 2KYCA 1KQVA 2KFGA 2FOTA 3I5GB 2WC8A 1AJ4A 3TDZA 1QIWA 1WLZA 2BECA 3CS1A 1SNLA 3EK8A 1YUTA 1M46A 2LMUA 2WOSA 3OB1B 1KSOA 2MHHA 2CTNA 3AAKA 4PHNA 1MHOA 2WCBA 1YX7A 4CFQA 5KSZA 2LLUA 2B1UA 4GGFA 2JZIA 4M2PA 1BOCA 1CFFA 2EC6C 4MLWA 1NX2A 3FWCA 1CLBA 4C0KA 4CPVA 2JXCA 1PK0D 2ZFDA 1NWDA 2OTGC 1ALVA 1UWOA 1A4PA 2H61C 1SL9A 2GGZA 1CMFA 3PLFB 5TNCA 1JUOA 4AOMA 2KI6C 5AEQA 1GGZA 2L4HA 3PFVA 3BUMB 2LNKA 1MXEA 1RK9A 3GK1A 3KO0A 1DF0A 3SG4A 1XO5A 2WNDA 4YBHB 2KQYA 2LLSA 1S6IA 2HF5A 2L5XB 4MRXA 1QVIY 1SW8A 2VRGA 2R2IA 1KK8B 1NCXA 1TNPA 5ER4X 3TUYC 1TNQA 1JSAA 1DGUA 1Y0VH 1BT6A 3GK2A 2ZN9A 1WRZA 1C07A 5DKQA 3I5IB 1XK4C 2K2FA 1KFXS 4GFTA 4D1EA 5KTYA 2NCPA 1F71A 2LV7A 1L2OC 1N2DA 3OHMB 2L51A 2K7DA 3WNXB 4HRGA 4YI9A 3TDUA 2Y5IA 1ZMZA 3EK4A 4JWQA 2L0PA 2L2EA 3NSLA 2M8UA 3NXAA 1EH2A 1SL7A 1E8AA 1NCZA 4OVNF 3F45A 2ZRTA 2D8NA 3O78A 3TS5B 2G2BA 1RFJA 2G9BA 3BQ3A 3DVEA 5JJGA 1BMOA 2M97A 1B7TZ 1HT9A 1XFXO 3CR2A 1AHRA 2OS8C 3HX4A 4GPLB 1BF5A 1W7IB 5I2LA 2KBMA 5CSNA 5PALA 1N0YA 1YRUB 2BCXA 3EVRA 1ZFSA 4QJ4B 2M7LA 2NLNA 1DJXA 3CZTX 2JNXA 3TDIA 1BU3A 2KI4B 1DJGA 1NX1A 1UUSA 1YX8A 3SIBA 2DOQA 5FYXA 2GV5A 1J7RA 1IRJA 1CDPA 1F4OA 1Y6WA 5AXIA 2LUCA 3DVMA 3NSOA 5B8IB 4WRIA 4PE7A 1SR6C 2JNFA 5I8NA 4YGAA 1MF8B 3SJSA 2O5GA 1CB1A 1UP5A 4OCIA 3A4UB 4PALA 3FIAA 2KDHA 1QX7A 4PHMA 1MQ1A 1ODBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTX A;  2O60 A;  2JC2 A;  1UHI A;  1NPQ A;  3C1V A;  3DVK A;  1JFK A;  4ICB A;  4PHJ A;  3ZNI A;  1AK8 A;  2MLE C;  2BBN A;  4M2Q A;  1TOP A;  1CLM A;  1GGW A;  1SYM A;  5DKN A;  4YGC B;  2LP2 A;  3OX5 A;  1BR1 B;  4XJK A;  1A2X A;  1KK7 Z;  1YRT B;  3LCP C;  4MN0 A;  3VRN A;  2BE6 A;  1YTZ C;  2L50 A;  2KAY A;  1UHJ A;  5HKY A;  2MAZ A;  5CPV A;  3RM1 A;  2K2A A;  3D0Y B;  4CLN A;  1RWY A;  2JU0 A;  2KQ6 A;  1ZUZ A;  4GBA A;  2RGI A;  1NUB A;  2IS9 A;  3GK4 X;  4P2Y B;  2LLT A;  1CDL A;  1WRK A;  1JFJ A;  1LIN A;  1QLK A;  4BY4 A;  1XYD A;  3WXA A;  3I5G C;  1F8H A;  3IF7 A;  1TRF A;  2JTT A;  1TCO B;  4UPG A;  3BOW A;  3JTD B;  3WHU B;  1EG4 A;  2H61 A;  2L98 A;  4I5L B;  1TN4 A;  1KFU L;  5DKR A;  1NSH A;  1F70 A;  3EKJ A;  1UHK A;  3DF0 B;  1AP4 A;  2KNE A;  1IKU A;  3JVT B;  2LVK A;  1CFP A;  3EKH A;  4DUQ A;  1QLS A;  4ORB B;  2ZKM X;  1TNX A;  3I5F B;  3HCM A;  1B4C A;  1IJ5 A;  4ORA B;  3PSR A;  2KHN A;  2LMT A;  3OP0 A;  1Y1U A;  5CSJ A;  5HYD A;  1S6J A;  1SCM B;  2E6W A;  3VRQ A;  2M49 B;  2BKI B;  1A75 A;  1XA5 A;  1EG3 A;  1S3P A;  1V1G A;  5HLV A;  1QAT A;  2M0R A;  3VGO A;  4FQO A;  1XK4 A;  5F6T A;  2Y4Q A;  2ZRS A;  2HPS A;  1RTP 1;  1CTR A;  2E30 A;  1J7P A;  1QAS A;  2Q4U A;  4A4B A;  1K96 A;  1K9U A;  1J7Q A;  4NDD A;  1KK8 C;  4YGE B;  1K90 D;  1PRW A;  1QVI Z;  2I7A A;  3EVU A;  4L9M A;  1U5I A;  4YRU A;  2SCP A;  4MEW A;  3I5I C;  1SY9 A;  4MSP A;  3O4Y A;  4Q04 A;  2PMY A;  1G4Y R;  1QJT A;  3PN7 B;  1S36 A;  2Y1N A;  2K61 A;  1R6P A;  3SG3 A;  2BL0 B;  2MJW B;  1KCY A;  2BE4 A;  3O6B A;  2KSP A;  3DVJ A;  2ISD A;  4N1F A;  5G08 A;  2COL B;  3LL8 B;  1LKJ A;  2PAL A;  2I18 A;  1WDC B;  1JF2 A;  4C0L A;  1DVI A;  1LA3 A;  1NX3 A;  1WY9 A;  2F3Y A;  5AER A;  3TS5 C;  1BR4 B;  2HQ8 A;  3E3R A;  3M0W A;  4HRE E;  1K2H A;  1KQM C;  4PE1 A;  1FI5 A;  1MXL C;  1F4Q A;  3CWG A;  3OB2 B;  1FI6 A;  4R1E A;  1M45 A;  1F55 A;  1AJ5 A;  