2P6BB

Crystal structure of human calcineurin in complex with pvivit peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
146
structure length
146
Chain Sequence
DADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PVIVIT 14-mer Peptide
publication title Structure of calcineurin in complex with PVIVIT peptide: Portrait of a low-affinity signalling interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 54
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2p6bB00
1QASA 1SK6D 3A8RA 2BBMA 1K95A 2KAXA 3TS5C 3WNXB 2CNPA 1NUBA 3EVRA 4NQGA 1XO5A 3O2PA 2ZRTA 1OOJA 1TCOB 5JOLA 4CFQA 5K89A 1FW4A 1YUSA 3JTDB 3TDZA 1TNXA 4YGDB 3EKHA 1V1FA 2F3ZA 1RK9A 2MLFC 1JFKA 1OZSA 1RWYA 1MUXA 3I5HC 1JBAA 1NX1A 1SR6B 2LLSA 2SCPA 1HT9A 4MSPA 4CPVA 2K7DA 4CLNA 3TUYC 1CFFA 3SJSA 1W7IB 4QJ5B 3OB1B 2BKIB 3VRNA 2JNFA 2I2RE 5FYXA 1K96A 2F3YA 3PALA 1XVJA 2Q91A 1YUUA 2HQ8A 2GGMA 1L7ZA 1EG4A 1WRLA 3VRQA 2WCBA 2Y1MA 3KHEA 4GPLB 2ZNEA 3ZWHA 2CBLA 2PALA 2LHLA 3FWCA 3VROA 4GGFC 5PALA 2F8PA 4MVFA 2I18A 5HKZA 2MHHA 3O78A 2JT3A 3NSOA 3LCPC 4M2OA 2A4JA 2L0PA 1AHRA 2NXQA 2M8UA 3ICBA 1CMGA 1DJZA 1SPYA 2G9BA 2K2FA 2KI6C 3AAKA 4YGBB 1BODA 3LK0A 1DMOA 5F6TA 1OMRA 2LE9B 3LL8B 1B8LA 4DIRA 1DF0A 4AQIA 1XYDA 1UP5A 2KGRA 2LVIA 3IF7A 1EG3A 4YGAA 2KBMA 1M46A 4YGCB 3SG4A 2WCEA 5D69A 4A4CA 3VRRA 1JC2A 1KK7Z 1KWOB 1WRKA 1KQVA 1OZOA 1CDLA 1AUIB 2L50A 1MF8B 1SKTA 1S1EA 4DS7A 1M31A 3H4SE 2KI4C 3I5FC 1QX7A 1NCYA 2WNDA 2BKHB 2LAPA 2NLNA 4D1EA 1K90D 1ALWA 3EKJA 1B47A 1SL9A 1X02A 2NCOA 1ZACA 2K2AA 3NSLA 3WXAA 2IS9A 1QVIY 4PHMA 3O6BA 3FIAA 1L2OB 1KK8C 1SCMC 4QJ4B 5HYDA 1SL8A 1R6PA 2QACA 1JF2A 1RROA 2HETA 4NDBA 1SW8A 2BCXA 2KHNA 4I5JA 2LNKA 4A4BA 3FWBA 3BXKA 4HSZA 3BYAA 1JSAA 5HLVA 2ZN9A 2KYCA 2WC8A 4DUQA 5J3XA 1XFZO 1TRFA 5DKNA 1EL4A 3D10A 2OTGC 2M7NA 2O60A 1SMGA 2K7OA 2F2PA 3C1VA 3I5GB 4OVNF 4PDZA 2KBIA 4MN0A 1JFJA 2HF5A 4NDCA 2K61A 2LP3A 1XFXO 2JTZA 5AEQA 1S26D 2L4IA 1J7RA 1ZUZA 1UHHA 3I5IC 1U5IA 2L5XB 1RECA 2FCDA 1S6JA 1XFUO 3VGOA 2L51A 2I7AA 1WDCB 1CFDA 2H2KA 2KAVA 1NPQA 2JQ6A 5AFPA 4TNCA 1IWQA 1FI6A 1QV0A 1BG1A 1F54A 1DGUA 1MR8A 1SNLA 4MZJA 3CWGA 1KSOA 2CT9A 4MZKA 2BCBA 4ZCUA 5B8IB 1YRTB 4AOMA 1CM4A 1FBVA 1OSAA 1WLMA 2KGBC 4PCWA 1HQVA 1J7PA 3GK1A 4L9MA 4FTGA 1GJYA 1BLQA 1ODBA 1TTXA 2EHBA 5KSZA 4E68A 4OV2A 1B7TZ 1CLLA 1KFUS 1U5IB 1V1GA 2EGDA 4WRIA 2JXLA 1Y6WA 2E6WA 2WOSA 1DGVA 5AANA 1YR5A 3EVVA 2MBXA 2B1UA 4OR9B 2Y1NA 1SR6C 1TNWA 2JPTA 1ZOTB 1XFWO 1AJ5A 2BBNA 5ER4X 1UUSA 2PVBA 3OX6A 2KDHA 5ER5A 4GFTA 2WORA 2HQWA 1K9KA 3OHMB 5CSJA 1FF1A 2LP2A 2VRGA 1EH2A 1K8UA 2LC5A 1UHKA 4DRWA 2ZN8A 3BQ3A 3GOFA 1DJHA 2EC6C 1JWDA 1NX3A 1F55A 3FS7A 5TNCA 1J1EA 1PSBA 2LCPA 2LMVA 2JTTA 1DTLA 1B8CA 5KU1A 2LLTA 4P2YB 2G2BA 4PE1A 3RM1A 4N5XA 4MLWA 3SIBA 1EJ3A 1NCXA 2M9GA 5I8NA 1NX0A 1DJYA 1PVAA 1DJWA 2PASA 1JUOA 3NXAA 1S6IA 3TUYB 1Y1AA 4PE0A 2M29A 2BECA 2ZFDA 1J7OA 3EK8A 2JULA 1MWNA 4YGEB 2NZ0A 2LMTA 4U8DA 2M97A 1UHNA 1B9AA 2ISDA 4CFRA 1AJ4A 2ZRSA 1J7QA 1KWOC 2K7BA 2LHIA 1J55A 1A2XA 3WHUB 3PN7B 2AMIA 1IG5A 3MSEB 2D8NA 3CR2A 1BT6A 3BUWB 3KF9A 2AAOA 1MHOA 1F4OA 1CDMA 1CLBA 3SG3A 1LA3A 1S6CA 1FI5A 1L2OC 4HRHA 1SL7A 4XYNA 1MXEA 1ZFSA 2BE6A 3RLZA 3DF0A 2R2IA 1A03A 4I5NB 3DVMA 1DF0B 1OMVA 2PMYA 2JWWA 3TDUA 1QX2A 3OB2B 1GGZA 1RTP1 2WCFA 2E30A 2K7CA 4PE4A 2H61C 4ORBB 1C7WA 1M45A 3KEVA 2BCAA 1VRKA 1NIWA 2KI4B 1H4BA 3I5FB 1F8HA 3BUMB 3CGAA 1PALA 1PRWA 1F70A 3IQQA 4JWQA 2AUCA 1AK8A 3K21A 1CKKA 3PSRA 1PULA 3OX5A 1Y1XA 2KAYA 2BL0C 2L2EA 3DF0B 3JVTB 1B8RA 1K9PA 1YURA 2SASA 2LMUA 1KQMB 1XK4C 1WDCC 4PE7A 2NCPA 4AQJA 1GQMA 1KFXS 1J1DA 1IRJA 2LVJA 1K93D 1YUTA 1S5GZ 2HPSA 2MLEC 1XFYO 2CTNA 3HCMA 4M2QA 3GK2A 1YRUB 5I2LA 4JQ0D 4ORCB 4I5LB 3SG6A 5G08A 4DCKA 2CXJA 2GGZA 5I2OA 4USLA 1QLKA 4MRXA 2M7LA 5IBWA 2TN4A 2K8MB 4PHJA 1AVSA 4MZLA 4HRGA 5BPJA 1N2DA 2M1KB 2RGIA 1TOPA 2K0JA 1B7TY 1PVBA 1TIZA 1DJIA 3I5IB 1KFUL 3TZ1A 1D1OA 1A29A 3JTDC 3TDIA 2KNEA 1M39A 1TNQA 2KYFA 5HKWA 3NSKA 3BUNB 1A4PA 1G33A 4GUKA 1BOCA 1WLZA 2FOTA 2FCEA 4YBHB 2OS8B 2ZNDA 2BE4A 3CZTX 4HREE 5HLOA 4FQOA 1QJTA 5I2QA 3BUXB 2KI6D 4GGNA 3CS1A 3DD4A 1N65A 1DJXA 3IQOA 3LK1A 2P6BB 1IJ5A 2M49B 1IGVA 1UHIA 1AP4A 3TS5B 4ORAB 1NCZA 1QLSA 3DVEA 3PM8A 4P5OE 2F33A 1BMOA 3CR5X 1YX8A 4UPGA 1DT7B 2JT0A 4GGFA 1EXRA 2JNXA 1NWDA 3SIAA 4GAOA 1IQ5A 4N1GA 1NSHA 1S3PA 4N1FA 5CPVA 1ALVA 3I5HB 2PSRA 1TNPA 2ZKMX 3DVJA 3AKAA 1CDPA 4MRYA 3EVUA 2L98A 1S36A 5AXIA 4ETOA 1CMFA 1K9UA 1GGWA 2PRUA 3AAJA 5CSIA 1B1GA 1QV1A 3ZNIA 1BR1B 1NP8A 1CLMA 1RFJA 4WQ2A 1KCYA 4GBAA 3PATA 2O5GA 4MBEA 4YI9A 1LKJA 1PSRA 3PFVA 1CFPA 2EC6B 1BF5A 1B4CA 2L4HA 1CFCA 4Q04A 1C07A 4PHKA 1H8BA 4YRUA 1CM1A 5KTYA 3KPXA 1KK7Y 3PN7C 3EK4A 5DKRA 1PK0D 3BUOB 5D7FA 4JPZB 2COLB 1QATA 3CR4X 1G4YR 1M63B 2MRDA 1SYMA 1KSMA 2JU0A 1OMDA 4IL1A 3CLNA 2I94A 3D0YA 5CSNA 1OQPA 2MA2A 2F2OA 1QX5B 3WHTB 1CB1A 4C0LA 3E3RA 2LLUA 3LLEA 4ICBA 1UURA 2CCMA 2LVKA 1YVLA 1WY9A 2JT8A 3NSIA 4PHNA 1CNPA 4BY5A 2KFFA 1YTZC 4I5KA 4OCIA 1IJ6A 3F45A 1IH0A 1QS7A 2JC2A 2JZIA 4R1EA 1A75A 1UWOA 3AKBA 1SBJA 4XJKA 1WRZA 2H61A 3CTNA 1XFVO 4NDDA 3SG7A 4M2PA 2M1UA 1BU3A 5GQQC 2GV5A 2JRFA 1LA0A 2FJUB 2MJWB 3EK7A 1LINA 3I5GC 3SG5A 2KSPA 3D0YB 2Y4QA 4OKHA 1F4QA 2MAZA 1K94A 4GNKB 2KQ6A 2KFHA 1QVIZ 5DKQA 4CIDA 1N0YA 3JVTC 1LVCD 1NYAA 1SY9A 5AERA 1KK8B 3OP0A 1QTXA 1KQMC 1SCMB 1XK4A 2OPOA 1G8IA 3VRPA 1BJFA 1TCFA 1UHJA 1ZMZA 1KFXL 1SRAA 2LVVA 1MXLC 1S5GY 1NX2A 1QIVA 3BOWA 1A75B 1QIWA 1QXPA 2KFGA 4C0KA 5HKYA 2LV7A 4XJKB 1IKUA 3GK4X 1JF0A 4C0JA 1CDNA 3M0WA 2OTGB 5JJGA 1XA5A 1DVIA 4ZCVA 1IQ3A 5CSFA 2M3WA 2QPTA 1BR4B 2JXCA 1W7JB 2DOQA 1R2UA 2LM5A 3HX4A 3O4YA 2BL0B 1Q80A 3A4UB 1CTRA 2JOJA 2KQYA 3DVKA 1YX7A 2LUXA 3KO0A 4QJ3B 4WQ3A 1K2HA 1DJGA 1OE9B 1Y0VH 1E8AA 2LUCA 4BY4A 2LANA 4F0ZB 1FPWA 3BOWB 2OS8C 1F71A 2Y5IA 2V53A 3SG2A 1LXFC 1Y1UA 2Q4UA 1C7VA 2KOTA 3QRXA 4MEWA 1MQ1A 1TN4A 1SCVA 1RJVA 2M0RA 4PALA 4YI8A 1YVHA 3PLFB
