3OX5A

Crystal structure of the calcium sensor calcium-binding protein 1 (cabp1)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
153
Chain Sequence
b'MDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 1
publication title Structural Basis for the Differential Effects of CaBP1 and Calmodulin on Ca(V)1.2 Calcium-Dependent Inactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium binding protein
total genus 49
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ox5A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ox5A02
1OZOA 4OCIA 1MR8A 2LCPA 2JULA 2ZRTA 1J1DA 2M3WA 2BKIB 1QS7A 2LE9B 4TNCA 3ZNIA 3TZ1A 2JC2A 4USLA 5I2QA 1QVIZ 2PRUA 1XA5A 2PSRA 5AANA 1PVAA 1NP8A 4OR9B 2I2RE 3SG5A 1PSRA 1GQMA 3I5IB 2JXLA 1F8HA 1BJFA 4PHKA 4YRUA 1IJ5A 1LVCD 1E8AA 2L50A 3VRNA 1JSAA 1CFFA 2JOJA 3KHEA 3I5FC 1GGZA 1UUSA 2NZ0A 1GGWA 4NDDA 1XVJA 4OV2A 3DVKA 1QX5B 1S1EA 2BCAA 2CCMA 3FWCA 1YURA 3TS5B 4CIDA 1K94A 1OMDA 2E30A 1C7WA 2L4IA 2NXQA 3H4SE 1A03A 1SCMC 3WHUB 2B1UA 1QJTA 4MSPA 1SW8A 3ICBA 4DIRA 5B8IB 2LP2A 3WXAA 1IH0A 5JJGA 2KFGA 1RTP1 1UURA 1DJHA 2KGRA 2MA2A 1UHJA 1IQ5A 5CSIA 1OQPA 2GGMA 2LMTA 1TNPA 1U5IB 1TNQA 3BUMB 3OX5A 1XFYO 1NSHA 2L2EA 3BOWA 2Y1MA 1DVIA 1EXRA 1KSOA 1N2DA 1YRUB 2BL0C 3IQQA 3DVEA 5KU1A 3MSEB 2LLUA 2BCXA 3D0YA 3I5GB 2A4JA 1NX3A 4N1GA 1CLMA 1SPYA 1ZOTB 1LKJA 2LVKA 3EVVA 1JF2A 1K9UA 1NX0A 4I5LB 2LHLA 1XFZO 2H61A 2Q4UA 1CKKA 4A4CA 2K7OA 1UHKA 1JUOA 1KWOC 1K96A 2HF5A 2K7CA 1RFJA 2G9BA 4CFQA 2KFHA 3I5FB 2IS9A 2F33A 3PN7C 3FIAA 2JXCA 1TIZA 3AAKA 4PE0A 2ZNDA 1B1GA 2KNEA 1SK6D 1QX7A 1IRJA 1B8LA 2VRGA 2L98A 3PATA 1SCMB 3EK8A 4MBEA 1Q80A 1K2HA 2K61A 1XFUO 3NXAA 2H61C 5CPVA 3TUYB 1TCOB 3EK7A 4AQIA 3BQ3A 2PASA 2JQ6A 1DJIA 2JRFA 1B47A 3CR4X 4I5JA 4PCWA 4P2YB 5DKRA 4YGAA 4MZLA 3O2PA 1F4OA 1RECA 3JVTC 1N65A 1QXPA 1RJVA 5D7FA 3I5IC 3HX4A 2L5XB 1EG3A 2FJUB 2KFFA 1IQ3A 1WLMA 2LVJA 2BBMA 1AJ4A 2EGDA 5AXIA 3AAJA 1QLSA 1V1FA 1C7VA 1CMGA 5GQQC 3LK0A 2LM5A 1RROA 3BUOB 3TS5C 3E3RA 2L4HA 3WHTB 3DF0B 4YI8A 1KWOB 3CR2A 1JWDA 2M29A 2JNFA 1KSMA 1LXFC 2NLNA 1SMGA 1BT6A 3OHMB 3PN7B 3EKHA 4C0KA 2M7LA 3SG2A 1KQMB 1K90D 4HREE 2M1KB 2ZRSA 4C0LA 1DJWA 1QV0A 1DT7B 1C07A 2M8UA 2HPSA 1MF8B 2ZFDA 4GGNA 2KBMA 1PK0D 2OTGC 1J7QA 3C1VA 2WC8A 2K8MB 3I5GC 1HT9A 1YTZC 1AUIB 1A4PA 3GK1A 2M0RA 4GNKB 5DKQA 1NX1A 3JVTB 1QTXA 1R2UA 1K9PA 4D1EA 3EVUA 1Y1UA 2O60A 2JWWA 3SIAA 2LUCA 3NSLA 4L9MA 3CS1A 1CDNA 1KK7Z 2BE4A 1AP4A 1NYAA 2WCFA 4Q04A 1S5GY 4PDZA 2F8PA 3RM1A 1QV1A 1XFVO 2LANA 1MWNA 2M97A 2I18A 3PM8A 4YGEB 1OZSA 3KO0A 1AJ5A 2WCEA 4YGBB 2KSPA 2BCBA 2KAYA 2BE6A 4E68A 4YI9A 1K9KA 1YUUA 1J7OA 3TUYC 2HQ8A 1CMFA 1TNXA 2L51A 1F71A 2R2IA 4ORCB 1DTLA 2KI6D 1CDLA 1YRTB 2Y1NA 3DF0A 4WRIA 4IL1A 2HQWA 1WRZA 1W7JB 2M49B 1K95A 2LMUA 1F54A 1FI5A 3GK2A 4PHJA 2JPTA 2BKHB 2OTGB 4ETOA 4FTGA 3BYAA 3VRRA 1QX2A 1A2XA 5CSJA 2G2BA 1A75B 3PALA 4GPLB 4ORBB 1R6PA 3OB1B 2HETA 2LUXA 1BF5A 4WQ2A 2COLB 3BXKA 3D10A 4XJKB 5HLVA 1NUBA 4GGFA 1BG1A 1SKTA 3SG3A 2AUCA 1L2OB 1DF0B 4MN0A 2D8NA 1CM1A 1PRWA 1S6IA 2KBIA 2LLTA 1EJ3A 3SIBA 3DD4A 1NCXA 1WRLA 2KOTA 3VRQA 2CTNA 2JU0A 2LP3A 3CZTX 1WLZA 2ZN9A 1PVBA 1M45A 2LC5A 1Y1AA 1AK8A 2RGIA 1KQMC 1A29A 2L0PA 4XYNA 2GV5A 5I8NA 2I94A 1L7ZA 2LHIA 1NCYA 4FQOA 1EL4A 1TOPA 1J1EA 1ODBA 1YVHA 1J55A 4M2OA 1YR5A 3OX6A 2QPTA 1MQ1A 3A4UB 3JTDB 4GGFC 1S5GZ 1EH2A 1CNPA 1WY9A 4NDBA 1G33A 4I5KA 4M2PA 4PE1A 1KK7Y 1KCYA 3EKJA 4GBAA 1IG5A 5IBWA 3NSKA 3OP0A 2QACA 3O78A 3LLEA 1MUXA 4MRYA 1S6CA 4PE4A 3VRPA 4WQ3A 2M9GA 2NCOA 5ER5A 1NCZA 5J3XA 1MHOA 3CGAA 1SY9A 1XFXO 3TDIA 1KQVA 1M63B 1B7TY 1AVSA 3AKAA 3F45A 4MRXA 3TDUA 1B8CA 4HRGA 1BR1B 1YX7A 5I2OA 1FPWA 1LA3A 1K93D 2KAXA 3RLZA 1XYDA 2TN4A 1CM4A 1DGUA 1DJGA 1KK8C 2SCPA 4QJ3B 4YGDB 5CSNA 1MXLC 1A75A 1SBJA 1XK4A 3LCPC 2MRDA 4BY4A 2DOQA 5KSZA 2EC6C 2BBNA 1B8RA 2NCPA 4XJKA 4AOMA 2MAZA 3CLNA 1OE9B 4JPZB 2FOTA 5D69A 3SG6A 3VGOA 3A8RA 1DF0A 1NWDA 5TNCA 2ZNEA 2PALA 1S3PA 1KFXL 3M0WA 2CNPA 4C0JA 4BY5A 3K21A 2KI4C 3EVRA 2KAVA 1FF1A 3AKBA 2H2KA 4JWQA 2LNKA 2MLFC 1VRKA 4QJ5B 3DVMA 3PFVA 1QIWA 4MEWA 3WNXB 1CFCA 1XK4C 1KFXS 1DGVA 1TN4A 1F55A 2ISDA 2JTZA 1FBVA 2PMYA 1MXEA 1HQVA 2MBXA 1WRKA 2KQ6A 3DVJA 3O6BA 1L2OC 1UP5A 1SCVA 1BR4B 3ZWHA 1WDCB 2KYFA 4A4BA 1W7IB 1DMOA 3QRXA 1EG4A 1KFUS 1SYMA 4PHMA 1SR6B 1AHRA 1BLQA 1K8UA 3TDZA 1IKUA 2KQYA 3GOFA 3SG4A 1SL9A 2M7NA 3SJSA 4ZCVA 5AFPA 2LVIA 1KK8B 5ER4X 4ZCUA 1SNLA 1TRFA 1UHIA 2WNDA 2O5GA 4HSZA 3I5HC 3JTDC 1S6JA 3KPXA 1OSAA 3KF9A 1B7TZ 2Y5IA 2EC6B 4GUKA 1JF0A 1QLKA 1D1OA 1PULA 1CLLA 1ZUZA 1CB1A 2CBLA 2OPOA 1RWYA 2PVBA 1YVLA 2Q91A 1IGVA 4F0ZB 2KI4B 2WCBA 4DRWA 2WOSA 1G8IA 1ALWA 2LLSA 1UHHA 2ZKMX 2WORA 3HCMA 1XFWO 3GK4X 3VROA 1S36A 1J7RA 1QIVA 2K7DA 1BODA 2KDHA 4M2QA 1QASA 3BUWB 1YUTA 4DCKA 1ALVA 5HKWA 4R1EA 3FS7A 2F2PA 4P5OE 5F6TA 2KGBC 1B4CA 2LMVA 4AQJA 1JC2A 2OS8B 4U8DA 1B9AA 2F3YA 1TTXA 3FWBA 4MZJA 4HRHA 2Y4QA 1QATA 1UHNA 2JZIA 4JQ0D 1YUSA 2E6WA 4DUQA 2K2AA 2MLEC 1M39A 2MJWB 4UPGA 1Y0VH 4QJ4B 2LVVA 3CWGA 1IWQA 1FW4A 2M1UA 3NSIA 5HYDA 4DS7A 4CPVA 3I5HB 1DJYA 4GFTA 5HKYA 1CFDA 2AAOA 1BU3A 1H8BA 2KI6C 4NDCA 4MZKA 2JTTA 5PALA 3IQOA 2K0JA 3PSRA 3CR5X 1YX8A 2P6BB 3BUNB 1V1GA 1OMVA 1CDMA 1GJYA 2CT9A 1OOJA 3BUXB 2JT3A 2V53A 3LL8B 1CLBA 2JT8A 1CTRA 2BECA 4MLWA 1WDCC 3PLFB 2JNXA 5CSFA 1QVIY 4GAOA 4N1FA 5AEQA 1SR6C 1RK9A 3NSOA 1SRAA 1F70A 2FCDA 5DKNA 1X02A 1ZFSA 1ZMZA 4YGCB 2K2FA 2ZN8A 1LA0A 4NQGA 1NX2A 1ZACA 1IJ6A 4YBHB 1FI6A 5I2LA 1NIWA 1PALA 4PHNA 1NPQA 1SL7A 2K7BA 4PE7A 1SL8A 4MVFA 1M46A 1S26D 1H4BA 2KYCA 4I5NB 4ORAB 3SG7A 1JBAA 2LV7A 2CXJA 1TNWA 2BL0B 1Y1XA 4OVNF 4ICBA 5FYXA 1XO5A 1Y6WA 3OB2B 5KTYA 1U5IA 1JFKA 1PSBA 1DJZA 2SASA 2FCEA 5AERA 4CFRA 1J7PA 2AMIA 3O4YA 2F2OA 1OMRA 5G08A 1DJXA 3IF7A 3LK1A 4N5XA 3EK4A 2MHHA 1F4QA 1CFPA 2JT0A 1KFUL 2EHBA 3KEVA 2I7AA 2GGZA 2F3ZA 3BOWB 1LINA 1UWOA 1N0YA 5K89A 4PALA 5JOLA 1BOCA 1CDPA 3D0YB 1TCFA 4OKHA 5BPJA 5HLOA 2KHNA 4CLNA 2OS8C 1M31A 3CTNA 2LAPA 1G4YR 5HKZA 1JFJA 1BMOA