2WCE A;  4I5J A;  4WQ2 A;  1DJY A;  3MSE B;  4PE4 A;  4JQ0 D;  1M39 A;  3CR5 X;  5D69 A;  3FS7 A;  1IWQ A;  1KWO B;  3KPX A;  1XFY O;  2EHB A;  4M2O A;  1OSA A;  4PE0 A;  1DF0 B;  2JT3 A;  2KI4 C;  2BKH B;  4ZCU A;  4OR9 B;  3BUO B;  1XVJ A;  2H2K A;  1ALW A;  1VRK A;  5AAN A;  2MA2 A;  3BUW B;  2L4I A;  4NQG A;  2LAN A;  5J3X A;  1LVC D;  1RRO A;  2SAS A;  3RLZ A;  4AQJ A;  2V53 A;  4WQ3 A;  1NX0 A;  1K8U A;  1SRA A;  2HET A;  3KF9 A;  2JPT A;  1R2U A;  1EXR A;  2FCE A;  2I94 A;  1JF0 A;  2LMV A;  2WCF A;  2TN4 A;  1KFU S;  4MBE A;  1DJH A;  2CCM A;  1CFD A;  3SG2 A;  3VRO A;  1WLM A;  1SPY A;  1OZO A;  2F3Z A;  2JWW A;  4MZL A;  1BLQ A;  3BUX B;  4GUK A;  5BPJ A;  1S5G Y;  2BCA A;  2JQ6 A;  2BBM A;  2PVB A;  4FTG A;  1REC A;  1DMO A;  1J55 A;  2KFF A;  1UUR A;  3BUN B;  3VRR A;  1DJW A;  1A29 A;  4GNK B;  5HLO A;  1K95 A;  2ZN8 A;  1UHN A;  1QS7 A;  1DJZ A;  5KU1 A;  4YGD B;  1B8L A;  1TCF A;  2JOJ A;  3LLE A;  3NSK A;  2JTZ A;  4QJ5 B;  1W7J B;  1KSM A;  2K0J A;  4XYN A;  1WRL A;  2Q91 A;  1B8C A;  2LVJ A;  1SCV A;  1JWD A;  2ZNE A;  2Y1M A;  1OQP A;  2LE9 B;  4QJ3 B;  2MBX A;  3LK0 A;  3FWB A;  1A03 A;  4F0Z B;  1PAL A;  1L7Z A;  1D1O A;  4E68 A;  4PCW A;  3SG7 A;  5I2O A;  1B47 A;  4HRH A;  1CMG A;  1C7V A;  4PHK A;  2JT0 A;  3SG6 A;  1BOD A;  5D7F A;  1J1D A;  1NYA A;  2LVI A;  4CFR A;  1QV0 A;  3I5F C;  3K21 A;  2NXQ A;  2JXL A;  2M3W A;  1CNP A;  2ZND A;  2F2P A;  2LM5 A;  1CLL A;  1M63 B;  2CNP A;  2LCP A;  1SCM C;  2OPO A;  1QV1 A;  2A4J A;  3I5H B;  4N1G A;  2I2R E;  3AKB A;  1IQ3 A;  2PAS A;  1JBA A;  2MRD A;  2AAO A;  4NDB A;  1DJI A;  1CDM A;  1AVS A;  1XFU O;  2M1K B;  1AUI B;  4XJK B;  1YVH A;  1G33 A;  4YI8 A;  1DT7 B;  3O2P A;  1K93 D;  1FW4 A;  3KEV A;  3NSI A;  1GJY A;  2LP3 A;  4HSZ A;  4I5K A;  1BJF A;  4MRY A;  4MVF A;  1G8I A;  4DIR A;  1PVA A;  1QXP A;  2LUX A;  1B8R A;  1J7O A;  1OMV A;  2JT8 A;  5HKW A;  3EVV A;  2K7B A;  1H4B A;  4AQI A;  1YVL A;  1YUU A;  4MZJ A;  2EC6 B;  3A8R A;  4DS7 A;  3PN7 C;  1FPW A;  1N65 A;  3BOW B;  1GQM A;  1EJ3 A;  2KAX A;  2OTG B;  1OMR A;  2PSR A;  2BL0 C;  2LVV A;  2HQW A;  2CT9 A;  2KGR A;  3QRX A;  4GGN A;  4ETO A;  1JC2 A;  1K9K A;  1WDC C;  4PDZ A;  5I2Q A;  1FF1 A;  3AKA A;  2CBL A;  4GGF C;  1QX2 A;  3PM8 A;  1XFZ O;  2K8M B;  3EK7 A;  1DTL A;  2F8P A;  4IL1 A;  1XFW O;  2CXJ A;  2FCD A;  3GOF A;  2M1U A;  2F33 A;  1EL4 A;  2P6B B;  3BYA A;  5HKZ A;  1ZOT B;  4BY5 A;  2KAV A;  4P5O E;  1B9A A;  2NZ0 A;  2F2O A;  1X02 A;  1PVB A;  3TUY B;  1F54 A;  1A75 B;  1IG5 A;  1TIZ A;  2K7C A;  5ER5 A;  1HQV A;  1KWO C;  1H8B A;  1NP8 A;  2KBI A;  1Y1X A;  3BXK A;  1OZS A;  3CGA A;  1MWN A;  1OOJ A;  2JUL A;  1IGV A;  1S26 D;  4N5X A;  1L2O B;  1V1F A;  2LHL A;  1IQ5 A;  4JPZ B;  1YUS A;  2AUC A;  1U5I B;  3LK1 A;  4NDC A;  1SKT A;  5CSI A;  1NCY A;  1CFC A;  2KGB C;  2PRU A;  4DRW A;  1B7T Y;  1KQM B;  1J1E A;  1OE9 B;  2AMI A;  1CM4 A;  4C0J A;  3WHT B;  2EGD A;  1QX5 B;  2OS8 B;  2K7O A;  4YGB B;  3D0Y A;  1LXF C;  4U8D A;  3VRP A;  2LHI A;  2GGM A;  3AAJ A;  5GQQ C;  1CKK A;  1CM1 A;  2QAC A;  2KI6 D;  1S5G Z;  1K9P A;  2LC5 A;  3H4S E;  1DGV A;  1MUX A;  1TNW A;  1QIV A;  3D10 A;  1SK6 D;  1B1G A;  4ORC B;  1KFX L;  4DCK A;  4TNC A;  1CDN A;  1RJV A;  3SG5 A;  3ZWH A;  4I5N B;  3CR4 X;  1MR8 