chains in the Genus database with same CATH superfamily
1QASA 2WC5A 1SK6D 3A8RA 2BBMA 1K95A 5FI6A 2KAXA 3TS5C 3NHIA 3WNXB 2CNPA 1NUBA 3EVRA 4NQGA 1XO5A 3O2PA 2ZRTA 1OOJA 1TCOB 5JOLA 4CFQA 5K89A 1FW4A 1YUSA 3JTDB 3TDZA 1DEKA 1TNXA 4YGDB 3EKHA 1V1FA 2F3ZA 1RK9A 2MLFC 1JFKA 1OZSA 1RWYA 1MUXA 3I5HC 1JBAA 1NX1A 1SR6B 2LLSA 2SCPA 1HT9A 3SS4A 4MSPA 4CPVA 2K7DA 4CLNA 3TUYC 1CFFA 3SJSA 1W7IB 4QJ5B 3OB1B 2BKIB 3VRNA 2JNFA 2I2RE 5FYXA 1K96A 2F3YA 3PALA 1XVJA 2Q91A 1YUUA 2HQ8A 2GGMA 1L7ZA 1EG4A 1P28A 1WRLA 2WCBA 3VRQA 2Y1MA 3KHEA 4GPLB 2ZNEA 3VB1A 2CBLA 3ZWHA 2PALA 2LHLA 3FWCA 2H8VA 4GGFC 3VROA 5PALA 1OOGA 2F8PA 4MVFA 2I18A 5HKZA 2MHHA 3O78A 2JT3A 3NSOA 3LCPC 3DY9A 4M2OA 3R1OA 2A4JA 2P70A 2L0PA 2QEOA 1LS8A 1AHRA 2NXQA 2M8UA 3ICBA 1CMGA 3D76A 1DJZA 1SPYA 2G9BA 2K2FA 2KI6C 3AAKA 4YGBB 2WC6A 1BODA 3LK0A 1DMOA 5F6TA 1OMRA 2LE9B 3LL8B 1B8LA 4DIRA 3QMEA 1DF0A 4AQIA 3S0AA 1XYDA 1UP5A 2KGRA 2LVIA 3IF7A 1EG3A 4YGAA 2KBMA 1M46A 4YGCB 3SG4A 2WCEA 5D69A 4A4CA 3VRRA 1JC2A 1KK7Z 1KWOB 1WRKA 1KQVA 1OZOA 1CDLA 1AUIB 2L50A 1MF8B 1SKTA 1S1EA 4DS7A 1M31A 3H4SE 2KI4C 3I5FC 1QX7A 1NCYA 2WNDA 2BKHB 2LAPA 2NLNA 4D1EA 3B86A 2WCMA 1K90D 1ALWA 1T14A 2KLDA 3EKJA 1B47A 1SL9A 1X02A 2NCOA 1ZACA 2K2AA 3NSLA 3WXAA 2IS9A 1QVIY 4PHMA 3O6BA 2P71A 3FIAA 1L2OB 1KK8C 1SCMC 4QJ4B 5HYDA 3DZTA 1SL8A 1R6PA 2QACA 1JF2A 1RROA 2HETA 4NDBA 1SW8A 2BCXA 2KHNA 4I5JA 2LNKA 3BJHA 4A4BA 3FWBA 3BXKA 4HSZA 3BYAA 1JSAA 3CYZA 5HLVA 2ZN9A 2KYCA 2WC8A 4DUQA 5J3XA 1XFZO 1TRFA 5DKNA 1EL4A 3D10A 2ERBA 2OTGC 2M7NA 2O60A 3NHTA 1SMGA 2K7OA 2F2PA 3C1VA 3I5GB 3Q8IA 4OVNF 4PDZA 2KBIA 4MN0A 1JFJA 3V2LA 2HF5A 4KYNA 4NDCA 2K61A 2LP3A 1XFXO 2JTZA 2GTEA 5AEQA 1S26D 2L4IA 1J7RA 1ZUZA 1UHHA 3I5IC 1U5IA 2L5XB 3D78A 1GM0A 1RECA 2FCDA 1S6JA 1XFUO 2WCLA 2L51A 3VGOA 2I7AA 1WDCB 1CFDA 2H2KA 2KAVA 3S0GA 1NPQA 2JQ6A 5AFPA 4TNCA 1IWQA 1FI6A 1QV0A 1BG1A 1F54A 1DGUA 1XFRA 1MR8A 3N7HA 1SNLA 4MZJA 3CWGA 1KSOA 2CT9A 4MZKA 2BCBA 4ZCUA 5B8IB 1YRTB 4AOMA 3B7AA 1CM4A 1FBVA 1OSAA 1WLMA 2KGBC 4PCWA 1HQVA 1J7PA 3GK1A 4L9MA 4FTGA 1GJYA 1BLQA 1ODBA 1TTXA 2EHBA 1OOHA 3FE8A 5KSZA 4E68A 4OV2A 1B7TZ 2L5YA 3RZSA 1CLLA 3R1PA 3CZ2A 1KFUS 1U5IB 1V1GA 2EGDA 4WRIA 2JXLA 1Y6WA 2E6WA 2WOSA 1DGVA 5AANA 1YR5A 3EVVA 2MBXA 2B1UA 4OR9B 2Y1NA 1OW4A 1SR6C 1TNWA 2JPTA 1ZOTB 3B87A 1XFWO 1AJ5A 1ORGA 2BBNA 5ER4X 1UUSA 1QWVA 2PVBA 3OX6A 2KDHA 5ER5A 4GFTA 2WORA 2HQWA 1K9KA 3OHMB 5CSJA 1FF1A 3PM2A 2LP2A 2VRGA 1EH2A 1K8UA 2LC5A 1UHKA 4DRWA 2ZN8A 3BQ3A 3GOFA 1DJHA 2EC6C 1JWDA 1NX3A 1F55A 3UO9A 3FS7A 5TNCA 1J1EA 1PSBA 2LCPA 2LMVA 2JTTA 3CABA 1DTLA 3D74A 1B8CA 5KU1A 2LLTA 4P2YB 2G2BA 4PE1A 3RM1A 4F7FA 2WCKA 4N5XA 4MLWA 3SIBA 1EJ3A 1NCXA 2M9GA 3S0FA 5I8NA 1NX0A 1DJYA 1PVAA 1DJWA 2PASA 1JUOA 3NXAA 1S6IA 4PT1A 3TUYB 1Y1AA 4PE0A 2M29A 2BECA 2ZFDA 1J7OA 3EK8A 2JULA 1MWNA 4YGEB 2NZ0A 2LMTA 4U8DA 2M97A 1UHNA 3L4AA 1B9AA 3BFHA 2ISDA 4CFRA 1AJ4A 1Z4HA 2ZRSA 1J7QA 1KWOC 2K7BA 2PYQA 2LHIA 1J55A 1A2XA 3CDNA 3WHUB 3PN7B 2AMIA 1IG5A 3MSEB 2D8NA 2YGUA 3CR2A 1BT6A 2JPOA 4INWA 3BUWB 3KF9A 2AAOA 1MHOA 1F4OA 1CDMA 1CLBA 3SG3A 1LA3A 5EL2A 1S6CA 1FI5A 1L2OC 4HRHA 1SL7A 4XYNA 1MXEA 1ZFSA 2BE6A 3RLZA 3DF0A 2R2IA 1A03A 4I5NB 3S0DA 1OOIX 3DVMA 1DF0B 1OMVA 2PMYA 4JD9A 2JWWA 3TDUA 1QX2A 3OB2B 1GGZA 1RTP1 3OGNA 2WCFA 2QEHA 2E30A 2K7CA 4PE4A 2H61C 4ORBB 1C7WA 1M45A 3KEVA 2BCAA 1VRKA 1NIWA 2KI4B 1H4BA 3I5FB 1F8HA 3BUMB 3CGAA 1PALA 1PRWA 1W9ZA 1F70A 3IQQA 4JWQA 2KPHA 2AUCA 1AK8A 3K21A 1CKKA 3PSRA 1PULA 3IVTA 3OX5A 1Y1XA 2BNXA 2KAYA 2BL0C 2L2EA 3DF0B 2QEBA 3JVTB 1B8RA 1K9PA 1YURA 3D73A 2SASA 2LMUA 1DELA 1KQMB 1XK4C 1WDCC 4PE7A 4IJ7A 2NCPA 3SS5A 4AQJA 1GQMA 1KFXS 1J1DA 3K1EA 1IRJA 2LVJA 1K93D 1YUTA 1S5GZ 2HPSA 2MLEC 1XFYO 2CTNA 3HCMA 3L4LA 4M2QA 3GK2A 1YRUB 5I2LA 4JQ0D 4ORCB 4I5LB 3SG6A 5G08A 4DCKA 2CXJA 2GGZA 4FQTA 5I2OA 4USLA 1QLKA 4MRXA 2M7LA 5IBWA 2TN4A 3OBVA 2K8MB 4PHJA 1AVSA 4MZLA 4HRGA 5FI2A 5BPJA 1N2DA 2M1KB 2RGIA 1TOPA 2K0JA 1B7TY 1PVBA 1TIZA 1DJIA 2QDIA 1KFUL 3I5IB 3TZ1A 5D3OA 1D1OA 1A29A 3JTDC 3TDIA 2KNEA 1M39A 1TNQA 2KYFA 5HKWA 3NSKA 3BUNB 1A4PA 1G33A 4GUKA 1BOCA 1WLZA 2FOTA 2FCEA 4YBHB 2OS8B 2ZNDA 2BE4A 3CZTX 4HREE 3CZ1A 5HLOA 4FQOA 1QJTA 5I2QA 3BUXB 3D77A 2KI6D 3EG5B 4GGNA 3CS1A 3SS3A 3DD4A 1N65A 1DJXA 3IQOA 3LK1A 2P6BB 1IJ5A 2M49B 1IGVA 1UHIA 1AP4A 3DYEA 3TS5B 4ORAB 1NCZA 1QLSA 3DVEA 3PM8A 4P5OE 2F33A 1BMOA 3CR5X 1YX8A 1TUZA 4UPGA 1DT7B 2JT0A 4GGFA 1EXRA 2JNXA 1NWDA 3SIAA 4GAOA 1IQ5A 4N1GA 1NSHA 1S3PA 4N1FA 5CPVA 1ALVA 3I5HB 2PSRA 1OOFA 1TNPA 2ZKMX 3DVJA 3AKAA 1CDPA 4MRYA 3EVUA 2L98A 1S36A 5AXIA 4ETOA 1CMFA 1K9UA 1GGWA 2PRUA 3AAJA 5CSIA 1IIOA 2K60A 1B1GA 1QV1A 3ZNIA 1BR1B 1NP8A 1CLMA 1RFJA 4WQ2A 1KCYA 4GBAA 3PATA 2O5GA 4MBEA 4YI9A 1LKJA 1PSRA 3PFVA 1CFPA 2EC6B 5I94A 1BF5A 1B4CA 3DXLA 2L4HA 3S0BA 1CFCA 4Q04A 1C07A 4PHKA 1H8BA 4YRUA 1CM1A 5KTYA 3KPXA 1KK7Y 3PN7C 3EK4A 3FE9A 5DKRA 2L2CA 1PK0D 3BUOB 5D7FA 4JPZB 2COLB 1QATA 3CR4X 1G4YR 1M63B 2MRDA 1SYMA 1KSMA 2JU0A 