3OX5A

Crystal structure of the calcium sensor calcium-binding protein 1 (cabp1)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
153
Chain Sequence
MDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 1
publication title Structural Basis for the Differential Effects of CaBP1 and Calmodulin on Ca(V)1.2 Calcium-Dependent Inactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium binding protein
total genus 49
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ox5A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ox5A02
1IJ5A 3OB1B 2HQWA 2JTTA 2M7NA 4E68A 2OTGC 3FIAA 2H61A 4QJ4B 5KTYA 2Y1MA 4MLWA 3KHEA 1CMGA 1K95A 1BR4B 1RECA 3LL8B 2KGBC 1RJVA 4PE0A 4BY4A 5BPJA 1YX7A 1QV1A 1ODBA 1KFUS 4MVFA 2PALA 1NCYA 4C0JA 1NCZA 4U8DA 5CPVA 1L2OB 2BE4A 1CLBA 3EKHA 1S6JA 2KAYA 3EK4A 1WRZA 3JVTC 4GFTA 1XFVO 1YTZC 2PSRA 1NIWA 3EVVA 2ZKMX 4HREE 4I5KA 4YGCB 1DJGA 1DJYA 2MHHA 3CLNA 2IS9A 3BOWB 1DF0B 1K2HA 1NX0A 4F0ZB 3OHMB 2HQ8A 1CFDA 2BCXA 4GGFC 4OKHA 2FCDA 2MJWB 2K0JA 2WCBA 1C07A 1N65A 1BLQA 1A75A 2KBMA 4XJKB 1B8LA 3EVRA 4PHKA 1RWYA 3CR4X 3CTNA 1OSAA 4GAOA 2KQ6A 1UWOA 1G4YR 1NWDA 2KFGA 3OB2B 2K7CA 1MXEA 1EXRA 3AAJA 5GQQC 1TCFA 2LC5A 4PE4A 4HSZA 2LCPA 1YX8A 3I5HB 3GK4X 1IQ3A 2CXJA 3PLFB 1CLLA 1GJYA 4PCWA 1ZFSA 2Q91A 1TNPA 1FPWA 4N5XA 1QVIZ 2JT8A 1RROA 1R6PA 4PHNA 3PM8A 5B8IB 4CFQA 2KBIA 1ALVA 3SG5A 1YVLA 5AEQA 4CIDA 1BJFA 1SYMA 3C1VA 4ORCB 1UUSA 1XFWO 1S6IA 1DJXA 4CLNA 1PSBA 1SNLA 1QX2A 2KFHA 2MAZA 4YGBB 1SY9A 2H2KA 3I5FB 2MBXA 1FI5A 1LKJA 2BE6A 4L9MA 4C0KA 1DT7B 1NYAA 1SMGA 5CSNA 2LMVA 3FS7A 3M0WA 5DKQA 1CKKA 3HX4A 2BCBA 2PMYA 5HKWA 2CTNA 3JTDC 1UURA 1CDMA 4A4BA 2LMUA 3D10A 4GGFA 4FQOA 2ISDA 3TDUA 3OP0A 1MWNA 4MRYA 1CFPA 1OE9B 1JF2A 2JTZA 1DJZA 3TZ1A 1BF5A 1YRTB 4I5NB 1JC2A 1LXFC 1G33A 1WDCC 3ICBA 1KQMB 5HKYA 4MN0A 2SASA 5D69A 4YGDB 2JNFA 2GV5A 2Q4UA 1EL4A 1B9AA 1KFUL 2JZIA 3WNXB 4MEWA 2KFFA 1NX1A 4D1EA 1BG1A 1NP8A 1BR1B 1V1FA 2FJUB 1JF0A 1Y1UA 3KEVA 3CZTX 3LK0A 1AUIB 2CBLA 1S1EA 4JWQA 2BKIB 2OS8C 1U5IA 2KSPA 4N1FA 1NPQA 4N1GA 2L51A 2CCMA 3DVEA 2Y4QA 4Q04A 1SCMB 3WXAA 5KU1A 3O78A 2LMTA 4CFRA 2I2RE 3GK1A 1MHOA 1EG4A 4CPVA 1XFZO 5CSJA 1LVCD 3TUYC 1TNQA 2JPTA 1OOJA 3VRNA 1SBJA 1XVJA 2M8UA 4FTGA 1H4BA 1J7QA 2M1KB 3BUWB 5FYXA 3DF0B 1XYDA 1FF1A 1UHIA 1SCVA 1Y6WA 3NSOA 2LNKA 5TNCA 1GGWA 3GK2A 3SG2A 1S36A 1SL9A 2P6BB 2BKHB 2EC6B 4NDDA 3TS5C 5KSZA 2F33A 1N2DA 3ZNIA 1UHHA 1J7PA 3I5IC 3O6BA 5HLOA 3BUNB 2JOJA 2MLEC 3CR2A 4M2PA 2E6WA 4XYNA 2JU0A 1SR6C 3DVMA 1OQPA 2K2AA 3D0YA 1KK8B 1QX5B 3NSKA 2HPSA 4I5LB 1M46A 1QXPA 2AUCA 1SK6D 3CS1A 4GGNA 3IQOA 1CDLA 5I8NA 1G8IA 3CGAA 1B47A 3MSEB 1J55A 5ER5A 1VRKA 2WCFA 1QVIY 1S5GZ 2EGDA 2FOTA 1B8RA 4HRHA 5CSIA 2MRDA 1C7WA 2BL0B 1AJ5A 1JFKA 5HLVA 2LUXA 2BCAA 2HF5A 1SKTA 2ZNDA 1QJTA 2M29A 2NXQA 1TN4A 2MLFC 1B8CA 1J1DA 1OZSA 3CWGA 4M2QA 4AOMA 1M45A 3A8RA 3KF9A 1W7JB 4AQJA 2KI6D 1FBVA 1AHRA 1WRLA 1CMFA 5D7FA 4DIRA 1DTLA 2B1UA 1EJ3A 4GUKA 1B4CA 4NDBA 3NSIA 2JULA 2ZFDA 3NXAA 1A2XA 1L2OC 2NZ0A 1B7TZ 2M9GA 2KI4B 2NCOA 3NSLA 1SL8A 1NCXA 1PVBA 2OPOA 4P2YB 1F4OA 1XO5A 4MZKA 1NX2A 2QACA 1IH0A 2LVJA 2K2FA 4MZJA 2LV7A 3F45A 4YGEB 3LK1A 1ALWA 1PSRA 1QX7A 1XFYO 1KCYA 2WCEA 2RGIA 4GPLB 1LA0A 5K89A 1CB1A 1DMOA 3AAKA 2O60A 3EK7A 1OZOA 4YGAA 3SIAA 3SG4A 5DKRA 2F3ZA 3BUMB 3WHTB 1FI6A 4PE1A 1BODA 4PDZA 4M2OA 1YURA 1M31A 1ZUZA 5HKZA 2L4IA 5AANA 1DVIA 5G08A 3TDZA 3OX6A 2TN4A 2F2OA 1XK4C 2K7OA 3DF0A 4C0LA 1BU3A 1WY9A 1UHJA 1Y1XA 2E30A 4UPGA 1JBAA 1QATA 1KWOB 1K93D 4YI9A 1IJ6A 3IF7A 1KQVA 1DJHA 2D8NA 5DKNA 1PRWA 3BYAA 2K8MB 4DUQA 1SPYA 3VRPA 1CLMA 2WNDA 2VRGA 1CTRA 4JQ0D 3VROA 4TNCA 1K96A 2ZNEA 4JPZB 1AVSA 2PASA 1IWQA 4MRXA 3PN7B 4DS7A 2JC2A 3I5GB 3EK8A 1A75B 2AAOA 2I94A 1M39A 4MZLA 3AKBA 1A4PA 1DGVA 2M97A 4I5JA 5F6TA 3E3RA 1JWDA 1X02A 3BOWA 4ICBA 1DF0A 2V53A 2OTGB 1QV0A 2FCEA 2LANA 5AFPA 1XFUO 1R2UA 1HT9A 1HQVA 2JWWA 1TNXA 5ER4X 1MQ1A 4OCIA 4PALA 1M63B 1AJ4A 1KQMC 2LVKA 4XJKA 3TS5B 3RLZA 1H8BA 1KK7Z 2PVBA 1S5GY 1E8AA 4WQ3A 1BT6A 2LAPA 1EG3A 1ZOTB 1JUOA 4A4CA 1AP4A 3O2PA 4OVNF 2MA2A 4PE7A 5J3XA 2JQ6A 1XK4A 1B1GA 3K21A 1TIZA 2R2IA 1XFXO 1YVHA 3JVTB 1L7ZA 4AQIA 3RM1A 3HCMA 3BUXB 1S3PA 1OMVA 1QTXA 1MR8A 2JXCA 3SIBA 1SRAA 1KFXS 3PSRA 2LHLA 5I2LA 1SCMC 5JJGA 4WQ2A 2QPTA 1K9KA 3CR5X 2LP3A 3PALA 1B7TY 1S26D 1QIVA 1CNPA 1F55A 1QLSA 2NCPA 4WRIA 1NSHA 4R1EA 3LCPC 3ZWHA 1F8HA 2EHBA 1UHKA 4YI8A 1RTP1 4NQGA 3PFVA 2NLNA 1K90D 1QLKA 2L4HA 1IRJA 1NX3A 1QS7A 1DGUA 3H4SE 2Y1NA 1PALA 2EC6C 2A4JA 2KGRA 1MF8B 1Y0VH 2LVIA 1EH2A 4YBHB 2M0RA 2GGMA 1WLZA 3KO0A 2I7AA 4NDCA 1LINA 2JRFA 1U5IB 2ZRSA 1RFJA 1BOCA 1K9PA 2M7LA 4ZCVA 2GGZA 2K7BA 2KYFA 1YUSA 1Y1AA 1UHNA 3AKAA 4ZCUA 1A03A 1KK8C 3DD4A 5IBWA 2WORA 2L5XB 1CFFA 3FWBA 4DCKA 2LE9B 1DJIA 4PHJA 4OV2A 2WC8A 1ZACA 2BBNA 1QASA 3DVJA 1SW8A 2O5GA 1W7IB 2LVVA 1WLMA 4BY5A 2BL0C 2G9BA 2LM5A 2M1UA 4YRUA 3VGOA 1YUTA 5PALA 2DOQA 3JTDB 2LLUA 2LLSA 4OR9B 3KPXA 3SG7A 1IQ5A 4GNKB 2AMIA 5CSFA 4PHMA 2CT9A 3BXKA 2F8PA 2LLTA 2LUCA 1AK8A 2ZN8A 4QJ3B 1J1EA 1NUBA 1TOPA 2JNXA 1WDCB 2KHNA 2L2EA 5AXIA 2JT3A 5JOLA 3TDIA 3WHUB 3GOFA 2WOSA 2L50A 1IKUA 2SCPA 1WRKA 2JT0A 2KAVA 2KI4C 3D0YB 3IQQA 2CNPA 3I5HC 1J7OA 4DRWA 3A4UB 1QIWA 5I2QA 1F54A 1CM4A 4ORAB 3VRQA 3EKJA 1CFCA 1CDNA 1YRUB 1CM1A 2ZN9A 4QJ5B 1BMOA 1KK7Y 1S6CA 4MSPA 2H61C 2KQYA 3DVKA 4GBAA 1YR5A 2OS8B 1CDPA 2KI6C 4ORBB 2LP2A 2KDHA 1KFXL 4P5OE 1IGVA 1N0YA 1JFJA 2M49B 3I5FC 3LLEA 3VRRA 1GGZA 1C7VA 1A29A 5I2OA 2KNEA 2F2PA 4IL1A 3TUYB 1LA3A 2I18A 1F4QA 4MBEA 4ETOA 2K61A 5AERA 1K9UA 3EVUA 2HETA 2KYCA 3O4YA 2ZRTA 1IG5A 2COLB 2L0PA 3FWCA 1K94A 2BECA 4USLA 1KWOC 1TTXA 1JSAA 1RK9A 1J7RA 2KAXA 2L98A 2PRUA 2Y5IA 1YUUA 1MUXA 1KSMA 2BBMA 2F3YA 1OMRA 3I5IB 1Q80A 3SG6A 1GQMA 3OX5A 1D1OA 1KSOA 2LHIA 1SR6B 2G2BA 2JXLA 1F70A 1SL7A 3PATA 2KOTA 3PN7C 1XA5A 4HRGA 1FW4A 3SG3A 1K8UA 1MXLC 3BUOB 1OMDA 2M3WA 3I5GC 3QRXA 3SJSA 1TNWA 5HYDA 1TCOB 1DJWA 1PULA 1UP5A 1V1GA 1PK0D 3BQ3A 1F71A 1ZMZA 1TRFA 1PVAA 2K7DA
chains in the Genus database with same CATH superfamily
1IJ5A 2WCMA 3OB1B 2HQWA 2JTTA 2M7NA 2WC5A 3S0AA 4E68A 2OTGC 3FIAA 2H61A 3B6XA 3SS5A 4QJ4B 5KTYA 2Y1MA 4MLWA 3KHEA 1CMGA 1K95A 1BR4B 1RECA 3BJHA 3LL8B 1QWVA 2KGBC 1RJVA 2PQLA 4PE0A 5FI7A 3L4LA 4BY4A 5I94A 5BPJA 1YX7A 1QV1A 1ODBA 1KFUS 3B86A 4MVFA 2PALA 1NCYA 4C0JA 1NCZA 4U8DA 1TUJA 5CPVA 1L2OB 5FI2A 2BE4A 1T14A 1CLBA 1ORGA 3EKHA 1S6JA 2KAYA 3S0FA 3EK4A 1WRZA 3JVTC 4GFTA 1XFVO 5FI6A 1YTZC 2PSRA 1NIWA 3EVVA 2ZKMX 4HREE 4I5KA 4YGCB 1DJGA 1DJYA 2MHHA 3CLNA 2IS9A 3BOWB 1DF0B 1K2HA 1NX0A 4F0ZB 3OHMB 2HQ8A 1CFDA 2BCXA 4GGFC 4OKHA 2FCDA 2MJWB 2K0JA 2WCBA 3CDNA 1C07A 1N65A 1BLQA 1A75A 2KBMA 4XJKB 3SS3A 1B8LA 3EVRA 4PHKA 1RWYA 3CR4X 3S0DA 3CTNA 1OSAA 4GAOA 2KQ6A 1UWOA 1G4YR 1NWDA 2KFGA 3OB2B 2K7CA 3O4XA 1MXEA 1EXRA 3AAJA 5GQQC 1TCFA 2LC5A 4PE4A 4HSZA 2LCPA 3FE6A 1YX8A 3I5HB 3GK4X 1IQ3A 2CXJA 3PLFB 1CLLA 1GJYA 4PCWA 1ZFSA 2Q91A 1TNPA 1FPWA 4N5XA 1QVIZ 2JT8A 1RROA 1R6PA 4PHNA 3PM8A 3DZTA 4CFQA 2KBIA 1ALVA 5B8IB 3SG5A 1YVLA 5AEQA 4CIDA 1BJFA 3QMEA 1SYMA 3C1VA 4ORCB 1UUSA 1XFWO 1S6IA 1DJXA 4CLNA 1PSBA 1LS8A 1QX2A 1SNLA 2KFHA 2MAZA 4YGBB 1SY9A 2H2KA 3I5FB 2MBXA 1FI5A 1LKJA 2BE6A 4L9MA 4C0KA 1DT7B 1NYAA 1SMGA 5CSNA 2LMVA 3FS7A 3M0WA 5DKQA 1CKKA 3HX4A 2BCBA 2PMYA 5HKWA 3L4AA 2CTNA 3JTDC 1UURA 1CDMA 4A4BA 2LMUA 3D10A 4GGFA 4FQOA 2ISDA 3TDUA 3OP0A 1MWNA 4MRYA 1CFPA 1OE9B 1JF2A 2JTZA 1DJZA 3R1PA 3TZ1A 1YRTB 4I5NB 1BF5A 1JC2A 1LXFC 1G33A 1WDCC 5D3OA 3ICBA 1KQMB 4INXA 5HKYA 4MN0A 2SASA 5D69A 4YGDB 2JNFA 2GV5A 2PYQA 2Q4UA 3FE8A 1EL4A 1B9AA 1OOGA 1KFUL 2JZIA 3Q8IA 3WNXB 3D75A 4INWA 2KFFA 4MEWA 1NX1A 4D1EA 1BG1A 1NP8A 1BR1B 1V1FA 2FJUB 1JF0A 1Y1UA 3KEVA 2KPHA 3CZTX 3LK0A 1AUIB 2CBLA 1S1EA 4JWQA 2BKIB 2OS8C 1U5IA 2KSPA 4N1FA 1NPQA 4N1GA 2L51A 2CCMA 3DVEA 2Y4QA 1SSEB 4Q04A 1GM0A 1SCMB 3WXAA 5KU1A 3O78A 2LMTA 2K60A 2I2RE 3GK1A 4CFRA 1MHOA 1EG4A 4CPVA 1XFZO 3CZ1A 5CSJA 1LVCD 3TUYC 1TNQA 2JPTA 1OOJA 1OOFA 2BNXA 3VRNA 1SBJA 1XVJA 2M8UA 3B88A 4FTGA 1H4BA 1J7QA 3V2LA 3R72A 2M1KB 3BUWB 5FYXA 3DF0B 1XYDA 3UNWA 3FE9A 1UHIA 1SCVA 1Y6WA 1FF1A 3NSOA 2LNKA 5TNCA 1GGWA 3GK2A 3SG2A 1S36A 1SL9A 2P6BB 2BKHB 2EC6B 4NDDA 2FJYA 3TS5C 2F33A 1N2DA 3ZNIA 5KSZA 3SS4A 1UHHA 1J7PA 3I5IC 3O6BA 4JKTA 5HLOA 3B7AA 3BUNB 2JOJA 2MLEC 3CR2A 4M2PA 2E6WA 4XYNA 4JD9A 2JU0A 1SR6C 3DVMA 5DICA 3NHIA 3CZ2A 1OQPA 2K2AA 3D0YA 1KK8B 1QX5B 3NSKA 2HPSA 4I5LB 1DQEA 1M46A 1QXPA 2AUCA 1SK6D 3CS1A 4GGNA 3IQOA 1CDLA 5I8NA 1G8IA 2QEOA 3CGAA 1B47A 3MSEB 1J55A 5ER5A 1VRKA 2WCFA 1QVIY 1S5GZ 2EGDA 3DY9A 2FOTA 1B8RA 4HRHA 5CSIA 1Z4HA 1C7WA 2MRDA 2BL0B 1AJ5A 1JFKA 5HLVA 2LUXA 3UO9A 2BCAA 2HF5A 1SKTA 2ZNDA 1QJTA 2M29A 2WCJA 2NXQA 1TN4A 2MLFC 1B8CA 1J1DA 1OZSA 2WCKA 3CWGA 4M2QA 4AOMA 1M45A 3A8RA 3KF9A 1W7JB 4AQJA 2KI6D 1FBVA 1AHRA 1WRLA 1CMFA 5D7FA 4DIRA 1DTLA 2B1UA 1EJ3A 4GUKA 1B4CA 3OBVA 4NDBA 3NSIA 2JULA 2ZFDA 3NXAA 1A2XA 1L2OC 2NZ0A 1B7TZ 2M9GA 2KI4B 2NCOA 3NHTA 3NSLA 1SL8A 3S0EA 3CABA 1NCXA 1PVBA 2OPOA 4P2YB 1F4OA 1XO5A 4MZKA 1NX2A 2QACA 1IH0A 4KYNA 2LVJA 2K2FA 4MZJA 2LV7A 3F45A 2BAPA 4YGEB 3LK1A 1DELA 1ALWA 1PSRA 1QX7A 1XFYO 1C3ZA 1KCYA 2WCEA 2RGIA 4GPLB 2WC6A 1LA0A 5K89A 1CB1A 1DMOA 3AAKA 2O60A 3EK7A 1OZOA 4YGAA 3SIAA 3SG4A 5DKRA 2F3ZA 3BUMB 3WHTB 1FI6A 4PE1A 1BODA 4PDZA 4M2OA 1YURA 3D74A 1M31A 1ZUZA 5HKZA 2L4IA 5AANA 1DVIA 5G08A 3TDZA 3OX6A 2TN4A 2F2OA 3BFAA 1XK4C 2K7OA 3DF0A 4C0LA 1BU3A 1WY9A 1UHJA 1Y1XA 2E30A 3K1EA 3EG5B 4UPGA 1QATA 1JBAA 1KWOB 1K93D 4YI9A 1IJ6A 3IF7A 1KQVA 1DJHA 2D8NA 5DKNA 3VB1A 3L47A 1PRWA 3BYAA 2K8MB 4DUQA 1SPYA 2WCHA 3VRPA 1CLMA 2WNDA 2VRGA 1CTRA 4JQ0D 3VROA 2L5YA 1K96A 4TNCA 2ZNEA 4JPZB 1AVSA 2PASA 1IWQA 4MRXA 3PN7B 3R1OA 4DS7A 2JC2A 3I5GB 3EK8A 1A75B 5EL2A 2AAOA 2I94A 1M39A 4MZLA 3AKBA 1A4PA 1DGVA 2M97A 4I5JA 5F6TA 3E3RA 1JWDA 1X02A 3BOWA 4ICBA 1DF0A 2V53A 2OTGB 3R1VA 1QV0A 2FCEA 2LANA 5AFPA 1XFUO 1R2UA 1HT9A 1HQVA 2JWWA 1Z2CB 1TNXA 5ER4X 1MQ1A 4OCIA 4PALA 1M63B 1AJ4A 1KQMC 2LVKA 4XJKA 3TS5B 3RLZA 2YGUA 1H8BA 1KK7Z 2PVBA 1S5GY 1E8AA 3DXLA 4WQ3A 1BT6A 2LAPA 1EG3A 1ZOTB 1JUOA 4A4CA 1AP4A 3O2PA 4OVNF 2MA2A 4PE7A 5J3XA 2JQ6A 1XK4A 1B1GA 3K21A 1TIZA 2R2IA 3D76A 3N7HA 1XFXO 1YVHA 3JVTB 1P28A 1L7ZA 4AQIA 1OOHA 4OZDA 3RM1A 3HCMA 3BUXB 1S3PA 1OMVA 1QTXA 1MR8A 2JXCA 3SIBA 2KLEA 1SRAA 1KFXS 3PSRA 2LHLA 5I2LA 1SCMC 5JJGA 4WQ2A 2QPTA 1K9KA 3CR5X 2LP3A 3PALA 1B7TY 1S26D 1QIVA 1CNPA 1F55A 1QLSA 2NCPA 3D78A 4WRIA 1NSHA 4R1EA 3LCPC 3ZWHA 1F8HA 2EHBA 1UHKA 4YI8A 1RTP1 4NQGA 3PFVA 4PT1A 2NLNA 1K90D 1QLKA 2L4HA 1IRJA 1NX3A 1QS7A 1IIOA 1DGUA 3H4SE 3PJIA 2Y1NA 1PALA 2EC6C 2A4JA 2KGRA 1MF8B 1Y0VH 4F7FA 2LVIA 1EH2A 4YBHB 2M0RA 2GGMA 1WLZA 3KO0A 2I7AA 4NDCA 1LINA 3D73A 4FQTA 2JRFA 1U5IB 5HL1A 2ZRSA 2H8VA 3D77A 1RFJA 1BOCA 1K9PA 2M7LA 4ZCVA 2GGZA 2K7BA 2KYFA 1YUSA 1Y1AA 1UHNA 3AKAA 4ZCUA 3B87A 1A03A 1KK8C 3DD4A 5IBWA 2P71A 2L5XB 2WORA 1DC1A 3FWBA 1CFFA 4DCKA 3S0BA 2LE9B 1DJIA 4PHJA 