A;  1FBV A;  1SR6 B;  1SBJ A;  1YR5 A;  1Y1A A;  1SMG A;  3DF0 A;  1UHH A;  3IQO A;  3PAL A;  2LAP A;  1SL8 A;  4USL A;  5CSF A;  3PAT A;  1PSR A;  1S1E A;  2BCB A;  1IH0 A;  4OKH A;  1YUR A;  2QPT A;  1S6C A;  4GAO A;  2KYF A;  3JTD C;  1C7W A;  2NCO A;  2FJU B;  1NIW A;  3CLN A;  1LA0 A;  1XFV O;  3CTN A;  3DD4 A;  4ZCV A;  5JOL A;  5K89 A;  1PSB A;  1KK7 Y;  3JVT C;  1QTX A;  2KOT A;  4A4C A;  1OMD A;  2WOR A;  4OV2 A;  1BG1 A;  1K94 A;  2KFH A;  5IBW A;  3KHE A;  1ZAC A;  4CID A;  5AFP A;  1Q80 A;  2M9G A;  2M29 A;  3SIA A;  3I5H C;  2JRF A;  2MLF C;  1IJ6 A;  3TZ1 A;  1M31 A;  3ICB A;  4MZK A;  3OX6 A;  1PUL A;  3IQQ A;  2M7N A;  2KYC A;  1KQV A;  2KFG A;  2FOT A;  3I5G B;  2WC8 A;  1AJ4 A;  3TDZ A;  1QIW A;  1WLZ A;  2BEC A;  3CS1 A;  1SNL A;  3EK8 A;  1YUT A;  1M46 A;  2LMU A;  2WOS A;  3OB1 B;  1KSO A;  2MHH A;  2CTN A;  3AAK A;  4PHN A;  1MHO A;  2WCB A;  1YX7 A;  4CFQ A;  5KSZ A;  2LLU A;  2B1U A;  4GGF A;  2JZI A;  4M2P A;  1BOC A;  1CFF A;  2EC6 C;  4MLW A;  1NX2 A;  3FWC A;  1CLB A;  4C0K A;  4CPV A;  2JXC A;  1PK0 D;  2ZFD A;  1NWD A;  2OTG C;  1ALV A;  1UWO A;  1A4P A;  2H61 C;  1SL9 A;  2GGZ A;  1CMF A;  3PLF B;  5TNC A;  1JUO A;  4AOM A;  2KI6 C;  5AEQ A;  1GGZ A;  2L4H A;  3PFV A;  3BUM B;  2LNK A;  1MXE A;  1RK9 A;  3GK1 A;  3KO0 A;  1DF0 A;  3SG4 A;  1XO5 A;  2WND A;  4YBH B;  2KQY A;  2LLS A;  1S6I A;  2HF5 A;  2L5X B;  4MRX A;  1QVI Y;  1SW8 A;  2VRG A;  2R2I A;  1KK8 B;  1NCX A;  1TNP A;  5ER4 X;  3TUY C;  1TNQ A;  1JSA A;  1DGU A;  1Y0V H;  1BT6 A;  3GK2 A;  2ZN9 A;  1WRZ A;  1C07 A;  5DKQ A;  3I5I B;  1XK4 C;  2K2F A;  1KFX S;  4GFT A;  4D1E A;  5KTY A;  2NCP A;  1F71 A;  2LV7 A;  1L2O C;  1N2D A;  3OHM B;  2L51 A;  2K7D A;  3WNX B;  4HRG A;  4YI9 A;  3TDU A;  2Y5I A;  1ZMZ A;  3EK4 A;  4JWQ A;  2L0P A;  2L2E A;  3NSL A;  2M8U A;  3NXA A;  1EH2 A;  1SL7 A;  1E8A A;  1NCZ A;  4OVN F;  3F45 A;  2ZRT A;  2D8N A;  3O78 A;  3TS5 B;  2G2B A;  1RFJ A;  2G9B A;  3BQ3 A;  3DVE A;  5JJG A;  1BMO A;  2M97 A;  1B7T Z;  1HT9 A;  1XFX O;  3CR2 A;  1AHR A;  2OS8 C;  3HX4 A;  4GPL B;  1BF5 A;  1W7I B;  5I2L A;  2KBM A;  5CSN A;  5PAL A;  1N0Y A;  1YRU B;  2BCX A;  3EVR A;  1ZFS A;  4QJ4 B;  2M7L A;  2NLN A;  1DJX A;  3CZT X;  2JNX A;  3TDI A;  1BU3 A;  2KI4 B;  1DJG A;  1NX1 A;  1UUS A;  1YX8 A;  3SIB A;  2DOQ A;  5FYX A;  2GV5 A;  1J7R A;  1IRJ A;  1CDP A;  1F4O A;  1Y6W A;  5AXI A;  2LUC A;  3DVM A;  3NSO A;  5B8I B;  4WRI A;  4PE7 A;  1SR6 C;  2JNF A;  5I8N A;  4YGA A;  1MF8 B;  3SJS A;  2O5G A;  1CB1 A;  1UP5 A;  4OCI A;  3A4U B;  4PAL A;  3FIA A;  2KDH A;  1QX7 A;  4PHM A;  1MQ1 A;  1ODB A; 
#chains in the Genus database with same CATH topology
 1TTX A;  2O60 A;  2JC2 A;  1UHI A;  1NPQ A;  3S0A A;  3C1V A;  3DVK A;  1JFK A;  4ICB A;  4PHJ A;  3ZNI A;  1AK8 A;  2MLE C;  2BBN A;  4M2Q A;  3D76 A;  1TOP A;  1CLM A;  1GGW A;  4KYN A;  3L4A A;  2QEV A;  1SYM A;  5DKN A;  3Q8I A;  1TUJ A;  4YGC B;  2LP2 A;  3OX5 A;  1BR1 B;  4XJK A;  1A2X A;  1KK7 Z;  1YRT B;  3LCP C;  4MN0 A;  3VRN A;  2BE6 A;  1YTZ C;  2L50 A;  2KAY A;  1UHJ A;  5HKY A;  2MAZ A;  5CPV A;  3RM1 A;  2K2A A;  3D0Y B;  4CLN A;  1RWY A;  2JU0 A;  2KQ6 A;  1ZUZ A;  4GBA A;  2RGI A;  1NUB A;  2IS9 A;  3GK4 X;  4P2Y B;  2LLT A;  1CDL A;  3R1V A;  1SSE B;  1WRK A;  3D75 A;  1JFJ A;  1LIN A;  1QLK A;  4BY4 A;  1XYD A;  3WXA A;  3DYE A;  3I5G C;  1F8H A;  3IF7 A;  1W9Z A;  1TRF A;  2JTT A;  1TCO B;  4UPG A;  5FI2 A;  3BOW A;  3JTD B;  3WHU B;  1EG4 A;  2H61 A;  2L98 A;  4I5L B;  1TN4 A;  1KFU L;  5DKR A;  1NSH A;  1F70 A;  3EKJ A;  1UHK A;  3DF0 B;  1AP4 A;  2BNX A;  2KNE A;  1IKU A;  3JVT B;  2LVK A;  1CFP A;  2WCH A;  3EKH A;  4DUQ A;  1QLS A;  4ORB B;  2ZKM X;  1TNX A;  3I5F B;  3HCM A;  1B4C A;  1IJ5 A;  4ORA B;  3CZ1 A;  2KHN A;  3PSR A;  2LMT A;  3OP0 A;  1Y1U A;  5CSJ A;  5HYD A;  1S6J A;  1SCM B;  2E6W A;  3VRQ A;  2M49 B;  2BKI B;  1A75 A;  3B88 A;  1XA5 A;  1EG3 A;  1S3P A;  1V1G A;  3K1E A;  5HLV A;  1QAT A;  3N7H A;  3SS5 A;  2M0R A;  3VGO A;  4FQO A;  1XK4 A;  5F6T A;  2Y4Q A;  2ZRS A;  2HPS A;  1RTP 1;  1CTR A;  2E30 A;  1J7P A;  1QAS A;  2Q4U A;  4A4B A;  1K96 A;  1K9U A;  1J7Q A;  4NDD A;  1KK8 C;  1T14 A;  1K90 D;  1PRW A;  1QVI Z;  2I7A A;  3EVU A;  4L9M A;  1U5I A;  4YGE B;  4YRU A;  2QEH A;  2SCP A;  4MEW A;  3I5I C;  1SY9 A;  3B87 A;  2H8V A;  4MSP A;  3O4Y A;  4Q04 A;  2PMY A;  1G4Y R;  1QJT A;  3PN7 B;  1S36 A;  2Y1N A;  2K61 A;  1R6P A;  3SG3 A;  2BL0 B;  2MJW B;  1KCY A;  2BE4 A;  3O6B A;  2KSP A;  3DVJ A;  2ISD A;  4N1F A;  5G08 A;  2COL B;  3LL8 B;  1LKJ A;  2PAL A;  2I18 A;  1WDC B;  1JF2 A;  4C0L A;  3D74 A;  1ORG A;  1DVI A;  1LA3 A;  1NX3 A;  1WY9 A;  2F3Y A;  5AER A;  3TS5 C;  1BR4 B;  2HQ8 A;  3E3R A;  3M0W A;  4HRE E;  1K2H A;  1KQM C;  2QEO A;  4PE1 A;  1FI5 A;  1MXL C;  1F4Q A;  3CWG A;  3OB2 B;  1FI6 A;  4R1E A;  1M45 A;  1F55 A;  1AJ5 A;  2WCE A;  4I5J A;  4WQ2 A;  1DJY A;  3MSE B;  4PE4 A;  4JQ0 D;  1M39 A;  3CR5 X;  5D69 A;  3FS7 A;  1IWQ A;  1KWO B;  3KPX A;  1XFY O;  2EHB A;  4M2O A;  1OSA A;  4PE0 A;  3R1P A;  1DF0 B;  2KLD A;  2JT3 A;  2KI4 C;  2BKH B;  4ZCU A;  4OR9 B;  3BUO B;  1XVJ A;  2H2K A;  1ALW A;  2WC5 A;  1OOH A;  1VRK A;  5AAN A;  3D77 A;  2MA2 A;  3BUW B;  2L4I A;  3CYZ A;  4NQG A;  2LAN A;  5J3X A;  1LVC D;  1RRO A;  2SAS A;  3RLZ A;  4AQJ A;  2V53 A;  4WQ3 A;  1NX0 A;  1K8U A;  1SRA A;  2HET A;  3KF9 A;  2JPT A;  1R2U A;  1EXR A;  1DEK A;  2FCE A;  2WCM A;  2I94 A;  3NHI A;  1JF0 A;  2LMV A;  2WCF A;  2TN4 A;  1KFU S;  4MBE A;  5FI7 A;  1DJH A;  2CCM A;  1CFD A;  3SG2 A;  3VRO A;  1WLM A;  1SPY A;  1OZO A;  2F3Z A;  2JWW A;  4MZL A;  1BLQ A;  3BUX B;  4GUK A;  2BAP A;  1S5G Y;  4FQT A;  5BPJ A;  2BCA A;  2JQ6 A;  2P70 A;  2QDI A;  2BBM A;  2PVB A;  4FTG A;  1REC A;  1DMO A;  1J55 A;  2KFF A;  3BFH A;  1UUR A;  3BUN B;  3VRR A;  1DJW A;  1A29 A;  4GNK B;  5HLO A;  1K95 A;  2ZN8 A;  1UHN A;  1QS7 A;  1DJZ A;  5KU1 A;  4YGD B;  1B8L A;  2FJY A;  1TCF A;  2JOJ A;  3CAB A;  3LLE A;  3NSK A;  2JTZ A;  4QJ5 B;  1W7J B;  2JPO A;  1KSM A;  2K0J A;  4XYN A;  1WRL A;  2Q91 A;  1B8C A;  2ERB A;  3DZT A;  2LVJ A;  1SCV A;  1JWD A;  2ZNE A;  2Y1M A;  1OQP A;  2LE9 B;  4QJ3 B;  2MBX A;  3LK0 A;  3FWB A;  3V2L A;  1A03 A;  4F0Z B;  1PAL A;  5FI6 A;  1L7Z A;  1D1O A;  4E68 A;  4PCW A;  3SG7 A;  1OOF A;  1B47 A;  4HRH A;  5I2O A;  1CMG A;  1C7V A;  2PYQ A;  4PHK A;  2JT0 A;  3SG6 A;  3D78 A;  1BOD A;  5D7F A;  1J1D A;  1NYA A;  2LVI A;  4CFR A;  1QV0 A;  3I5F C;  3K21 A;  2NXQ A;  4F7F A;  3DY9 A;  2JXL A;  3CZ0 A;  2M3W A;  3OBV A;  1CNP A;  2ZND A;  2F2P A;  2LM5 A;  1CLL A;  1M63 