2WCHA 1OMDA 4IL1A 3CLNA 2I94A 3D0YA 5CSNA 1OQPA 2QEVA 2MA2A 2F2OA 5FI7A 1QX5B 3WHTB 1CB1A 4C0LA 3E3RA 2LLUA 1SSEB 3LLEA 3BFAA 4ICBA 1UURA 2CCMA 2LVKA 3UNWA 1YVLA 1WY9A 2JT8A 3NSIA 2BAPA 4PHNA 1CNPA 2PQLA 4BY5A 2KFFA 4OZDA 1YTZC 4I5KA 4OCIA 1IJ6A 3F45A 1IH0A 1QS7A 2JC2A 2JZIA 4R1EA 1A75A 1UWOA 3AKBA 1SBJA 5DICA 4XJKA 1WRZA 2H61A 3CTNA 1XFVO 4NDDA 3SG7A 1C3YA 4M2PA 2M1UA 1BU3A 1C3ZA 3R72A 5GQQC 2GV5A 2JRFA 4JKTA 3S0EA 1LA0A 2FJUB 2MJWB 3EK7A 1LINA 3I5GC 3SG5A 2KSPA 3D0YB 2Y4QA 4OKHA 1F4QA 2MAZA 1K94A 4GNKB 2KQ6A 2KFHA 1QVIZ 5HL1A 5DKQA 4CIDA 1N0YA 3JVTC 1LVCD 1Z2CB 1NYAA 1SY9A 5AERA 1KK8B 3OP0A 1QTXA 1TWOA 1KQMC 1SCMB 3O4XA 1XK4A 2OPOA 1G8IA 3VRPA 1BJFA 1TCFA 1UHJA 1ZMZA 1KFXL 3B6XA 1SRAA 2LVVA 1MXLC 1S5GY 1NX2A 1QIVA 3BOWA 1A75B 1QIWA 1QXPA 2KFGA 3BFBA 4C0KA 5HKYA 2LV7A 4XJKB 2KLEA 1IKUA 3R1VA 3GK4X 1JF0A 3PJIA 4C0JA 3B88A 3M0WA 1CDNA 2OTGB 3D75A 5JJGA 3L47A 1XA5A 1DVIA 4ZCVA 1IQ3A 5CSFA 2M3WA 2QPTA 1BR4B 2JXCA 1W7JB 1DC1A 2DOQA 4INXA 1R2UA 2LM5A 3HX4A 3O4YA 2BL0B 1Q80A 3A4UB 1CTRA 2JOJA 2KQYA 3DVKA 1YX7A 2LUXA 3KO0A 4QJ3B 4WQ3A 1K2HA 1DJGA 1OE9B 1Y0VH 1E8AA 2LUCA 4BY4A 2LANA 4F0ZB 1FPWA 1DQEA 3BOWB 2OS8C 1F71A 2WCJA 2Y5IA 2V53A 3SG2A 1LXFC 1Y1UA 2FJYA 2Q4UA 1C7VA 2KOTA 3QRXA 4MEWA 1MQ1A 1TN4A 3FE6A 1SCVA 3NGVA 1RJVA 2M0RA 4PALA 4YI8A 1YVHA 3CZ0A 1TUJA 3PLFB
chains in the Genus database with same CATH topology
1QASA 1SK6D 3A8RA 2BBMA 1K95A 2KAXA 3TS5C 3WNXB 2CNPA 1NUBA 3EVRA 4NQGA 1XO5A 3O2PA 2ZRTA 1OOJA 1TCOB 5JOLA 4CFQA 5K89A 1FW4A 1YUSA 3JTDB 3TDZA 1TNXA 4YGDB 3EKHA 1V1FA 2F3ZA 1RK9A 2MLFC 1JFKA 1OZSA 1RWYA 1MUXA 3I5HC 1JBAA 1NX1A 1SR6B 2LLSA 2SCPA 1HT9A 4MSPA 4CPVA 2K7DA 4CLNA 3TUYC 1CFFA 3SJSA 1W7IB 4QJ5B 3OB1B 2BKIB 3VRNA 2JNFA 2I2RE 5FYXA 1K96A 2F3YA 3PALA 1XVJA 2Q91A 1YUUA 2HQ8A 2GGMA 1L7ZA 1EG4A 1WRLA 3VRQA 2WCBA 2Y1MA 3KHEA 4GPLB 2ZNEA 3ZWHA 2CBLA 2PALA 2LHLA 3FWCA 3VROA 4GGFC 5PALA 2F8PA 4MVFA 2I18A 5HKZA 2MHHA 3O78A 2JT3A 3NSOA 3LCPC 4M2OA 2A4JA 2L0PA 1AHRA 2NXQA 2M8UA 3ICBA 1CMGA 1DJZA 1SPYA 2G9BA 2K2FA 2KI6C 3AAKA 4YGBB 1BODA 3LK0A 1DMOA 5F6TA 1OMRA 2LE9B 3LL8B 1B8LA 4DIRA 1DF0A 4AQIA 1XYDA 1UP5A 2KGRA 2LVIA 3IF7A 1EG3A 4YGAA 2KBMA 1M46A 4YGCB 3SG4A 2WCEA 5D69A 4A4CA 3VRRA 1JC2A 1KK7Z 1KWOB 1WRKA 1KQVA 1OZOA 1CDLA 1AUIB 2L50A 1MF8B 1SKTA 1S1EA 4DS7A 1M31A 3H4SE 2KI4C 3I5FC 1QX7A 1NCYA 2WNDA 2BKHB 2LAPA 2NLNA 4D1EA 1K90D 1ALWA 3EKJA 1B47A 1SL9A 1X02A 2NCOA 1ZACA 2K2AA 3NSLA 3WXAA 2IS9A 1QVIY 4PHMA 3O6BA 3FIAA 1L2OB 1KK8C 1SCMC 4QJ4B 5HYDA 1SL8A 1R6PA 2QACA 1JF2A 1RROA 2HETA 4NDBA 1SW8A 2BCXA 2KHNA 4I5JA 2LNKA 4A4BA 3FWBA 3BXKA 4HSZA 3BYAA 1JSAA 5HLVA 2ZN9A 2KYCA 2WC8A 4DUQA 5J3XA 1XFZO 1TRFA 5DKNA 1EL4A 3D10A 2OTGC 2M7NA 2O60A 1SMGA 2K7OA 2F2PA 3C1VA 3I5GB 4OVNF 4PDZA 2KBIA 4MN0A 1JFJA 2HF5A 4NDCA 2K61A 2LP3A 1XFXO 2JTZA 5AEQA 1S26D 2L4IA 1J7RA 1ZUZA 1UHHA 3I5IC 1U5IA 2L5XB 1RECA 2FCDA 1S6JA 1XFUO 3VGOA 2L51A 2I7AA 1WDCB 1CFDA 2H2KA 2KAVA 1NPQA 2JQ6A 5AFPA 4TNCA 1IWQA 1FI6A 1QV0A 1BG1A 1F54A 1DGUA 1MR8A 1SNLA 4MZJA 3CWGA 1KSOA 2CT9A 4MZKA 2BCBA 4ZCUA 5B8IB 1YRTB 4AOMA 1CM4A 1FBVA 1OSAA 1WLMA 2KGBC 4PCWA 1HQVA 1J7PA 3GK1A 4L9MA 4FTGA 1GJYA 1BLQA 1ODBA 1TTXA 2EHBA 5KSZA 4E68A 4OV2A 1B7TZ 1CLLA 1KFUS 1U5IB 1V1GA 2EGDA 4WRIA 2JXLA 1Y6WA 2E6WA 2WOSA 1DGVA 5AANA 1YR5A 3EVVA 2MBXA 2B1UA 4OR9B 2Y1NA 1SR6C 1TNWA 2JPTA 1ZOTB 1XFWO 1AJ5A 2BBNA 5ER4X 1UUSA 2PVBA 3OX6A 2KDHA 5ER5A 4GFTA 2WORA 2HQWA 1K9KA 3OHMB 5CSJA 1FF1A 2LP2A 2VRGA 1EH2A 1K8UA 2LC5A 1UHKA 4DRWA 2ZN8A 3BQ3A 3GOFA 1DJHA 2EC6C 1JWDA 1NX3A 1F55A 3FS7A 5TNCA 1J1EA 1PSBA 2LCPA 2LMVA 2JTTA 1DTLA 1B8CA 5KU1A 2LLTA 4P2YB 2G2BA 4PE1A 3RM1A 4N5XA 4MLWA 3SIBA 1EJ3A 1NCXA 2M9GA 5I8NA 1NX0A 1DJYA 1PVAA 1DJWA 2PASA 1JUOA 3NXAA 1S6IA 3TUYB 1Y1AA 4PE0A 2M29A 2BECA 2ZFDA 1J7OA 3EK8A 2JULA 1MWNA 4YGEB 2NZ0A 2LMTA 4U8DA 2M97A 1UHNA 1B9AA 2ISDA 4CFRA 1AJ4A 2ZRSA 1J7QA 1KWOC 2K7BA 2LHIA 1J55A 1A2XA 3WHUB 3PN7B 2AMIA 1IG5A 3MSEB 2D8NA 3CR2A 1BT6A 3BUWB 3KF9A 2AAOA 1MHOA 1F4OA 1CDMA 1CLBA 3SG3A 1LA3A 1S6CA 1FI5A 1L2OC 4HRHA 1SL7A 4XYNA 1MXEA 1ZFSA 2BE6A 3RLZA 3DF0A 2R2IA 1A03A 4I5NB 3DVMA 1DF0B 1OMVA 2PMYA 2JWWA 3TDUA 1QX2A 3OB2B 1GGZA 1RTP1 2WCFA 2E30A 2K7CA 4PE4A 2H61C 4ORBB 1C7WA 1M45A 3KEVA 2BCAA 1VRKA 1NIWA 2KI4B 1H4BA 3I5FB 1F8HA 3BUMB 3CGAA 1PALA 1PRWA 1F70A 3IQQA 4JWQA 2AUCA 1AK8A 3K21A 1CKKA 3PSRA 1PULA 3OX5A 1Y1XA 2KAYA 2BL0C 2L2EA 3DF0B 3JVTB 1B8RA 1K9PA 1YURA 2SASA 2LMUA 1KQMB 1XK4C 1WDCC 4PE7A 2NCPA 4AQJA 1GQMA 1KFXS 1J1DA 1IRJA 2LVJA 1K93D 1YUTA 1S5GZ 2HPSA 2MLEC 1XFYO 2CTNA 3HCMA 4M2QA 3GK2A 1YRUB 5I2LA 4JQ0D 4ORCB 4I5LB 3SG6A 5G08A 4DCKA 2CXJA 2GGZA 5I2OA 4USLA 1QLKA 4MRXA 2M7LA 5IBWA 2TN4A 2K8MB 4PHJA 1AVSA 4MZLA 4HRGA 5BPJA 1N2DA 2M1KB 2RGIA 1TOPA 2K0JA 1B7TY 1PVBA 1TIZA 1DJIA 3I5IB 1KFUL 3TZ1A 1D1OA 1A29A 3JTDC 3TDIA 2KNEA 1M39A 1TNQA 2KYFA 5HKWA 3NSKA 3BUNB 1A4PA 1G33A 4GUKA 1BOCA 1WLZA 2FOTA 2FCEA 4YBHB 2OS8B 2ZNDA 2BE4A 3CZTX 4HREE 5HLOA 4FQOA 1QJTA 5I2QA 3BUXB 2KI6D 4GGNA 3CS1A 3DD4A 1N65A 1DJXA 3IQOA 3LK1A 2P6BB 1IJ5A 2M49B 1IGVA 1UHIA 1AP4A 3TS5B 4ORAB 1NCZA 1QLSA 3DVEA 3PM8A 4P5OE 2F33A 1BMOA 3CR5X 1YX8A 4UPGA 1DT7B 2JT0A 4GGFA 1EXRA 2JNXA 1NWDA 3SIAA 4GAOA 1IQ5A 4N1GA 1NSHA 1S3PA 4N1FA 5CPVA 1ALVA 3I5HB 2PSRA 1TNPA 2ZKMX 3DVJA 3AKAA 1CDPA 4MRYA 3EVUA 2L98A 1S36A 5AXIA 4ETOA 1CMFA 1K9UA 1GGWA 2PRUA 3AAJA 5CSIA 1B1GA 1QV1A 3ZNIA 1BR1B 1NP8A 1CLMA 1RFJA 4WQ2A 1KCYA 