4OV2A 2WC8A 1ZACA 2BBNA 1QASA 3DVJA 1SW8A 2O5GA 1W7IB 2LVVA 1WLMA 4BY5A 2BL0C 2G9BA 2LM5A 2M1UA 4YRUA 2WCLA 3VGOA 1YUTA 5PALA 2DOQA 3JTDB 2LLUA 2LLSA 3DYEA 1C3YA 4OR9B 1OW4A 1TUZA 3KPXA 3SG7A 1XFRA 1IQ5A 4GNKB 2AMIA 5CSFA 4PHMA 2CT9A 3IVTA 3BXKA 2F8PA 2LLTA 2LUCA 1AK8A 2ZN8A 4QJ3B 1J1EA 1NUBA 1TOPA 2JNXA 1WDCB 2KHNA 2L2EA 5AXIA 2JT3A 5JOLA 3TDIA 3WHUB 3GOFA 3BFHA 1OOIX 2WOSA 1TWOA 2L50A 1IKUA 2SCPA 1WRKA 2JT0A 2KAVA 2KI4C 3D0YB 3IQQA 1W9ZA 2CNPA 3I5HC 1J7OA 4DRWA 2QEVA 3A4UB 1QIWA 5I2QA 1F54A 1CM4A 4ORAB 3VRQA 3EKJA 1CFCA 1CDNA 1YRUB 1CM1A 2JPOA 2ZN9A 4QJ5B 1BMOA 1KK7Y 1S6CA 4MSPA 2ERBA 2H61C 2KQYA 3DVKA 4GBAA 1YR5A 2OS8B 1CDPA 2KI6C 4ORBB 2LP2A 2KDHA 1KFXL 4P5OE 1IGVA 1N0YA 1JFJA 2M49B 2P70A 2KLDA 3I5FC 3LLEA 3VRRA 1GGZA 4IJ7A 2QEBA 1C7VA 1A29A 5I2OA 2KNEA 2F2PA 4IL1A 3TUYB 2QEHA 1LA3A 2I18A 1F4QA 4MBEA 4ETOA 2K61A 5AERA 1K9UA 3EVUA 2HETA 2KYCA 3O4YA 2ZRTA 1IG5A 2COLB 2L0PA 3FWCA 1K94A 2BECA 4USLA 1KWOC 1TTXA 1JSAA 1RK9A 1J7RA 2KAXA 2L98A 2PRUA 2Y5IA 3CYZA 1YUUA 3PM2A 2L2CA 1MUXA 1KSMA 2BBMA 2F3YA 1OMRA 3I5IB 1Q80A 3SG6A 1GQMA 3OX5A 1D1OA 3NGVA 1KSOA 3S0GA 3BFBA 2LHIA 1SR6B 2G2BA 2JXLA 1F70A 1SL7A 3PATA 2KOTA 3PN7C 1XA5A 4HRGA 1FW4A 3SG3A 1K8UA 1MXLC 3BUOB 1OMDA 2M3WA 3I5GC 3OGNA 3QRXA 1TNWA 3SJSA 5HYDA 3RZSA 1TCOB 1DJWA 2QDIA 1DEKA 1PULA 1UP5A 1V1GA 1PK0D 3BQ3A 1F71A 2GTEA 3CZ0A 1ZMZA 1TRFA 1PVAA 2K7DA
chains in the Genus database with same CATH topology
1IJ5A 3OB1B 2HQWA 2JTTA 2M7NA 4E68A 2OTGC 3FIAA 2H61A 4QJ4B 5KTYA 2Y1MA 4MLWA 3KHEA 1CMGA 1K95A 1BR4B 1RECA 3LL8B 2KGBC 1RJVA 4PE0A 4BY4A 5BPJA 1YX7A 1QV1A 1ODBA 1KFUS 4MVFA 2PALA 1NCYA 4C0JA 1NCZA 4U8DA 5CPVA 1L2OB 2BE4A 1CLBA 3EKHA 1S6JA 2KAYA 3EK4A 1WRZA 3JVTC 4GFTA 1XFVO 1YTZC 2PSRA 1NIWA 3EVVA 2ZKMX 4HREE 4I5KA 4YGCB 1DJGA 1DJYA 2MHHA 3CLNA 2IS9A 3BOWB 1DF0B 1K2HA 1NX0A 4F0ZB 3OHMB 2HQ8A 1CFDA 2BCXA 4GGFC 4OKHA 2FCDA 2MJWB 2K0JA 2WCBA 1C07A 1N65A 1BLQA 1A75A 2KBMA 4XJKB 1B8LA 3EVRA 4PHKA 1RWYA 3CR4X 3CTNA 1OSAA 4GAOA 2KQ6A 1UWOA 1G4YR 1NWDA 2KFGA 3OB2B 2K7CA 1MXEA 1EXRA 3AAJA 5GQQC 1TCFA 2LC5A 4PE4A 4HSZA 2LCPA 1YX8A 3I5HB 3GK4X 1IQ3A 2CXJA 3PLFB 1CLLA 1GJYA 4PCWA 1ZFSA 2Q91A 1TNPA 1FPWA 4N5XA 1QVIZ 2JT8A 1RROA 1R6PA 4PHNA 3PM8A 5B8IB 4CFQA 2KBIA 1ALVA 3SG5A 1YVLA 5AEQA 4CIDA 1BJFA 1SYMA 3C1VA 4ORCB 1UUSA 1XFWO 1S6IA 1DJXA 4CLNA 1PSBA 1SNLA 1QX2A 2KFHA 2MAZA 4YGBB 1SY9A 2H2KA 3I5FB 2MBXA 1FI5A 1LKJA 2BE6A 4L9MA 4C0KA 1DT7B 1NYAA 1SMGA 5CSNA 2LMVA 3FS7A 3M0WA 5DKQA 1CKKA 3HX4A 2BCBA 2PMYA 5HKWA 2CTNA 3JTDC 1UURA 1CDMA 4A4BA 2LMUA 3D10A 4GGFA 4FQOA 2ISDA 3TDUA 3OP0A 1MWNA 4MRYA 1CFPA 1OE9B 1JF2A 2JTZA 1DJZA 3TZ1A 1BF5A 1YRTB 4I5NB 1JC2A 1LXFC 1G33A 1WDCC 3ICBA 1KQMB 5HKYA 4MN0A 2SASA 5D69A 4YGDB 2JNFA 2GV5A 2Q4UA 1EL4A 1B9AA 1KFUL 2JZIA 3WNXB 4MEWA 2KFFA 1NX1A 4D1EA 1BG1A 1NP8A 1BR1B 1V1FA 2FJUB 1JF0A 1Y1UA 3KEVA 3CZTX 3LK0A 1AUIB 2CBLA 1S1EA 4JWQA 2BKIB 2OS8C 1U5IA 2KSPA 4N1FA 1NPQA 4N1GA 2L51A 2CCMA 3DVEA 2Y4QA 4Q04A 1SCMB 3WXAA 5KU1A 3O78A 2LMTA 4CFRA 2I2RE 3GK1A 1MHOA 1EG4A 4CPVA 1XFZO 5CSJA 1LVCD 3TUYC 1TNQA 2JPTA 1OOJA 3VRNA 1SBJA 1XVJA 2M8UA 4FTGA 1H4BA 1J7QA 2M1KB 3BUWB 5FYXA 3DF0B 1XYDA 1FF1A 1UHIA 1SCVA 1Y6WA 3NSOA 2LNKA 5TNCA 1GGWA 3GK2A 3SG2A 1S36A 1SL9A 2P6BB 2BKHB 2EC6B 4NDDA 3TS5C 5KSZA 2F33A 1N2DA 3ZNIA 1UHHA 1J7PA 3I5IC 3O6BA 5HLOA 3BUNB 2JOJA 2MLEC 3CR2A 4M2PA 2E6WA 4XYNA 2JU0A 1SR6C 3DVMA 1OQPA 2K2AA 3D0YA 1KK8B 1QX5B 3NSKA 2HPSA 4I5LB 1M46A 1QXPA 2AUCA 1SK6D 3CS1A 4GGNA 3IQOA 1CDLA 5I8NA 1G8IA 3CGAA 1B47A 3MSEB 1J55A 5ER5A 1VRKA 2WCFA 1QVIY 1S5GZ 2EGDA 2FOTA 1B8RA 4HRHA 5CSIA 2MRDA 1C7WA 2BL0B 1AJ5A 1JFKA 5HLVA 2LUXA 2BCAA 2HF5A 1SKTA 2ZNDA 1QJTA 2M29A 2NXQA 1TN4A 2MLFC 1B8CA 1J1DA 1OZSA 3CWGA 4M2QA 4AOMA 1M45A 3A8RA 3KF9A 1W7JB 4AQJA 2KI6D 1FBVA 1AHRA 1WRLA 1CMFA 5D7FA 4DIRA 1DTLA 2B1UA 1EJ3A 4GUKA 1B4CA 4NDBA 3NSIA 2JULA 2ZFDA 3NXAA 1A2XA 1L2OC 2NZ0A 1B7TZ 2M9GA 2KI4B 2NCOA 3NSLA 1SL8A 1NCXA 1PVBA 2OPOA 4P2YB 1F4OA 1XO5A 4MZKA 1NX2A 2QACA 1IH0A 2LVJA 2K2FA 4MZJA 2LV7A 3F45A 4YGEB 3LK1A 1ALWA 1PSRA 1QX7A 1XFYO 1KCYA 2WCEA 2RGIA 4GPLB 1LA0A 5K89A 1CB1A 1DMOA 3AAKA 2O60A 3EK7A 1OZOA 4YGAA 3SIAA 3SG4A 5DKRA 2F3ZA 3BUMB 3WHTB 1FI6A 4PE1A 1BODA 4PDZA 4M2OA 1YURA 1M31A 1ZUZA 5HKZA 2L4IA 5AANA 1DVIA 5G08A 3TDZA 3OX6A 2TN4A 2F2OA 1XK4C 2K7OA 3DF0A 4C0LA 1BU3A 1WY9A 1UHJA 1Y1XA 2E30A 4UPGA 1JBAA 1QATA 1KWOB 1K93D 4YI9A 1IJ6A 3IF7A 1KQVA 1DJHA 2D8NA 5DKNA 1PRWA 3BYAA 2K8MB 4DUQA 1SPYA 3VRPA 1CLMA 2WNDA 2VRGA 1CTRA 4JQ0D 3VROA 4TNCA 1K96A 2ZNEA 4JPZB 1AVSA 2PASA 1IWQA 4MRXA 3PN7B 4DS7A 2JC2A 3I5GB 3EK8A 1A75B 2AAOA 2I94A 1M39A 4MZLA 3AKBA 1A4PA 1DGVA 2M97A 4I5JA 5F6TA 3E3RA 1JWDA 1X02A 3BOWA 4ICBA 1DF0A 2V53A 2OTGB 1QV0A 2FCEA 2LANA 5AFPA 1XFUO 1R2UA 1HT9A 1HQVA 2JWWA 1TNXA 5ER4X 1MQ1A 4OCIA 4PALA 1M63B 1AJ4A 1KQMC 2LVKA 4XJKA 3TS5B 3RLZA 1H8BA 1KK7Z 2PVBA 1S5GY 1E8AA 4WQ3A 1BT6A 2LAPA 1EG3A 1ZOTB 1JUOA 4A4CA 1AP4A 3O2PA 4OVNF 2MA2A 4PE7A 5J3XA 2JQ6A 1XK4A 1B1GA 3K21A 1TIZA 2R2IA 1XFXO 1YVHA 3JVTB 1L7ZA 4AQIA 3RM1A 3HCMA 3BUXB 1S3PA 1OMVA 1QTXA 1MR8A 2JXCA 3SIBA 1SRAA 1KFXS 3PSRA 2LHLA 5I2LA 1SCMC 5JJGA 4WQ2A 2QPTA 1K9KA 3CR5X 2LP3A 3PALA 1B7TY 1S26D 1QIVA 1CNPA 1F55A 1QLSA 2NCPA 4WRIA 1NSHA 4R1EA 3LCPC 3ZWHA 1F8HA 2EHBA 1UHKA 4YI8A 1RTP1 4NQGA 3PFVA 2NLNA 1K90D 1QLKA 2L4HA 1IRJA 1NX3A 1QS7A 1DGUA 3H4SE 2Y1NA 1PALA 2EC6C 2A4JA 2KGRA 1MF8B 1Y0VH 2LVIA 1EH2A 4YBHB 2M0RA 2GGMA 