chains in the Genus database with same CATH superfamily
3CZ0A 1OZOA 2WC5A 4OCIA 1MR8A 2LCPA 2JULA 2ZRTA 1J1DA 2ERBA 2BKIB 1QS7A 2M3WA 3Q8IA 2LE9B 4TNCA 3ZNIA 3TZ1A 2JC2A 4USLA 3SS4A 1QVIZ 5I2QA 2PRUA 1XA5A 2PSRA 1DELA 5AANA 1PVAA 1NP8A 4OR9B 2I2RE 3SG5A 1PSRA 1GQMA 3I5IB 2JXLA 1F8HA 1BJFA 4PHKA 4YRUA 1IJ5A 1LVCD 1E8AA 2L50A 3VRNA 1JSAA 1CFFA 2JOJA 3KHEA 2WCLA 3I5FC 1GGZA 1UUSA 2NZ0A 1GGWA 3B6XA 4NDDA 1XVJA 4OV2A 3DVKA 1QX5B 1S1EA 2BCAA 2CCMA 3FWCA 1YURA 2QEOA 3TS5B 4CIDA 1K94A 1OMDA 2E30A 1C7WA 2L4IA 1LS8A 2NXQA 3H4SE 3R72A 1A03A 1SCMC 3DYEA 3WHUB 2B1UA 1QJTA 4MSPA 3B7AA 1SW8A 3ICBA 3S0EA 4DIRA 5B8IB 2LP2A 3WXAA 1IH0A 5JJGA 1T14A 2KFGA 1RTP1 1UURA 2QEBA 1DJHA 2KGRA 2MA2A 1UHJA 1IQ5A 5CSIA 1OQPA 2GGMA 2LMTA 1TNPA 1U5IB 1TNQA 3BUMB 3OX5A 1XFYO 1NSHA 2L2EA 3BOWA 2Y1MA 1DVIA 1EXRA 1KSOA 1N2DA 1YRUB 2BL0C 3IQQA 3DVEA 5KU1A 3MSEB 2LLUA 2BCXA 3D0YA 3I5GB 2A4JA 1NX3A 4N1GA 3OGNA 1CLMA 1SPYA 1TWOA 1ZOTB 1LKJA 2LVKA 3EVVA 1JF2A 1K9UA 1NX0A 4I5LB 2LHLA 1XFZO 2H61A 2Q4UA 1CKKA 4A4CA 2K7OA 1UHKA 1JUOA 1KWOC 1K96A 2HF5A 2K7CA 1RFJA 2G9BA 4CFQA 2KFHA 3I5FB 2IS9A 2F33A 3PN7C 3FIAA 2JXCA 1TIZA 3AAKA 4PE0A 3EG5B 2ZNDA 1B1GA 2KNEA 1SK6D 5I94A 1QX7A 1IRJA 1B8LA 1DQEA 2QEVA 2YGUA 2VRGA 1W9ZA 2L98A 3PATA 1SCMB 3EK8A 4MBEA 1Q80A 1K2HA 2K61A 1XFUO 3FE8A 3NXAA 2H61C 5CPVA 3TUYB 1TCOB 3EK7A 4AQIA 3BQ3A 2PASA 2JQ6A 1DJIA 2L5YA 3B86A 2JRFA 1B47A 3CR4X 2BAPA 4I5JA 4PCWA 4P2YB 5DKRA 4YGAA 4MZLA 3O2PA 1F4OA 1RECA 3JVTC 1N65A 5FI2A 1QXPA 1RJVA 5D7FA 3I5IC 3HX4A 2L5XB 1EG3A 2FJUB 2KFFA 1IQ3A 1WLMA 2LVJA 2BBMA 1AJ4A 2EGDA 3L4AA 5AXIA 3AAJA 1QLSA 1V1FA 1C7VA 1CMGA 5GQQC 3LK0A 2LM5A 1RROA 3BUOB 3TS5C 3E3RA 4PT1A 2L4HA 5FI7A 3WHTB 3DF0B 4YI8A 1KWOB 3CR2A 3D78A 3DZTA 1JWDA 3BFBA 3S0GA 2M29A 2JNFA 1KSMA 1LXFC 2NLNA 1SMGA 1BT6A 3OHMB 3PN7B 3EKHA 4C0KA 2M7LA 3BFHA 3SG2A 3S0AA 1KQMB 1K90D 4HREE 2M1KB 2ZRSA 4C0LA 1DJWA 1QV0A 1DT7B 1C07A 2M8UA 2HPSA 1MF8B 4IJ7A 2ZFDA 4GGNA 2KBMA 1PK0D 2OTGC 1J7QA 1OOFA 3C1VA 1QWVA 2WC8A 2K8MB 3I5GC 1HT9A 1YTZC 1AUIB 1A4PA 3GK1A 2M0RA 4GNKB 5DKQA 1NX1A 3JVTB 1QTXA 1R2UA 1K9PA 4D1EA 3EVUA 1Y1UA 2O60A 2JWWA 3SIAA 2LUCA 3NSLA 4L9MA 3CS1A 1CDNA 1KK7Z 2BE4A 1AP4A 1NYAA 2WCFA 4Q04A 1S5GY 4PDZA 2F8PA 3RM1A 1QV1A 1XFVO 2LANA 1MWNA 2PQLA 2M97A 2I18A 3PM8A 4YGEB 1OZSA 3KO0A 1AJ5A 2WCEA 4YGBB 2KSPA 2BCBA 3O4XA 2KAYA 2BE6A 4E68A 4YI9A 1K9KA 3B88A 1YUUA 1J7OA 3TUYC 4F7FA 2HQ8A 1CMFA 1TNXA 2L51A 1F71A 2R2IA 4ORCB 1DTLA 2KI6D 1CDLA 1YRTB 2L2CA 2Y1NA 3DF0A 4WRIA 3S0FA 4IL1A 2HQWA 1IIOA 1WRZA 1W7JB 3D75A 2M49B 1K95A 2LMUA 1OOGA 3RZSA 1F54A 3GK2A 4PHJA 2JPTA 2BKHB 4OZDA 1FI5A 2WCMA 2OTGB 4ETOA 4FTGA 3BYAA 3NHIA 1QX2A 3VRRA 3S0DA 1A2XA 5CSJA 3VB1A 3UNWA 2G2BA 1A75B 3PALA 4GPLB 4ORBB 1R6PA 3OB1B 2HETA 2LUXA 1BF5A 4WQ2A 2COLB 3BXKA 3D10A 4XJKB 5HLVA 3OBVA 1NUBA 4GGFA 1BG1A 1SKTA 3SG3A 2AUCA 1L2OB 1DF0B 2P71A 4MN0A 2D8NA 1CM1A 1PRWA 1S6IA 2KBIA 2LLTA 2P70A 1EJ3A 3PJIA 3R1VA 3SIBA 3DD4A 1NCXA 1WRLA 3PM2A 2KOTA 3VRQA 2CTNA 2JU0A 2LP3A 3CZTX 1WLZA 2ZN9A 5D3OA 1PVBA 1M45A 2LC5A 1Y1AA 1AK8A 2RGIA 3NHTA 1KQMC 1A29A 2L0PA 4XYNA 2GV5A 5I8NA 2I94A 1L7ZA 2LHIA 1NCYA 1XFRA 4FQOA 1EL4A 3BJHA 1TOPA 1J1EA 1ODBA 1YVHA 1J55A 3L47A 4M2OA 1YR5A 3OX6A 2QPTA 1MQ1A 3A4UB 3JTDB 4GGFC 1S5GZ 1EH2A 1CNPA 1WY9A 4NDBA 1G33A 4I5KA 4M2PA 4PE1A 1KK7Y 1KCYA 3K1EA 1TUZA 3CYZA 3EKJA 4GBAA 1IG5A 5IBWA 3NSKA 3OP0A 2QACA 3O78A 3LLEA 1MUXA 4MRYA 1S6CA 3R1PA 4PE4A 3FE6A 4WQ3A 3B87A 3VRPA 2M9GA 2NCOA 5ER5A 1NCZA 5J3XA 1MHOA 3CGAA 1SY9A 1XFXO 3TDIA 1KQVA 2QDIA 1M63B 1B7TY 1AVSA 3AKAA 3F45A 4MRXA 3TDUA 1B8CA 4HRGA 1GM0A 1BR1B 1YX7A 5I2OA 1FPWA 1LA3A 1K93D 2KAXA 3RLZA 1XYDA 1OW4A 4JKTA 2TN4A 1CM4A 1DGUA 1DJGA 1KK8C 2SCPA 4QJ3B 4YGDB 5CSNA 1MXLC 1A75A 2WCHA 1SBJA 1XK4A 3LCPC 1Z2CB 2MRDA 4BY4A 2DOQA 3S0BA 5KSZA 2EC6C 2BBNA 1B8RA 2NCPA 3FE9A 4KYNA 2MAZA 4XJKA 3CLNA 1OE9B 4JPZB 2FOTA 5D69A 3SG6A 3VGOA 3CDNA 3A8RA 1DF0A 1NWDA 5TNCA 2ZNEA 2PALA 1S3PA 1KFXL 3M0WA 2CNPA 1Z4HA 4C0JA 1P28A 4BY5A 3K21A 2KI4C 3EVRA 2KAVA 1FF1A 3AKBA 4JD9A 2H2KA 4JWQA 2LNKA 5HL1A 2MLFC 1VRKA 4QJ5B 1OOIX 3DVMA 1QIWA 3PFVA 4MEWA 3WNXB 1CFCA 1XK4C 1KFXS 1DGVA 1TN4A 3IVTA 1F55A 2ISDA 2JTZA 1FBVA 2PMYA 2KLDA 3DXLA 1MXEA 1HQVA 2MBXA 1WRKA 2KQ6A 3DVJA 3O6BA 1L2OC 1UP5A 1SCVA 1BR4B 3ZWHA 1WDCB 2KYFA 4A4BA 1W7IB 1DMOA 3QRXA 1EG4A 1KFUS 1SYMA 4PHMA 1SR6B 5DICA 1AHRA 1BLQA 1K8UA 3SS3A 3TDZA 2KQYA 1TUJA 2JPOA 3GOFA 3SG4A 1IKUA 1SL9A 2FJYA 5EL2A 2M7NA 3BFAA 3SJSA 1OOHA 4ZCVA 3N7HA 5AFPA 2KLEA 2LVIA 1KK8B 5ER4X 4ZCUA 1SNLA 1TRFA 1UHIA 2WNDA 2O5GA 4HSZA 3I5HC 3JTDC 1S6JA 3KPXA 1OSAA 3KF9A 1B7TZ 2Y5IA 5FI6A 2EC6B 4GUKA 1JF0A 1QLKA 1D1OA 1PULA 1CLLA 1ZUZA 3QMEA 1CB1A 2CBLA 2OPOA 1RWYA 2PVBA 1YVLA 2Q91A 3UO9A 1IGVA 3L4LA 4F0ZB 2KI4B 3D74A 3DY9A 2WCBA 4DRWA 2WOSA 1G8IA 1ALWA 2LLSA 1UHHA 2ZKMX 2WORA 2GTEA 1XFWO 3GK4X 3HCMA 3NGVA 3VROA 1S36A 1J7RA 1QIVA 2K7DA 1BODA 2KDHA 4M2QA 1QASA 