4GBAA 3PATA 2O5GA 4MBEA 4YI9A 1LKJA 1PSRA 3PFVA 1CFPA 2EC6B 1BF5A 1B4CA 2L4HA 1CFCA 4Q04A 1C07A 4PHKA 1H8BA 4YRUA 1CM1A 5KTYA 3KPXA 1KK7Y 3PN7C 3EK4A 5DKRA 1PK0D 3BUOB 5D7FA 4JPZB 2COLB 1QATA 3CR4X 1G4YR 1M63B 2MRDA 1SYMA 1KSMA 2JU0A 1OMDA 4IL1A 3CLNA 2I94A 3D0YA 5CSNA 1OQPA 2MA2A 2F2OA 1QX5B 3WHTB 1CB1A 4C0LA 3E3RA 2LLUA 3LLEA 4ICBA 1UURA 2CCMA 2LVKA 1YVLA 1WY9A 2JT8A 3NSIA 4PHNA 1CNPA 4BY5A 2KFFA 1YTZC 4I5KA 4OCIA 1IJ6A 3F45A 1IH0A 1QS7A 2JC2A 2JZIA 4R1EA 1A75A 1UWOA 3AKBA 1SBJA 4XJKA 1WRZA 2H61A 3CTNA 1XFVO 4NDDA 3SG7A 4M2PA 2M1UA 1BU3A 5GQQC 2GV5A 2JRFA 1LA0A 2FJUB 2MJWB 3EK7A 1LINA 3I5GC 3SG5A 2KSPA 3D0YB 2Y4QA 4OKHA 1F4QA 2MAZA 1K94A 4GNKB 2KQ6A 2KFHA 1QVIZ 5DKQA 4CIDA 1N0YA 3JVTC 1LVCD 1NYAA 1SY9A 5AERA 1KK8B 3OP0A 1QTXA 1KQMC 1SCMB 1XK4A 2OPOA 1G8IA 3VRPA 1BJFA 1TCFA 1UHJA 1ZMZA 1KFXL 1SRAA 2LVVA 1MXLC 1S5GY 1NX2A 1QIVA 3BOWA 1A75B 1QIWA 1QXPA 2KFGA 4C0KA 5HKYA 2LV7A 4XJKB 1IKUA 3GK4X 1JF0A 4C0JA 1CDNA 3M0WA 2OTGB 5JJGA 1XA5A 1DVIA 4ZCVA 1IQ3A 5CSFA 2M3WA 2QPTA 1BR4B 2JXCA 1W7JB 2DOQA 1R2UA 2LM5A 3HX4A 3O4YA 2BL0B 1Q80A 3A4UB 1CTRA 2JOJA 2KQYA 3DVKA 1YX7A 2LUXA 3KO0A 4QJ3B 4WQ3A 1K2HA 1DJGA 1OE9B 1Y0VH 1E8AA 2LUCA 4BY4A 2LANA 4F0ZB 1FPWA 3BOWB 2OS8C 1F71A 2Y5IA 2V53A 3SG2A 1LXFC 1Y1UA 2Q4UA 1C7VA 2KOTA 3QRXA 4MEWA 1MQ1A 1TN4A 1SCVA 1RJVA 2M0RA 4PALA 4YI8A 1YVHA 3PLFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAS A;  1SK6 D;  3A8R A;  2BBM A;  1K95 A;  2KAX A;  3TS5 C;  3WNX B;  2CNP A;  1NUB A;  3EVR A;  4NQG A;  1XO5 A;  3O2P A;  2ZRT A;  1OOJ A;  1TCO B;  5JOL A;  4CFQ A;  5K89 A;  1FW4 A;  1YUS A;  3JTD B;  3TDZ A;  1TNX A;  4YGD B;  3EKH A;  1V1F A;  2F3Z A;  1RK9 A;  2MLF C;  1JFK A;  1OZS A;  1RWY A;  1MUX A;  3I5H C;  1JBA A;  1NX1 A;  1SR6 B;  2LLS A;  2SCP A;  1HT9 A;  4MSP A;  4CPV A;  2K7D A;  4CLN A;  3TUY C;  1CFF A;  3SJS A;  1W7I B;  4QJ5 B;  3OB1 B;  2BKI B;  3VRN A;  2JNF A;  2I2R E;  5FYX A;  1K96 A;  2F3Y A;  3PAL A;  1XVJ A;  2Q91 A;  1YUU A;  2HQ8 A;  2GGM A;  1L7Z A;  1EG4 A;  1WRL A;  3VRQ A;  2WCB A;  2Y1M A;  3KHE A;  4GPL B;  2ZNE A;  3ZWH A;  2CBL A;  2PAL A;  2LHL A;  3FWC A;  3VRO A;  4GGF C;  5PAL A;  2F8P A;  4MVF A;  2I18 A;  5HKZ A;  2MHH A;  3O78 A;  2JT3 A;  3NSO A;  3LCP C;  4M2O A;  2A4J A;  2L0P A;  1AHR A;  2NXQ A;  2M8U A;  3ICB A;  1CMG A;  1DJZ A;  1SPY A;  2G9B A;  2K2F A;  2KI6 C;  3AAK A;  4YGB B;  1BOD A;  3LK0 A;  1DMO A;  5F6T A;  1OMR A;  2LE9 B;  3LL8 B;  1B8L A;  4DIR A;  1DF0 A;  4AQI A;  1XYD A;  1UP5 A;  2KGR A;  2LVI A;  3IF7 A;  1EG3 A;  4YGA A;  2KBM A;  1M46 A;  4YGC B;  3SG4 A;  2WCE A;  5D69 A;  4A4C A;  3VRR A;  1JC2 A;  1KK7 Z;  1KWO B;  1WRK A;  1KQV A;  1OZO A;  1CDL A;  1AUI B;  2L50 A;  1MF8 B;  1SKT A;  1S1E A;  4DS7 A;  1M31 A;  3H4S E;  2KI4 C;  3I5F C;  1QX7 A;  1NCY A;  2WND A;  2BKH B;  2LAP A;  2NLN A;  4D1E A;  1K90 D;  1ALW A;  3EKJ A;  1B47 A;  1SL9 A;  1X02 A;  2NCO A;  1ZAC A;  2K2A A;  3NSL A;  3WXA A;  2IS9 A;  1QVI Y;  4PHM A;  3O6B A;  3FIA A;  1L2O B;  1KK8 C;  1SCM C;  4QJ4 B;  5HYD A;  1SL8 A;  1R6P A;  2QAC A;  1JF2 A;  1RRO A;  2HET A;  4NDB A;  1SW8 A;  2BCX A;  2KHN A;  4I5J A;  2LNK A;  4A4B A;  3FWB A;  3BXK A;  4HSZ A;  3BYA A;  1JSA A;  5HLV A;  2ZN9 A;  2KYC A;  2WC8 A;  4DUQ A;  5J3X A;  1XFZ O;  1TRF A;  5DKN A;  1EL4 A;  3D10 A;  2OTG C;  2M7N A;  2O60 A;  1SMG A;  2K7O A;  2F2P A;  3C1V A;  3I5G B;  4OVN F;  4PDZ A;  2KBI A;  4MN0 A;  1JFJ A;  2HF5 A;  4NDC A;  2K61 A;  2LP3 A;  1XFX O;  2JTZ A;  5AEQ A;  1S26 D;  2L4I A;  1J7R A;  1ZUZ A;  1UHH A;  3I5I C;  1U5I A;  2L5X B;  1REC A;  2FCD A;  1S6J A;  1XFU O;  3VGO A;  2L51 A;  2I7A A;  1WDC B;  1CFD A;  2H2K A;  2KAV A;  1NPQ A;  2JQ6 A;  5AFP A;  4TNC A;  1IWQ A;  1FI6 A;  1QV0 A;  1BG1 A;  1F54 A;  1DGU A;  1MR8 A;  1SNL A;  4MZJ A;  3CWG A;  1KSO A;  2CT9 A;  4MZK A;  2BCB A;  4ZCU A;  5B8I B;  1YRT B;  4AOM A;  1CM4 A;  1FBV A;  1OSA A;  1WLM A;  2KGB C;  4PCW A;  1HQV A;  1J7P A;  3GK1 A;  4L9M A;  4FTG A;  1GJY A;  1BLQ A;  1ODB A;  1TTX A;  2EHB A;  5KSZ A;  4E68 A;  4OV2 A;  1B7T Z;  1CLL A;  1KFU S;  1U5I B;  1V1G A;  2EGD A;  4WRI A;  2JXL A;  1Y6W A;  2E6W A;  2WOS A;  1DGV A;  5AAN A;  1YR5 A;  3EVV A;  2MBX A;  2B1U A;  4OR9 B;  2Y1N A;  1SR6 C;  1TNW A;  2JPT A;  1ZOT B;  1XFW O;  1AJ5 A;  2BBN A;  5ER4 X;  1UUS A;  2PVB A;  3OX6 A;  2KDH A;  5ER5 A;  4GFT A;  2WOR A;  2HQW A;  1K9K A;  3OHM B;  5CSJ A;  1FF1 A;  2LP2 A;  2VRG A;  1EH2 A;  1K8U A;  2LC5 A;  1UHK A;  4DRW A;  2ZN8 A;  3BQ3 A;  3GOF A;  1DJH A;  2EC6 C;  1JWD A;  1NX3 A;  1F55 A;  3FS7 A;  5TNC A;  1J1E A;  1PSB A;  2LCP A;  2LMV A;  2JTT A;  1DTL A;  1B8C A;  5KU1 A;  2LLT A;  4P2Y B;  2G2B A;  4PE1 A;  3RM1 A;  4N5X A;  4MLW A;  3SIB A;  1EJ3 A;  1NCX A;  2M9G A;  5I8N A;  1NX0 A;  1DJY A;  1PVA A;  1DJW A;  2PAS A;  1JUO A;  3NXA A;  1S6I A;  3TUY B;  1Y1A A;  4PE0 A;  2M29 A;  2BEC A;  2ZFD A;  1J7O A;  3EK8 A;  2JUL A;  1MWN A;  4YGE B;  2NZ0 A;  2LMT A;  4U8D A;  2M97 A;  1UHN A;  1B9A A;  2ISD A;  4CFR A;  1AJ4 A;  2ZRS A;  1J7Q A;  1KWO C;  2K7B A;  2LHI A;  1J55 A;  1A2X A;  3WHU B;  3PN7 B;  2AMI A;  1IG5 A;  3MSE B;  2D8N A;  3CR2 A;  1BT6 A;  3BUW B;  3KF9 A;  2AAO A;  1MHO A;  1F4O A;  1CDM A;  1CLB A;  3SG3 A;  1LA3 A;  1S6C A;  1FI5 A;  1L2O C;  4HRH A;  1SL7 A;  4XYN A;  1MXE A;  