2P6BB

Crystal structure of human calcineurin in complex with pvivit peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
146
structure length
146
Chain Sequence
b'DADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PVIVIT 14-mer Peptide
publication title Structure of calcineurin in complex with PVIVIT peptide: Portrait of a low-affinity signalling interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 54
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2p6bB00
2KI6D 1IG5A 3D0YB 1IJ5A 2JTZA 2D8NA 3CTNA 1CDLA 4CIDA 2M1UA 4AQIA 2AAOA 1SPYA 1NSHA 2SASA 4MEWA 2JOJA 1BT6A 1DJIA 1R2UA 4M2PA 3BOWA 1A75B 3GK2A 1CLMA 2GV5A 2TN4A 2M8UA 1S6IA 2LP2A 3KPXA 5G08A 2AMIA 3NSKA 4HSZA 1HQVA 3OB1B 1WY9A 1J55A 2BL0B 1YRUB 1M39A 1IQ3A 1MXEA 1EG4A 1QV1A 5DKQA 3WNXB 4C0KA 1QX7A 1FBVA 1J7OA 4HRHA 4YI8A 1DJGA 1K8UA 2BCXA 2IS9A 2LMUA 2ZNDA 3EKHA 4MZLA 3VRNA 2KAYA 4YRUA 4GGFC 1WLZA 1MQ1A 1ZOTB 1B1GA 3OHMB 1S36A 1FW4A 1L2OB 1M31A 2NLNA 5I2LA 1JWDA 3AAJA 1B8LA 1JF2A 1S6JA 1SBJA 1S26D 4A4BA 3TS5C 2KFGA 1BODA 3SJSA 2JZIA 1YURA 1B9AA 1SCVA 1ZUZA 2O60A 3VRRA 2M7NA 4I5KA 1RECA 1PSBA 1UURA 3NSOA 5KU1A 2OTGB 2RGIA 3SG7A 1AUIB 2M3WA 2LNKA 3AKBA 4PHMA 1NWDA 5AERA 1RWYA 4FQOA 2KI4B 3WXAA 2M1KB 3KO0A 1Y1UA 4ORCB 2LVKA 1SR6C 1DT7B 2FCDA 3NSIA 4GPLB 5CSFA 1M46A 1K9UA 1QS7A 2FCEA 3IF7A 1PVAA 1MUXA 5HKZA 1TTXA 2BBNA 2BL0C 1WDCB 4PHNA 5B8IB 2JNFA 1S5GZ 3VRPA 2LLUA 3TDIA 4XJKA 4MZJA 1C7WA 3I5FC 5BPJA 1ODBA 4MLWA 1SK6D 1L7ZA 2EC6B 2K0JA 1YRTB 3I5HC 4HRGA 1JFKA 2OPOA 4PCWA 1K9PA 2V53A 1BR1B 3SG4A 3GK4X 2Y1MA 3SG5A 2MLEC 3EK4A 4YBHB 1K95A 2I2RE 2ZNEA 1KSMA 1V1FA 1CDNA 1DJZA 1SRAA 2Q91A 3DVKA 1EJ3A 3ICBA 4CLNA 4AQJA 1EG3A 3D10A 4ORBB 2LLTA 1CKKA 2B1UA 4D1EA 1OZOA 3K21A 1BLQA 1OOJA 4GFTA 1GQMA 3I5IC 4YGDB 2K7BA 2KGBC 2WOSA 1CM1A 4YI9A 2CBLA 4OV2A 4CFQA 1BJFA 2LE9B 1OE9B 1R6PA 2PASA 2ZFDA 3DVMA 3TZ1A 1FPWA 1KSOA 1GGWA 2GGMA 2L51A 3VRQA 4ZCVA 2KNEA 2NCOA 3H4SE 1C7VA 2CNPA 1CB1A 1RK9A 1DJYA 1SKTA 3DVJA 4C0JA 4GAOA 4IL1A 1N0YA 1IKUA 2R2IA 1JFJA 2ZRSA 1PSRA 3O78A 1FI6A 1XFUO 2M0RA 1B8RA 3GK1A 5HLOA 3CS1A 2WCEA 1NIWA 4F0ZB 2Q4UA 3OX6A 2HETA 1RFJA 4BY4A 1A29A 1EL4A 4HREE 4OKHA 4PE7A 1A4PA 1NUBA 1A2XA 1TOPA 1LVCD 4M2QA 3PSRA 1DGVA 4GGFA 1LXFC 1SL8A 1ZACA 1OSAA 5F6TA 2KDHA 1CLLA 5CSNA 1F55A 1DVIA 3BOWB 5TNCA 1NCXA 3VROA 4L9MA 1WLMA 4QJ4B 1HT9A 3JTDB 4AOMA 1F4QA 3BUXB 1SCMB 1IH0A 2LUCA 1M45A 2DOQA 1BG1A 1X02A 1KFXS 1Y1AA 4M2OA 3BXKA 2KAVA 2BECA 1QIWA 1XFWO 2G9BA 4WQ2A 2OS8C 5FYXA 1CM4A 1QVIZ 2BCBA 3EK7A 3OB2B 2LV7A 2JNXA 4WQ3A 1KFXL 2PRUA 1QLKA 2EHBA 1NX1A 4U8DA 5CSJA 2ZN8A 3FWBA 1DGUA 1NCZA 2WORA 2JXLA 1XFXO 4DIRA 3BUOB 1NPQA 1KWOC 2PMYA 3EVUA 3HCMA 5KTYA 3ZNIA 2BKHB 3FIAA 5D69A 4YGAA 2KQYA 2F2PA 2JXCA 2F3YA 3JVTC 4OR9B 3TUYC 3PN7B 2WCBA 1YTZC 3CZTX 1BMOA 1MWNA 