B;  2CNP A;  2LCP A;  1SCM C;  2OPO A;  1QV1 A;  2A4J A;  3I5H B;  4N1G A;  2I2R E;  3AKB A;  1IQ3 A;  2PAS A;  1JBA A;  3NHT A;  2MRD A;  2AAO A;  4NDB A;  3UO9 A;  1DJI A;  1CDM A;  1AVS A;  1XFU O;  2M1K B;  1AUI B;  3PJI A;  4XJK B;  1YVH A;  1G33 A;  4YI8 A;  3BJH A;  1DT7 B;  3O2P A;  1K93 D;  1FW4 A;  3KEV A;  3NSI A;  1GJY A;  2LP3 A;  4HSZ A;  4I5K A;  1BJF A;  4MRY A;  4MVF A;  1G8I A;  4DIR A;  1PVA A;  1QXP A;  2LUX A;  1B8R A;  1J7O A;  1OMV A;  3S0E A;  2JT8 A;  5HKW A;  3EVV A;  2K7B A;  3BFB A;  1H4B A;  3S0B A;  4AQI A;  1YVL A;  1YUU A;  4MZJ A;  2EC6 B;  3A8R A;  3EG5 B;  4DS7 A;  3PN7 C;  2WCJ A;  1FPW A;  3FE9 A;  1N65 A;  3BOW B;  1GQM A;  1EJ3 A;  2KAX A;  2OTG B;  1OMR A;  2PSR A;  2BL0 C;  2LVV A;  4JD9 A;  2HQW A;  2CT9 A;  2KGR A;  3QRX A;  4GGN A;  4ETO A;  1JC2 A;  1K9K A;  1WDC C;  4PDZ A;  5I2Q A;  1FF1 A;  3AKA A;  2CBL A;  4GGF C;  1QX2 A;  3PM8 A;  1XFZ O;  2K8M B;  2PQL A;  3EK7 A;  1DTL A;  2F8P A;  4IL1 A;  1XFW O;  2CXJ A;  3L47 A;  2FCD A;  3GOF A;  2M1U A;  2F33 A;  1EL4 A;  2P6B B;  3BYA A;  5HKZ A;  1ZOT B;  3UNW A;  4BY5 A;  2KAV A;  4P5O E;  1B9A A;  5D3O A;  2NZ0 A;  2F2O A;  1X02 A;  1PVB A;  3TUY B;  1F54 A;  1P28 A;  1A75 B;  1IG5 A;  1TIZ A;  2K7C A;  5ER5 A;  1HQV A;  1KWO C;  1H8B A;  1NP8 A;  2P71 A;  2KBI A;  1Y1X A;  3BXK A;  1OZS A;  3CGA A;  1MWN A;  3R72 A;  1OOJ A;  2JUL A;  2QEB A;  1IGV A;  1GM0 A;  1S26 D;  4N5X A;  1L2O B;  1V1F A;  2LHL A;  3B7A A;  3CDN A;  4JKT A;  1IQ5 A;  4JPZ B;  1YUS A;  2AUC A;  1U5I B;  3LK1 A;  4NDC A;  1SKT A;  2L2C A;  5CSI A;  1NCY A;  1CFC A;  2KGB C;  2PRU A;  4DRW A;  1B7T Y;  1KQM B;  4IJ7 A;  1J1E A;  1OE9 B;  2AMI A;  1Z4H A;  1CM4 A;  1LS8 A;  4C0J A;  3WHT B;  2EGD A;  1QX5 B;  2OS8 B;  2K7O A;  4YGB B;  3D0Y A;  1LXF C;  4U8D A;  3VRP A;  2LHI A;  2GGM A;  3AAJ A;  5GQQ C;  1CKK A;  1CM1 A;  2QAC A;  5EL2 A;  2KI6 D;  3IVT A;  1S5G Z;  1DEL A;  1K9P A;  3L4L A;  2LC5 A;  3H4S E;  1DGV A;  1MUX A;  1QWV A;  1TNW A;  1QIV A;  2L5Y A;  3D10 A;  1C3Z A;  1SK6 D;  3FE8 A;  1B1G A;  4ORC B;  3PM2 A;  1KFX L;  4DCK A;  4TNC A;  1CDN A;  1RJV A;  3SG5 A;  3ZWH A;  4I5N B;  3CR4 X;  1MR8 A;  1FBV A;  1SR6 B;  1SBJ A;  1YR5 A;  1Y1A A;  1SMG A;  3DF0 A;  1UHH A;  3IQO A;  3PAL A;  2LAP A;  1SL8 A;  4USL A;  1OW4 A;  5CSF A;  3PAT A;  1PSR A;  1S1E A;  2BCB A;  5I94 A;  3VB1 A;  1IH0 A;  3OGN A;  4OKH A;  1YUR A;  2QPT A;  1S6C A;  4GAO A;  2KYF A;  3JTD C;  1C7W A;  2NCO A;  2FJU B;  2KPH A;  1NIW A;  3CLN A;  1LA0 A;  1XFV O;  3BFA A;  3CTN A;  3DD4 A;  4ZCV A;  5JOL A;  5K89 A;  1PSB A;  1KK7 Y;  3JVT C;  3S0G A;  3SS3 A;  1QTX A;  2KOT A;  4A4C A;  1OMD A;  2WOR A;  4OV2 A;  3SS4 A;  1BG1 A;  1K94 A;  2KFH A;  5IBW A;  2YGU A;  3KHE A;  1ZAC A;  4CID A;  5AFP A;  1Q80 A;  2M9G A;  2M29 A;  3SIA A;  3I5H C;  3S0D A;  2JRF A;  2MLF C;  1IJ6 A;  3TZ1 A;  1M31 A;  3ICB A;  4MZK A;  3D73 A;  1TUZ A;  3OX6 A;  1PUL A;  2WCK A;  3IQQ A;  2M7N A;  2KYC A;  1KQV A;  2KFG A;  5HL1 A;  2FOT A;  3I5G B;  2WC8 A;  3R1O A;  1AJ4 A;  2WCL A;  3TDZ A;  1QIW A;  1WLZ A;  2BEC A;  3CS1 A;  1SNL A;  3EK8 A;  1YUT A;  1M46 A;  2LMU A;  2WOS A;  3OB1 B;  1KSO A;  2MHH A;  2CTN A;  3AAK A;  4PHN A;  1MHO A;  2WCB A;  1YX7 A;  4CFQ A;  5KSZ A;  2LLU A;  2B1U A;  4GGF A;  2JZI