1ZFS A;  2BE6 A;  3RLZ A;  3DF0 A;  2R2I A;  1A03 A;  4I5N B;  3DVM A;  1DF0 B;  1OMV A;  2PMY A;  2JWW A;  3TDU A;  1QX2 A;  3OB2 B;  1GGZ A;  1RTP 1;  2WCF A;  2E30 A;  2K7C A;  4PE4 A;  2H61 C;  4ORB B;  1C7W A;  1M45 A;  3KEV A;  2BCA A;  1VRK A;  1NIW A;  2KI4 B;  1H4B A;  3I5F B;  1F8H A;  3BUM B;  3CGA A;  1PAL A;  1PRW A;  1F70 A;  3IQQ A;  4JWQ A;  2AUC A;  1AK8 A;  3K21 A;  1CKK A;  3PSR A;  1PUL A;  3OX5 A;  1Y1X A;  2KAY A;  2BL0 C;  2L2E A;  3DF0 B;  3JVT B;  1B8R A;  1K9P A;  1YUR A;  2SAS A;  2LMU A;  1KQM B;  1XK4 C;  1WDC C;  4PE7 A;  2NCP A;  4AQJ A;  1GQM A;  1KFX S;  1J1D A;  1IRJ A;  2LVJ A;  1K93 D;  1YUT A;  1S5G Z;  2HPS A;  2MLE C;  1XFY O;  2CTN A;  3HCM A;  4M2Q A;  3GK2 A;  1YRU B;  5I2L A;  4JQ0 D;  4ORC B;  4I5L B;  3SG6 A;  5G08 A;  4DCK A;  2CXJ A;  2GGZ A;  5I2O A;  4USL A;  1QLK A;  4MRX A;  2M7L A;  5IBW A;  2TN4 A;  2K8M B;  4PHJ A;  1AVS A;  4MZL A;  4HRG A;  5BPJ A;  1N2D A;  2M1K B;  2RGI A;  1TOP A;  2K0J A;  1B7T Y;  1PVB A;  1TIZ A;  1DJI A;  3I5I B;  1KFU L;  3TZ1 A;  1D1O A;  1A29 A;  3JTD C;  3TDI A;  2KNE A;  1M39 A;  1TNQ A;  2KYF A;  5HKW A;  3NSK A;  3BUN B;  1A4P A;  1G33 A;  4GUK A;  1BOC A;  1WLZ A;  2FOT A;  2FCE A;  4YBH B;  2OS8 B;  2ZND A;  2BE4 A;  3CZT X;  4HRE E;  5HLO A;  4FQO A;  1QJT A;  5I2Q A;  3BUX B;  2KI6 D;  4GGN A;  3CS1 A;  3DD4 A;  1N65 A;  1DJX A;  3IQO A;  3LK1 A;  2P6B B;  1IJ5 A;  2M49 B;  1IGV A;  1UHI A;  1AP4 A;  3TS5 B;  4ORA B;  1NCZ A;  1QLS A;  3DVE A;  3PM8 A;  4P5O E;  2F33 A;  1BMO A;  3CR5 X;  1YX8 A;  4UPG A;  1DT7 B;  2JT0 A;  4GGF A;  1EXR A;  2JNX A;  1NWD A;  3SIA A;  4GAO A;  1IQ5 A;  4N1G A;  1NSH A;  1S3P A;  4N1F A;  5CPV A;  1ALV A;  3I5H B;  2PSR A;  1TNP A;  2ZKM X;  3DVJ A;  3AKA A;  1CDP A;  4MRY A;  3EVU A;  2L98 A;  1S36 A;  5AXI A;  4ETO A;  1CMF A;  1K9U A;  1GGW A;  2PRU A;  3AAJ A;  5CSI A;  1B1G A;  1QV1 A;  3ZNI A;  1BR1 B;  1NP8 A;  1CLM A;  1RFJ A;  4WQ2 A;  1KCY A;  4GBA A;  3PAT A;  2O5G A;  4MBE A;  4YI9 A;  1LKJ A;  1PSR A;  3PFV A;  1CFP A;  2EC6 B;  1BF5 A;  1B4C A;  2L4H A;  1CFC A;  4Q04 A;  1C07 A;  4PHK A;  1H8B A;  4YRU A;  1CM1 A;  5KTY A;  3KPX A;  1KK7 Y;  3PN7 C;  3EK4 A;  5DKR A;  1PK0 D;  3BUO B;  5D7F A;  4JPZ B;  2COL B;  1QAT A;  3CR4 X;  1G4Y R;  1M63 B;  2MRD A;  1SYM A;  1KSM A;  2JU0 A;  1OMD A;  4IL1 A;  3CLN A;  2I94 A;  3D0Y A;  5CSN A;  1OQP A;  2MA2 A;  2F2O A;  1QX5 B;  3WHT B;  1CB1 A;  4C0L A;  3E3R A;  2LLU A;  3LLE A;  4ICB A;  1UUR A;  2CCM A;  2LVK A;  1YVL A;  1WY9 A;  2JT8 A;  3NSI A;  4PHN A;  1CNP A;  4BY5 A;  2KFF A;  1YTZ C;  4I5K A;  4OCI A;  1IJ6 A;  3F45 A;  1IH0 A;  1QS7 A;  2JC2 A;  2JZI A;  4R1E A;  1A75 A;  1UWO A;  3AKB A;  1SBJ A;  4XJK A;  1WRZ A;  2H61 A;  3CTN A;  1XFV O;  4NDD A;  3SG7 A;  4M2P A;  2M1U A;  1BU3 A;  5GQQ C;  2GV5 A;  2JRF A;  1LA0 A;  2FJU B;  2MJW B;  3EK7 A;  1LIN A;  3I5G C;  3SG5 A;  2KSP A;  3D0Y B;  2Y4Q A;  4OKH A;  1F4Q A;  2MAZ A;  1K94 A;  4GNK B;  2KQ6 A;  2KFH A;  1QVI Z;  5DKQ A;  4CID A;  1N0Y A;  3JVT C;  1LVC D;  1NYA A;  1SY9 A;  5AER A;  1KK8 B;  3OP0 A;  1QTX A;  1KQM C;  1SCM B;  1XK4 A;  2OPO A;  1G8I A;  3VRP A;  1BJF A;  1TCF A;  1UHJ A;  1ZMZ A;  1KFX L;  1SRA A;  2LVV A;  1MXL C;  1S5G Y;  1NX2 A;  1QIV A;  3BOW A;  1A75 B;  1QIW A;  1QXP A;  2KFG A;  4C0K A;  5HKY A;  2LV7 A;  4XJK B;  1IKU A;  3GK4 X;  1JF0 A;  4C0J A;  1CDN A;  3M0W A;  2OTG B;  5JJG A;  1XA5 A;  1DVI A;  4ZCV A;  1IQ3 A;  5CSF A;  2M3W A;  2QPT A;  1BR4 B;  2JXC A;  1W7J B;  2DOQ A;  1R2U A;  2LM5 A;  3HX4 A;  3O4Y A;  2BL0 B;  1Q80 A;  3A4U B;  1CTR A;  2JOJ A;  2KQY A;  3DVK A;  1YX7 A;  2LUX A;  3KO0 A;  4QJ3 B;  4WQ3 A;  1K2H A;  1DJG A;  1OE9 B;  1Y0V H;  1E8A A;  2LUC A;  4BY4 A;  2LAN A;  4F0Z B;  1FPW A;  3BOW B;  2OS8 C;  1F71 A;  2Y5I A;  2V53 A;  3SG2 A;  1LXF C;  1Y1U A;  2Q4U A;  1C7V A;  2KOT A;  3QRX A;  4MEW A;  1MQ1 A;  1TN4 A;  1SCV A;  1RJV A;  2M0R A;  4PAL A;  4YI8 A;  1YVH A;  3PLF B; 
#chains in the Genus database with same CATH topology
 1QAS A;  2WC5 A;  1SK6 D;  3A8R A;  2BBM A;  1K95 A;  5FI6 A;  2KAX A;  3TS5 C;  3NHI A;  3WNX B;  2CNP A;  1NUB A;  3EVR A;  4NQG A;  1XO5 A;  3O2P A;  2ZRT A;  1OOJ A;  1TCO B;  5JOL A;  4CFQ A;  5K89 A;  1FW4 A;  1YUS A;  3JTD B;  3TDZ A;  1DEK A;  1TNX A;  4YGD B;  3EKH A;  1V1F A;  2F3Z A;  1RK9 A;  2MLF C;  1JFK A;  1OZS A;  1RWY A;  1MUX A;  3I5H C;  1JBA A;  1NX1 A;  1SR6 B;  2LLS A;  2SCP A;  1HT9 A;  3SS4 A;  4MSP A;  4CPV A;  2K7D A;  4CLN A;  3TUY C;  1CFF A;  3SJS A;  1W7I B;  4QJ5 B;  3OB1 B;  2BKI B;  3VRN A;  2JNF A;  2I2R E;  5FYX A;  1K96 A;  2F3Y A;  3PAL A;  1XVJ A;  2Q91 A;  1YUU A;  2HQ8 A;  2GGM A;  1L7Z A;  1EG4 A;  1P28 A;  1WRL A;  2WCB A;  3VRQ A;  2Y1M A;  3KHE A;  4GPL B;  2ZNE A;  3VB1 A;  2CBL A;  3ZWH A;  2PAL A;  2LHL A;  3FWC A;  2H8V A;  4GGF C;  3VRO A;  5PAL A;  1OOG A;  2F8P A;  4MVF A;  2I18 A;  5HKZ A;  2MHH A;  3O78 A;  2JT3 A;  3NSO A;  3LCP C;  3DY9 A;  4M2O A;  3R1O A;  2A4J A;  2P70 A;  2L0P A;  2QEO A;  1LS8 A;  1AHR A;  2NXQ A;  2M8U A;  3ICB A;  1CMG A;  3D76 A;  1DJZ A;  1SPY A;  2G9B A;  2K2F A;  2KI6 C;  3AAK A;  4YGB B;  2WC6 A;  1BOD A;  3LK0 A;  1DMO A;  5F6T A;  1OMR A;  2LE9 B;  3LL8 B;  1B8L A;  4DIR A;  3QME A;  1DF0 A;  4AQI A;  3S0A A;  1XYD A;  