1UHNA 1LKJA 3AKAA 1YUUA 1YUTA 2VRGA 4PE4A 1F8HA 1KK8C 1CMGA 3HX4A 1G4YR 1CFDA 4UPGA 5AEQA 2LCPA 3PATA 1C07A 1IJ6A 2EGDA 4ETOA 2QPTA 1KQMB 1EH2A 2KBIA 4Q04A 2I94A 2LVJA 4DCKA 1NX2A 1SMGA 2HQ8A 1SCMC 3CGAA 2KFFA 3M0WA 4MVFA 1DF0A 1K90D 1XK4C 2WCFA 5I8NA 2L50A 1KFUS 1S1EA 3F45A 1TCFA 2CTNA 3MSEB 2LHIA 3O6BA 4XJKB 1QVIY 1S3PA 3SG2A 1J7QA 2KSPA 2KFHA 2LUXA 2ZRTA 4I5JA 3KHEA 1NCYA 3I5GB 3DVEA 4PALA 2JT8A 1BU3A 1YVLA 1UHHA 1PALA 1KFUL 2JRFA 3EVRA 1YX8A 2Y5IA 1B7TZ 3C1VA 4NDBA 3BQ3A 3CR5X 1QTXA 3RM1A 1UWOA 5I2QA 1SL9A 1TNQA 1L2OC 2JULA 3WHUB 3DD4A 3E3RA 2MJWB 1CNPA 1K96A 5DKNA 1OZSA 1FF1A 3OX5A 4NDDA 2WC8A 4JWQA 4MBEA 5J3XA 3O2PA 2ZN9A 1MF8B 2HF5A 2LC5A 5I2OA 2OTGC 2MRDA 3CR4X 5D7FA 1IQ5A 1D1OA 1XFZO 2H61C 3FWCA 4CFRA 4QJ5B 2JTTA 4C0LA 2KI4C 3PALA 1XFVO 3OP0A 4PE1A 3A4UB 2ISDA 1M63B 2E30A 1U5IA 2CXJA 1A03A 1AVSA 3WHTB 2KBMA 2KQ6A 2BCAA 1B8CA 2F33A 3DF0B 4ORAB 1W7JB 1CLBA 2L2EA 1SW8A 3DF0A 2KAXA 3CR2A 3EVVA 1J1EA 3GOFA 5DKRA 1G33A 1WDCC 2LLSA 1CFFA 1WRLA 3O4YA 2MAZA 3PFVA 1IGVA 2JQ6A 3BUWB 4MN0A 1TNPA 1J1DA 5IBWA 3I5GC 1K2HA 5ER5A 3PLFB 4XYNA 1B7TY 2HQWA 1XA5A 4N1GA 1F54A 2I7AA 2EC6C 3KEVA 2FOTA 4P2YB 1SY9A 2KGRA 2NZ0A 3LK1A 3SIBA 1RJVA 3QRXA 1FI5A 5CSIA 1CDMA 1CDPA 1PRWA 2K7CA 4JQ0D 4QJ3B 3TS5B 4JPZB 4PHKA 4CPVA 2K8MB 5CPVA 5HYDA 2PVBA 3IQOA 2MA2A 3VGOA 5JJGA 2JWWA 1JBAA 2F2OA 1B4CA 3FS7A 1JC2A 4YGCB 1IWQA 1QV0A 3D0YA 2LMTA 2Y4QA 1YX7A 1GJYA 1SYMA 3LK0A 1XYDA 1MXLC 1N2DA 3LL8B 1ALVA 5HKWA 1SR6B 1V1GA 2M49B 4I5LB 4OVNF 1G8IA 2M7LA 4BY5A 4PDZA 1ALWA 4NDCA 1TNWA 3IQQA 1A75A 2M97A 1AHRA 2K61A 5JOLA 2L4IA 5HKYA 1XK4A 1AJ4A 1QXPA 2LAPA 1OMDA 2BE4A 4MZKA 4FTGA 1KK7Z 1TIZA 2BKIB 2LVIA 4YGBB 1QLSA 5AXIA 1AP4A 3I5FB 3KF9A 1TRFA 1K9KA 2L5XB 1BOCA 2K2FA 3EK8A 3PM8A 1UHJA 1MR8A 1CTRA 1RTP1 1QX2A 3I5HB 2JU0A 2AUCA 1DJHA 1LA0A 2GGZA 1CFPA 2JC2A 4GBAA 1WRKA 1SL7A 4N5XA 2BE6A 4DUQA 2JT0A 3CLNA 2LMVA 2KI6C 1DTLA 3JTDC 2NXQA 1DF0B 1OQPA 4USLA 5AANA 1AJ5A 1Y0VH 1Y1XA 4MRXA 1KCYA 1UP5A 3I5IB 2QACA 1PK0D 2JT3A 2PALA 3SG6A 2G2BA 2L4HA 2H2KA 1E8AA 2Y1NA 5PALA 1DJWA 2M9GA 3BUMB 4GGNA 1JSAA 1QATA 2H61A 3SG3A 2K7DA 2LVVA 2KYCA 1NYAA 2SCPA 3A8RA 1K94A 1F71A 2P6BB 2MLFC 1KQVA 1RROA 5GQQC 3ZWHA 2JPTA 1W7IB 1XO5A 1ZMZA 2F8PA 2MBXA 1OMRA 1F4OA 1N65A 3AAKA 4PE0A 2WNDA 2PSRA 1KK7Y 1BR4B 2MHHA 4TNCA 1JUOA 4WRIA 3NSLA 1QIVA 1QASA 1YVHA 3PN7C 2KHNA 1F70A 1Y6WA 2I18A 3RLZA 3EKJA 1SNLA 1DMOA 1WRZA 4NQGA 1TCOB 4N1FA 4GUKA 1CMFA 5HLVA 3LLEA 1J7PA 1TNXA 3BUNB 1AK8A 2O5GA 1H8BA 4OCIA 2KYFA 1YUSA 1KQMC 1LA3A 4I5NB 1K93D 2CT9A 2KOTA 1U5IB 4MRYA 2K2AA 2FJUB 1NX3A 1PVBA 4PHJA 4R1EA 2COLB 4DRWA 1J7RA 1VRKA 5K89A 4GNKB 2NCPA 1NX0A 2LP3A 3NXAA 2LM5A 2OS8B 1NP8A 4A4CA 4DS7A 1LINA 3LCPC 1MHOA 1XFYO 2L98A 1DJXA 4E68A 1PULA 1JF0A 1CFCA 1UHIA 5AFPA 2F3ZA 3TDZA 4MSPA 1S6CA 5KSZA 1ZFSA 2LHLA 1BF5A 4ZCUA 1UUSA 2ZKMX 1KWOB 1B47A 2HPSA 2LANA 4P5OE 2L0PA 2M29A 1OMVA 1QJTA 4YGEB 1EXRA 1YR5A 2E6WA 3TDUA 1Q80A 1S5GY 3JVTB 5ER4X 2BBMA 3TUYB 1H4BA 1GGZA 1UHKA 2A4JA 1QX5B 1TN4A 3CWGA 2CCMA 4ICBA 3BYAA 1XVJA 2K7OA 1KK8B 1IRJA 3SIAA