1WLZA 3KO0A 2I7AA 4NDCA 1LINA 2JRFA 1U5IB 2ZRSA 1RFJA 1BOCA 1K9PA 2M7LA 4ZCVA 2GGZA 2K7BA 2KYFA 1YUSA 1Y1AA 1UHNA 3AKAA 4ZCUA 1A03A 1KK8C 3DD4A 5IBWA 2WORA 2L5XB 1CFFA 3FWBA 4DCKA 2LE9B 1DJIA 4PHJA 4OV2A 2WC8A 1ZACA 2BBNA 1QASA 3DVJA 1SW8A 2O5GA 1W7IB 2LVVA 1WLMA 4BY5A 2BL0C 2G9BA 2LM5A 2M1UA 4YRUA 3VGOA 1YUTA 5PALA 2DOQA 3JTDB 2LLUA 2LLSA 4OR9B 3KPXA 3SG7A 1IQ5A 4GNKB 2AMIA 5CSFA 4PHMA 2CT9A 3BXKA 2F8PA 2LLTA 2LUCA 1AK8A 2ZN8A 4QJ3B 1J1EA 1NUBA 1TOPA 2JNXA 1WDCB 2KHNA 2L2EA 5AXIA 2JT3A 5JOLA 3TDIA 3WHUB 3GOFA 2WOSA 2L50A 1IKUA 2SCPA 1WRKA 2JT0A 2KAVA 2KI4C 3D0YB 3IQQA 2CNPA 3I5HC 1J7OA 4DRWA 3A4UB 1QIWA 5I2QA 1F54A 1CM4A 4ORAB 3VRQA 3EKJA 1CFCA 1CDNA 1YRUB 1CM1A 2ZN9A 4QJ5B 1BMOA 1KK7Y 1S6CA 4MSPA 2H61C 2KQYA 3DVKA 4GBAA 1YR5A 2OS8B 1CDPA 2KI6C 4ORBB 2LP2A 2KDHA 1KFXL 4P5OE 1IGVA 1N0YA 1JFJA 2M49B 3I5FC 3LLEA 3VRRA 1GGZA 1C7VA 1A29A 5I2OA 2KNEA 2F2PA 4IL1A 3TUYB 1LA3A 2I18A 1F4QA 4MBEA 4ETOA 2K61A 5AERA 1K9UA 3EVUA 2HETA 2KYCA 3O4YA 2ZRTA 1IG5A 2COLB 2L0PA 3FWCA 1K94A 2BECA 4USLA 1KWOC 1TTXA 1JSAA 1RK9A 1J7RA 2KAXA 2L98A 2PRUA 2Y5IA 1YUUA 1MUXA 1KSMA 2BBMA 2F3YA 1OMRA 3I5IB 1Q80A 3SG6A 1GQMA 3OX5A 1D1OA 1KSOA 2LHIA 1SR6B 2G2BA 2JXLA 1F70A 1SL7A 3PATA 2KOTA 3PN7C 1XA5A 4HRGA 1FW4A 3SG3A 1K8UA 1MXLC 3BUOB 1OMDA 2M3WA 3I5GC 3QRXA 3SJSA 1TNWA 5HYDA 1TCOB 1DJWA 1PULA 1UP5A 1V1GA 1PK0D 3BQ3A 1F71A 1ZMZA 1TRFA 1PVAA 2K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  3OB1 B;  2HQW A;  2JTT A;  2M7N A;  4E68 A;  2OTG C;  3FIA A;  2H61 A;  4QJ4 B;  5KTY A;  2Y1M A;  4MLW A;  3KHE A;  1CMG A;  1K95 A;  1BR4 B;  1REC A;  3LL8 B;  2KGB C;  1RJV A;  4PE0 A;  4BY4 A;  5BPJ A;  1YX7 A;  1QV1 A;  1ODB A;  1KFU S;  4MVF A;  2PAL A;  1NCY A;  4C0J A;  1NCZ A;  4U8D A;  5CPV A;  1L2O B;  2BE4 A;  1CLB A;  3EKH A;  1S6J A;  2KAY A;  3EK4 A;  1WRZ A;  3JVT C;  4GFT A;  1XFV O;  1YTZ C;  2PSR A;  1NIW A;  3EVV A;  2ZKM X;  4HRE E;  4I5K A;  4YGC B;  1DJG A;  1DJY A;  2MHH A;  3CLN A;  2IS9 A;  3BOW B;  1DF0 B;  1K2H A;  1NX0 A;  4F0Z B;  3OHM B;  2HQ8 A;  1CFD A;  2BCX A;  4GGF C;  4OKH A;  2FCD A;  2MJW B;  2K0J A;  2WCB A;  1C07 A;  1N65 A;  1BLQ A;  1A75 A;  2KBM A;  4XJK B;  1B8L A;  3EVR A;  4PHK A;  1RWY A;  3CR4 X;  3CTN A;  1OSA A;  4GAO A;  2KQ6 A;  1UWO A;  1G4Y R;  1NWD A;  2KFG A;  3OB2 B;  2K7C A;  1MXE A;  1EXR A;  3AAJ A;  5GQQ C;  1TCF A;  2LC5 A;  4PE4 A;  4HSZ A;  2LCP A;  1YX8 A;  3I5H B;  3GK4 X;  1IQ3 A;  2CXJ A;  3PLF B;  1CLL A;  1GJY A;  4PCW A;  1ZFS A;  2Q91 A;  1TNP A;  1FPW A;  4N5X A;  1QVI Z;  2JT8 A;  1RRO A;  1R6P A;  4PHN A;  3PM8 A;  5B8I B;  4CFQ A;  2KBI A;  1ALV A;  3SG5 A;  1YVL A;  5AEQ A;  4CID A;  1BJF A;  1SYM A;  3C1V A;  4ORC B;  1UUS A;  1XFW O;  1S6I A;  1DJX A;  4CLN A;  1PSB A;  1SNL A;  1QX2 A;  2KFH A;  2MAZ A;  4YGB B;  1SY9 A;  2H2K A;  3I5F B;  2MBX A;  1FI5 A;  1LKJ A;  2BE6 A;  4L9M A;  4C0K A;  1DT7 B;  1NYA A;  1SMG A;  5CSN A;  2LMV A;  3FS7 A;  3M0W A;  5DKQ A;  1CKK A;  3HX4 A;  2BCB A;  2PMY A;  5HKW A;  2CTN A;  3JTD C;  1UUR A;  1CDM A;  4A4B A;  2LMU A;  3D10 A;  4GGF A;  4FQO A;  2ISD A;  3TDU A;  3OP0 A;  1MWN A;  4MRY A;  1CFP A;  1OE9 B;  1JF2 A;  2JTZ A;  1DJZ A;  3TZ1 A;  1BF5 A;  1YRT B;  4I5N B;  1JC2 A;  1LXF C;  1G33 A;  1WDC C;  3ICB A;  1KQM B;  5HKY A;  4MN0 A;  2SAS A;  5D69 A;  4YGD B;  2JNF A;  2GV5 A;  2Q4U A;  1EL4 A;  1B9A A;  1KFU L;  2JZI A;  3WNX B;  4MEW A;  2KFF A;  1NX1 A;  4D1E A;  1BG1 A;  1NP8 A;  1BR1 B;  1V1F A;  2FJU B;  1JF0 A;  1Y1U A;  3KEV A;  3CZT X;  3LK0 A;  1AUI B;  2CBL A;  1S1E A;  4JWQ A;  2BKI B;  2OS8 C;  1U5I A;  2KSP A;  4N1F A;  1NPQ A;  4N1G A;  2L51 A;  2CCM A;  3DVE A;  2Y4Q A;  4Q04 A;  1SCM B;  3WXA A;  5KU1 A;  3O78 A;  2LMT A;  4CFR A;  2I2R E;  3GK1 A;  1MHO A;  1EG4 A;  4CPV A;  1XFZ O;  5CSJ A;  1LVC D;  3TUY C;  1TNQ A;  2JPT A;  1OOJ A;  3VRN A;  1SBJ A;  1XVJ A;  2M8U A;  4FTG A;  1H4B A;  1J7Q A;  2M1K B;  3BUW B;  5FYX A;  3DF0 B;  1XYD A;  1FF1 A;  1UHI A;  1SCV A;  1Y6W A;  3NSO A;  2LNK A;  5TNC A;  1GGW A;  3GK2 A;  3SG2 A;  1S36 A;  1SL9 A;  2P6B B;  2BKH B;  2EC6 B;  4NDD A;  3TS5 C;  5KSZ A;  2F33 A;  1N2D A;  3ZNI A;  1UHH A;  1J7P A;  3I5I C;  3O6B A;  5HLO A;  3BUN B;  2JOJ A;  2MLE C;  3CR2 A;  4M2P A;  2E6W A;  4XYN A;  2JU0 A;  1SR6 C;  3DVM A;  1OQP A;  2K2A A;  3D0Y A;  1KK8 B;  1QX5 B;  3NSK A;  2HPS A;  4I5L B;  1M46 A;  1QXP A;  2AUC A;  1SK6 D;  3CS1 A;  4GGN A;  3IQO A;  1CDL A;  5I8N A;  1G8I A;  3CGA A;  1B47 A;  3MSE B;  1J55 A;  5ER5 A;  1VRK A;  2WCF A;  1QVI Y;  1S5G Z;  2EGD A;  2FOT A;  1B8R A;  4HRH A;  5CSI A;  2MRD A;  1C7W A;  2BL0 B;  1AJ5 A;  1JFK A;  5HLV A;  2LUX A;  2BCA A;  2HF5 A;  1SKT A;  2ZND A;  1QJT A;  2M29 A;  2NXQ A;  1TN4 A;  2MLF C;  1B8C A;  1J1D A;  1OZS A;  3CWG A;  4M2Q A;  4AOM A;  1M45 A;  3A8R A;  3KF9 A;  1W7J B;  4AQJ A;  2KI6 D;  1FBV A;  1AHR A;  1WRL A;  1CMF A;  5D7F A;  4DIR A;  1DTL A;  2B1U A;  1EJ3 A;  4GUK A;  1B4C A;  4NDB A;  3NSI A;  2JUL A;  2ZFD A;  3NXA A;  1A2X A;  1L2O C;  2NZ0 A;  1B7T Z;  2M9G A;  2KI4 B;  2NCO A;  3NSL A;  1SL8 A;  1NCX A;  1PVB A;  2OPO A;  4P2Y B;  1F4O A;  1XO5 A;  4MZK A;  1NX2 A;  2QAC A;  1IH0 A;  2LVJ A;  2K2F A;  4MZJ A;  2LV7 A;  3F45 A;  4YGE B;  3LK1 A;  1ALW A;  1PSR A;  1QX7 A;  1XFY O;  1KCY A;  2WCE A;  2RGI A;  4GPL B;  1LA0 A;  