3BUWB 1YUTA 4DCKA 1ALVA 5HKWA 4R1EA 3FS7A 2F2PA 4P5OE 5F6TA 2KGBC 3V2LA 2H8VA 1B4CA 2LMVA 1C3ZA 4AQJA 1JC2A 2OS8B 4U8DA 1B9AA 2F3YA 1TTXA 3FWBA 4MZJA 4HRHA 2Y4QA 1QATA 1UHNA 2JZIA 4FQTA 4JQ0D 1YUSA 2E6WA 4DUQA 2K2AA 2MLEC 1M39A 3R1OA 1ORGA 2MJWB 2BNXA 4UPGA 1Y0VH 4QJ4B 2LVVA 3CWGA 1IWQA 1FW4A 2M1UA 3NSIA 5HYDA 4DS7A 4CPVA 3I5HB 3CZ1A 1DJYA 4GFTA 5HKYA 1CFDA 2AAOA 1BU3A 1H8BA 2KI6C 4NDCA 4MZKA 2JTTA 5PALA 3IQOA 2K0JA 3PSRA 1DEKA 3CR5X 1YX8A 2P6BB 3BUNB 1V1GA 1OMVA 2PYQA 1CDMA 1GJYA 2CT9A 1OOJA 3BUXB 2JT3A 2V53A 3LL8B 1CLBA 2JT8A 1DC1A 1CTRA 2BECA 4MLWA 1WDCC 3PLFB 2JNXA 5CSFA 1QVIY 4GAOA 4N1FA 5AEQA 3D76A 1SR6C 1RK9A 3NSOA 1SRAA 1SSEB 1C3YA 1F70A 2FCDA 3CZ2A 5DKNA 1X02A 1ZFSA 1ZMZA 3D73A 4YGCB 2K2FA 2ZN8A 1LA0A 4NQGA 1NX2A 1ZACA 1IJ6A 4YBHB 1FI6A 5I2LA 1NIWA 1PALA 4PHNA 1NPQA 1SL7A 2K7BA 4PE7A 1SL8A 4MVFA 1M46A 1S26D 1H4BA 2KYCA 4I5NB 4ORAB 3SG7A 1JBAA 2LV7A 2CXJA 1TNWA 2BL0B 1Y1XA 4OVNF 4ICBA 5FYXA 1XO5A 2KPHA 1Y6WA 2K60A 3SS5A 2QEHA 3OB2B 5KTYA 2WCJA 1U5IA 2WC6A 1JFKA 1PSBA 1DJZA 2SASA 2FCEA 5AERA 4CFRA 1J7PA 2AMIA 3O4YA 2F2OA 4INWA 1OMRA 5G08A 1DJXA 4INXA 3IF7A 3LK1A 4N5XA 3EK4A 2MHHA 1F4QA 1CFPA 4AOMA 2JT0A 3CABA 1KFUL 2EHBA 3KEVA 2I7AA 2WCKA 2GGZA 2F3ZA 3BOWB 1LINA 1UWOA 1N0YA 5K89A 4PALA 5JOLA 1BOCA 1CDPA 3D0YB 1TCFA 4OKHA 5BPJA 3D77A 5HLOA 2KHNA 4CLNA 2OS8C 1M31A 3CTNA 2LAPA 1G4YR 5HKZA 1JFJA 1BMOA
chains in the Genus database with same CATH topology
1OZOA 4OCIA 1MR8A 2LCPA 2JULA 2ZRTA 1J1DA 2M3WA 2BKIB 1QS7A 2LE9B 4TNCA 3ZNIA 3TZ1A 2JC2A 4USLA 5I2QA 1QVIZ 2PRUA 1XA5A 2PSRA 5AANA 1PVAA 1NP8A 4OR9B 2I2RE 3SG5A 1PSRA 1GQMA 3I5IB 2JXLA 1F8HA 1BJFA 4PHKA 4YRUA 1IJ5A 1LVCD 1E8AA 2L50A 3VRNA 1JSAA 1CFFA 2JOJA 3KHEA 3I5FC 1GGZA 1UUSA 2NZ0A 1GGWA 4NDDA 1XVJA 4OV2A 3DVKA 1QX5B 1S1EA 2BCAA 2CCMA 3FWCA 1YURA 3TS5B 4CIDA 1K94A 1OMDA 2E30A 1C7WA 2L4IA 2NXQA 3H4SE 1A03A 1SCMC 3WHUB 2B1UA 1QJTA 4MSPA 1SW8A 3ICBA 4DIRA 5B8IB 2LP2A 3WXAA 1IH0A 5JJGA 2KFGA 1RTP1 1UURA 1DJHA 2KGRA 2MA2A 1UHJA 1IQ5A 5CSIA 1OQPA 2GGMA 2LMTA 1TNPA 1U5IB 1TNQA 3BUMB 3OX5A 1XFYO 1NSHA 2L2EA 3BOWA 2Y1MA 1DVIA 1EXRA 1KSOA 1N2DA 1YRUB 2BL0C 3IQQA 3DVEA 5KU1A 3MSEB 2LLUA 2BCXA 3D0YA 3I5GB 2A4JA 1NX3A 4N1GA 1CLMA 1SPYA 1ZOTB 1LKJA 2LVKA 3EVVA 1JF2A 1K9UA 1NX0A 4I5LB 2LHLA 1XFZO 2H61A 2Q4UA 1CKKA 4A4CA 2K7OA 1UHKA 1JUOA 1KWOC 1K96A 2HF5A 2K7CA 1RFJA 2G9BA 4CFQA 2KFHA 3I5FB 2IS9A 2F33A 3PN7C 3FIAA 2JXCA 1TIZA 3AAKA 4PE0A 2ZNDA 1B1GA 2KNEA 1SK6D 1QX7A 1IRJA 1B8LA 2VRGA 2L98A 3PATA 1SCMB 3EK8A 4MBEA 1Q80A 1K2HA 2K61A 1XFUO 3NXAA 2H61C 5CPVA 3TUYB 1TCOB 3EK7A 4AQIA 3BQ3A 2PASA 2JQ6A 1DJIA 2JRFA 1B47A 3CR4X 4I5JA 4PCWA 4P2YB 5DKRA 4YGAA 4MZLA 3O2PA 1F4OA 1RECA 3JVTC 1N65A 1QXPA 1RJVA 5D7FA 3I5IC 3HX4A 2L5XB 1EG3A 2FJUB 2KFFA 1IQ3A 1WLMA 2LVJA 2BBMA 1AJ4A 2EGDA 5AXIA 3AAJA 1QLSA 1V1FA 1C7VA 1CMGA 5GQQC 3LK0A 2LM5A 1RROA 3BUOB 3TS5C 3E3RA 2L4HA 3WHTB 3DF0B 4YI8A 1KWOB 3CR2A 1JWDA 2M29A 2JNFA 1KSMA 1LXFC 2NLNA 1SMGA 1BT6A 3OHMB 3PN7B 3EKHA 4C0KA 2M7LA 3SG2A 1KQMB 1K90D 4HREE 2M1KB 2ZRSA 4C0LA 1DJWA 1QV0A 1DT7B 1C07A 2M8UA 2HPSA 1MF8B 2ZFDA 4GGNA 2KBMA 1PK0D 2OTGC 1J7QA 3C1VA 2WC8A 2K8MB 3I5GC 1HT9A 1YTZC 1AUIB 1A4PA 3GK1A 2M0RA 4GNKB 5DKQA 1NX1A 3JVTB 1QTXA 1R2UA 1K9PA 4D1EA 3EVUA 1Y1UA 2O60A 2JWWA 3SIAA 2LUCA 3NSLA 4L9MA 3CS1A 1CDNA 1KK7Z 2BE4A 1AP4A 1NYAA 2WCFA 4Q04A 1S5GY 4PDZA 2F8PA 3RM1A 1QV1A 1XFVO 2LANA 1MWNA 2M97A 2I18A 3PM8A 4YGEB 1OZSA 3KO0A 1AJ5A 2WCEA 4YGBB 2KSPA 2BCBA 2KAYA 2BE6A 4E68A 4YI9A 1K9KA 1YUUA 1J7OA 3TUYC 2HQ8A 1CMFA 1TNXA 2L51A 1F71A 2R2IA 4ORCB 1DTLA 2KI6D 1CDLA 1YRTB 2Y1NA 3DF0A 4WRIA 4IL1A 2HQWA 1WRZA 1W7JB 2M49B 1K95A 2LMUA 1F54A 1FI5A 3GK2A 4PHJA 2JPTA 2BKHB 2OTGB 4ETOA 4FTGA 3BYAA 3VRRA 1QX2A 1A2XA 5CSJA 2G2BA 1A75B 3PALA 4GPLB 4ORBB 1R6PA 3OB1B 2HETA 2LUXA 1BF5A 4WQ2A 2COLB 3BXKA 3D10A 4XJKB 5HLVA 1NUBA 4GGFA 1BG1A 1SKTA 3SG3A 2AUCA 1L2OB 1DF0B 4MN0A 2D8NA 1CM1A 1PRWA 1S6IA 2KBIA 2LLTA 1EJ3A 3SIBA 3DD4A 1NCXA 1WRLA 2KOTA 3VRQA 2CTNA 2JU0A 2LP3A 3CZTX 1WLZA 2ZN9A 1PVBA 1M45A 2LC5A 1Y1AA 1AK8A 2RGIA 1KQMC 1A29A 2L0PA 4XYNA 2GV5A 5I8NA 2I94A 1L7ZA 2LHIA 1NCYA 4FQOA 1EL4A 1TOPA 1J1EA 1ODBA 1YVHA 1J55A 4M2OA 1YR5A 3OX6A 2QPTA 1MQ1A 3A4UB 3JTDB 4GGFC 1S5GZ 1EH2A 1CNPA 1WY9A 4NDBA 1G33A 4I5KA 4M2PA 4PE1A 1KK7Y 1KCYA 3EKJA 4GBAA 1IG5A 5IBWA 3NSKA 3OP0A 2QACA 3O78A 3LLEA 1MUXA 4MRYA 1S6CA 4PE4A 3VRPA 4WQ3A 2M9GA 2NCOA 5ER5A 1NCZA 5J3XA 1MHOA 3CGAA 1SY9A 1XFXO 3TDIA 1KQVA 1M63B 1B7TY 1AVSA 3AKAA 3F45A 4MRXA 3TDUA 1B8CA 4HRGA 1BR1B 1YX7A 5I2OA 1FPWA 1LA3A 1K93D 2KAXA 3RLZA 1XYDA 2TN4A 1CM4A 1DGUA 1DJGA 1KK8C 2SCPA 4QJ3B 4YGDB 5CSNA 1MXLC 1A75A 1SBJA 1XK4A 3LCPC 2MRDA 4BY4A 2DOQA 5KSZA 2EC6C 2BBNA 1B8RA 2NCPA 4XJKA 4AOMA 2MAZA 3CLNA 1OE9B 4JPZB 2FOTA 5D69A 3SG6A 3VGOA 3A8RA 1DF0A 1NWDA 5TNCA 2ZNEA 2PALA 1S3PA 1KFXL 3M0WA 2CNPA 4C0JA 4BY5A 3K21A 2KI4C 3EVRA 2KAVA 1FF1A 3AKBA 2H2KA 4JWQA 2LNKA 2MLFC 1VRKA 4QJ5B 3DVMA 3PFVA 1QIWA 4MEWA 3WNXB 1CFCA 1XK4C 1KFXS 1DGVA 1TN4A 1F55A 2ISDA 2JTZA 1FBVA 2PMYA 1MXEA 1HQVA 2MBXA 1WRKA 2KQ6A 3DVJA 3O6BA 1L2OC 1UP5A 1SCVA 1BR4B 3ZWHA 1WDCB 2KYFA 4A4BA 1W7IB 1DMOA 3QRXA 1EG4A 1KFUS 1SYMA 4PHMA 1SR6B 1AHRA 1BLQA 1K8UA 3TDZA 1IKUA 2KQYA 3GOFA 3SG4A 1SL9A 2M7NA 3SJSA 4ZCVA 5AFPA 2LVIA 1KK8B 5ER4X 4ZCUA 1SNLA 1TRFA 1UHIA 2WNDA 2O5GA 4HSZA 3I5HC 3JTDC 1S6JA 3KPXA 1OSAA 3KF9A 1B7TZ 2Y5IA 2EC6B 4GUKA 1JF0A 1QLKA 1D1OA 1PULA 1CLLA 1ZUZA 1CB1A 2CBLA 