chains in the Genus database with same CATH superfamily
2KI6D 1IG5A 3D0YB 1IJ5A 2JTZA 2D8NA 3CTNA 1CDLA 4CIDA 2M1UA 4AQIA 2AAOA 1SPYA 1NSHA 2SASA 4MEWA 1Z4HA 2JOJA 1BT6A 1DJIA 1R2UA 2P70A 3BOWA 4M2PA 4FQTA 1A75B 3GK2A 1CLMA 2GV5A 4IJ7A 2TN4A 2M8UA 1S6IA 2LP2A 3KPXA 5G08A 2AMIA 3NSKA 4HSZA 1HQVA 1OOFA 3OB1B 1WY9A 1J55A 2BL0B 2YGUA 1YRUB 1M39A 3PM2A 1IQ3A 1MXEA 1EG4A 1QV1A 5DKQA 3WNXB 3IVTA 1QX7A 4C0KA 1FBVA 1J7OA 3B86A 4HRHA 4YI8A 1OOHA 1DJGA 1K8UA 2BCXA 2IS9A 2JPOA 2LMUA 2ZNDA 3EKHA 4MZLA 3VRNA 2KAYA 4YRUA 4GGFC 1WLZA 1MQ1A 1ZOTB 3RZSA 1B1GA 5I94A 3OHMB 1S36A 1FW4A 1L2OB 1M31A 2NLNA 5I2LA 1JWDA 3CZ1A 3AAJA 1B8LA 1JF2A 5HL1A 1S6JA 1SBJA 1S26D 4A4BA 3TS5C 2KFGA 1Z2CB 1BODA 3SJSA 2JZIA 1YURA 1B9AA 1SCVA 1ZUZA 2O60A 3VRRA 2M7NA 4I5KA 1RECA 1PSBA 1UURA 3NSOA 2WC5A 5KU1A 2OTGB 2RGIA 3SG7A 1AUIB 2M3WA 2LNKA 3AKBA 4PHMA 2QEHA 1NWDA 5AERA 1RWYA 3B88A 4FQOA 2KI4B 3WXAA 2M1KB 3KO0A 1Y1UA 4ORCB 2LVKA 1SR6C 1DT7B 2FCDA 3NSIA 4GPLB 5CSFA 1M46A 1K9UA 1QS7A 2FCEA 3DXLA 3IF7A 1PVAA 1MUXA 5HKZA 3OGNA 1TTXA 2BBNA 2BL0C 1WDCB 4PHNA 5B8IB 2JNFA 1S5GZ 3DYEA 2LLUA 3VRPA 3TDIA 1C3YA 4XJKA 4MZJA 1C7WA 3I5FC 5BPJA 1ODBA 4MLWA 3D73A 1SK6D 1L7ZA 2EC6B 2K0JA 1YRTB 3I5HC 5EL2A 4HRGA 1JFKA 2OPOA 4PCWA 1K9PA 2V53A 1BR1B 3SG4A 3GK4X 2Y1MA 3SG5A 2MLEC 3EK4A 4YBHB 3FE6A 3FE8A 1K95A 2I2RE 2ZNEA 1KSMA 1V1FA 1CDNA 1DJZA 1SRAA 2Q91A 3DVKA 1EJ3A 3ICBA 4CLNA 4AQJA 1EG3A 3D10A 4ORBB 2FJYA 2LLTA 3S0AA 1CKKA 2B1UA 4D1EA 1OZOA 3K21A 1BLQA 1OOJA 3D74A 4GFTA 1GQMA 2WCKA 3I5IC 4YGDB 4PT1A 2K7BA 2KGBC 2WOSA 1CM1A 4YI9A 2CBLA 4OV2A 4CFQA 1BJFA 2LE9B 1OE9B 1R6PA 2PASA 2ZFDA 3DVMA 3TZ1A 1FPWA 1KSOA 1GGWA 2GGMA 2L51A 3VRQA 4ZCVA 2KNEA 2NCOA 3H4SE 1C7VA 2CNPA 1CB1A 1RK9A 1DEKA 3L47A 4F7FA 1DJYA 1SKTA 3DVJA 4C0JA 4GAOA 4IL1A 1N0YA 1IKUA 2BAPA 2R2IA 2ZRSA 1JFJA 1PSRA 3O4XA 3O78A 1FI6A 1XFUO 2M0RA 1B8RA 3GK1A 5HLOA 1TUJA 3CS1A 2WCEA 1NIWA 4JKTA 4F0ZB 2Q4UA 3OX6A 2HETA 1RFJA 4KYNA 4BY4A 1A29A 1EL4A 2PYQA 4HREE 4OKHA 4PE7A 1A4PA 1NUBA 1A2XA 1TOPA 3D75A 1LVCD 4M2QA 3CZ0A 3PSRA 3UNWA 3SS4A 1DGVA 4GGFA 1LXFC 1SL8A 1ZACA 3S0GA 1OSAA 5F6TA 2KDHA 2WCJA 1CLLA 5CSNA 1F55A 4OZDA 1DVIA 3BOWB 5TNCA 1NCXA 3L4AA 3BFBA 1WLMA 4L9MA 3VROA 1HT9A 3JTDB 4QJ4B 1P28A 1F4QA 3BUXB 1SCMB 4AOMA 2LUCA 1IH0A 1OOGA 1M45A 2DOQA 1DC1A 1BG1A 1X02A 1KFXS 1Y1AA 4M2OA 3BXKA 1OW4A 3S0DA 2GTEA 2BECA 2KAVA 1QIWA 1XFWO 2G9BA 4WQ2A 2OS8C 5FYXA 1CM4A 1QVIZ 2BCBA 3EK7A 3OB2B 2LV7A 2JNXA 4WQ3A 1IIOA 1KFXL 2PRUA 1QLKA 2EHBA 1NX1A 4U8DA 5CSJA 2ZN8A 3FWBA 1DGUA 1NCZA 2WORA 2JXLA 1XFXO 