5K89 A;  1CB1 A;  1DMO A;  3AAK A;  2O60 A;  3EK7 A;  1OZO A;  4YGA A;  3SIA A;  3SG4 A;  5DKR A;  2F3Z A;  3BUM B;  3WHT B;  1FI6 A;  4PE1 A;  1BOD A;  4PDZ A;  4M2O A;  1YUR A;  1M31 A;  1ZUZ A;  5HKZ A;  2L4I A;  5AAN A;  1DVI A;  5G08 A;  3TDZ A;  3OX6 A;  2TN4 A;  2F2O A;  1XK4 C;  2K7O A;  3DF0 A;  4C0L A;  1BU3 A;  1WY9 A;  1UHJ A;  1Y1X A;  2E30 A;  4UPG A;  1JBA A;  1QAT A;  1KWO B;  1K93 D;  4YI9 A;  1IJ6 A;  3IF7 A;  1KQV A;  1DJH A;  2D8N A;  5DKN A;  1PRW A;  3BYA A;  2K8M B;  4DUQ A;  1SPY A;  3VRP A;  1CLM A;  2WND A;  2VRG A;  1CTR A;  4JQ0 D;  3VRO A;  4TNC A;  1K96 A;  2ZNE A;  4JPZ B;  1AVS A;  2PAS A;  1IWQ A;  4MRX A;  3PN7 B;  4DS7 A;  2JC2 A;  3I5G B;  3EK8 A;  1A75 B;  2AAO A;  2I94 A;  1M39 A;  4MZL A;  3AKB A;  1A4P A;  1DGV A;  2M97 A;  4I5J A;  5F6T A;  3E3R A;  1JWD A;  1X02 A;  3BOW A;  4ICB A;  1DF0 A;  2V53 A;  2OTG B;  1QV0 A;  2FCE A;  2LAN A;  5AFP A;  1XFU O;  1R2U A;  1HT9 A;  1HQV A;  2JWW A;  1TNX A;  5ER4 X;  1MQ1 A;  4OCI A;  4PAL A;  1M63 B;  1AJ4 A;  1KQM C;  2LVK A;  4XJK A;  3TS5 B;  3RLZ A;  1H8B A;  1KK7 Z;  2PVB A;  1S5G Y;  1E8A A;  4WQ3 A;  1BT6 A;  2LAP A;  1EG3 A;  1ZOT B;  1JUO A;  4A4C A;  1AP4 A;  3O2P A;  4OVN F;  2MA2 A;  4PE7 A;  5J3X A;  2JQ6 A;  1XK4 A;  1B1G A;  3K21 A;  1TIZ A;  2R2I A;  1XFX O;  1YVH A;  3JVT B;  1L7Z A;  4AQI A;  3RM1 A;  3HCM A;  3BUX B;  1S3P A;  1OMV A;  1QTX A;  1MR8 A;  2JXC A;  3SIB A;  1SRA A;  1KFX S;  3PSR A;  2LHL A;  5I2L A;  1SCM C;  5JJG A;  4WQ2 A;  2QPT A;  1K9K A;  3CR5 X;  2LP3 A;  3PAL A;  1B7T Y;  1S26 D;  1QIV A;  1CNP A;  1F55 A;  1QLS A;  2NCP A;  4WRI A;  1NSH A;  4R1E A;  3LCP C;  3ZWH A;  1F8H A;  2EHB A;  1UHK A;  4YI8 A;  1RTP 1;  4NQG A;  3PFV A;  2NLN A;  1K90 D;  1QLK A;  2L4H A;  1IRJ A;  1NX3 A;  1QS7 A;  1DGU A;  3H4S E;  2Y1N A;  1PAL A;  2EC6 C;  2A4J A;  2KGR A;  1MF8 B;  1Y0V H;  2LVI A;  1EH2 A;  4YBH B;  2M0R A;  2GGM A;  1WLZ A;  3KO0 A;  2I7A A;  4NDC A;  1LIN A;  2JRF A;  1U5I B;  2ZRS A;  1RFJ A;  1BOC A;  1K9P A;  2M7L A;  4ZCV A;  2GGZ A;  2K7B A;  2KYF A;  1YUS A;  1Y1A A;  1UHN A;  3AKA A;  4ZCU A;  1A03 A;  1KK8 C;  3DD4 A;  5IBW A;  2WOR A;  2L5X B;  1CFF A;  3FWB A;  4DCK A;  2LE9 B;  1DJI A;  4PHJ A;  4OV2 A;  2WC8 A;  1ZAC A;  2BBN A;  1QAS A;  3DVJ A;  1SW8 A;  2O5G A;  1W7I B;  2LVV A;  1WLM A;  4BY5 A;  2BL0 C;  2G9B A;  2LM5 A;  2M1U A;  4YRU A;  3VGO A;  1YUT A;  5PAL A;  2DOQ A;  3JTD B;  2LLU A;  2LLS A;  4OR9 B;  3KPX A;  3SG7 A;  1IQ5 A;  4GNK B;  2AMI A;  5CSF A;  4PHM A;  2CT9 A;  3BXK A;  2F8P A;  2LLT A;  2LUC A;  1AK8 A;  2ZN8 A;  4QJ3 B;  1J1E A;  1NUB A;  1TOP A;  2JNX A;  1WDC B;  2KHN A;  2L2E A;  5AXI A;  2JT3 A;  5JOL A;  3TDI A;  3WHU B;  3GOF A;  2WOS A;  2L50 A;  1IKU A;  2SCP A;  1WRK A;  2JT0 A;  2KAV A;  2KI4 C;  3D0Y B;  3IQQ A;  2CNP A;  3I5H C;  1J7O A;  4DRW A;  3A4U B;  1QIW A;  5I2Q A;  1F54 A;  1CM4 A;  4ORA B;  3VRQ A;  3EKJ A;  1CFC A;  1CDN A;  1YRU B;  1CM1 A;  2ZN9 A;  4QJ5 B;  1BMO A;  1KK7 Y;  1S6C A;  4MSP A;  2H61 C;  2KQY A;  3DVK A;  4GBA A;  1YR5 A;  2OS8 B;  1CDP A;  2KI6 C;  4ORB B;  2LP2 A;  2KDH A;  1KFX L;  4P5O E;  1IGV A;  1N0Y A;  1JFJ A;  2M49 B;  3I5F C;  3LLE A;  3VRR A;  1GGZ A;  1C7V A;  1A29 A;  5I2O A;  2KNE A;  2F2P A;  4IL1 A;  3TUY B;  1LA3 A;  2I18 A;  1F4Q A;  4MBE A;  4ETO A;  2K61 A;  5AER A;  1K9U A;  3EVU A;  2HET A;  2KYC A;  3O4Y A;  2ZRT A;  1IG5 A;  2COL B;  2L0P A;  3FWC A;  1K94 A;  2BEC A;  4USL A;  1KWO C;  1TTX A;  1JSA A;  1RK9 A;  1J7R A;  2KAX A;  2L98 A;  2PRU A;  2Y5I A;  1YUU A;  1MUX A;  1KSM A;  2BBM A;  2F3Y A;  1OMR A;  3I5I B;  1Q80 A;  3SG6 A;  1GQM A;  3OX5 A;  1D1O A;  1KSO A;  2LHI A;  1SR6 B;  2G2B A;  2JXL A;  1F70 A;  1SL7 A;  3PAT A;  2KOT A;  3PN7 C;  1XA5 A;  4HRG A;  1FW4 A;  3SG3 A;  1K8U A;  1MXL C;  3BUO B;  1OMD A;  2M3W A;  3I5G C;  3QRX A;  3SJS A;  1TNW A;  5HYD A;  1TCO B;  1DJW A;  1PUL A;  1UP5 A;  1V1G A;  1PK0 D;  3BQ3 A;  1F71 A;  1ZMZ A;  1TRF A;  1PVA A;  2K7D A; 
#chains in the Genus database with same CATH topology
 1IJ5 A;  2WCM A;  3OB1 B;  2HQW A;  2JTT A;  2M7N A;  2WC5 A;  3S0A A;  4E68 A;  2OTG C;  3FIA A;  2H61 A;  3B6X A;  3SS5 A;  4QJ4 B;  5KTY A;  2Y1M A;  4MLW A;  3KHE A;  1CMG A;  1K95 A;  1BR4 B;  1REC A;  3BJH A;  3LL8 B;  1QWV A;  2KGB C;  1RJV A;  2PQL A;  4PE0 A;  5FI7 A;  3L4L A;  4BY4 A;  5I94 A;  5BPJ A;  1YX7 A;  1QV1 A;  1ODB A;  1KFU S;  3B86 A;  4MVF A;  2PAL A;  1NCY A;  4C0J A;  1NCZ A;  4U8D A;  1TUJ A;  5CPV A;  1L2O B;  5FI2 A;  2BE4 A;  1T14 A;  1CLB A;  1ORG A;  3EKH A;  1S6J A;  2KAY A;  3S0F A;  3EK4 A;  1WRZ A;  3JVT C;  4GFT A;  1XFV O;  5FI6 A;  1YTZ C;  2PSR A;  1NIW A;  3EVV A;  2ZKM X;  4HRE E;  4I5K A;  4YGC B;  1DJG A;  1DJY A;  2MHH A;  3CLN A;  2IS9 A;  3BOW B;  1DF0 B;  1K2H A;  1NX0 A;  4F0Z B;  3OHM B;  2HQ8 A;  1CFD A;  2BCX A;  4GGF C;  4OKH A;  2FCD A;  2MJW B;  2K0J A;  2WCB A;  3CDN A;  1C07 A;  1N65 A;  1BLQ A;  1A75 A;  2KBM A;  4XJK B;  3SS3 A;  1B8L A;  3EVR A;  4PHK A;  1RWY A;  3CR4 X;  3S0D A;  3CTN A;  1OSA A;  4GAO A;  2KQ6 A;  1UWO A;  1G4Y R;  1NWD A;  2KFG A;  3OB2 B;  2K7C A;  3O4X A;  1MXE A;  1EXR A;  3AAJ A;  5GQQ C;  1TCF A;  2LC5 A;  4PE4 A;  4HSZ A;  2LCP A;  3FE6 A;  1YX8 A;  3I5H B;  3GK4 X;  1IQ3 A;  2CXJ A;  3PLF B;  1CLL