2OPOA 1RWYA 2PVBA 1YVLA 2Q91A 1IGVA 4F0ZB 2KI4B 2WCBA 4DRWA 2WOSA 1G8IA 1ALWA 2LLSA 1UHHA 2ZKMX 2WORA 3HCMA 1XFWO 3GK4X 3VROA 1S36A 1J7RA 1QIVA 2K7DA 1BODA 2KDHA 4M2QA 1QASA 3BUWB 1YUTA 4DCKA 1ALVA 5HKWA 4R1EA 3FS7A 2F2PA 4P5OE 5F6TA 2KGBC 1B4CA 2LMVA 4AQJA 1JC2A 2OS8B 4U8DA 1B9AA 2F3YA 1TTXA 3FWBA 4MZJA 4HRHA 2Y4QA 1QATA 1UHNA 2JZIA 4JQ0D 1YUSA 2E6WA 4DUQA 2K2AA 2MLEC 1M39A 2MJWB 4UPGA 1Y0VH 4QJ4B 2LVVA 3CWGA 1IWQA 1FW4A 2M1UA 3NSIA 5HYDA 4DS7A 4CPVA 3I5HB 1DJYA 4GFTA 5HKYA 1CFDA 2AAOA 1BU3A 1H8BA 2KI6C 4NDCA 4MZKA 2JTTA 5PALA 3IQOA 2K0JA 3PSRA 3CR5X 1YX8A 2P6BB 3BUNB 1V1GA 1OMVA 1CDMA 1GJYA 2CT9A 1OOJA 3BUXB 2JT3A 2V53A 3LL8B 1CLBA 2JT8A 1CTRA 2BECA 4MLWA 1WDCC 3PLFB 2JNXA 5CSFA 1QVIY 4GAOA 4N1FA 5AEQA 1SR6C 1RK9A 3NSOA 1SRAA 1F70A 2FCDA 5DKNA 1X02A 1ZFSA 1ZMZA 4YGCB 2K2FA 2ZN8A 1LA0A 4NQGA 1NX2A 1ZACA 1IJ6A 4YBHB 1FI6A 5I2LA 1NIWA 1PALA 4PHNA 1NPQA 1SL7A 2K7BA 4PE7A 1SL8A 4MVFA 1M46A 1S26D 1H4BA 2KYCA 4I5NB 4ORAB 3SG7A 1JBAA 2LV7A 2CXJA 1TNWA 2BL0B 1Y1XA 4OVNF 4ICBA 5FYXA 1XO5A 1Y6WA 3OB2B 5KTYA 1U5IA 1JFKA 1PSBA 1DJZA 2SASA 2FCEA 5AERA 4CFRA 1J7PA 2AMIA 3O4YA 2F2OA 1OMRA 5G08A 1DJXA 3IF7A 3LK1A 4N5XA 3EK4A 2MHHA 1F4QA 1CFPA 2JT0A 1KFUL 2EHBA 3KEVA 2I7AA 2GGZA 2F3ZA 3BOWB 1LINA 1UWOA 1N0YA 5K89A 4PALA 5JOLA 1BOCA 1CDPA 3D0YB 1TCFA 4OKHA 5BPJA 5HLOA 2KHNA 4CLNA 2OS8C 1M31A 3CTNA 2LAPA 1G4YR 5HKZA 1JFJA 1BMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZO A;  4OCI A;  1MR8 A;  2LCP A;  2JUL A;  2ZRT A;  1J1D A;  2M3W A;  2BKI B;  1QS7 A;  2LE9 B;  4TNC A;  3ZNI A;  3TZ1 A;  2JC2 A;  4USL A;  5I2Q A;  1QVI Z;  2PRU A;  1XA5 A;  2PSR A;  5AAN A;  1PVA A;  1NP8 A;  4OR9 B;  2I2R E;  3SG5 A;  1PSR A;  1GQM A;  3I5I B;  2JXL A;  1F8H A;  1BJF A;  4PHK A;  4YRU A;  1IJ5 A;  1LVC D;  1E8A A;  2L50 A;  3VRN A;  1JSA A;  1CFF A;  2JOJ A;  3KHE A;  3I5F C;  1GGZ A;  1UUS A;  2NZ0 A;  1GGW A;  4NDD A;  1XVJ A;  4OV2 A;  3DVK A;  1QX5 B;  1S1E A;  2BCA A;  2CCM A;  3FWC A;  1YUR A;  3TS5 B;  4CID A;  1K94 A;  1OMD A;  2E30 A;  1C7W A;  2L4I A;  2NXQ A;  3H4S E;  1A03 A;  1SCM C;  3WHU B;  2B1U A;  1QJT A;  4MSP A;  1SW8 A;  3ICB A;  4DIR A;  5B8I B;  2LP2 A;  3WXA A;  1IH0 A;  5JJG A;  2KFG A;  1RTP 1;  1UUR A;  1DJH A;  2KGR A;  2MA2 A;  1UHJ A;  1IQ5 A;  5CSI A;  1OQP A;  2GGM A;  2LMT A;  1TNP A;  1U5I B;  1TNQ A;  3BUM B;  3OX5 A;  1XFY O;  1NSH A;  2L2E A;  3BOW A;  2Y1M A;  1DVI A;  1EXR A;  1KSO A;  1N2D A;  1YRU B;  2BL0 C;  3IQQ A;  3DVE A;  5KU1 A;  3MSE B;  2LLU A;  2BCX A;  3D0Y A;  3I5G B;  2A4J A;  1NX3 A;  4N1G A;  1CLM A;  1SPY A;  1ZOT B;  1LKJ A;  2LVK A;  3EVV A;  1JF2 A;  1K9U A;  1NX0 A;  4I5L B;  2LHL A;  1XFZ O;  2H61 A;  2Q4U A;  1CKK A;  4A4C A;  2K7O A;  1UHK A;  1JUO A;  1KWO C;  1K96 A;  2HF5 A;  2K7C A;  1RFJ A;  2G9B A;  4CFQ A;  2KFH A;  3I5F B;  2IS9 A;  2F33 A;  3PN7 C;  3FIA A;  2JXC A;  1TIZ A;  3AAK A;  4PE0 A;  2ZND A;  1B1G A;  2KNE A;  1SK6 D;  1QX7 A;  1IRJ A;  1B8L A;  2VRG A;  2L98 A;  3PAT A;  1SCM B;  3EK8 A;  4MBE A;  1Q80 A;  1K2H A;  2K61 A;  1XFU O;  3NXA A;  2H61 C;  5CPV A;  3TUY B;  1TCO B;  3EK7 A;  4AQI A;  3BQ3 A;  2PAS A;  2JQ6 A;  1DJI A;  2JRF A;  1B47 A;  3CR4 X;  4I5J A;  4PCW A;  4P2Y B;  5DKR A;  4YGA A;  4MZL A;  3O2P A;  1F4O A;  1REC A;  3JVT C;  1N65 A;  1QXP A;  1RJV A;  5D7F A;  3I5I C;  3HX4 A;  2L5X B;  1EG3 A;  2FJU B;  2KFF A;  1IQ3 A;  1WLM A;  2LVJ A;  2BBM A;  1AJ4 A;  2EGD A;  5AXI A;  3AAJ A;  1QLS A;  1V1F A;  1C7V A;  1CMG A;  5GQQ C;  3LK0 A;  2LM5 A;  1RRO A;  3BUO B;  3TS5 C;  3E3R A;  2L4H A;  3WHT B;  3DF0 B;  4YI8 A;  1KWO B;  3CR2 A;  1JWD A;  2M29 A;  2JNF A;  1KSM A;  1LXF C;  2NLN A;  1SMG A;  1BT6 A;  3OHM B;  3PN7 B;  3EKH A;  4C0K A;  2M7L A;  3SG2 A;  1KQM B;  1K90 D;  4HRE E;  2M1K B;  2ZRS A;  4C0L A;  1DJW A;  1QV0 A;  1DT7 B;  1C07 A;  2M8U A;  2HPS A;  1MF8 B;  2ZFD A;  4GGN A;  2KBM A;  1PK0 D;  2OTG C;  1J7Q A;  3C1V A;  2WC8 A;  2K8M B;  3I5G C;  1HT9 A;  1YTZ C;  1AUI B;  1A4P A;  3GK1 A;  2M0R A;  4GNK B;  5DKQ A;  1NX1 A;  3JVT B;  1QTX A;  1R2U A;  1K9P A;  4D1E A;  3EVU A;  1Y1U A;  2O60 A;  2JWW A;  3SIA A;  2LUC A;  3NSL A;  4L9M A;  3CS1 A;  1CDN A;  1KK7 Z;  2BE4 A;  1AP4 A;  1NYA A;  2WCF A;  4Q04 A;  1S5G Y;  4PDZ A;  2F8P A;  3RM1 A;  1QV1 A;  1XFV O;  2LAN A;  1MWN A;  2M97 A;  2I18 A;  3PM8 A;  4YGE B;  1OZS A;  3KO0 A;  1AJ5 A;  2WCE A;  4YGB B;  2KSP A;  2BCB A;  2KAY A;  2BE6 A;  4E68 A;  4YI9 A;  1K9K A;  1YUU A;  1J7O A;  3TUY C;  2HQ8 A;  1CMF A;  1TNX A;  2L51 A;  1F71 A;  2R2I A;  4ORC B;  1DTL A;  2KI6 D;  1CDL A;  1YRT B;  2Y1N A;  3DF0 A;  4WRI A;  4IL1 A;  2HQW A;  1WRZ A;  1W7J B;  2M49 B;  1K95 A;  2LMU A;  1F54 A;  1FI5 A;  3GK2 A;  4PHJ A;  2JPT A;  2BKH B;  2OTG B;  4ETO A;  4FTG A;  3BYA A;  3VRR A;  1QX2 A;  1A2X A;  5CSJ A;  2G2B A;  1A75 B;  3PAL A;  4GPL B;  4ORB B;  1R6P A;  3OB1 B;  2HET A;  2LUX A;  1BF5 A;  4WQ2 A;  2COL B;  3BXK A;  3D10 A;  4XJK B;  5HLV A;  1NUB A;  4GGF A;  1BG1 A;  1SKT A;  3SG3 A;  2AUC A;  1L2O B;  1DF0 B;  4MN0 A;  2D8N A;  1CM1 A;  1PRW A;  1S6I A;  2KBI A;  2LLT A;  1EJ3 A;  3SIB A;  3DD4 A;  1NCX A;  1WRL A;  2KOT A;  3VRQ A;  2CTN A;  2JU0 A;  2LP3 A;  3CZT X;  1WLZ A;  2ZN9 A;  1PVB A;  1M45 A;  2LC5 A;  1Y1A A;  1AK8 A;  2RGI A;  1KQM C;  1A29 A;  2L0P A;  4XYN A;  2GV5 A;  5I8N