4DIRA 3BUOB 1NPQA 3V2LA 1KWOC 1XFRA 2PMYA 3EVUA 3HCMA 5KTYA 3ZNIA 3CDNA 2BKHB 3FIAA 5D69A 4YGAA 4INWA 2KQYA 2F2PA 2JXCA 3B6XA 2F3YA 3JVTC 4OR9B 3TUYC 2QDIA 3PN7B 2WCBA 1YTZC 3CZTX 3EG5B 1BMOA 1MWNA 1UHNA 1LKJA 3AKAA 1YUUA 1YUTA 2VRGA 4PE4A 1F8HA 3R1OA 1KK8C 1CMGA 3HX4A 1G4YR 1CFDA 4UPGA 5AEQA 2LCPA 3PATA 1C07A 1IJ6A 2EGDA 4ETOA 2QPTA 1KQMB 3L4LA 2KBIA 1EH2A 4Q04A 2I94A 3N7HA 2LVJA 4DCKA 1NX2A 1SMGA 2HQ8A 1SCMC 3CGAA 2KFFA 3M0WA 4MVFA 1DF0A 1K90D 1XK4C 2WCFA 5I8NA 2L50A 1KFUS 1S1EA 3F45A 1TCFA 2CTNA 3MSEB 2LHIA 3O6BA 4XJKB 1QVIY 1S3PA 3SG2A 1J7QA 2KSPA 2KFHA 2LUXA 2ZRTA 4I5JA 3KHEA 1NCYA 1DELA 5FI7A 3I5GB 3DVEA 2WCLA 4PALA 2JT8A 1BU3A 1YVLA 1UHHA 1PALA 1KFUL 2JRFA 2L2CA 3EVRA 1YX8A 2Y5IA 1B7TZ 3C1VA 4NDBA 3BQ3A 3CR5X 1QTXA 3RM1A 1UWOA 5I2QA 1SL9A 1TUZA 1C3ZA 1TNQA 1L2OC 2JULA 3WHUB 1LS8A 2L5YA 2MJWB 3DD4A 3E3RA 1K96A 5DKNA 1OZSA 1CNPA 1FF1A 3OX5A 2KPHA 2H8VA 4NDDA 2WC8A 4JWQA 4MBEA 3B87A 5J3XA 3O2PA 2ZN9A 3SS3A 1MF8B 2HF5A 2LC5A 5I2OA 2OTGC 2BNXA 2MRDA 3CR4X 5D7FA 1IQ5A 3NGVA 1XFZO 1D1OA 2KLDA 2H61C 3FWCA 4CFRA 4QJ5B 2JTTA 4C0LA 2KI4C 2QEOA 3Q8IA 3PALA 1XFVO 3OP0A 4PE1A 3A4UB 2ISDA 1M63B 2E30A 1U5IA 2CXJA 1A03A 1AVSA 3WHTB 2KBMA 2KQ6A 2BCAA 1B8CA 2F33A 3DF0B 1DQEA 1W7JB 4ORAB 2L2EA 1CLBA 1SW8A 3DF0A 2KAXA 3CR2A 3EVVA 1J1EA 3GOFA 5DKRA 1G33A 1WDCC 2LLSA 1CFFA 5FI6A 1WRLA 5DICA 3O4YA 2MAZA 2QEBA 3PFVA 1IGVA 1W9ZA 2JQ6A 3BUWB 4MN0A 1TNPA 1J1DA 5IBWA 3I5GC 1K2HA 5ER5A 3PLFB 4XYNA 1B7TY 2HQWA 3NHIA 5D3OA 1XA5A 4N1GA 1F54A 2I7AA 2EC6C 3KEVA 3CZ2A 2FOTA 4P2YB 1SY9A 2KGRA 2NZ0A 3DZTA 3LK1A 3SIBA 1RJVA 3QRXA 1FI5A 5CSIA 1CDMA 3QMEA 1CDPA 1PRWA 2K7CA 4JQ0D 4QJ3B 3TS5B 4JPZB 3B7AA 3CABA 4PHKA 4CPVA 2K8MB 5CPVA 5HYDA 2PVBA 3IQOA 2MA2A 3VGOA 5JJGA 2JWWA 1JBAA 2F2OA 1B4CA 3FS7A 1JC2A 4YGCB 1IWQA 1QV0A 3D0YA 2LMTA 2Y4QA 2KLEA 1YX7A 1GJYA 3D77A 1SYMA 3LK0A 1XYDA 1MXLC 1N2DA 3LL8B 1ALVA 5HKWA 1SR6B 1V1GA 2M49B 4I5LB 4OVNF 1G8IA 2M7LA 4BY5A 4PDZA 1ALWA 4NDCA 1TNWA 3IQQA 1A75A 2M97A 3CYZA 1AHRA 2K61A 3PJIA 5JOLA 2L4IA 5HKYA 1XK4A 1AJ4A 1QXPA 2LAPA 1OMDA 2BE4A 1OOIX 4FTGA 4MZKA 1KK7Z 1TIZA 1T14A 2BKIB 2LVIA 4YGBB 1QLSA 5AXIA 1AP4A 3I5FB 3KF9A 1TRFA 1K9KA 2L5XB 3S0EA 2K2FA 3EK8A 3PM8A 1BOCA 1UHJA 1MR8A 1CTRA 1RTP1 1QX2A 3I5HB 2JU0A 2AUCA 1DJHA 1LA0A 2GGZA 1CFPA 2JC2A 4GBAA 1WRKA 1SL7A 4N5XA 2BE6A 3BJHA 4INXA 2JT0A 4DUQA 3CLNA 2LMVA 2KI6C 1DTLA 3JTDC 2NXQA 1DF0B 1OQPA 2PQLA 4USLA 5AANA 1AJ5A 1Y0VH 1Y1XA 3BFHA 4MRXA 1UP5A 1KCYA 3I5IB 2QACA 3NHTA 1PK0D 2JT3A 2PALA 3SG6A 2G2BA 2L4HA 2H2KA 1E8AA 2WCHA 2Y1NA 5PALA 1DJWA 2M9GA 3BUMB 4GGNA 2QEVA 1JSAA 1QATA 2H61A 3SG3A 2K7DA 2LVVA 2KYCA 1NYAA 2SCPA 3A8RA 5FI2A 1K94A 1F71A 2P6BB 2MLFC 3R72A 1KQVA 1RROA 5GQQC 3ZWHA 2JPTA 1W7IB 3S0BA 1XO5A 1ZMZA 2F8PA 2MBXA 1OMRA 1F4OA 1N65A 3AAKA 4PE0A 3OBVA 2WNDA 2PSRA 