1UP5 A;  2KGR A;  2LVI A;  3IF7 A;  1EG3 A;  4YGA A;  2KBM A;  1M46 A;  4YGC B;  3SG4 A;  2WCE A;  5D69 A;  4A4C A;  3VRR A;  1JC2 A;  1KK7 Z;  1KWO B;  1WRK A;  1KQV A;  1OZO A;  1CDL A;  1AUI B;  2L50 A;  1MF8 B;  1SKT A;  1S1E A;  4DS7 A;  1M31 A;  3H4S E;  2KI4 C;  3I5F C;  1QX7 A;  1NCY A;  2WND A;  2BKH B;  2LAP A;  2NLN A;  4D1E A;  3B86 A;  2WCM A;  1K90 D;  1ALW A;  1T14 A;  2KLD A;  3EKJ A;  1B47 A;  1SL9 A;  1X02 A;  2NCO A;  1ZAC A;  2K2A A;  3NSL A;  3WXA A;  2IS9 A;  1QVI Y;  4PHM A;  3O6B A;  2P71 A;  3FIA A;  1L2O B;  1KK8 C;  1SCM C;  4QJ4 B;  5HYD A;  3DZT A;  1SL8 A;  1R6P A;  2QAC A;  1JF2 A;  1RRO A;  2HET A;  4NDB A;  1SW8 A;  2BCX A;  2KHN A;  4I5J A;  2LNK A;  3BJH A;  4A4B A;  3FWB A;  3BXK A;  4HSZ A;  3BYA A;  1JSA A;  3CYZ A;  5HLV A;  2ZN9 A;  2KYC A;  2WC8 A;  4DUQ A;  5J3X A;  1XFZ O;  1TRF A;  5DKN A;  1EL4 A;  3D10 A;  2ERB A;  2OTG C;  2M7N A;  2O60 A;  3NHT A;  1SMG A;  2K7O A;  2F2P A;  3C1V A;  3I5G B;  3Q8I A;  4OVN F;  4PDZ A;  2KBI A;  4MN0 A;  1JFJ A;  3V2L A;  2HF5 A;  4KYN A;  4NDC A;  2K61 A;  2LP3 A;  1XFX O;  2JTZ A;  2GTE A;  5AEQ A;  1S26 D;  2L4I A;  1J7R A;  1ZUZ A;  1UHH A;  3I5I C;  1U5I A;  2L5X B;  3D78 A;  1GM0 A;  1REC A;  2FCD A;  1S6J A;  1XFU O;  2WCL A;  2L51 A;  3VGO A;  2I7A A;  1WDC B;  1CFD A;  2H2K A;  2KAV A;  3S0G A;  1NPQ A;  2JQ6 A;  5AFP A;  4TNC A;  1IWQ A;  1FI6 A;  1QV0 A;  1BG1 A;  1F54 A;  1DGU A;  1XFR A;  1MR8 A;  3N7H A;  1SNL A;  4MZJ A;  3CWG A;  1KSO A;  2CT9 A;  4MZK A;  2BCB A;  4ZCU A;  5B8I B;  1YRT B;  4AOM A;  3B7A A;  1CM4 A;  1FBV A;  1OSA A;  1WLM A;  2KGB C;  4PCW A;  1HQV A;  1J7P A;  3GK1 A;  4L9M A;  4FTG A;  1GJY A;  1BLQ A;  1ODB A;  1TTX A;  2EHB A;  1OOH A;  3FE8 A;  5KSZ A;  4E68 A;  4OV2 A;  1B7T Z;  2L5Y A;  3RZS A;  1CLL A;  3R1P A;  3CZ2 A;  1KFU S;  1U5I B;  1V1G A;  2EGD A;  4WRI A;  2JXL A;  1Y6W A;  2E6W A;  2WOS A;  1DGV A;  5AAN A;  1YR5 A;  3EVV A;  2MBX A;  2B1U A;  4OR9 B;  2Y1N A;  1OW4 A;  1SR6 C;  1TNW A;  2JPT A;  1ZOT B;  3B87 A;  1XFW O;  1AJ5 A;  1ORG A;  2BBN A;  5ER4 X;  1UUS A;  1QWV A;  2PVB A;  3OX6 A;  2KDH A;  5ER5 A;  4GFT A;  2WOR A;  2HQW A;  1K9K A;  3OHM B;  5CSJ A;  1FF1 A;  3PM2 A;  2LP2 A;  2VRG A;  1EH2 A;  1K8U A;  2LC5 A;  1UHK A;  4DRW A;  2ZN8 A;  3BQ3 A;  3GOF A;  1DJH A;  2EC6 C;  1JWD A;  1NX3 A;  1F55 A;  3UO9 A;  3FS7 A;  5TNC A;  1J1E A;  1PSB A;  2LCP A;  2LMV A;  2JTT A;  3CAB A;  1DTL A;  3D74 A;  1B8C A;  5KU1 A;  2LLT A;  4P2Y B;  2G2B A;  4PE1 A;  3RM1 A;  4F7F A;  2WCK A;  4N5X A;  4MLW A;  3SIB A;  1EJ3 A;  1NCX A;  2M9G A;  3S0F A;  5I8N A;  1NX0 A;  1DJY A;  1PVA A;  1DJW A;  2PAS A;  1JUO A;  3NXA A;  1S6I A;  4PT1 A;  3TUY B;  1Y1A A;  4PE0 A;  2M29 A;  2BEC A;  2ZFD A;  1J7O A;  3EK8 A;  2JUL A;  1MWN A;  4YGE B;  2NZ0 A;  2LMT A;  4U8D A;  2M97 A;  1UHN A;  3L4A A;  1B9A A;  3BFH A;  2ISD A;  4CFR A;  1AJ4 A;  1Z4H A;  2ZRS A;  1J7Q A;  1KWO C;  2K7B A;  2PYQ A;  2LHI A;  1J55 A;  1A2X A;  3CDN A;  3WHU B;  3PN7 B;  2AMI A;  1IG5 A;  3MSE B;  2D8N A;  2YGU A;  3CR2 A;  1BT6 A;  2JPO A;  4INW A;  3BUW B;  3KF9 A;  2AAO A;  1MHO A;  1F4O A;  1CDM A;  1CLB A;  3SG3 A;  1LA3 A;  5EL2 A;  1S6C A;  1FI5 A;  1L2O C;  4HRH A;  1SL7 A;  4XYN A;  1MXE A;  1ZFS A;  2BE6 A;  3RLZ A;  3DF0 A;  2R2I A;  1A03 A;  4I5N B;  3S0D A;  1OOI X;  3DVM A;  1DF0 B;  1OMV A;  2PMY A;  4JD9 A;  2JWW A;  3TDU A;  1QX2 A;  3OB2 B;  1GGZ A;  1RTP 1;  3OGN A;  2WCF A;  2QEH A;  2E30 A;  2K7C A;  4PE4 A;  2H61 C;  4ORB B;  1C7W A;  1M45 A;  3KEV A;  2BCA A;  1VRK A;  1NIW A;  2KI4 B;  1H4B A;  3I5F B;  1F8H A;  3BUM B;  3CGA A;  1PAL A;  1PRW A;  1W9Z A;  1F70 A;  3IQQ A;  4JWQ A;  2KPH A;  2AUC A;  1AK8 A;  3K21 A;  1CKK A;  3PSR A;  1PUL A;  3IVT A;  3OX5 A;  1Y1X A;  2BNX A;  2KAY A;  2BL0 C;  2L2E A;  3DF0 B;  2QEB A;  3JVT B;  1B8R A;  1K9P A;  1YUR A;  3D73 A;  2SAS A;  2LMU A;  1DEL A;  1KQM B;  1XK4 C;  1WDC C;  4PE7 A;  4IJ7 A;  2NCP A;  3SS5 A;  4AQJ A;  1GQM A;  1KFX S;  1J1D A;  3K1E A;  1IRJ A;  2LVJ A;  1K93 D;  1YUT A;  1S5G Z;  2HPS A;  2MLE C;  1XFY O;  2CTN A;  3HCM A;  3L4L A;  4M2Q A;  3GK2 A;  1YRU B;  5I2L A;  4JQ0 D;  4ORC B;  4I5L B;  3SG6 A;  5G08 A;  4DCK A;  2CXJ A;  2GGZ A;  4FQT A;  5I2O A;  4USL A;  1QLK A;  4MRX A;  2M7L A;  5IBW A;  2TN4 A;  3OBV A;  2K8M B;  4PHJ A;  1AVS A;  4MZL A;  4HRG A;  5FI2 A;  5BPJ A;  1N2D A;  2M1K B;  2RGI A;  1TOP A;  2K0J A;  1B7T Y;  1PVB A;  1TIZ A;  1DJI A;  2QDI A;  1KFU L;  3I5I B;  3TZ1 A;  5D3O A;  1D1O A;  1A29 A;  3JTD C;  3TDI A;  2KNE A;  1M39 A;  1TNQ A;  2KYF A;  5HKW A;  3NSK A;  3BUN B;  1A4P A;  1G33 A;  4GUK A;  1BOC A;  1WLZ A;  2FOT A;  2FCE A;  4YBH B;  2OS8 B;  2ZND A;  2BE4 A;  3CZT X;  4HRE E;  3CZ1 A;  5HLO A;  4FQO A;  1QJT A;  5I2Q A;  3BUX B;  3D77 A;  2KI6 D;  3EG5 B;  4GGN A;  3CS1 A;  3SS3 A;  3DD4 A;  1N65 A;  1DJX A;  3IQO A;  3LK1 A;  2P6B B;  1IJ5 A;  2M49 B;  1IGV A;  1UHI A;  1AP4 A;  3DYE A;  3TS5 B;  4ORA B;  1NCZ A;  1QLS A;  3DVE A;  3PM8 A;  4P5O E;  2F33 A;  1BMO A;  3CR5 X;  1YX8 A;  1TUZ A;  4UPG A;  1DT7 B;  2JT0 A;  4GGF A;  1EXR A;  2JNX A;  1NWD A;  3SIA A;  4GAO A;  1IQ5 A;  4N1G A;  1NSH A;  1S3P A;  4N1F A;  5CPV A;  1ALV A;  3I5H B;  2PSR A;  1OOF A;  1TNP A;  2ZKM X;  3DVJ A;  3AKA A;  1CDP A;  