A;  2I94 A;  1L7Z A;  2LHI A;  1NCY A;  4FQO A;  1EL4 A;  1TOP A;  1J1E A;  1ODB A;  1YVH A;  1J55 A;  4M2O A;  1YR5 A;  3OX6 A;  2QPT A;  1MQ1 A;  3A4U B;  3JTD B;  4GGF C;  1S5G Z;  1EH2 A;  1CNP A;  1WY9 A;  4NDB A;  1G33 A;  4I5K A;  4M2P A;  4PE1 A;  1KK7 Y;  1KCY A;  3EKJ A;  4GBA A;  1IG5 A;  5IBW A;  3NSK A;  3OP0 A;  2QAC A;  3O78 A;  3LLE A;  1MUX A;  4MRY A;  1S6C A;  4PE4 A;  3VRP A;  4WQ3 A;  2M9G A;  2NCO A;  5ER5 A;  1NCZ A;  5J3X A;  1MHO A;  3CGA A;  1SY9 A;  1XFX O;  3TDI A;  1KQV A;  1M63 B;  1B7T Y;  1AVS A;  3AKA A;  3F45 A;  4MRX A;  3TDU A;  1B8C A;  4HRG A;  1BR1 B;  1YX7 A;  5I2O A;  1FPW A;  1LA3 A;  1K93 D;  2KAX A;  3RLZ A;  1XYD A;  2TN4 A;  1CM4 A;  1DGU A;  1DJG A;  1KK8 C;  2SCP A;  4QJ3 B;  4YGD B;  5CSN A;  1MXL C;  1A75 A;  1SBJ A;  1XK4 A;  3LCP C;  2MRD A;  4BY4 A;  2DOQ A;  5KSZ A;  2EC6 C;  2BBN A;  1B8R A;  2NCP A;  4XJK A;  4AOM A;  2MAZ A;  3CLN A;  1OE9 B;  4JPZ B;  2FOT A;  5D69 A;  3SG6 A;  3VGO A;  3A8R A;  1DF0 A;  1NWD A;  5TNC A;  2ZNE A;  2PAL A;  1S3P A;  1KFX L;  3M0W A;  2CNP A;  4C0J A;  4BY5 A;  3K21 A;  2KI4 C;  3EVR A;  2KAV A;  1FF1 A;  3AKB A;  2H2K A;  4JWQ A;  2LNK A;  2MLF C;  1VRK A;  4QJ5 B;  3DVM A;  3PFV A;  1QIW A;  4MEW A;  3WNX B;  1CFC A;  1XK4 C;  1KFX S;  1DGV A;  1TN4 A;  1F55 A;  2ISD A;  2JTZ A;  1FBV A;  2PMY A;  1MXE A;  1HQV A;  2MBX A;  1WRK A;  2KQ6 A;  3DVJ A;  3O6B A;  1L2O C;  1UP5 A;  1SCV A;  1BR4 B;  3ZWH A;  1WDC B;  2KYF A;  4A4B A;  1W7I B;  1DMO A;  3QRX A;  1EG4 A;  1KFU S;  1SYM A;  4PHM A;  1SR6 B;  1AHR A;  1BLQ A;  1K8U A;  3TDZ A;  1IKU A;  2KQY A;  3GOF A;  3SG4 A;  1SL9 A;  2M7N A;  3SJS A;  4ZCV A;  5AFP A;  2LVI A;  1KK8 B;  5ER4 X;  4ZCU A;  1SNL A;  1TRF A;  1UHI A;  2WND A;  2O5G A;  4HSZ A;  3I5H C;  3JTD C;  1S6J A;  3KPX A;  1OSA A;  3KF9 A;  1B7T Z;  2Y5I A;  2EC6 B;  4GUK A;  1JF0 A;  1QLK A;  1D1O A;  1PUL A;  1CLL A;  1ZUZ A;  1CB1 A;  2CBL A;  2OPO A;  1RWY A;  2PVB A;  1YVL A;  2Q91 A;  1IGV A;  4F0Z B;  2KI4 B;  2WCB A;  4DRW A;  2WOS A;  1G8I A;  1ALW A;  2LLS A;  1UHH A;  2ZKM X;  2WOR A;  3HCM A;  1XFW O;  3GK4 X;  3VRO A;  1S36 A;  1J7R A;  1QIV A;  2K7D A;  1BOD A;  2KDH A;  4M2Q A;  1QAS A;  3BUW B;  1YUT A;  4DCK A;  1ALV A;  5HKW A;  4R1E A;  3FS7 A;  2F2P A;  4P5O E;  5F6T A;  2KGB C;  1B4C A;  2LMV A;  4AQJ A;  1JC2 A;  2OS8 B;  4U8D A;  1B9A A;  2F3Y A;  1TTX A;  3FWB A;  4MZJ A;  4HRH A;  2Y4Q A;  1QAT A;  1UHN A;  2JZI A;  4JQ0 D;  1YUS A;  2E6W A;  4DUQ A;  2K2A A;  2MLE C;  1M39 A;  2MJW B;  4UPG A;  1Y0V H;  4QJ4 B;  2LVV A;  3CWG A;  1IWQ A;  1FW4 A;  2M1U A;  3NSI A;  5HYD A;  4DS7 A;  4CPV A;  3I5H B;  1DJY A;  4GFT A;  5HKY A;  1CFD A;  2AAO A;  1BU3 A;  1H8B A;  2KI6 C;  4NDC A;  4MZK A;  2JTT A;  5PAL A;  3IQO A;  2K0J A;  3PSR A;  3CR5 X;  1YX8 A;  2P6B B;  3BUN B;  1V1G A;  1OMV A;  1CDM A;  1GJY A;  2CT9 A;  1OOJ A;  3BUX B;  2JT3 A;  2V53 A;  3LL8 B;  1CLB A;  2JT8 A;  1CTR A;  2BEC A;  4MLW A;  1WDC C;  3PLF B;  2JNX A;  5CSF A;  1QVI Y;  4GAO A;  4N1F A;  5AEQ A;  1SR6 C;  1RK9 A;  3NSO A;  1SRA A;  1F70 A;  2FCD A;  5DKN A;  1X02 A;  1ZFS A;  1ZMZ A;  4YGC B;  2K2F A;  2ZN8 A;  1LA0 A;  4NQG A;  1NX2 A;  1ZAC A;  1IJ6 A;  4YBH B;  1FI6 A;  5I2L A;  1NIW A;  1PAL A;  4PHN A;  1NPQ A;  1SL7 A;  2K7B A;  4PE7 A;  1SL8 A;  4MVF A;  1M46 A;  1S26 D;  1H4B A;  2KYC A;  4I5N B;  4ORA B;  3SG7 A;  1JBA A;  2LV7 A;  2CXJ A;  1TNW A;  2BL0 B;  1Y1X A;  4OVN F;  4ICB A;  5FYX A;  1XO5 A;  1Y6W A;  3OB2 B;  5KTY A;  1U5I A;  1JFK A;  1PSB A;  1DJZ A;  2SAS A;  2FCE A;  5AER A;  4CFR A;  1J7P A;  2AMI A;  3O4Y A;  2F2O A;  1OMR A;  5G08 A;  1DJX A;  3IF7 A;  3LK1 A;  4N5X A;  3EK4 A;  2MHH A;  1F4Q A;  1CFP A;  2JT0 A;  1KFU L;  2EHB A;  3KEV A;  2I7A A;  2GGZ A;  2F3Z A;  3BOW B;  1LIN A;  1UWO A;  1N0Y A;  5K89 A;  4PAL A;  5JOL A;  1BOC A;  1CDP A;  3D0Y B;  1TCF A;  4OKH A;  5BPJ A;  5HLO A;  2KHN A;  4CLN A;  2OS8 C;  1M31 A;  3CTN A;  2LAP A;  1G4Y R;  5HKZ A;  1JFJ A;  1BMO A; 
#chains in the Genus database with same CATH topology
 3CZ0 A;  1OZO A;  2WC5 A;  4OCI A;  1MR8 A;  2LCP A;  2JUL A;  2ZRT A;  1J1D A;  2ERB A;  2BKI B;  1QS7 A;  2M3W A;  3Q8I A;  2LE9 B;  4TNC A;  3ZNI A;  3TZ1 A;  2JC2 A;  4USL A;  3SS4 A;  1QVI Z;  5I2Q A;  2PRU A;  1XA5 A;  2PSR A;  1DEL A;  5AAN A;  1PVA A;  1NP8 A;  4OR9 B;  2I2R E;  3SG5 A;  1PSR A;  1GQM A;  3I5I B;  2JXL A;  1F8H A;  1BJF A;  4PHK A;  4YRU A;  1IJ5 A;  1LVC D;  1E8A A;  2L50 A;  3VRN A;  1JSA A;  1CFF A;  2JOJ A;  3KHE A;  2WCL A;  3I5F C;  1GGZ A;  1UUS A;  2NZ0 A;  1GGW A;  3B6X A;  4NDD A;  1XVJ A;  4OV2 A;  3DVK A;  1QX5 B;  1S1E A;  2BCA A;  2CCM A;  3FWC A;  1YUR A;  2QEO A;  3TS5 B;  4CID A;  1K94 A;  1OMD A;  2E30 A;  1C7W A;  2L4I A;  1LS8 A;  2NXQ A;  3H4S E;  3R72 A;  1A03 A;  1SCM C;  3DYE A;  3WHU B;  2B1U A;  1QJT A;  4MSP A;  3B7A A;  1SW8 A;  3ICB A;  3S0E A;  4DIR A;  5B8I B;  2LP2 A;  3WXA A;  1IH0 A;  5JJG A;  1T14 A;  2KFG A;  1RTP 1;  1UUR A;  2QEB A;  1DJH A;  2KGR A;  2MA2 A;  1UHJ A;  1IQ5 A;  5CSI A;  1OQP A;  2GGM A;  2LMT A;  1TNP A;  1U5I B;  1TNQ A;  3BUM B;  3OX5 A;  1XFY O;  1NSH A;  2L2E A;  3BOW A;  2Y1M A;  1DVI A;  1EXR A;  1KSO A;  1N2D A;  1YRU B;  2BL0 C;  3IQQ A;  3DVE A;  5KU1 A;  3MSE B;  2LLU A;  2BCX A;  3D0Y A;  3I5G