1KK7Y 1BR4B 2MHHA 4TNCA 1JUOA 3R1VA 4WRIA 3NSLA 1QIVA 2WCMA 1QASA 1YVHA 3PN7C 2KHNA 1F70A 1Y6WA 2I18A 1GM0A 4JD9A 3RLZA 3EKJA 1SNLA 1DMOA 1WRZA 3FE9A 4NQGA 1TCOB 4N1FA 4GUKA 1CMFA 5HLVA 3LLEA 1J7PA 1TNXA 1TWOA 3BUNB 1AK8A 2O5GA 1H8BA 4OCIA 2KYFA 1YUSA 1KQMC 1LA3A 4I5NB 1K93D 2CT9A 2KOTA 3BFAA 1U5IB 4MRYA 2K2AA 2FJUB 1NX3A 1PVBA 3K1EA 4PHJA 4R1EA 2COLB 2WC6A 3UO9A 4DRWA 1J7RA 1VRKA 5K89A 4GNKB 2NCPA 1NX0A 2LP3A 2K60A 2LM5A 3D78A 2OS8B 3NXAA 1NP8A 4A4CA 4DS7A 1LINA 1ORGA 1MHOA 1XFYO 2L98A 3LCPC 1DJXA 2P71A 4E68A 1PULA 1JF0A 1CFCA 2ERBA 1UHIA 5AFPA 2F3ZA 3TDZA 3R1PA 4MSPA 1S6CA 5KSZA 1ZFSA 1SSEB 2LHLA 1BF5A 3S0FA 4ZCUA 1UUSA 2ZKMX 1KWOB 1B47A 2HPSA 3SS5A 2LANA 4P5OE 2L0PA 2M29A 3D76A 1OMVA 1QJTA 4YGEB 1EXRA 1YR5A 2E6WA 3TDUA 1Q80A 1S5GY 3JVTB 5ER4X 1QWVA 2BBMA 3TUYB 1H4BA 3VB1A 1GGZA 1UHKA 2A4JA 1QX5B 1TN4A 3CWGA 2CCMA 4ICBA 3BYAA 1XVJA 2K7OA 1KK8B 1IRJA 3SIAA 3DY9A
chains in the Genus database with same CATH topology
2KI6D 1IG5A 3D0YB 1IJ5A 2JTZA 2D8NA 3CTNA 1CDLA 4CIDA 2M1UA 4AQIA 2AAOA 1SPYA 1NSHA 2SASA 4MEWA 2JOJA 1BT6A 1DJIA 1R2UA 4M2PA 3BOWA 1A75B 3GK2A 1CLMA 2GV5A 2TN4A 2M8UA 1S6IA 2LP2A 3KPXA 5G08A 2AMIA 3NSKA 4HSZA 1HQVA 3OB1B 1WY9A 1J55A 2BL0B 1YRUB 1M39A 1IQ3A 1MXEA 1EG4A 1QV1A 5DKQA 3WNXB 4C0KA 1QX7A 1FBVA 1J7OA 4HRHA 4YI8A 1DJGA 1K8UA 2BCXA 2IS9A 2LMUA 2ZNDA 3EKHA 4MZLA 3VRNA 2KAYA 4YRUA 4GGFC 1WLZA 1MQ1A 1ZOTB 1B1GA 3OHMB 1S36A 1FW4A 1L2OB 1M31A 2NLNA 5I2LA 1JWDA 3AAJA 1B8LA 1JF2A 1S6JA 1SBJA 1S26D 4A4BA 3TS5C 2KFGA 1BODA 3SJSA 2JZIA 1YURA 1B9AA 1SCVA 1ZUZA 2O60A 3VRRA 2M7NA 4I5KA 1RECA 1PSBA 1UURA 3NSOA 5KU1A 2OTGB 2RGIA 3SG7A 1AUIB 2M3WA 2LNKA 3AKBA 4PHMA 1NWDA 5AERA 1RWYA 4FQOA 2KI4B 3WXAA 2M1KB 3KO0A 1Y1UA 4ORCB 2LVKA 1SR6C 1DT7B 2FCDA 3NSIA 4GPLB 5CSFA 1M46A 1K9UA 1QS7A 2FCEA 3IF7A 1PVAA 1MUXA 5HKZA 1TTXA 2BBNA 2BL0C 1WDCB 4PHNA 5B8IB 2JNFA 1S5GZ 3VRPA 2LLUA 3TDIA 4XJKA 4MZJA 1C7WA 3I5FC 5BPJA 1ODBA 4MLWA 1SK6D 1L7ZA 2EC6B 2K0JA 1YRTB 3I5HC 4HRGA 1JFKA 2OPOA 4PCWA 1K9PA 2V53A 1BR1B 3SG4A 3GK4X 2Y1MA 3SG5A 2MLEC 3EK4A 4YBHB 1K95A 2I2RE 2ZNEA 1KSMA 1V1FA 1CDNA 1DJZA 1SRAA 2Q91A 3DVKA 1EJ3A 3ICBA 4CLNA 4AQJA 1EG3A 3D10A 4ORBB 2LLTA 1CKKA 2B1UA 4D1EA 1OZOA 3K21A 1BLQA 1OOJA 4GFTA 1GQMA 3I5IC 4YGDB 2K7BA 2KGBC 2WOSA 1CM1A 4YI9A 2CBLA 4OV2A 4CFQA 1BJFA 2LE9B 1OE9B 1R6PA 2PASA 2ZFDA 3DVMA 3TZ1A 1FPWA 1KSOA 1GGWA 2GGMA 2L51A 3VRQA 4ZCVA 2KNEA 2NCOA 3H4SE 1C7VA 2CNPA 1CB1A 1RK9A 1DJYA 1SKTA 3DVJA 4C0JA 4GAOA 4IL1A 1N0YA 1IKUA 2R2IA 1JFJA 2ZRSA 1PSRA 3O78A 1FI6A 1XFUO 2M0RA 1B8RA 3GK1A 5HLOA 3CS1A 2WCEA 1NIWA 4F0ZB 2Q4UA 3OX6A 2HETA 1RFJA 4BY4A 1A29A 1EL4A 4HREE 4OKHA 4PE7A 1A4PA 1NUBA 1A2XA 1TOPA 1LVCD 4M2QA 3PSRA 1DGVA 4GGFA 1LXFC 1SL8A 1ZACA 1OSAA 5F6TA 2KDHA 1CLLA 5CSNA 1F55A 1DVIA 3BOWB 5TNCA 1NCXA 3VROA 4L9MA 