A;  4M2P A;  1IIO A;  1BOC A;  1CFF A;  2EC6 C;  4MLW A;  1NX2 A;  3FWC A;  1CLB A;  4C0K A;  4CPV A;  2JXC A;  1PK0 D;  2ZFD A;  1NWD A;  2OTG C;  1ALV A;  1UWO A;  1A4P A;  2H61 C;  1SL9 A;  2GGZ A;  1CMF A;  3CZ2 A;  3PLF B;  5TNC A;  1JUO A;  4AOM A;  2KI6 C;  5AEQ A;  1GGZ A;  2L4H A;  2GTE A;  3BUM B;  3PFV A;  2LNK A;  1MXE A;  1RK9 A;  3GK1 A;  3QME A;  3KO0 A;  1C3Y A;  1DC1 A;  1DF0 A;  3SG4 A;  1XO5 A;  2WND A;  4YBH B;  2KQY A;  2K60 A;  2LLS A;  1S6I A;  2HF5 A;  2L5X B;  3O4X A;  4MRX A;  1QVI Y;  1SW8 A;  2VRG A;  2R2I A;  1KK8 B;  1NCX A;  1TNP A;  5ER4 X;  3TUY C;  1TNQ A;  4PT1 A;  1JSA A;  1DGU A;  1Y0V H;  1BT6 A;  3GK2 A;  2ZN9 A;  4INX A;  1WRZ A;  1C07 A;  5DKQ A;  3I5I B;  1XK4 C;  2K2F A;  1KFX S;  4GFT A;  4D1E A;  5KTY A;  1TWO A;  2NCP A;  1F71 A;  2LV7 A;  3RZS A;  4OZD A;  1L2O C;  1N2D A;  3OHM B;  2L51 A;  2K7D A;  3WNX B;  4HRG A;  4YI9 A;  3TDU A;  2Y5I A;  1ZMZ A;  3EK4 A;  4JWQ A;  2L0P A;  2L2E A;  3NSL A;  2M8U A;  3S0F A;  1OOG A;  3NXA A;  1EH2 A;  1SL7 A;  1E8A A;  1NCZ A;  4OVN F;  3F45 A;  2ZRT A;  2D8N A;  3O78 A;  3TS5 B;  2G2B A;  1RFJ A;  2G9B A;  3BQ3 A;  3DVE A;  5JJG A;  1BMO A;  1XFR A;  2M97 A;  1B7T Z;  1HT9 A;  1XFX O;  3NGV A;  2WC6 A;  3CR2 A;  1AHR A;  2OS8 C;  3HX4 A;  4GPL B;  1BF5 A;  1W7I B;  5I2L A;  2KBM A;  5CSN A;  5PAL A;  1N0Y A;  1YRU B;  1Z2C B;  2BCX A;  3FE6 A;  3EVR A;  1OOI X;  1ZFS A;  4QJ4 B;  2M7L A;  2NLN A;  1DJX A;  3CZT X;  2JNX A;  3B86 A;  1BU3 A;  3TDI A;  5DIC A;  2KI4 B;  1DJG A;  1NX1 A;  1DQE A;  1UUS A;  1YX8 A;  3SIB A;  2DOQ A;  5FYX A;  2GV5 A;  1J7R A;  1IRJ A;  1CDP A;  1F4O A;  1Y6W A;  3DXL A;  2LUC A;  3DVM A;  5AXI A;  2KLE A;  3NSO A;  5B8I B;  4WRI A;  4PE7 A;  1SR6 C;  2JNF A;  5I8N A;  4YGA A;  1MF8 B;  3SJS A;  2O5G A;  1CB1 A;  1UP5 A;  4INW A;  4OCI A;  3A4U B;  4PAL A;  3FIA A;  2KDH A;  3B6X A;  1QX7 A;  4PHM A;  1MQ1 A;  1ODB A; 
#chains in the Genus database with same CATH homology
 1TTX A;  2O60 A;  2JC2 A;  1UHI A;  1NPQ A;  3C1V A;  3DVK A;  1JFK A;  4ICB A;  4PHJ A;  3ZNI A;  1AK8 A;  2MLE C;  2BBN A;  4M2Q A;  1TOP A;  1CLM A;  1GGW A;  1SYM A;  5DKN A;  4YGC B;  2LP2 A;  3OX5 A;  1BR1 B;  4XJK A;  1A2X A;  1KK7 Z;  1YRT B;  3LCP C;  4MN0 A;  3VRN A;  2BE6 A;  1YTZ C;  2L50 A;  2KAY A;  1UHJ A;  5HKY A;  2MAZ A;  5CPV A;  3RM1 A;  2K2A A;  3D0Y B;  4CLN A;  1RWY A;  2JU0 A;  2KQ6 A;  1ZUZ A;  4GBA A;  2RGI A;  1NUB A;  2IS9 A;  3GK4 X;  4P2Y B;  2LLT A;  1CDL A;  1WRK A;  1JFJ A;  1LIN A;  1QLK A;  4BY4 A;  1XYD A;  3WXA A;  3I5G C;  1F8H A;  3IF7 A;  1TRF A;  2JTT A;  1TCO B;  4UPG A;  3BOW A;  3JTD B;  3WHU B;  1EG4 A;  2H61 A;  2L98 A;  4I5L B;  1TN4 A;  1KFU L;  5DKR A;  1NSH A;  1F70 A;  3EKJ A;  1UHK A;  3DF0 B;  1AP4 A;  2KNE A;  1IKU A;  3JVT B;  2LVK A;  1CFP A;  3EKH A;  4DUQ A;  1QLS A;  4ORB B;  2ZKM X;  1TNX A;  3I5F B;  3HCM A;  1B4C A;  1IJ5 A;  4ORA B;  3PSR A;  2KHN A;  2LMT A;  3OP0 A;  1Y1U A;  5CSJ A;  5HYD A;  1S6J A;  1SCM B;  2E6W A;  3VRQ A;  2M49 B;  2BKI B;  1A75 A;  1XA5 A;  1EG3 A;  1S3P A;  1V1G A;  5HLV A;  1QAT A;  2M0R A;  3VGO A;  4FQO A;  1XK4 A;  5F6T A;  2Y4Q A;  2ZRS A;  2HPS A;  1RTP 1;  1CTR A;  2E30 A;  1J7P A;  1QAS A;  2Q4U A;  4A4B A;  1K96 A;  1K9U A;  1J7Q A;  4NDD A;  1KK8 C;  4YGE B;  1K90 