4MRY A;  3EVU A;  2L98 A;  1S36 A;  5AXI A;  4ETO A;  1CMF A;  1K9U A;  1GGW A;  2PRU A;  3AAJ A;  5CSI A;  1IIO A;  2K60 A;  1B1G A;  1QV1 A;  3ZNI A;  1BR1 B;  1NP8 A;  1CLM A;  1RFJ A;  4WQ2 A;  1KCY A;  4GBA A;  3PAT A;  2O5G A;  4MBE A;  4YI9 A;  1LKJ A;  1PSR A;  3PFV A;  1CFP A;  2EC6 B;  5I94 A;  1BF5 A;  1B4C A;  3DXL A;  2L4H A;  3S0B A;  1CFC A;  4Q04 A;  1C07 A;  4PHK A;  1H8B A;  4YRU A;  1CM1 A;  5KTY A;  3KPX A;  1KK7 Y;  3PN7 C;  3EK4 A;  3FE9 A;  5DKR A;  2L2C A;  1PK0 D;  3BUO B;  5D7F A;  4JPZ B;  2COL B;  1QAT A;  3CR4 X;  1G4Y R;  1M63 B;  2MRD A;  1SYM A;  1KSM A;  2JU0 A;  2WCH A;  1OMD A;  4IL1 A;  3CLN A;  2I94 A;  3D0Y A;  5CSN A;  1OQP A;  2QEV A;  2MA2 A;  2F2O A;  5FI7 A;  1QX5 B;  3WHT B;  1CB1 A;  4C0L A;  3E3R A;  2LLU A;  1SSE B;  3LLE A;  3BFA A;  4ICB A;  1UUR A;  2CCM A;  2LVK A;  3UNW A;  1YVL A;  1WY9 A;  2JT8 A;  3NSI A;  2BAP A;  4PHN A;  1CNP A;  2PQL A;  4BY5 A;  2KFF A;  4OZD A;  1YTZ C;  4I5K A;  4OCI A;  1IJ6 A;  3F45 A;  1IH0 A;  1QS7 A;  2JC2 A;  2JZI A;  4R1E A;  1A75 A;  1UWO A;  3AKB A;  1SBJ A;  5DIC A;  4XJK A;  1WRZ A;  2H61 A;  3CTN A;  1XFV O;  4NDD A;  3SG7 A;  1C3Y A;  4M2P A;  2M1U A;  1BU3 A;  1C3Z A;  3R72 A;  5GQQ C;  2GV5 A;  2JRF A;  4JKT A;  3S0E A;  1LA0 A;  2FJU B;  2MJW B;  3EK7 A;  1LIN A;  3I5G C;  3SG5 A;  2KSP A;  3D0Y B;  2Y4Q A;  4OKH A;  1F4Q A;  2MAZ A;  1K94 A;  4GNK B;  2KQ6 A;  2KFH A;  1QVI Z;  5HL1 A;  5DKQ A;  4CID A;  1N0Y A;  3JVT C;  1LVC D;  1Z2C B;  1NYA A;  1SY9 A;  5AER A;  1KK8 B;  3OP0 A;  1QTX A;  1TWO A;  1KQM C;  1SCM B;  3O4X A;  1XK4 A;  2OPO A;  1G8I A;  3VRP A;  1BJF A;  1TCF A;  1UHJ A;  1ZMZ A;  1KFX L;  3B6X A;  1SRA A;  2LVV A;  1MXL C;  1S5G Y;  1NX2 A;  1QIV A;  3BOW A;  1A75 B;  1QIW A;  1QXP A;  2KFG A;  3BFB A;  4C0K A;  5HKY A;  2LV7 A;  4XJK B;  2KLE A;  1IKU A;  3R1V A;  3GK4 X;  1JF0 A;  3PJI A;  4C0J A;  3B88 A;  3M0W A;  1CDN A;  2OTG B;  3D75 A;  5JJG A;  3L47 A;  1XA5 A;  1DVI A;  4ZCV A;  1IQ3 A;  5CSF A;  2M3W A;  2QPT A;  1BR4 B;  2JXC A;  1W7J B;  1DC1 A;  2DOQ A;  4INX A;  1R2U A;  2LM5 A;  3HX4 A;  3O4Y A;  2BL0 B;  1Q80 A;  3A4U B;  1CTR A;  2JOJ A;  2KQY A;  3DVK A;  1YX7 A;  2LUX A;  3KO0 A;  4QJ3 B;  4WQ3 A;  1K2H A;  1DJG A;  1OE9 B;  1Y0V H;  1E8A A;  2LUC A;  4BY4 A;  2LAN A;  4F0Z B;  1FPW A;  1DQE A;  3BOW B;  2OS8 C;  1F71 A;  2WCJ A;  2Y5I A;  2V53 A;  3SG2 A;  1LXF C;  1Y1U A;  2FJY A;  2Q4U A;  1C7V A;  2KOT A;  3QRX A;  4MEW A;  1MQ1 A;  1TN4 A;  3FE6 A;  1SCV A;  3NGV A;  1RJV A;  2M0R A;  4PAL A;  4YI8 A;  1YVH A;  3CZ0 A;  1TUJ A;  3PLF B; 
#chains in the Genus database with same CATH homology
 1QAS A;  1SK6 D;  3A8R A;  2BBM A;  1K95 A;  2KAX A;  3TS5 C;  3WNX B;  2CNP A;  1NUB A;  3EVR A;  4NQG A;  1XO5 A;  3O2P A;  2ZRT A;  1OOJ A;  1TCO B;  5JOL A;  4CFQ A;  5K89 A;  1FW4 A;  1YUS A;  3JTD B;  3TDZ A;  1TNX A;  4YGD B;  3EKH A;  1V1F A;  2F3Z A;  1RK9 A;  2MLF C;  1JFK A;  1OZS A;  1RWY A;  1MUX A;  3I5H C;  1JBA A;  1NX1 A;  1SR6 B;  2LLS A;  2SCP A;  1HT9 A;  4MSP A;  4CPV A;  2K7D A;  4CLN A;  3TUY C;  1CFF A;  3SJS A;  1W7I B;  4QJ5 B;  3OB1 B;  2BKI B;  3VRN A;  2JNF A;  2I2R E;  5FYX A;  1K96 A;  2F3Y A;  3PAL A;  1XVJ A;  2Q91 A;  1YUU A;  2HQ8 A;  2GGM A;  1L7Z A;  1EG4 A;  1WRL A;  3VRQ A;  2WCB A;  2Y1M A;  3KHE A;  4GPL B;  2ZNE A;  3ZWH A;  2CBL A;  2PAL A;  2LHL A;  3FWC A;  3VRO A;  4GGF C;  5PAL A;  2F8P A;  4MVF A;  2I18 A;  5HKZ A;  2MHH A;  3O78 A;  2JT3 A;  3NSO A;  3LCP C;  4M2O A;  2A4J A;  2L0P A;  1AHR A;  2NXQ A;  2M8U A;  3ICB A;  1CMG A;  1DJZ A;  1SPY A;  2G9B A;  2K2F A;  2KI6 C;  3AAK A;  4YGB B;  1BOD A;  3LK0 A;  1DMO A;  5F6T A;  1OMR A;  2LE9 B;  3LL8 B;  1B8L A;  4DIR A;  1DF0 A;  4AQI A;  1XYD A;  1UP5 A;  2KGR A;  2LVI A;  3IF7 A;  1EG3 A;  4YGA A;  2KBM A;  1M46 A;  4YGC B;  3SG4 A;  2WCE A;  5D69 A;  4A4C A;  3VRR A;  1JC2 A;  1KK7 Z;  1KWO B;  1WRK A;  1KQV A;  1OZO A;  1CDL A;  1AUI B;  2L50 A;  1MF8 B;  1SKT A;  1S1E A;  4DS7 A;  1M31 A;  3H4S E;  2KI4 C;  3I5F C;  1QX7 A;  1NCY A;  2WND A;  2BKH B;  2LAP A;  2NLN A;  4D1E A;  1K90 D;  1ALW A;  3EKJ A;  1B47 A;  1SL9 A;  1X02 A;  2NCO A;  1ZAC A;  2K2A A;  3NSL A;  3WXA A;  2IS9 A;  1QVI Y;  4PHM A;  3O6B A;  3FIA A;  1L2O B;  1KK8 C;  1SCM C;  4QJ4 B;  5HYD A;  1SL8 A;  1R6P A;  2QAC A;  1JF2 A;  1RRO A;  2HET A;  4NDB A;  1SW8 A;  2BCX A;  2KHN A;  4I5J A;  2LNK A;  4A4B A;  3FWB A;  3BXK A;  4HSZ A;  3BYA A;  1JSA A;  5HLV A;  2ZN9 A;  2KYC A;  2WC8 A;  4DUQ A;  5J3X A;  1XFZ O;  1TRF A;  5DKN A;  1EL4 A;  3D10 A;  2OTG C;  2M7N A;  2O60 A;  1SMG A;  2K7O A;  2F2P A;  3C1V A;  3I5G B;  4OVN F;  4PDZ A;  2KBI A;  4MN0 A;  1JFJ A;  2HF5 A;  4NDC A;  2K61 A;  2LP3 A;  1XFX O;  2JTZ A;  5AEQ A;  1S26 D;  2L4I A;  1J7R A;  1ZUZ A;  1UHH A;  3I5I C;  1U5I A;  2L5X B;  1REC A;  2FCD A;  1S6J A;  1XFU O;  3VGO A;  2L51 A;  2I7A A;  1WDC B;  1CFD A;  2H2K A;  2KAV A;  1NPQ A;  2JQ6 A;  5AFP A;  4TNC A;  1IWQ A;  1FI6 A;  1QV0 A;  1BG1 A;  1F54 A;  1DGU A;  1MR8 A;  1SNL A;  4MZJ A;  3CWG A;  1KSO A;  2CT9 A;  4MZK A;  2BCB A;  4ZCU A;  5B8I B;  1YRT B;  4AOM A;  1CM4 A;  1FBV A;  1OSA A;  1WLM A;  2KGB C;  4PCW A;  1HQV A;  1J7P A;  3GK1 A;  4L9M A;  4FTG A;  1GJY A;  1BLQ A;  1ODB A;  1TTX A;  2EHB A;  5KSZ A;  4E68 