1WLMA 4QJ4B 1HT9A 3JTDB 4AOMA 1F4QA 3BUXB 1SCMB 1IH0A 2LUCA 1M45A 2DOQA 1BG1A 1X02A 1KFXS 1Y1AA 4M2OA 3BXKA 2KAVA 2BECA 1QIWA 1XFWO 2G9BA 4WQ2A 2OS8C 5FYXA 1CM4A 1QVIZ 2BCBA 3EK7A 3OB2B 2LV7A 2JNXA 4WQ3A 1KFXL 2PRUA 1QLKA 2EHBA 1NX1A 4U8DA 5CSJA 2ZN8A 3FWBA 1DGUA 1NCZA 2WORA 2JXLA 1XFXO 4DIRA 3BUOB 1NPQA 1KWOC 2PMYA 3EVUA 3HCMA 5KTYA 3ZNIA 2BKHB 3FIAA 5D69A 4YGAA 2KQYA 2F2PA 2JXCA 2F3YA 3JVTC 4OR9B 3TUYC 3PN7B 2WCBA 1YTZC 3CZTX 1BMOA 1MWNA 1UHNA 1LKJA 3AKAA 1YUUA 1YUTA 2VRGA 4PE4A 1F8HA 1KK8C 1CMGA 3HX4A 1G4YR 1CFDA 4UPGA 5AEQA 2LCPA 3PATA 1C07A 1IJ6A 2EGDA 4ETOA 2QPTA 1KQMB 1EH2A 2KBIA 4Q04A 2I94A 2LVJA 4DCKA 1NX2A 1SMGA 2HQ8A 1SCMC 3CGAA 2KFFA 3M0WA 4MVFA 1DF0A 1K90D 1XK4C 2WCFA 5I8NA 2L50A 1KFUS 1S1EA 3F45A 1TCFA 2CTNA 3MSEB 2LHIA 3O6BA 4XJKB 1QVIY 1S3PA 3SG2A 1J7QA 2KSPA 2KFHA 2LUXA 2ZRTA 4I5JA 3KHEA 1NCYA 3I5GB 3DVEA 4PALA 2JT8A 1BU3A 1YVLA 1UHHA 1PALA 1KFUL 2JRFA 3EVRA 1YX8A 2Y5IA 1B7TZ 3C1VA 4NDBA 3BQ3A 3CR5X 1QTXA 3RM1A 1UWOA 5I2QA 1SL9A 1TNQA 1L2OC 2JULA 3WHUB 3DD4A 3E3RA 2MJWB 1CNPA 1K96A 5DKNA 1OZSA 1FF1A 3OX5A 4NDDA 2WC8A 4JWQA 4MBEA 5J3XA 3O2PA 2ZN9A 1MF8B 2HF5A 2LC5A 5I2OA 2OTGC 2MRDA 3CR4X 5D7FA 1IQ5A 1D1OA 1XFZO 2H61C 3FWCA 4CFRA 4QJ5B 2JTTA 4C0LA 2KI4C 3PALA 1XFVO 3OP0A 4PE1A 3A4UB 2ISDA 1M63B 2E30A 1U5IA 2CXJA 1A03A 1AVSA 3WHTB 2KBMA 2KQ6A 2BCAA 1B8CA 2F33A 3DF0B 4ORAB 1W7JB 1CLBA 2L2EA 1SW8A 3DF0A 2KAXA 3CR2A 3EVVA 1J1EA 3GOFA 5DKRA 1G33A 1WDCC 2LLSA 1CFFA 1WRLA 3O4YA 2MAZA 3PFVA 1IGVA 2JQ6A 3BUWB 4MN0A 1TNPA 1J1DA 5IBWA 3I5GC 1K2HA 5ER5A 3PLFB 4XYNA 1B7TY 2HQWA 1XA5A 4N1GA 1F54A 2I7AA 2EC6C 3KEVA 2FOTA 4P2YB 1SY9A 2KGRA 2NZ0A 3LK1A 3SIBA 1RJVA 3QRXA 1FI5A 5CSIA 1CDMA 1CDPA 1PRWA 2K7CA 4JQ0D 4QJ3B 3TS5B 4JPZB 4PHKA 4CPVA 2K8MB 5CPVA 5HYDA 2PVBA 3IQOA 2MA2A 3VGOA 5JJGA 2JWWA 1JBAA 2F2OA 1B4CA 3FS7A 1JC2A 4YGCB 1IWQA 1QV0A 3D0YA 2LMTA 2Y4QA 1YX7A 1GJYA 1SYMA 3LK0A 1XYDA 1MXLC 1N2DA 3LL8B 1ALVA 5HKWA 1SR6B 1V1GA 2M49B 4I5LB 4OVNF 1G8IA 2M7LA 4BY5A 4PDZA 1ALWA 4NDCA 1TNWA 3IQQA 1A75A 2M97A 1AHRA 2K61A 5JOLA 2L4IA 5HKYA 1XK4A 1AJ4A 1QXPA 2LAPA 1OMDA 2BE4A 4MZKA 4FTGA 1KK7Z 1TIZA 2BKIB 2LVIA 4YGBB 1QLSA 5AXIA 1AP4A 3I5FB 3KF9A 1TRFA 1K9KA 2L5XB 1BOCA 2K2FA 3EK8A 3PM8A 1UHJA 1MR8A 1CTRA 1RTP1 1QX2A 3I5HB 2JU0A 2AUCA 1DJHA 1LA0A 2GGZA 1CFPA 2JC2A 4GBAA 1WRKA 1SL7A 4N5XA 2BE6A 4DUQA 2JT0A 3CLNA 2LMVA 2KI6C 1DTLA 3JTDC 2NXQA 1DF0B 1OQPA 4USLA 5AANA 1AJ5A 1Y0VH 1Y1XA 4MRXA 1KCYA 1UP5A 3I5IB 2QACA 1PK0D 2JT3A 2PALA 3SG6A 2G2BA 2L4HA 2H2KA 1E8AA 2Y1NA 5PALA 1DJWA 2M9GA 3BUMB 4GGNA 1JSAA 1QATA 2H61A 3SG3A 2K7DA 2LVVA 2KYCA 1NYAA 2SCPA 3A8RA 1K94A 1F71A 2P6BB 2MLFC 1KQVA 1RROA 5GQQC 3ZWHA 2JPTA 1W7IB 1XO5A 1ZMZA 2F8PA 2MBXA 1OMRA 1F4OA 1N65A 3AAKA 4PE0A 2WNDA 2PSRA 1KK7Y 1BR4B 2MHHA 4TNCA 1JUOA 4WRIA 3NSLA 1QIVA 