B;  2A4J A;  1NX3 A;  4N1G A;  3OGN A;  1CLM A;  1SPY A;  1TWO A;  1ZOT B;  1LKJ A;  2LVK A;  3EVV A;  1JF2 A;  1K9U A;  1NX0 A;  4I5L B;  2LHL A;  1XFZ O;  2H61 A;  2Q4U A;  1CKK A;  4A4C A;  2K7O A;  1UHK A;  1JUO A;  1KWO C;  1K96 A;  2HF5 A;  2K7C A;  1RFJ A;  2G9B A;  4CFQ A;  2KFH A;  3I5F B;  2IS9 A;  2F33 A;  3PN7 C;  3FIA A;  2JXC A;  1TIZ A;  3AAK A;  4PE0 A;  3EG5 B;  2ZND A;  1B1G A;  2KNE A;  1SK6 D;  5I94 A;  1QX7 A;  1IRJ A;  1B8L A;  1DQE A;  2QEV A;  2YGU A;  2VRG A;  1W9Z A;  2L98 A;  3PAT A;  1SCM B;  3EK8 A;  4MBE A;  1Q80 A;  1K2H A;  2K61 A;  1XFU O;  3FE8 A;  3NXA A;  2H61 C;  5CPV A;  3TUY B;  1TCO B;  3EK7 A;  4AQI A;  3BQ3 A;  2PAS A;  2JQ6 A;  1DJI A;  2L5Y A;  3B86 A;  2JRF A;  1B47 A;  3CR4 X;  2BAP A;  4I5J A;  4PCW A;  4P2Y B;  5DKR A;  4YGA A;  4MZL A;  3O2P A;  1F4O A;  1REC A;  3JVT C;  1N65 A;  5FI2 A;  1QXP A;  1RJV A;  5D7F A;  3I5I C;  3HX4 A;  2L5X B;  1EG3 A;  2FJU B;  2KFF A;  1IQ3 A;  1WLM A;  2LVJ A;  2BBM A;  1AJ4 A;  2EGD A;  3L4A A;  5AXI A;  3AAJ A;  1QLS A;  1V1F A;  1C7V A;  1CMG A;  5GQQ C;  3LK0 A;  2LM5 A;  1RRO A;  3BUO B;  3TS5 C;  3E3R A;  4PT1 A;  2L4H A;  5FI7 A;  3WHT B;  3DF0 B;  4YI8 A;  1KWO B;  3CR2 A;  3D78 A;  3DZT A;  1JWD A;  3BFB A;  3S0G A;  2M29 A;  2JNF A;  1KSM A;  1LXF C;  2NLN A;  1SMG A;  1BT6 A;  3OHM B;  3PN7 B;  3EKH A;  4C0K A;  2M7L A;  3BFH A;  3SG2 A;  3S0A A;  1KQM B;  1K90 D;  4HRE E;  2M1K B;  2ZRS A;  4C0L A;  1DJW A;  1QV0 A;  1DT7 B;  1C07 A;  2M8U A;  2HPS A;  1MF8 B;  4IJ7 A;  2ZFD A;  4GGN A;  2KBM A;  1PK0 D;  2OTG C;  1J7Q A;  1OOF A;  3C1V A;  1QWV A;  2WC8 A;  2K8M B;  3I5G C;  1HT9 A;  1YTZ C;  1AUI B;  1A4P A;  3GK1 A;  2M0R A;  4GNK B;  5DKQ A;  1NX1 A;  3JVT B;  1QTX A;  1R2U A;  1K9P A;  4D1E A;  3EVU A;  1Y1U A;  2O60 A;  2JWW A;  3SIA A;  2LUC A;  3NSL A;  4L9M A;  3CS1 A;  1CDN A;  1KK7 Z;  2BE4 A;  1AP4 A;  1NYA A;  2WCF A;  4Q04 A;  1S5G Y;  4PDZ A;  2F8P A;  3RM1 A;  1QV1 A;  1XFV O;  2LAN A;  1MWN A;  2PQL A;  2M97 A;  2I18 A;  3PM8 A;  4YGE B;  1OZS A;  3KO0 A;  1AJ5 A;  2WCE A;  4YGB B;  2KSP A;  2BCB A;  3O4X A;  2KAY A;  2BE6 A;  4E68 A;  4YI9 A;  1K9K A;  3B88 A;  1YUU A;  1J7O A;  3TUY C;  4F7F A;  2HQ8 A;  1CMF A;  1TNX A;  2L51 A;  1F71 A;  2R2I A;  4ORC B;  1DTL A;  2KI6 D;  1CDL A;  1YRT B;  2L2C A;  2Y1N A;  3DF0 A;  4WRI A;  3S0F A;  4IL1 A;  2HQW A;  1IIO A;  1WRZ A;  1W7J B;  3D75 A;  2M49 B;  1K95 A;  2LMU A;  1OOG A;  3RZS A;  1F54 A;  3GK2 A;  4PHJ A;  2JPT A;  2BKH B;  4OZD A;  1FI5 A;  2WCM A;  2OTG B;  4ETO A;  4FTG A;  3BYA A;  3NHI A;  1QX2 A;  3VRR A;  3S0D A;  1A2X A;  5CSJ A;  3VB1 A;  3UNW A;  2G2B A;  1A75 B;  3PAL A;  4GPL B;  4ORB B;  1R6P A;  3OB1 B;  2HET A;  2LUX A;  1BF5 A;  4WQ2 A;  2COL B;  3BXK A;  3D10 A;  4XJK B;  5HLV A;  3OBV A;  1NUB A;  4GGF A;  1BG1 A;  1SKT A;  3SG3 A;  2AUC A;  1L2O B;  1DF0 B;  2P71 A;  4MN0 A;  2D8N A;  1CM1 A;  1PRW A;  1S6I A;  2KBI A;  2LLT A;  2P70 A;  1EJ3 A;  3PJI A;  3R1V A;  3SIB A;  3DD4 A;  1NCX A;  1WRL A;  3PM2 A;  2KOT A;  3VRQ A;  2CTN A;  2JU0 A;  2LP3 A;  3CZT X;  1WLZ A;  2ZN9 A;  5D3O A;  1PVB A;  1M45 A;  2LC5 A;  1Y1A A;  1AK8 A;  2RGI A;  3NHT A;  1KQM C;  1A29 A;  2L0P A;  4XYN A;  2GV5 A;  5I8N A;  2I94 A;  1L7Z A;  2LHI A;  1NCY A;  1XFR A;  4FQO A;  1EL4 A;  3BJH A;  1TOP A;  1J1E A;  1ODB A;  1YVH A;  1J55 A;  3L47 A;  4M2O A;  1YR5 A;  3OX6 A;  2QPT A;  1MQ1 A;  3A4U B;  3JTD B;  4GGF C;  1S5G Z;  1EH2 A;  1CNP A;  1WY9 A;  4NDB A;  1G33 A;  4I5K A;  4M2P A;  4PE1 A;  1KK7 Y;  1KCY A;  3K1E A;  1TUZ A;  3CYZ A;  3EKJ A;  4GBA A;  1IG5 A;  5IBW A;  3NSK A;  3OP0 A;  2QAC A;  3O78 A;  3LLE A;  1MUX A;  4MRY A;  1S6C A;  3R1P A;  4PE4 A;  3FE6 A;  4WQ3 A;  3B87 A;  3VRP A;  2M9G A;  2NCO A;  5ER5 A;  1NCZ A;  5J3X A;  1MHO A;  3CGA A;  1SY9 A;  1XFX O;  3TDI A;  1KQV A;  2QDI A;  1M63 B;  1B7T Y;  1AVS A;  3AKA A;  3F45 A;  4MRX A;  3TDU A;  1B8C A;  4HRG A;  1GM0 A;  1BR1 B;  1YX7 A;  5I2O A;  1FPW A;  1LA3 A;  1K93 D;  2KAX A;  3RLZ A;  1XYD A;  1OW4 A;  4JKT A;  2TN4 A;  1CM4 A;  1DGU A;  1DJG A;  1KK8 C;  2SCP A;  4QJ3 B;  4YGD B;  5CSN A;  1MXL C;  1A75 A;  2WCH A;  1SBJ A;  1XK4 A;  3LCP C;  1Z2C B;  2MRD A;  4BY4 A;  2DOQ A;  3S0B A;  5KSZ A;  2EC6 C;  2BBN A;  1B8R A;  2NCP A;  3FE9 A;  4KYN A;  2MAZ A;  4XJK A;  3CLN A;  1OE9 B;  4JPZ B;  2FOT A;  5D69 A;  3SG6 A;  3VGO A;  3CDN A;  3A8R A;  1DF0 A;  1NWD A;  5TNC A;  2ZNE A;  2PAL A;  1S3P A;  1KFX L;  3M0W A;  2CNP A;  1Z4H A;  4C0J A;  1P28 A;  4BY5 A;  3K21 A;  2KI4 C;  3EVR A;  2KAV A;  1FF1 A;  3AKB A;  4JD9 A;  2H2K A;  4JWQ A;  2LNK A;  5HL1 A;  2MLF C;  1VRK A;  4QJ5 B;  1OOI X;  3DVM A;  1QIW A;  3PFV A;  4MEW A;  3WNX B;  1CFC A;  1XK4 C;  1KFX S;  1DGV A;  1TN4 A;  3IVT A;  1F55 A;  2ISD A;  2JTZ A;  1FBV A;  2PMY A;  2KLD A;  3DXL A;  1MXE A;  1HQV A;  2MBX A;  1WRK A;  2KQ6 A;  3DVJ A;  3O6B A;  1L2O C;  1UP5 A;  1SCV A;  1BR4 B;  3ZWH A;  1WDC B;  2KYF A;  4A4B A;  1W7I B;  1DMO A;  3QRX A;  1EG4 A;  1KFU S;  1SYM A;  4PHM A;  1SR6 B;  5DIC A;  1AHR A;  1BLQ A;  1K8U A;  3SS3 A;  3TDZ A;  2KQY A;  1TUJ A;  2JPO A;  3GOF A;  3SG4 A;  1IKU A;  1SL9 A;  2FJY A;  5EL2 A;  2M7N A;  3BFA A;  3SJS A;  1OOH A;  4ZCV A;  3N7H A;  5AFP A;  2KLE A;  2LVI A;  1KK8 B;  5ER4 X;  4ZCU A;  1SNL