A;  1GJY A;  4PCW A;  1ZFS A;  2Q91 A;  1TNP A;  1FPW A;  4N5X A;  1QVI Z;  2JT8 A;  1RRO A;  1R6P A;  4PHN A;  3PM8 A;  3DZT A;  4CFQ A;  2KBI A;  1ALV A;  5B8I B;  3SG5 A;  1YVL A;  5AEQ A;  4CID A;  1BJF A;  3QME A;  1SYM A;  3C1V A;  4ORC B;  1UUS A;  1XFW O;  1S6I A;  1DJX A;  4CLN A;  1PSB A;  1LS8 A;  1QX2 A;  1SNL A;  2KFH A;  2MAZ A;  4YGB B;  1SY9 A;  2H2K A;  3I5F B;  2MBX A;  1FI5 A;  1LKJ A;  2BE6 A;  4L9M A;  4C0K A;  1DT7 B;  1NYA A;  1SMG A;  5CSN A;  2LMV A;  3FS7 A;  3M0W A;  5DKQ A;  1CKK A;  3HX4 A;  2BCB A;  2PMY A;  5HKW A;  3L4A A;  2CTN A;  3JTD C;  1UUR A;  1CDM A;  4A4B A;  2LMU A;  3D10 A;  4GGF A;  4FQO A;  2ISD A;  3TDU A;  3OP0 A;  1MWN A;  4MRY A;  1CFP A;  1OE9 B;  1JF2 A;  2JTZ A;  1DJZ A;  3R1P A;  3TZ1 A;  1YRT B;  4I5N B;  1BF5 A;  1JC2 A;  1LXF C;  1G33 A;  1WDC C;  5D3O A;  3ICB A;  1KQM B;  4INX A;  5HKY A;  4MN0 A;  2SAS A;  5D69 A;  4YGD B;  2JNF A;  2GV5 A;  2PYQ A;  2Q4U A;  3FE8 A;  1EL4 A;  1B9A A;  1OOG A;  1KFU L;  2JZI A;  3Q8I A;  3WNX B;  3D75 A;  4INW A;  2KFF A;  4MEW A;  1NX1 A;  4D1E A;  1BG1 A;  1NP8 A;  1BR1 B;  1V1F A;  2FJU B;  1JF0 A;  1Y1U A;  3KEV A;  2KPH A;  3CZT X;  3LK0 A;  1AUI B;  2CBL A;  1S1E A;  4JWQ A;  2BKI B;  2OS8 C;  1U5I A;  2KSP A;  4N1F A;  1NPQ A;  4N1G A;  2L51 A;  2CCM A;  3DVE A;  2Y4Q A;  1SSE B;  4Q04 A;  1GM0 A;  1SCM B;  3WXA A;  5KU1 A;  3O78 A;  2LMT A;  2K60 A;  2I2R E;  3GK1 A;  4CFR A;  1MHO A;  1EG4 A;  4CPV A;  1XFZ O;  3CZ1 A;  5CSJ A;  1LVC D;  3TUY C;  1TNQ A;  2JPT A;  1OOJ A;  1OOF A;  2BNX A;  3VRN A;  1SBJ A;  1XVJ A;  2M8U A;  3B88 A;  4FTG A;  1H4B A;  1J7Q A;  3V2L A;  3R72 A;  2M1K B;  3BUW B;  5FYX A;  3DF0 B;  1XYD A;  3UNW A;  3FE9 A;  1UHI A;  1SCV A;  1Y6W A;  1FF1 A;  3NSO A;  2LNK A;  5TNC A;  1GGW A;  3GK2 A;  3SG2 A;  1S36 A;  1SL9 A;  2P6B B;  2BKH B;  2EC6 B;  4NDD A;  2FJY A;  3TS5 C;  2F33 A;  1N2D A;  3ZNI A;  5KSZ A;  3SS4 A;  1UHH A;  1J7P A;  3I5I C;  3O6B A;  4JKT A;  5HLO A;  3B7A A;  3BUN B;  2JOJ A;  2MLE C;  3CR2 A;  4M2P A;  2E6W A;  4XYN A;  4JD9 A;  2JU0 A;  1SR6 C;  3DVM A;  5DIC A;  3NHI A;  3CZ2 A;  1OQP A;  2K2A A;  3D0Y A;  1KK8 B;  1QX5 B;  3NSK A;  2HPS A;  4I5L B;  1DQE A;  1M46 A;  1QXP A;  2AUC A;  1SK6 D;  3CS1 A;  4GGN A;  3IQO A;  1CDL A;  5I8N A;  1G8I A;  2QEO A;  3CGA A;  1B47 A;  3MSE B;  1J55 A;  5ER5 A;  1VRK A;  2WCF A;  1QVI Y;  1S5G Z;  2EGD A;  3DY9 A;  2FOT A;  1B8R A;  4HRH A;  5CSI A;  1Z4H A;  1C7W A;  2MRD A;  2BL0 B;  1AJ5 A;  1JFK A;  5HLV A;  2LUX A;  3UO9 A;  2BCA A;  2HF5 A;  1SKT A;  2ZND A;  1QJT A;  2M29 A;  2WCJ A;  2NXQ A;  1TN4 A;  2MLF C;  1B8C A;  1J1D A;  1OZS A;  2WCK A;  3CWG A;  4M2Q A;  4AOM A;  1M45 A;  3A8R A;  3KF9 A;  1W7J B;  4AQJ A;  2KI6 D;  1FBV A;  1AHR A;  1WRL A;  1CMF A;  5D7F A;  4DIR A;  1DTL A;  2B1U A;  1EJ3 A;  4GUK A;  1B4C A;  3OBV A;  4NDB A;  3NSI A;  2JUL A;  2ZFD A;  3NXA A;  1A2X A;  1L2O C;  2NZ0 A;  1B7T Z;  2M9G A;  2KI4 B;  2NCO A;  3NHT A;  3NSL A;  1SL8 A;  3S0E A;  3CAB A;  1NCX A;  1PVB A;  2OPO A;  4P2Y B;  1F4O A;  1XO5 A;  4MZK A;  1NX2 A;  2QAC A;  1IH0 A;  4KYN A;  2LVJ A;  2K2F A;  4MZJ A;  2LV7 A;  3F45 A;  2BAP A;  4YGE B;  3LK1 A;  1DEL A;  1ALW A;  1PSR A;  1QX7 A;  1XFY O;  1C3Z A;  1KCY A;  2WCE A;  2RGI A;  4GPL B;  2WC6 A;  1LA0 A;  5K89 A;  1CB1 A;  1DMO A;  3AAK A;  2O60 A;  3EK7 A;  1OZO A;  4YGA A;  3SIA A;  3SG4 A;  5DKR A;  2F3Z A;  3BUM B;  3WHT B;  1FI6 A;  4PE1 A;  1BOD A;  4PDZ A;  4M2O A;  1YUR A;  3D74 A;  1M31 A;  1ZUZ A;  5HKZ A;  2L4I A;  5AAN A;  1DVI A;  5G08 A;  3TDZ A;  3OX6 A;  2TN4 A;  2F2O A;  3BFA A;  1XK4 C;  2K7O A;  3DF0 A;  4C0L A;  1BU3 A;  1WY9 A;  1UHJ A;  1Y1X A;  2E30 A;  3K1E A;  3EG5 B;  4UPG A;  1QAT A;  1JBA A;  1KWO B;  1K93 D;  4YI9 A;  1IJ6 A;  3IF7 A;  1KQV A;  1DJH A;  2D8N A;  5DKN A;  3VB1 A;  3L47 A;  1PRW A;  3BYA A;  2K8M B;  4DUQ A;  1SPY A;  2WCH A;  3VRP A;  1CLM A;  2WND A;  2VRG A;  1CTR A;  4JQ0 D;  3VRO A;  2L5Y A;  1K96 A;  4TNC A;  2ZNE A;  4JPZ B;  1AVS A;  2PAS A;  1IWQ A;  4MRX A;  3PN7 B;  3R1O A;  4DS7 A;  2JC2 A;  3I5G B;  3EK8 A;  1A75 B;  5EL2 A;  2AAO A;  2I94 A;  1M39 A;  4MZL A;  3AKB A;  1A4P A;  1DGV A;  2M97 A;  4I5J A;  5F6T A;  3E3R A;  1JWD A;  1X02 A;  3BOW A;  4ICB A;  1DF0 A;  2V53 A;  2OTG B;  3R1V A;  1QV0 A;  2FCE A;  2LAN A;  5AFP A;  1XFU O;  1R2U A;  1HT9 A;  1HQV A;  2JWW A;  1Z2C B;  1TNX A;  5ER4 X;  1MQ1 A;  4OCI A;  4PAL A;  1M63 B;  1AJ4 A;  1KQM C;  2LVK A;  4XJK A;  3TS5 B;  3RLZ A;  2YGU A;  1H8B A;  1KK7 Z;  2PVB A;  1S5G Y;  1E8A A;  3DXL A;  4WQ3 A;  1BT6 A;  2LAP A;  1EG3 A;  1ZOT B;  1JUO A;  4A4C A;  1AP4 A;  3O2P A;  4OVN F;  2MA2 A;  4PE7 A;  5J3X A;  2JQ6 A;  1XK4 A;  1B1G A;  3K21 A;  1TIZ A;  2R2I A;  3D76 A;  3N7H A;  1XFX O;  1YVH A;  3JVT B;  1P28 A;  1L7Z A;  4AQI A;  1OOH A;  4OZD A;  3RM1 A;  3HCM A;  3BUX B;  1S3P A;  1OMV A;  1QTX A;  1MR8 A;  2JXC A;  3SIB A;  2KLE A;  1SRA A;  1KFX S;  3PSR A;  2LHL A;  5I2L A;  1SCM C;  5JJG A;  4WQ2 A;  2QPT A;  1K9K A;  3CR5 X;  2LP3 A;  3PAL A;  1B7T Y;  1S26 D;  1QIV A;  1CNP A;  1F55 A;  1QLS A;  2NCP A;  3D78 A;  4WRI A;  1NSH A;  4R1E A;  3LCP C;  3ZWH A;  1F8H A;  2EHB A;  1UHK A;  4YI8 A;  1RTP 1;  4NQG A;  3PFV A;  4PT1 A;  2NLN A;  1K90 D;  1QLK A;  2L4H A;  1IRJ A;  1NX3 