1QASA 1YVHA 3PN7C 2KHNA 1F70A 1Y6WA 2I18A 3RLZA 3EKJA 1SNLA 1DMOA 1WRZA 4NQGA 1TCOB 4N1FA 4GUKA 1CMFA 5HLVA 3LLEA 1J7PA 1TNXA 3BUNB 1AK8A 2O5GA 1H8BA 4OCIA 2KYFA 1YUSA 1KQMC 1LA3A 4I5NB 1K93D 2CT9A 2KOTA 1U5IB 4MRYA 2K2AA 2FJUB 1NX3A 1PVBA 4PHJA 4R1EA 2COLB 4DRWA 1J7RA 1VRKA 5K89A 4GNKB 2NCPA 1NX0A 2LP3A 3NXAA 2LM5A 2OS8B 1NP8A 4A4CA 4DS7A 1LINA 3LCPC 1MHOA 1XFYO 2L98A 1DJXA 4E68A 1PULA 1JF0A 1CFCA 1UHIA 5AFPA 2F3ZA 3TDZA 4MSPA 1S6CA 5KSZA 1ZFSA 2LHLA 1BF5A 4ZCUA 1UUSA 2ZKMX 1KWOB 1B47A 2HPSA 2LANA 4P5OE 2L0PA 2M29A 1OMVA 1QJTA 4YGEB 1EXRA 1YR5A 2E6WA 3TDUA 1Q80A 1S5GY 3JVTB 5ER4X 2BBMA 3TUYB 1H4BA 1GGZA 1UHKA 2A4JA 1QX5B 1TN4A 3CWGA 2CCMA 4ICBA 3BYAA 1XVJA 2K7OA 1KK8B 1IRJA 3SIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 D;  1IG5 A;  3D0Y B;  1IJ5 A;  2JTZ A;  2D8N A;  3CTN A;  1CDL A;  4CID A;  2M1U A;  4AQI A;  2AAO A;  1SPY A;  1NSH A;  2SAS A;  4MEW A;  2JOJ A;  1BT6 A;  1DJI A;  1R2U A;  4M2P A;  3BOW A;  1A75 B;  3GK2 A;  1CLM A;  2GV5 A;  2TN4 A;  2M8U A;  1S6I A;  2LP2 A;  3KPX A;  5G08 A;  2AMI A;  3NSK A;  4HSZ A;  1HQV A;  3OB1 B;  1WY9 A;  1J55 A;  2BL0 B;  1YRU B;  1M39 A;  1IQ3 A;  1MXE A;  1EG4 A;  1QV1 A;  5DKQ A;  3WNX B;  4C0K A;  1QX7 A;  1FBV A;  1J7O A;  4HRH A;  4YI8 A;  1DJG A;  1K8U A;  2BCX A;  2IS9 A;  2LMU A;  2ZND A;  3EKH A;  4MZL A;  3VRN A;  2KAY A;  4YRU A;  4GGF C;  1WLZ A;  1MQ1 A;  1ZOT B;  1B1G A;  3OHM B;  1S36 A;  1FW4 A;  1L2O B;  1M31 A;  2NLN A;  5I2L A;  1JWD A;  3AAJ A;  1B8L A;  1JF2 A;  1S6J A;  1SBJ A;  1S26 D;  4A4B A;  3TS5 C;  2KFG A;  1BOD A;  3SJS A;  2JZI A;  1YUR A;  1B9A A;  1SCV A;  1ZUZ A;  2O60 A;  3VRR A;  2M7N A;  4I5K A;  1REC A;  1PSB A;  1UUR A;  3NSO A;  5KU1 A;  2OTG B;  2RGI A;  3SG7 A;  1AUI B;  2M3W A;  2LNK A;  3AKB A;  4PHM A;  1NWD A;  5AER A;  1RWY A;  4FQO A;  2KI4 B;  3WXA A;  2M1K B;  3KO0 A;  1Y1U A;  4ORC B;  2LVK A;  1SR6 C;  1DT7 B;  2FCD A;  3NSI A;  4GPL B;  5CSF A;  1M46 A;  1K9U A;  1QS7 A;  2FCE A;  3IF7 A;  1PVA A;  1MUX A;  5HKZ A;  1TTX A;  2BBN A;  2BL0 C;  1WDC B;  4PHN A;  5B8I B;  2JNF A;  1S5G Z;  3VRP A;  2LLU A;  3TDI A;  4XJK A;  4MZJ A;  1C7W A;  3I5F C;  5BPJ A;  1ODB A;  4MLW A;  1SK6 D;  1L7Z A;  2EC6 B;  2K0J A;  1YRT B;  3I5H C;  4HRG A;  1JFK A;  2OPO A;  4PCW A;  1K9P A;  2V53 A;  1BR1 B;  3SG4 A;  3GK4 X;  2Y1M A;  3SG5 A;  2MLE C;  3EK4 A;  4YBH B;  1K95 A;  2I2R E;  2ZNE A;  1KSM A;  1V1F A;  1CDN A;  1DJZ A;  1SRA A;  2Q91 A;  3DVK A;  1EJ3 A;  3ICB A;  4CLN A;  4AQJ A;  1EG3 A;  3D10 A;  4ORB B;  2LLT A;  1CKK A;  2B1U A;  4D1E A;  1OZO A;  3K21 A;  1BLQ A;  1OOJ A;  4GFT A;  1GQM A;  3I5I C;  4YGD B;  2K7B A;  2KGB C;  2WOS A;  1CM1 A;  4YI9 A;  2CBL A;  4OV2 A;  4CFQ A;  1BJF A;  2LE9 B;  1OE9 B;  1R6P A;  