A;  1TRF A;  1UHI A;  2WND A;  2O5G A;  4HSZ A;  3I5H C;  3JTD C;  1S6J A;  3KPX A;  1OSA A;  3KF9 A;  1B7T Z;  2Y5I A;  5FI6 A;  2EC6 B;  4GUK A;  1JF0 A;  1QLK A;  1D1O A;  1PUL A;  1CLL A;  1ZUZ A;  3QME A;  1CB1 A;  2CBL A;  2OPO A;  1RWY A;  2PVB A;  1YVL A;  2Q91 A;  3UO9 A;  1IGV A;  3L4L A;  4F0Z B;  2KI4 B;  3D74 A;  3DY9 A;  2WCB A;  4DRW A;  2WOS A;  1G8I A;  1ALW A;  2LLS A;  1UHH A;  2ZKM X;  2WOR A;  2GTE A;  1XFW O;  3GK4 X;  3HCM A;  3NGV A;  3VRO A;  1S36 A;  1J7R A;  1QIV A;  2K7D A;  1BOD A;  2KDH A;  4M2Q A;  1QAS A;  3BUW B;  1YUT A;  4DCK A;  1ALV A;  5HKW A;  4R1E A;  3FS7 A;  2F2P A;  4P5O E;  5F6T A;  2KGB C;  3V2L A;  2H8V A;  1B4C A;  2LMV A;  1C3Z A;  4AQJ A;  1JC2 A;  2OS8 B;  4U8D A;  1B9A A;  2F3Y A;  1TTX A;  3FWB A;  4MZJ A;  4HRH A;  2Y4Q A;  1QAT A;  1UHN A;  2JZI A;  4FQT A;  4JQ0 D;  1YUS A;  2E6W A;  4DUQ A;  2K2A A;  2MLE C;  1M39 A;  3R1O A;  1ORG A;  2MJW B;  2BNX A;  4UPG A;  1Y0V H;  4QJ4 B;  2LVV A;  3CWG A;  1IWQ A;  1FW4 A;  2M1U A;  3NSI A;  5HYD A;  4DS7 A;  4CPV A;  3I5H B;  3CZ1 A;  1DJY A;  4GFT A;  5HKY A;  1CFD A;  2AAO A;  1BU3 A;  1H8B A;  2KI6 C;  4NDC A;  4MZK A;  2JTT A;  5PAL A;  3IQO A;  2K0J A;  3PSR A;  1DEK A;  3CR5 X;  1YX8 A;  2P6B B;  3BUN B;  1V1G A;  1OMV A;  2PYQ A;  1CDM A;  1GJY A;  2CT9 A;  1OOJ A;  3BUX B;  2JT3 A;  2V53 A;  3LL8 B;  1CLB A;  2JT8 A;  1DC1 A;  1CTR A;  2BEC A;  4MLW A;  1WDC C;  3PLF B;  2JNX A;  5CSF A;  1QVI Y;  4GAO A;  4N1F A;  5AEQ A;  3D76 A;  1SR6 C;  1RK9 A;  3NSO A;  1SRA A;  1SSE B;  1C3Y A;  1F70 A;  2FCD A;  3CZ2 A;  5DKN A;  1X02 A;  1ZFS A;  1ZMZ A;  3D73 A;  4YGC B;  2K2F A;  2ZN8 A;  1LA0 A;  4NQG A;  1NX2 A;  1ZAC A;  1IJ6 A;  4YBH B;  1FI6 A;  5I2L A;  1NIW A;  1PAL A;  4PHN A;  1NPQ A;  1SL7 A;  2K7B A;  4PE7 A;  1SL8 A;  4MVF A;  1M46 A;  1S26 D;  1H4B A;  2KYC A;  4I5N B;  4ORA B;  3SG7 A;  1JBA A;  2LV7 A;  2CXJ A;  1TNW A;  2BL0 B;  1Y1X A;  4OVN F;  4ICB A;  5FYX A;  1XO5 A;  2KPH A;  1Y6W A;  2K60 A;  3SS5 A;  2QEH A;  3OB2 B;  5KTY A;  2WCJ A;  1U5I A;  2WC6 A;  1JFK A;  1PSB A;  1DJZ A;  2SAS A;  2FCE A;  5AER A;  4CFR A;  1J7P A;  2AMI A;  3O4Y A;  2F2O A;  4INW A;  1OMR A;  5G08 A;  1DJX A;  4INX A;  3IF7 A;  3LK1 A;  4N5X A;  3EK4 A;  2MHH A;  1F4Q A;  1CFP A;  4AOM A;  2JT0 A;  3CAB A;  1KFU L;  2EHB A;  3KEV A;  2I7A A;  2WCK A;  2GGZ A;  2F3Z A;  3BOW B;  1LIN A;  1UWO A;  1N0Y A;  5K89 A;  4PAL A;  5JOL A;  1BOC A;  1CDP A;  3D0Y B;  1TCF A;  4OKH A;  5BPJ A;  3D77 A;  5HLO A;  2KHN A;  4CLN A;  2OS8 C;  1M31 A;  3CTN A;  2LAP A;  1G4Y R;  5HKZ A;  1JFJ A;  1BMO A; 
#chains in the Genus database with same CATH homology
 1OZO A;  4OCI A;  1MR8 A;  2LCP A;  2JUL A;  2ZRT A;  1J1D A;  2M3W A;  2BKI B;  1QS7 A;  2LE9 B;  4TNC A;  3ZNI A;  3TZ1 A;  2JC2 A;  4USL A;  5I2Q A;  1QVI Z;  2PRU A;  1XA5 A;  2PSR A;  5AAN A;  1PVA A;  1NP8 A;  4OR9 B;  2I2R E;  3SG5 A;  1PSR A;  1GQM A;  3I5I B;  2JXL A;  1F8H A;  1BJF A;  4PHK A;  4YRU A;  1IJ5 A;  1LVC D;  1E8A A;  2L50 A;  3VRN A;  1JSA A;  1CFF A;  2JOJ A;  3KHE A;  3I5F C;  1GGZ A;  1UUS A;  2NZ0 A;  1GGW A;  4NDD A;  1XVJ A;  4OV2 A;  3DVK A;  1QX5 B;  1S1E A;  2BCA A;  2CCM A;  3FWC A;  1YUR A;  3TS5 B;  4CID A;  1K94 A;  1OMD A;  2E30 A;  1C7W A;  2L4I A;  2NXQ A;  3H4S E;  1A03 A;  1SCM C;  3WHU B;  2B1U A;  1QJT A;  4MSP A;  1SW8 A;  3ICB A;  4DIR A;  5B8I B;  2LP2 A;  3WXA A;  1IH0 A;  5JJG A;  2KFG A;  1RTP 1;  1UUR A;  1DJH A;  2KGR A;  2MA2 A;  1UHJ A;  1IQ5 A;  5CSI A;  1OQP A;  2GGM A;  2LMT A;  1TNP A;  1U5I B;  1TNQ A;  3BUM B;  3OX5 A;  1XFY O;  1NSH A;  2L2E A;  3BOW A;  2Y1M A;  1DVI A;  1EXR A;  1KSO A;  1N2D A;  1YRU B;  2BL0 C;  3IQQ A;  3DVE A;  5KU1 A;  3MSE B;  2LLU A;  2BCX A;  3D0Y A;  3I5G B;  2A4J A;  1NX3 A;  4N1G A;  1CLM A;  1SPY A;  1ZOT B;  1LKJ A;  2LVK A;  3EVV A;  1JF2 A;  1K9U A;  1NX0 A;  4I5L B;  2LHL A;  1XFZ O;  2H61 A;  2Q4U A;  1CKK A;  4A4C A;  2K7O A;  1UHK A;  1JUO A;  1KWO C;  1K96 A;  2HF5 A;  2K7C A;  1RFJ A;  2G9B A;  4CFQ A;  2KFH A;  3I5F B;  2IS9 A;  2F33 A;  3PN7 C;  3FIA A;  2JXC A;  1TIZ A;  3AAK A;  4PE0 A;  2ZND A;  1B1G A;  2KNE A;  1SK6 D;  1QX7 A;  1IRJ A;  1B8L A;  2VRG A;  2L98 A;  3PAT A;  1SCM B;  3EK8 A;  4MBE A;  1Q80 A;  1K2H A;  2K61 A;  1XFU O;  3NXA A;  2H61 C;  5CPV A;  3TUY B;  1TCO B;  3EK7 A;  4AQI A;  3BQ3 A;  2PAS A;  2JQ6 A;  1DJI A;  2JRF A;  1B47 A;  3CR4 X;  4I5J A;  4PCW A;  4P2Y B;  5DKR A;  4YGA A;  4MZL A;  3O2P A;  1F4O A;  1REC A;  3JVT C;  1N65 A;  1QXP A;  1RJV A;  5D7F A;  3I5I C;  3HX4 A;  2L5X B;  1EG3 A;  2FJU B;  2KFF A;  1IQ3 A;  1WLM A;  2LVJ A;  2BBM A;  1AJ4 A;  2EGD A;  5AXI A;  3AAJ A;  1QLS A;  1V1F A;  1C7V A;  1CMG A;  5GQQ C;  3LK0 A;  2LM5 A;  1RRO A;  3BUO B;  3TS5 C;  3E3R A;  2L4H A;  3WHT B;  3DF0 B;  4YI8 A;  1KWO B;  3CR2 A;  1JWD A;  2M29 A;  2JNF A;  1KSM A;  1LXF C;  2NLN A;  1SMG A;  1BT6 A;  3OHM B;  3PN7 B;  3EKH A;  4C0K A;  2M7L A;  3SG2 A;  1KQM B;  1K90 D;  4HRE E;  2M1K B;  2ZRS A;  4C0L A;  1DJW A;  1QV0 A;  1DT7 B;  1C07 A;  2M8U A;  2HPS A;  1MF8 B;  2ZFD A;  4GGN A;  2KBM A;  1PK0 D;  2OTG C;  1J7Q A;  3C1V A;  2WC8 A;  2K8M B;  3I5G C;  1HT9 A;  1YTZ C;  1AUI B;  1A4P A;  3GK1 A;  2M0R A;  4GNK B;  5DKQ A;  1NX1 A;  3JVT B;  1QTX A;  1R2U A;  1K9P A;  4D1E