D;  1PRW A;  1QVI Z;  2I7A A;  3EVU A;  4L9M A;  1U5I A;  4YRU A;  2SCP A;  4MEW A;  3I5I C;  1SY9 A;  4MSP A;  3O4Y A;  4Q04 A;  2PMY A;  1G4Y R;  1QJT A;  3PN7 B;  1S36 A;  2Y1N A;  2K61 A;  1R6P A;  3SG3 A;  2BL0 B;  2MJW B;  1KCY A;  2BE4 A;  3O6B A;  2KSP A;  3DVJ A;  2ISD A;  4N1F A;  5G08 A;  2COL B;  3LL8 B;  1LKJ A;  2PAL A;  2I18 A;  1WDC B;  1JF2 A;  4C0L A;  1DVI A;  1LA3 A;  1NX3 A;  1WY9 A;  2F3Y A;  5AER A;  3TS5 C;  1BR4 B;  2HQ8 A;  3E3R A;  3M0W A;  4HRE E;  1K2H A;  1KQM C;  4PE1 A;  1FI5 A;  1MXL C;  1F4Q A;  3CWG A;  3OB2 B;  1FI6 A;  4R1E A;  1M45 A;  1F55 A;  1AJ5 A;  2WCE A;  4I5J A;  4WQ2 A;  1DJY A;  3MSE B;  4PE4 A;  4JQ0 D;  1M39 A;  3CR5 X;  5D69 A;  3FS7 A;  1IWQ A;  1KWO B;  3KPX A;  1XFY O;  2EHB A;  4M2O A;  1OSA A;  4PE0 A;  1DF0 B;  2JT3 A;  2KI4 C;  2BKH B;  4ZCU A;  4OR9 B;  3BUO B;  1XVJ A;  2H2K A;  1ALW A;  1VRK A;  5AAN A;  2MA2 A;  3BUW B;  2L4I A;  4NQG A;  2LAN A;  5J3X A;  1LVC D;  1RRO A;  2SAS A;  3RLZ A;  4AQJ A;  2V53 A;  4WQ3 A;  1NX0 A;  1K8U A;  1SRA A;  2HET A;  3KF9 A;  2JPT A;  1R2U A;  1EXR A;  2FCE A;  2I94 A;  1JF0 A;  2LMV A;  2WCF A;  2TN4 A;  1KFU S;  4MBE A;  1DJH A;  2CCM A;  1CFD A;  3SG2 A;  3VRO A;  1WLM A;  1SPY A;  1OZO A;  2F3Z A;  2JWW A;  4MZL A;  1BLQ A;  3BUX B;  4GUK A;  5BPJ A;  1S5G Y;  2BCA A;  2JQ6 A;  2BBM A;  2PVB A;  4FTG A;  1REC A;  1DMO A;  1J55 A;  2KFF A;  1UUR A;  3BUN B;  3VRR A;  1DJW A;  1A29 A;  4GNK B;  5HLO A;  1K95 A;  2ZN8 A;  1UHN A;  1QS7 A;  1DJZ A;  5KU1 A;  4YGD B;  1B8L A;  1TCF A;  2JOJ A;  3LLE A;  3NSK A;  2JTZ A;  4QJ5 B;  1W7J B;  1KSM A;  2K0J A;  4XYN A;  1WRL A;  2Q91 A;  1B8C A;  2LVJ A;  1SCV A;  1JWD A;  2ZNE A;  2Y1M A;  1OQP A;  2LE9 B;  4QJ3 B;  2MBX A;  3LK0 A;  3FWB A;  1A03 A;  4F0Z B;  1PAL A;  1L7Z A;  1D1O A;  4E68 A;  4PCW A;  3SG7 A;  5I2O A;  1B47 A;  4HRH A;  1CMG A;  1C7V A;  4PHK A;  2JT0 A;  3SG6 A;  1BOD A;  5D7F A;  1J1D A;  1NYA A;  2LVI A;  4CFR A;  1QV0 A;  3I5F C;  3K21 A;  2NXQ A;  2JXL A;  2M3W A;  1CNP A;  2ZND A;  2F2P A;  2LM5 A;  1CLL A;  1M63 B;  2CNP A;  2LCP A;  1SCM C;  2OPO A;  1QV1 A;  2A4J A;  3I5H B;  4N1G A;  2I2R E;  3AKB A;  1IQ3 A;  2PAS A;  1JBA A;  2MRD A;  2AAO A;  4NDB A;  1DJI A;  1CDM A;  1AVS A;  1XFU O;  2M1K B;  1AUI B;  4XJK B;  1YVH A;  1G33 A;  4YI8 A;  1DT7 B;  3O2P A;  1K93 D;  1FW4 A;  3KEV A;  3NSI A;  1GJY A;  2LP3 A;  4HSZ A;  4I5K A;  1BJF A;  4MRY A;  4MVF A;  1G8I A;  4DIR A;  1PVA A;  1QXP A;  2LUX A;  1B8R A;  1J7O A;  1OMV A;  2JT8 A;  5HKW A;  3EVV A;  2K7B A;  1H4B A;  4AQI A;  1YVL A;  1YUU A;  4MZJ A;  2EC6 B;  3A8R A;  4DS7 A;  3PN7 C;  1FPW A;  1N65 A;  3BOW B;  1GQM A;  1EJ3 A;  2KAX A;  2OTG B;  1OMR A;  2PSR A;  2BL0 C;  2LVV A;  2HQW A;  2CT9 A;  2KGR A;  3QRX A;  4GGN A;  4ETO A;  1JC2 A;  1K9K A;  1WDC C;  4PDZ A;  5I2Q A;  1FF1 A;  3AKA A;  2CBL A;  4GGF C;  1QX2 A;  3PM8 A;  1XFZ O;  2K8M B;  3EK7 A;  1DTL A;  2F8P A;  4IL1 A;  1XFW O;  2CXJ A;  2FCD A;  3GOF A;  2M1U A;  2F33 A;  1EL4 A;  2P6B B;  3BYA A;  5HKZ A;  1ZOT B;  4BY5 A;  2KAV A;  4P5O E;  1B9A A;  2NZ0 A;  2F2O A;  1X02 A;  1PVB A;  3TUY B;  1F54 A;  1A75 B;  1IG5 A;  1TIZ A;  2K7C A;  5ER5 A;  1HQV A;  1KWO C;  1H8B A;  1NP8 A;  2KBI A;  1Y1X A;  3BXK A;  1OZS A;  3CGA A;  1MWN A;  1OOJ A;  2JUL