A;  1QS7 A;  1IIO A;  1DGU A;  3H4S E;  3PJI A;  2Y1N A;  1PAL A;  2EC6 C;  2A4J A;  2KGR A;  1MF8 B;  1Y0V H;  4F7F A;  2LVI A;  1EH2 A;  4YBH B;  2M0R A;  2GGM A;  1WLZ A;  3KO0 A;  2I7A A;  4NDC A;  1LIN A;  3D73 A;  4FQT A;  2JRF A;  1U5I B;  5HL1 A;  2ZRS A;  2H8V A;  3D77 A;  1RFJ A;  1BOC A;  1K9P A;  2M7L A;  4ZCV A;  2GGZ A;  2K7B A;  2KYF A;  1YUS A;  1Y1A A;  1UHN A;  3AKA A;  4ZCU A;  3B87 A;  1A03 A;  1KK8 C;  3DD4 A;  5IBW A;  2P71 A;  2L5X B;  2WOR A;  1DC1 A;  3FWB A;  1CFF A;  4DCK A;  3S0B A;  2LE9 B;  1DJI A;  4PHJ A;  4OV2 A;  2WC8 A;  1ZAC A;  2BBN A;  1QAS A;  3DVJ A;  1SW8 A;  2O5G A;  1W7I B;  2LVV A;  1WLM A;  4BY5 A;  2BL0 C;  2G9B A;  2LM5 A;  2M1U A;  4YRU A;  2WCL A;  3VGO A;  1YUT A;  5PAL A;  2DOQ A;  3JTD B;  2LLU A;  2LLS A;  3DYE A;  1C3Y A;  4OR9 B;  1OW4 A;  1TUZ A;  3KPX A;  3SG7 A;  1XFR A;  1IQ5 A;  4GNK B;  2AMI A;  5CSF A;  4PHM A;  2CT9 A;  3IVT A;  3BXK A;  2F8P A;  2LLT A;  2LUC A;  1AK8 A;  2ZN8 A;  4QJ3 B;  1J1E A;  1NUB A;  1TOP A;  2JNX A;  1WDC B;  2KHN A;  2L2E A;  5AXI A;  2JT3 A;  5JOL A;  3TDI A;  3WHU B;  3GOF A;  3BFH A;  1OOI X;  2WOS A;  1TWO A;  2L50 A;  1IKU A;  2SCP A;  1WRK A;  2JT0 A;  2KAV A;  2KI4 C;  3D0Y B;  3IQQ A;  1W9Z A;  2CNP A;  3I5H C;  1J7O A;  4DRW A;  2QEV A;  3A4U B;  1QIW A;  5I2Q A;  1F54 A;  1CM4 A;  4ORA B;  3VRQ A;  3EKJ A;  1CFC A;  1CDN A;  1YRU B;  1CM1 A;  2JPO A;  2ZN9 A;  4QJ5 B;  1BMO A;  1KK7 Y;  1S6C A;  4MSP A;  2ERB A;  2H61 C;  2KQY A;  3DVK A;  4GBA A;  1YR5 A;  2OS8 B;  1CDP A;  2KI6 C;  4ORB B;  2LP2 A;  2KDH A;  1KFX L;  4P5O E;  1IGV A;  1N0Y A;  1JFJ A;  2M49 B;  2P70 A;  2KLD A;  3I5F C;  3LLE A;  3VRR A;  1GGZ A;  4IJ7 A;  2QEB A;  1C7V A;  1A29 A;  5I2O A;  2KNE A;  2F2P A;  4IL1 A;  3TUY B;  2QEH A;  1LA3 A;  2I18 A;  1F4Q A;  4MBE A;  4ETO A;  2K61 A;  5AER A;  1K9U A;  3EVU A;  2HET A;  2KYC A;  3O4Y A;  2ZRT A;  1IG5 A;  2COL B;  2L0P A;  3FWC A;  1K94 A;  2BEC A;  4USL A;  1KWO C;  1TTX A;  1JSA A;  1RK9 A;  1J7R A;  2KAX A;  2L98 A;  2PRU A;  2Y5I A;  3CYZ A;  1YUU A;  3PM2 A;  2L2C A;  1MUX A;  1KSM A;  2BBM A;  2F3Y A;  1OMR A;  3I5I B;  1Q80 A;  3SG6 A;  1GQM A;  3OX5 A;  1D1O A;  3NGV A;  1KSO A;  3S0G A;  3BFB A;  2LHI A;  1SR6 B;  2G2B A;  2JXL A;  1F70 A;  1SL7 A;  3PAT A;  2KOT A;  3PN7 C;  1XA5 A;  4HRG A;  1FW4 A;  3SG3 A;  1K8U A;  1MXL C;  3BUO B;  1OMD A;  2M3W A;  3I5G C;  3OGN A;  3QRX A;  1TNW A;  3SJS A;  5HYD A;  3RZS A;  1TCO B;  1DJW A;  2QDI A;  1DEK A;  1PUL A;  1UP5 A;  1V1G A;  1PK0 D;  3BQ3 A;  1F71 A;  2GTE A;  3CZ0 A;  1ZMZ A;  1TRF A;  1PVA A;  2K7D A; 
#chains in the Genus database with same CATH homology
 1IJ5 A;  3OB1 B;  2HQW A;  2JTT A;  2M7N A;  4E68 A;  2OTG C;  3FIA A;  2H61 A;  4QJ4 B;  5KTY A;  2Y1M A;  4MLW A;  3KHE A;  1CMG A;  1K95 A;  1BR4 B;  1REC A;  3LL8 B;  2KGB C;  1RJV A;  4PE0 A;  4BY4 A;  5BPJ A;  1YX7 A;  1QV1 A;  1ODB A;  1KFU S;  4MVF A;  2PAL A;  1NCY A;  4C0J A;  1NCZ A;  4U8D A;  5CPV A;  1L2O B;  2BE4 A;  1CLB A;  3EKH A;  1S6J A;  2KAY A;  3EK4 A;  1WRZ A;  3JVT C;  4GFT A;  1XFV O;  1YTZ C;  2PSR A;  1NIW A;  3EVV A;  2ZKM X;  4HRE E;  4I5K A;  4YGC B;  1DJG A;  1DJY A;  2MHH A;  3CLN A;  2IS9 A;  3BOW B;  1DF0 B;  1K2H A;  1NX0 A;  4F0Z B;  3OHM B;  2HQ8 A;  1CFD A;  2BCX A;  4GGF C;  4OKH A;  2FCD A;  2MJW B;  2K0J A;  2WCB A;  1C07 A;  1N65 A;  1BLQ A;  1A75 A;  2KBM A;  4XJK B;  1B8L A;  3EVR A;  4PHK A;  1RWY A;  3CR4 X;  3CTN A;  1OSA A;  4GAO A;  2KQ6 A;  1UWO A;  1G4Y R;  1NWD A;  2KFG A;  3OB2 B;  2K7C A;  1MXE A;  1EXR A;  3AAJ A;  5GQQ C;  1TCF A;  2LC5 A;  4PE4 A;  4HSZ A;  2LCP A;  1YX8 A;  3I5H B;  3GK4 X;  1IQ3 A;  2CXJ A;  3PLF B;  1CLL A;  1GJY A;  4PCW A;  1ZFS A;  2Q91 A;  1TNP A;  1FPW A;  4N5X A;  1QVI Z;  2JT8 A;  1RRO A;  1R6P A;  4PHN A;  3PM8 A;  5B8I B;  4CFQ A;  2KBI A;  1ALV A;  3SG5 A;  1YVL A;  5AEQ A;  4CID A;  1BJF A;  1SYM A;  3C1V A;  4ORC B;  1UUS A;  1XFW O;  1S6I A;  1DJX A;  4CLN A;  1PSB A;  1SNL A;  1QX2 A;  2KFH A;  2MAZ A;  4YGB B;  1SY9 A;  2H2K A;  3I5F B;  2MBX A;  1FI5 A;  1LKJ A;  2BE6 A;  4L9M A;  4C0K A;  1DT7 B;  1NYA A;  1SMG A;  5CSN A;  2LMV A;  3FS7 A;  3M0W A;  5DKQ A;  1CKK A;  3HX4 A;  2BCB A;  2PMY A;  5HKW A;  2CTN A;  3JTD C;  1UUR A;  1CDM A;  4A4B A;  2LMU A;  3D10 A;  4GGF A;  4FQO A;  2ISD A;  3TDU A;  3OP0 A;  1MWN A;  4MRY A;  1CFP A;  1OE9 B;  1JF2 A;  2JTZ A;  1DJZ A;  3TZ1 A;  1BF5 A;  1YRT B;  4I5N B;  1JC2 A;  1LXF C;  1G33 A;  1WDC C;  3ICB A;  1KQM B;  5HKY A;  4MN0 A;  2SAS A;  5D69 A;  4YGD B;  2JNF A;  2GV5 A;  2Q4U A;  1EL4 A;  1B9A A;  1KFU L;  2JZI A;  3WNX B;  4MEW A;  2KFF A;  1NX1 A;  4D1E A;  1BG1 A;  1NP8 A;  1BR1 B;  1V1F A;  2FJU B;  1JF0 A;  1Y1U A;  3KEV A;  3CZT X;  3LK0 A;  1AUI B;  2CBL A;  1S1E A;  4JWQ A;  2BKI B;  2OS8 C;  1U5I A;  2KSP A;  4N1F A;  1NPQ A;  4N1G A;  2L51 A;  2CCM A;  3DVE A;  2Y4Q A;  4Q04 A;  1SCM B;  3WXA A;  5KU1 A;  3O78 A;  2LMT A;  4CFR A;  2I2R E;  3GK1 A;  1MHO A;  1EG4 A;  4CPV A;  1XFZ O;  5CSJ A;  1LVC D;  3TUY C;  1TNQ A;  2JPT A;  1OOJ A;  3VRN A;  1SBJ A;  1XVJ A;  2M8U A;  4FTG A;  1H4B A;  1J7Q A;  2M1K B;  3BUW B;  5FYX A;  3DF0 B;  1XYD A;  1FF1 A;  1UHI A;  1SCV A;  1Y6W A;  3NSO A;  2LNK A;  5TNC A;  1GGW A;  3GK2 A;  3SG2 A;  1S36 A;  1SL9 A;  2P6B