A;  4OV2 A;  1B7T Z;  1CLL A;  1KFU S;  1U5I B;  1V1G A;  2EGD A;  4WRI A;  2JXL A;  1Y6W A;  2E6W A;  2WOS A;  1DGV A;  5AAN A;  1YR5 A;  3EVV A;  2MBX A;  2B1U A;  4OR9 B;  2Y1N A;  1SR6 C;  1TNW A;  2JPT A;  1ZOT B;  1XFW O;  1AJ5 A;  2BBN A;  5ER4 X;  1UUS A;  2PVB A;  3OX6 A;  2KDH A;  5ER5 A;  4GFT A;  2WOR A;  2HQW A;  1K9K A;  3OHM B;  5CSJ A;  1FF1 A;  2LP2 A;  2VRG A;  1EH2 A;  1K8U A;  2LC5 A;  1UHK A;  4DRW A;  2ZN8 A;  3BQ3 A;  3GOF A;  1DJH A;  2EC6 C;  1JWD A;  1NX3 A;  1F55 A;  3FS7 A;  5TNC A;  1J1E A;  1PSB A;  2LCP A;  2LMV A;  2JTT A;  1DTL A;  1B8C A;  5KU1 A;  2LLT A;  4P2Y B;  2G2B A;  4PE1 A;  3RM1 A;  4N5X A;  4MLW A;  3SIB A;  1EJ3 A;  1NCX A;  2M9G A;  5I8N A;  1NX0 A;  1DJY A;  1PVA A;  1DJW A;  2PAS A;  1JUO A;  3NXA A;  1S6I A;  3TUY B;  1Y1A A;  4PE0 A;  2M29 A;  2BEC A;  2ZFD A;  1J7O A;  3EK8 A;  2JUL A;  1MWN A;  4YGE B;  2NZ0 A;  2LMT A;  4U8D A;  2M97 A;  1UHN A;  1B9A A;  2ISD A;  4CFR A;  1AJ4 A;  2ZRS A;  1J7Q A;  1KWO C;  2K7B A;  2LHI A;  1J55 A;  1A2X A;  3WHU B;  3PN7 B;  2AMI A;  1IG5 A;  3MSE B;  2D8N A;  3CR2 A;  1BT6 A;  3BUW B;  3KF9 A;  2AAO A;  1MHO A;  1F4O A;  1CDM A;  1CLB A;  3SG3 A;  1LA3 A;  1S6C A;  1FI5 A;  1L2O C;  4HRH A;  1SL7 A;  4XYN A;  1MXE A;  1ZFS A;  2BE6 A;  3RLZ A;  3DF0 A;  2R2I A;  1A03 A;  4I5N B;  3DVM A;  1DF0 B;  1OMV A;  2PMY A;  2JWW A;  3TDU A;  1QX2 A;  3OB2 B;  1GGZ A;  1RTP 1;  2WCF A;  2E30 A;  2K7C A;  4PE4 A;  2H61 C;  4ORB B;  1C7W A;  1M45 A;  3KEV A;  2BCA A;  1VRK A;  1NIW A;  2KI4 B;  1H4B A;  3I5F B;  1F8H A;  3BUM B;  3CGA A;  1PAL A;  1PRW A;  1F70 A;  3IQQ A;  4JWQ A;  2AUC A;  1AK8 A;  3K21 A;  1CKK A;  3PSR A;  1PUL A;  3OX5 A;  1Y1X A;  2KAY A;  2BL0 C;  2L2E A;  3DF0 B;  3JVT B;  1B8R A;  1K9P A;  1YUR A;  2SAS A;  2LMU A;  1KQM B;  1XK4 C;  1WDC C;  4PE7 A;  2NCP A;  4AQJ A;  1GQM A;  1KFX S;  1J1D A;  1IRJ A;  2LVJ A;  1K93 D;  1YUT A;  1S5G Z;  2HPS A;  2MLE C;  1XFY O;  2CTN A;  3HCM A;  4M2Q A;  3GK2 A;  1YRU B;  5I2L A;  4JQ0 D;  4ORC B;  4I5L B;  3SG6 A;  5G08 A;  4DCK A;  2CXJ A;  2GGZ A;  5I2O A;  4USL A;  1QLK A;  4MRX A;  2M7L A;  5IBW A;  2TN4 A;  2K8M B;  4PHJ A;  1AVS A;  4MZL A;  4HRG A;  5BPJ A;  1N2D A;  2M1K B;  2RGI A;  1TOP A;  2K0J A;  1B7T Y;  1PVB A;  1TIZ A;  1DJI A;  3I5I B;  1KFU L;  3TZ1 A;  1D1O A;  1A29 A;  3JTD C;  3TDI A;  2KNE A;  1M39 A;  1TNQ A;  2KYF A;  5HKW A;  3NSK A;  3BUN B;  1A4P A;  1G33 A;  4GUK A;  1BOC A;  1WLZ A;  2FOT A;  2FCE A;  4YBH B;  2OS8 B;  2ZND A;  2BE4 A;  3CZT X;  4HRE E;  5HLO A;  4FQO A;  1QJT A;  5I2Q A;  3BUX B;  2KI6 D;  4GGN A;  3CS1 A;  3DD4 A;  1N65 A;  1DJX A;  3IQO A;  3LK1 A;  2P6B B;  1IJ5 A;  2M49 B;  1IGV A;  1UHI A;  1AP4 A;  3TS5 B;  4ORA B;  1NCZ A;  1QLS A;  3DVE A;  3PM8 A;  4P5O E;  2F33 A;  1BMO A;  3CR5 X;  1YX8 A;  4UPG A;  1DT7 B;  2JT0 A;  4GGF A;  1EXR A;  2JNX A;  1NWD A;  3SIA A;  4GAO A;  1IQ5 A;  4N1G A;  1NSH A;  1S3P A;  4N1F A;  5CPV A;  1ALV A;  3I5H B;  2PSR A;  1TNP A;  2ZKM X;  3DVJ A;  3AKA A;  1CDP A;  4MRY A;  3EVU A;  2L98 A;  1S36 A;  5AXI A;  4ETO A;  1CMF A;  1K9U A;  1GGW A;  2PRU A;  3AAJ A;  5CSI A;  1B1G A;  1QV1 A;  3ZNI A;  1BR1 B;  1NP8 A;  1CLM A;  1RFJ A;  4WQ2 A;  1KCY A;  4GBA A;  3PAT A;  2O5G A;  4MBE A;  4YI9 A;  1LKJ A;  1PSR A;  3PFV A;  1CFP A;  2EC6 B;  1BF5 A;  1B4C A;  2L4H A;  1CFC A;  4Q04 A;  1C07 A;  4PHK A;  1H8B A;  4YRU A;  1CM1 A;  5KTY A;  3KPX A;  1KK7 Y;  3PN7 C;  3EK4 A;  5DKR A;  1PK0 D;  3BUO B;  5D7F A;  4JPZ B;  2COL B;  1QAT A;  3CR4 X;  1G4Y R;  1M63 B;  2MRD A;  1SYM A;  1KSM A;  2JU0 A;  1OMD A;  4IL1 A;  3CLN A;  2I94 A;  3D0Y A;  5CSN A;  1OQP A;  2MA2 A;  2F2O A;  1QX5 B;  3WHT B;  1CB1 A;  4C0L A;  3E3R A;  2LLU A;  3LLE A;  4ICB A;  1UUR A;  2CCM A;  2LVK A;  1YVL A;  1WY9 A;  2JT8 A;  3NSI A;  4PHN A;  1CNP A;  4BY5 A;  2KFF A;  1YTZ C;  4I5K A;  4OCI A;  1IJ6 A;  3F45 A;  1IH0 A;  1QS7 A;  2JC2 A;  2JZI A;  4R1E A;  1A75 A;  1UWO A;  3AKB A;  1SBJ A;  4XJK A;  1WRZ A;  2H61 A;  3CTN A;  1XFV O;  4NDD A;  3SG7 A;  4M2P A;  2M1U A;  1BU3 A;  5GQQ C;  2GV5 A;  2JRF A;  1LA0 A;  2FJU B;  2MJW B;  3EK7 A;  1LIN A;  3I5G C;  3SG5 A;  2KSP A;  3D0Y B;  2Y4Q A;  4OKH A;  1F4Q A;  2MAZ A;  1K94 A;  4GNK B;  2KQ6 A;  2KFH A;  1QVI Z;  5DKQ A;  4CID A;  1N0Y A;  3JVT C;  1LVC D;  1NYA A;  1SY9 A;  5AER A;  1KK8 B;  3OP0 A;  1QTX A;  1KQM C;  1SCM B;  1XK4 A;  2OPO A;  1G8I A;  3VRP A;  1BJF A;  1TCF A;  1UHJ A;  1ZMZ A;  1KFX L;  1SRA A;  2LVV A;  1MXL C;  1S5G Y;  1NX2 A;  1QIV A;  3BOW A;  1A75 B;  1QIW A;  1QXP A;  2KFG A;  4C0K A;  5HKY A;  2LV7 A;  4XJK B;  1IKU A;  3GK4 X;  1JF0 A;  4C0J A;  1CDN A;  3M0W A;  2OTG B;  5JJG A;  1XA5 A;  1DVI A;  4ZCV A;  1IQ3 A;  5CSF A;  2M3W A;  2QPT A;  1BR4 B;  2JXC A;  1W7J B;  2DOQ A;  1R2U A;  2LM5 A;  3HX4 A;  3O4Y A;  2BL0 B;  1Q80 A;  3A4U B;  1CTR A;  2JOJ A;  2KQY A;  3DVK A;  1YX7 A;  2LUX A;  3KO0 A;  4QJ3 B;  4WQ3 A;  1K2H A;  1DJG A;  1OE9 B;  1Y0V H;  1E8A A;  2LUC A;  4BY4 A;  2LAN A;  4F0Z B;  1FPW A;  3BOW B;  2OS8 C;  1F71 A;  2Y5I A;  2V53 A;  3SG2 A;  1LXF C;  1Y1U A;  2Q4U A;  1C7V A;  2KOT A;  3QRX A;  4MEW A;  1MQ1 A;  1TN4 A;  1SCV A;  1RJV A;  2M0R A;  4PAL A;  4YI8 A;  1YVH A;  3PLF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...