A;  1IGV A;  1S26 D;  4N5X A;  1L2O B;  1V1F A;  2LHL A;  1IQ5 A;  4JPZ B;  1YUS A;  2AUC A;  1U5I B;  3LK1 A;  4NDC A;  1SKT A;  5CSI A;  1NCY A;  1CFC A;  2KGB C;  2PRU A;  4DRW A;  1B7T Y;  1KQM B;  1J1E A;  1OE9 B;  2AMI A;  1CM4 A;  4C0J A;  3WHT B;  2EGD A;  1QX5 B;  2OS8 B;  2K7O A;  4YGB B;  3D0Y A;  1LXF C;  4U8D A;  3VRP A;  2LHI A;  2GGM A;  3AAJ A;  5GQQ C;  1CKK A;  1CM1 A;  2QAC A;  2KI6 D;  1S5G Z;  1K9P A;  2LC5 A;  3H4S E;  1DGV A;  1MUX A;  1TNW A;  1QIV A;  3D10 A;  1SK6 D;  1B1G A;  4ORC B;  1KFX L;  4DCK A;  4TNC A;  1CDN A;  1RJV A;  3SG5 A;  3ZWH A;  4I5N B;  3CR4 X;  1MR8 A;  1FBV A;  1SR6 B;  1SBJ A;  1YR5 A;  1Y1A A;  1SMG A;  3DF0 A;  1UHH A;  3IQO A;  3PAL A;  2LAP A;  1SL8 A;  4USL A;  5CSF A;  3PAT A;  1PSR A;  1S1E A;  2BCB A;  1IH0 A;  4OKH A;  1YUR A;  2QPT A;  1S6C A;  4GAO A;  2KYF A;  3JTD C;  1C7W A;  2NCO A;  2FJU B;  1NIW A;  3CLN A;  1LA0 A;  1XFV O;  3CTN A;  3DD4 A;  4ZCV A;  5JOL A;  5K89 A;  1PSB A;  1KK7 Y;  3JVT C;  1QTX A;  2KOT A;  4A4C A;  1OMD A;  2WOR A;  4OV2 A;  1BG1 A;  1K94 A;  2KFH A;  5IBW A;  3KHE A;  1ZAC A;  4CID A;  5AFP A;  1Q80 A;  2M9G A;  2M29 A;  3SIA A;  3I5H C;  2JRF A;  2MLF C;  1IJ6 A;  3TZ1 A;  1M31 A;  3ICB A;  4MZK A;  3OX6 A;  1PUL A;  3IQQ A;  2M7N A;  2KYC A;  1KQV A;  2KFG A;  2FOT A;  3I5G B;  2WC8 A;  1AJ4 A;  3TDZ A;  1QIW A;  1WLZ A;  2BEC A;  3CS1 A;  1SNL A;  3EK8 A;  1YUT A;  1M46 A;  2LMU A;  2WOS A;  3OB1 B;  1KSO A;  2MHH A;  2CTN A;  3AAK A;  4PHN A;  1MHO A;  2WCB A;  1YX7 A;  4CFQ A;  5KSZ A;  2LLU A;  2B1U A;  4GGF A;  2JZI A;  4M2P A;  1BOC A;  1CFF A;  2EC6 C;  4MLW A;  1NX2 A;  3FWC A;  1CLB A;  4C0K A;  4CPV A;  2JXC A;  1PK0 D;  2ZFD A;  1NWD A;  2OTG C;  1ALV A;  1UWO A;  1A4P A;  2H61 C;  1SL9 A;  2GGZ A;  1CMF A;  3PLF B;  5TNC A;  1JUO A;  4AOM A;  2KI6 C;  5AEQ A;  1GGZ A;  2L4H A;  3PFV A;  3BUM B;  2LNK A;  1MXE A;  1RK9 A;  3GK1 A;  3KO0 A;  1DF0 A;  3SG4 A;  1XO5 A;  2WND A;  4YBH B;  2KQY A;  2LLS A;  1S6I A;  2HF5 A;  2L5X B;  4MRX A;  1QVI Y;  1SW8 A;  2VRG A;  2R2I A;  1KK8 B;  1NCX A;  1TNP A;  5ER4 X;  3TUY C;  1TNQ A;  1JSA A;  1DGU A;  1Y0V H;  1BT6 A;  3GK2 A;  2ZN9 A;  1WRZ A;  1C07 A;  5DKQ A;  3I5I B;  1XK4 C;  2K2F A;  1KFX S;  4GFT A;  4D1E A;  5KTY A;  2NCP A;  1F71 A;  2LV7 A;  1L2O C;  1N2D A;  3OHM B;  2L51 A;  2K7D A;  3WNX B;  4HRG A;  4YI9 A;  3TDU A;  2Y5I A;  1ZMZ A;  3EK4 A;  4JWQ A;  2L0P A;  2L2E A;  3NSL A;  2M8U A;  3NXA A;  1EH2 A;  1SL7 A;  1E8A A;  1NCZ A;  4OVN F;  3F45 A;  2ZRT A;  2D8N A;  3O78 A;  3TS5 B;  2G2B A;  1RFJ A;  2G9B A;  3BQ3 A;  3DVE A;  5JJG A;  1BMO A;  2M97 A;  1B7T Z;  1HT9 A;  1XFX O;  3CR2 A;  1AHR A;  2OS8 C;  3HX4 A;  4GPL B;  1BF5 A;  1W7I B;  5I2L A;  2KBM A;  5CSN A;  5PAL A;  1N0Y A;  1YRU B;  2BCX A;  3EVR A;  1ZFS A;  4QJ4 B;  2M7L A;  2NLN A;  1DJX A;  3CZT X;  2JNX A;  3TDI A;  1BU3 A;  2KI4 B;  1DJG A;  1NX1 A;  1UUS A;  1YX8 A;  3SIB A;  2DOQ A;  5FYX A;  2GV5 A;  1J7R A;  1IRJ A;  1CDP A;  1F4O A;  1Y6W A;  5AXI A;  2LUC A;  3DVM A;  3NSO A;  5B8I B;  4WRI A;  4PE7 A;  1SR6 C;  2JNF A;  5I8N A;  4YGA A;  1MF8 B;  3SJS A;  2O5G A;  1CB1 A;  1UP5 A;  4OCI A;  3A4U B;  4PAL A;  3FIA A;  2KDH A;  1QX7 A;  4PHM A;  1MQ1 A;  1ODB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...