B;  2BKH B;  2EC6 B;  4NDD A;  3TS5 C;  5KSZ A;  2F33 A;  1N2D A;  3ZNI A;  1UHH A;  1J7P A;  3I5I C;  3O6B A;  5HLO A;  3BUN B;  2JOJ A;  2MLE C;  3CR2 A;  4M2P A;  2E6W A;  4XYN A;  2JU0 A;  1SR6 C;  3DVM A;  1OQP A;  2K2A A;  3D0Y A;  1KK8 B;  1QX5 B;  3NSK A;  2HPS A;  4I5L B;  1M46 A;  1QXP A;  2AUC A;  1SK6 D;  3CS1 A;  4GGN A;  3IQO A;  1CDL A;  5I8N A;  1G8I A;  3CGA A;  1B47 A;  3MSE B;  1J55 A;  5ER5 A;  1VRK A;  2WCF A;  1QVI Y;  1S5G Z;  2EGD A;  2FOT A;  1B8R A;  4HRH A;  5CSI A;  2MRD A;  1C7W A;  2BL0 B;  1AJ5 A;  1JFK A;  5HLV A;  2LUX A;  2BCA A;  2HF5 A;  1SKT A;  2ZND A;  1QJT A;  2M29 A;  2NXQ A;  1TN4 A;  2MLF C;  1B8C A;  1J1D A;  1OZS A;  3CWG A;  4M2Q A;  4AOM A;  1M45 A;  3A8R A;  3KF9 A;  1W7J B;  4AQJ A;  2KI6 D;  1FBV A;  1AHR A;  1WRL A;  1CMF A;  5D7F A;  4DIR A;  1DTL A;  2B1U A;  1EJ3 A;  4GUK A;  1B4C A;  4NDB A;  3NSI A;  2JUL A;  2ZFD A;  3NXA A;  1A2X A;  1L2O C;  2NZ0 A;  1B7T Z;  2M9G A;  2KI4 B;  2NCO A;  3NSL A;  1SL8 A;  1NCX A;  1PVB A;  2OPO A;  4P2Y B;  1F4O A;  1XO5 A;  4MZK A;  1NX2 A;  2QAC A;  1IH0 A;  2LVJ A;  2K2F A;  4MZJ A;  2LV7 A;  3F45 A;  4YGE B;  3LK1 A;  1ALW A;  1PSR A;  1QX7 A;  1XFY O;  1KCY A;  2WCE A;  2RGI A;  4GPL B;  1LA0 A;  5K89 A;  1CB1 A;  1DMO A;  3AAK A;  2O60 A;  3EK7 A;  1OZO A;  4YGA A;  3SIA A;  3SG4 A;  5DKR A;  2F3Z A;  3BUM B;  3WHT B;  1FI6 A;  4PE1 A;  1BOD A;  4PDZ A;  4M2O A;  1YUR A;  1M31 A;  1ZUZ A;  5HKZ A;  2L4I A;  5AAN A;  1DVI A;  5G08 A;  3TDZ A;  3OX6 A;  2TN4 A;  2F2O A;  1XK4 C;  2K7O A;  3DF0 A;  4C0L A;  1BU3 A;  1WY9 A;  1UHJ A;  1Y1X A;  2E30 A;  4UPG A;  1JBA A;  1QAT A;  1KWO B;  1K93 D;  4YI9 A;  1IJ6 A;  3IF7 A;  1KQV A;  1DJH A;  2D8N A;  5DKN A;  1PRW A;  3BYA A;  2K8M B;  4DUQ A;  1SPY A;  3VRP A;  1CLM A;  2WND A;  2VRG A;  1CTR A;  4JQ0 D;  3VRO A;  4TNC A;  1K96 A;  2ZNE A;  4JPZ B;  1AVS A;  2PAS A;  1IWQ A;  4MRX A;  3PN7 B;  4DS7 A;  2JC2 A;  3I5G B;  3EK8 A;  1A75 B;  2AAO A;  2I94 A;  1M39 A;  4MZL A;  3AKB A;  1A4P A;  1DGV A;  2M97 A;  4I5J A;  5F6T A;  3E3R A;  1JWD A;  1X02 A;  3BOW A;  4ICB A;  1DF0 A;  2V53 A;  2OTG B;  1QV0 A;  2FCE A;  2LAN A;  5AFP A;  1XFU O;  1R2U A;  1HT9 A;  1HQV A;  2JWW A;  1TNX A;  5ER4 X;  1MQ1 A;  4OCI A;  4PAL A;  1M63 B;  1AJ4 A;  1KQM C;  2LVK A;  4XJK A;  3TS5 B;  3RLZ A;  1H8B A;  1KK7 Z;  2PVB A;  1S5G Y;  1E8A A;  4WQ3 A;  1BT6 A;  2LAP A;  1EG3 A;  1ZOT B;  1JUO A;  4A4C A;  1AP4 A;  3O2P A;  4OVN F;  2MA2 A;  4PE7 A;  5J3X A;  2JQ6 A;  1XK4 A;  1B1G A;  3K21 A;  1TIZ A;  2R2I A;  1XFX O;  1YVH A;  3JVT B;  1L7Z A;  4AQI A;  3RM1 A;  3HCM A;  3BUX B;  1S3P A;  1OMV A;  1QTX A;  1MR8 A;  2JXC A;  3SIB A;  1SRA A;  1KFX S;  3PSR A;  2LHL A;  5I2L A;  1SCM C;  5JJG A;  4WQ2 A;  2QPT A;  1K9K A;  3CR5 X;  2LP3 A;  3PAL A;  1B7T Y;  1S26 D;  1QIV A;  1CNP A;  1F55 A;  1QLS A;  2NCP A;  4WRI A;  1NSH A;  4R1E A;  3LCP C;  3ZWH A;  1F8H A;  2EHB A;  1UHK A;  4YI8 A;  1RTP 1;  4NQG A;  3PFV A;  2NLN A;  1K90 D;  1QLK A;  2L4H A;  1IRJ A;  1NX3 A;  1QS7 A;  1DGU A;  3H4S E;  2Y1N A;  1PAL A;  2EC6 C;  2A4J A;  2KGR A;  1MF8 B;  1Y0V H;  2LVI A;  1EH2 A;  4YBH B;  2M0R A;  2GGM A;  1WLZ A;  3KO0 A;  2I7A A;  4NDC A;  1LIN A;  2JRF A;  1U5I B;  2ZRS A;  1RFJ A;  1BOC A;  1K9P A;  2M7L A;  4ZCV A;  2GGZ A;  2K7B A;  2KYF A;  1YUS A;  1Y1A A;  1UHN A;  3AKA A;  4ZCU A;  1A03 A;  1KK8 C;  3DD4 A;  5IBW A;  2WOR A;  2L5X B;  1CFF A;  3FWB A;  4DCK A;  2LE9 B;  1DJI A;  4PHJ A;  4OV2 A;  2WC8 A;  1ZAC A;  2BBN A;  1QAS A;  3DVJ A;  1SW8 A;  2O5G A;  1W7I B;  2LVV A;  1WLM A;  4BY5 A;  2BL0 C;  2G9B A;  2LM5 A;  2M1U A;  4YRU A;  3VGO A;  1YUT A;  5PAL A;  2DOQ A;  3JTD B;  2LLU A;  2LLS A;  4OR9 B;  3KPX A;  3SG7 A;  1IQ5 A;  4GNK B;  2AMI A;  5CSF A;  4PHM A;  2CT9 A;  3BXK A;  2F8P A;  2LLT A;  2LUC A;  1AK8 A;  2ZN8 A;  4QJ3 B;  1J1E A;  1NUB A;  1TOP A;  2JNX A;  1WDC B;  2KHN A;  2L2E A;  5AXI A;  2JT3 A;  5JOL A;  3TDI A;  3WHU B;  3GOF A;  2WOS A;  2L50 A;  1IKU A;  2SCP A;  1WRK A;  2JT0 A;  2KAV A;  2KI4 C;  3D0Y B;  3IQQ A;  2CNP A;  3I5H C;  1J7O A;  4DRW A;  3A4U B;  1QIW A;  5I2Q A;  1F54 A;  1CM4 A;  4ORA B;  3VRQ A;  3EKJ A;  1CFC A;  1CDN A;  1YRU B;  1CM1 A;  2ZN9 A;  4QJ5 B;  1BMO A;  1KK7 Y;  1S6C A;  4MSP A;  2H61 C;  2KQY A;  3DVK A;  4GBA A;  1YR5 A;  2OS8 B;  1CDP A;  2KI6 C;  4ORB B;  2LP2 A;  2KDH A;  1KFX L;  4P5O E;  1IGV A;  1N0Y A;  1JFJ A;  2M49 B;  3I5F C;  3LLE A;  3VRR A;  1GGZ A;  1C7V A;  1A29 A;  5I2O A;  2KNE A;  2F2P A;  4IL1 A;  3TUY B;  1LA3 A;  2I18 A;  1F4Q A;  4MBE A;  4ETO A;  2K61 A;  5AER A;  1K9U A;  3EVU A;  2HET A;  2KYC A;  3O4Y A;  2ZRT A;  1IG5 A;  2COL B;  2L0P A;  3FWC A;  1K94 A;  2BEC A;  4USL A;  1KWO C;  1TTX A;  1JSA A;  1RK9 A;  1J7R A;  2KAX A;  2L98 A;  2PRU A;  2Y5I A;  1YUU A;  1MUX A;  1KSM A;  2BBM A;  2F3Y A;  1OMR A;  3I5I B;  1Q80 A;  3SG6 A;  1GQM A;  3OX5 A;  1D1O A;  1KSO A;  2LHI A;  1SR6 B;  2G2B A;  2JXL A;  1F70 A;  1SL7 A;  3PAT A;  2KOT A;  3PN7 C;  1XA5 A;  4HRG A;  1FW4 A;  3SG3 A;  1K8U A;  1MXL C;  3BUO B;  1OMD A;  2M3W A;  3I5G C;  3QRX A;  3SJS A;  1TNW A;  5HYD A;  1TCO B;  1DJW A;  1PUL A;  1UP5 A;  1V1G A;  1PK0 D;  3BQ3 A;  1F71 A;  1ZMZ A;  1TRF A;  1PVA A;  2K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...