A;  3EVU A;  1Y1U A;  2O60 A;  2JWW A;  3SIA A;  2LUC A;  3NSL A;  4L9M A;  3CS1 A;  1CDN A;  1KK7 Z;  2BE4 A;  1AP4 A;  1NYA A;  2WCF A;  4Q04 A;  1S5G Y;  4PDZ A;  2F8P A;  3RM1 A;  1QV1 A;  1XFV O;  2LAN A;  1MWN A;  2M97 A;  2I18 A;  3PM8 A;  4YGE B;  1OZS A;  3KO0 A;  1AJ5 A;  2WCE A;  4YGB B;  2KSP A;  2BCB A;  2KAY A;  2BE6 A;  4E68 A;  4YI9 A;  1K9K A;  1YUU A;  1J7O A;  3TUY C;  2HQ8 A;  1CMF A;  1TNX A;  2L51 A;  1F71 A;  2R2I A;  4ORC B;  1DTL A;  2KI6 D;  1CDL A;  1YRT B;  2Y1N A;  3DF0 A;  4WRI A;  4IL1 A;  2HQW A;  1WRZ A;  1W7J B;  2M49 B;  1K95 A;  2LMU A;  1F54 A;  1FI5 A;  3GK2 A;  4PHJ A;  2JPT A;  2BKH B;  2OTG B;  4ETO A;  4FTG A;  3BYA A;  3VRR A;  1QX2 A;  1A2X A;  5CSJ A;  2G2B A;  1A75 B;  3PAL A;  4GPL B;  4ORB B;  1R6P A;  3OB1 B;  2HET A;  2LUX A;  1BF5 A;  4WQ2 A;  2COL B;  3BXK A;  3D10 A;  4XJK B;  5HLV A;  1NUB A;  4GGF A;  1BG1 A;  1SKT A;  3SG3 A;  2AUC A;  1L2O B;  1DF0 B;  4MN0 A;  2D8N A;  1CM1 A;  1PRW A;  1S6I A;  2KBI A;  2LLT A;  1EJ3 A;  3SIB A;  3DD4 A;  1NCX A;  1WRL A;  2KOT A;  3VRQ A;  2CTN A;  2JU0 A;  2LP3 A;  3CZT X;  1WLZ A;  2ZN9 A;  1PVB A;  1M45 A;  2LC5 A;  1Y1A A;  1AK8 A;  2RGI A;  1KQM C;  1A29 A;  2L0P A;  4XYN A;  2GV5 A;  5I8N A;  2I94 A;  1L7Z A;  2LHI A;  1NCY A;  4FQO A;  1EL4 A;  1TOP A;  1J1E A;  1ODB A;  1YVH A;  1J55 A;  4M2O A;  1YR5 A;  3OX6 A;  2QPT A;  1MQ1 A;  3A4U B;  3JTD B;  4GGF C;  1S5G Z;  1EH2 A;  1CNP A;  1WY9 A;  4NDB A;  1G33 A;  4I5K A;  4M2P A;  4PE1 A;  1KK7 Y;  1KCY A;  3EKJ A;  4GBA A;  1IG5 A;  5IBW A;  3NSK A;  3OP0 A;  2QAC A;  3O78 A;  3LLE A;  1MUX A;  4MRY A;  1S6C A;  4PE4 A;  3VRP A;  4WQ3 A;  2M9G A;  2NCO A;  5ER5 A;  1NCZ A;  5J3X A;  1MHO A;  3CGA A;  1SY9 A;  1XFX O;  3TDI A;  1KQV A;  1M63 B;  1B7T Y;  1AVS A;  3AKA A;  3F45 A;  4MRX A;  3TDU A;  1B8C A;  4HRG A;  1BR1 B;  1YX7 A;  5I2O A;  1FPW A;  1LA3 A;  1K93 D;  2KAX A;  3RLZ A;  1XYD A;  2TN4 A;  1CM4 A;  1DGU A;  1DJG A;  1KK8 C;  2SCP A;  4QJ3 B;  4YGD B;  5CSN A;  1MXL C;  1A75 A;  1SBJ A;  1XK4 A;  3LCP C;  2MRD A;  4BY4 A;  2DOQ A;  5KSZ A;  2EC6 C;  2BBN A;  1B8R A;  2NCP A;  4XJK A;  4AOM A;  2MAZ A;  3CLN A;  1OE9 B;  4JPZ B;  2FOT A;  5D69 A;  3SG6 A;  3VGO A;  3A8R A;  1DF0 A;  1NWD A;  5TNC A;  2ZNE A;  2PAL A;  1S3P A;  1KFX L;  3M0W A;  2CNP A;  4C0J A;  4BY5 A;  3K21 A;  2KI4 C;  3EVR A;  2KAV A;  1FF1 A;  3AKB A;  2H2K A;  4JWQ A;  2LNK A;  2MLF C;  1VRK A;  4QJ5 B;  3DVM A;  3PFV A;  1QIW A;  4MEW A;  3WNX B;  1CFC A;  1XK4 C;  1KFX S;  1DGV A;  1TN4 A;  1F55 A;  2ISD A;  2JTZ A;  1FBV A;  2PMY A;  1MXE A;  1HQV A;  2MBX A;  1WRK A;  2KQ6 A;  3DVJ A;  3O6B A;  1L2O C;  1UP5 A;  1SCV A;  1BR4 B;  3ZWH A;  1WDC B;  2KYF A;  4A4B A;  1W7I B;  1DMO A;  3QRX A;  1EG4 A;  1KFU S;  1SYM A;  4PHM A;  1SR6 B;  1AHR A;  1BLQ A;  1K8U A;  3TDZ A;  1IKU A;  2KQY A;  3GOF A;  3SG4 A;  1SL9 A;  2M7N A;  3SJS A;  4ZCV A;  5AFP A;  2LVI A;  1KK8 B;  5ER4 X;  4ZCU A;  1SNL A;  1TRF A;  1UHI A;  2WND A;  2O5G A;  4HSZ A;  3I5H C;  3JTD C;  1S6J A;  3KPX A;  1OSA A;  3KF9 A;  1B7T Z;  2Y5I A;  2EC6 B;  4GUK A;  1JF0 A;  1QLK A;  1D1O A;  1PUL A;  1CLL A;  1ZUZ A;  1CB1 A;  2CBL A;  2OPO A;  1RWY A;  2PVB A;  1YVL A;  2Q91 A;  1IGV A;  4F0Z B;  2KI4 B;  2WCB A;  4DRW A;  2WOS A;  1G8I A;  1ALW A;  2LLS A;  1UHH A;  2ZKM X;  2WOR A;  3HCM A;  1XFW O;  3GK4 X;  3VRO A;  1S36 A;  1J7R A;  1QIV A;  2K7D A;  1BOD A;  2KDH A;  4M2Q A;  1QAS A;  3BUW B;  1YUT A;  4DCK A;  1ALV A;  5HKW A;  4R1E A;  3FS7 A;  2F2P A;  4P5O E;  5F6T A;  2KGB C;  1B4C A;  2LMV A;  4AQJ A;  1JC2 A;  2OS8 B;  4U8D A;  1B9A A;  2F3Y A;  1TTX A;  3FWB A;  4MZJ A;  4HRH A;  2Y4Q A;  1QAT A;  1UHN A;  2JZI A;  4JQ0 D;  1YUS A;  2E6W A;  4DUQ A;  2K2A A;  2MLE C;  1M39 A;  2MJW B;  4UPG A;  1Y0V H;  4QJ4 B;  2LVV A;  3CWG A;  1IWQ A;  1FW4 A;  2M1U A;  3NSI A;  5HYD A;  4DS7 A;  4CPV A;  3I5H B;  1DJY A;  4GFT A;  5HKY A;  1CFD A;  2AAO A;  1BU3 A;  1H8B A;  2KI6 C;  4NDC A;  4MZK A;  2JTT A;  5PAL A;  3IQO A;  2K0J A;  3PSR A;  3CR5 X;  1YX8 A;  2P6B B;  3BUN B;  1V1G A;  1OMV A;  1CDM A;  1GJY A;  2CT9 A;  1OOJ A;  3BUX B;  2JT3 A;  2V53 A;  3LL8 B;  1CLB A;  2JT8 A;  1CTR A;  2BEC A;  4MLW A;  1WDC C;  3PLF B;  2JNX A;  5CSF A;  1QVI Y;  4GAO A;  4N1F A;  5AEQ A;  1SR6 C;  1RK9 A;  3NSO A;  1SRA A;  1F70 A;  2FCD A;  5DKN A;  1X02 A;  1ZFS A;  1ZMZ A;  4YGC B;  2K2F A;  2ZN8 A;  1LA0 A;  4NQG A;  1NX2 A;  1ZAC A;  1IJ6 A;  4YBH B;  1FI6 A;  5I2L A;  1NIW A;  1PAL A;  4PHN A;  1NPQ A;  1SL7 A;  2K7B A;  4PE7 A;  1SL8 A;  4MVF A;  1M46 A;  1S26 D;  1H4B A;  2KYC A;  4I5N B;  4ORA B;  3SG7 A;  1JBA A;  2LV7 A;  2CXJ A;  1TNW A;  2BL0 B;  1Y1X A;  4OVN F;  4ICB A;  5FYX A;  1XO5 A;  1Y6W A;  3OB2 B;  5KTY A;  1U5I A;  1JFK A;  1PSB A;  1DJZ A;  2SAS A;  2FCE A;  5AER A;  4CFR A;  1J7P A;  2AMI A;  3O4Y A;  2F2O A;  1OMR A;  5G08 A;  1DJX A;  3IF7 A;  3LK1 A;  4N5X A;  3EK4 A;  2MHH A;  1F4Q A;  1CFP A;  2JT0 A;  1KFU L;  2EHB A;  3KEV A;  2I7A A;  2GGZ A;  2F3Z A;  3BOW B;  1LIN A;  1UWO A;  1N0Y A;  5K89 A;  4PAL A;  5JOL A;  1BOC A;  1CDP A;  3D0Y B;  1TCF A;  4OKH A;  5BPJ A;  5HLO A;  2KHN A;  4CLN A;  2OS8 C;  1M31 A;  3CTN A;  2LAP A;  1G4Y R;  5HKZ A;  1JFJ A;  1BMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...