2PAS A;  2ZFD A;  3DVM A;  3TZ1 A;  1FPW A;  1KSO A;  1GGW A;  2GGM A;  2L51 A;  3VRQ A;  4ZCV A;  2KNE A;  2NCO A;  3H4S E;  1C7V A;  2CNP A;  1CB1 A;  1RK9 A;  1DJY A;  1SKT A;  3DVJ A;  4C0J A;  4GAO A;  4IL1 A;  1N0Y A;  1IKU A;  2R2I A;  1JFJ A;  2ZRS A;  1PSR A;  3O78 A;  1FI6 A;  1XFU O;  2M0R A;  1B8R A;  3GK1 A;  5HLO A;  3CS1 A;  2WCE A;  1NIW A;  4F0Z B;  2Q4U A;  3OX6 A;  2HET A;  1RFJ A;  4BY4 A;  1A29 A;  1EL4 A;  4HRE E;  4OKH A;  4PE7 A;  1A4P A;  1NUB A;  1A2X A;  1TOP A;  1LVC D;  4M2Q A;  3PSR A;  1DGV A;  4GGF A;  1LXF C;  1SL8 A;  1ZAC A;  1OSA A;  5F6T A;  2KDH A;  1CLL A;  5CSN A;  1F55 A;  1DVI A;  3BOW B;  5TNC A;  1NCX A;  3VRO A;  4L9M A;  1WLM A;  4QJ4 B;  1HT9 A;  3JTD B;  4AOM A;  1F4Q A;  3BUX B;  1SCM B;  1IH0 A;  2LUC A;  1M45 A;  2DOQ A;  1BG1 A;  1X02 A;  1KFX S;  1Y1A A;  4M2O A;  3BXK A;  2KAV A;  2BEC A;  1QIW A;  1XFW O;  2G9B A;  4WQ2 A;  2OS8 C;  5FYX A;  1CM4 A;  1QVI Z;  2BCB A;  3EK7 A;  3OB2 B;  2LV7 A;  2JNX A;  4WQ3 A;  1KFX L;  2PRU A;  1QLK A;  2EHB A;  1NX1 A;  4U8D A;  5CSJ A;  2ZN8 A;  3FWB A;  1DGU A;  1NCZ A;  2WOR A;  2JXL A;  1XFX O;  4DIR A;  3BUO B;  1NPQ A;  1KWO C;  2PMY A;  3EVU A;  3HCM A;  5KTY A;  3ZNI A;  2BKH B;  3FIA A;  5D69 A;  4YGA A;  2KQY A;  2F2P A;  2JXC A;  2F3Y A;  3JVT C;  4OR9 B;  3TUY C;  3PN7 B;  2WCB A;  1YTZ C;  3CZT X;  1BMO A;  1MWN A;  1UHN A;  1LKJ A;  3AKA A;  1YUU A;  1YUT A;  2VRG A;  4PE4 A;  1F8H A;  1KK8 C;  1CMG A;  3HX4 A;  1G4Y R;  1CFD A;  4UPG A;  5AEQ A;  2LCP A;  3PAT A;  1C07 A;  1IJ6 A;  2EGD A;  4ETO A;  2QPT A;  1KQM B;  1EH2 A;  2KBI A;  4Q04 A;  2I94 A;  2LVJ A;  4DCK A;  1NX2 A;  1SMG A;  2HQ8 A;  1SCM C;  3CGA A;  2KFF A;  3M0W A;  4MVF A;  1DF0 A;  1K90 D;  1XK4 C;  2WCF A;  5I8N A;  2L50 A;  1KFU S;  1S1E A;  3F45 A;  1TCF A;  2CTN A;  3MSE B;  2LHI A;  3O6B A;  4XJK B;  1QVI Y;  1S3P A;  3SG2 A;  1J7Q A;  2KSP A;  2KFH A;  2LUX A;  2ZRT A;  4I5J A;  3KHE A;  1NCY A;  3I5G B;  3DVE A;  4PAL A;  2JT8 A;  1BU3 A;  1YVL A;  1UHH A;  1PAL A;  1KFU L;  2JRF A;  3EVR A;  1YX8 A;  2Y5I A;  1B7T Z;  3C1V A;  4NDB A;  3BQ3 A;  3CR5 X;  1QTX A;  3RM1 A;  1UWO A;  5I2Q A;  1SL9 A;  1TNQ A;  1L2O C;  2JUL A;  3WHU B;  3DD4 A;  3E3R A;  2MJW B;  1CNP A;  1K96 A;  5DKN A;  1OZS A;  1FF1 A;  3OX5 A;  4NDD A;  2WC8 A;  4JWQ A;  4MBE A;  5J3X A;  3O2P A;  2ZN9 A;  1MF8 B;  2HF5 A;  2LC5 A;  5I2O A;  2OTG C;  2MRD A;  3CR4 X;  5D7F A;  1IQ5 A;  1D1O A;  1XFZ O;  2H61 C;  3FWC A;  4CFR A;  4QJ5 B;  2JTT A;  4C0L A;  2KI4 C;  3PAL A;  1XFV O;  3OP0 A;  4PE1 A;  3A4U B;  2ISD A;  1M63 B;  2E30 A;  1U5I A;  2CXJ A;  1A03 A;  1AVS A;  3WHT B;  2KBM A;  2KQ6 A;  2BCA A;  1B8C A;  2F33 A;  3DF0 B;  4ORA B;  1W7J B;  1CLB A;  2L2E A;  1SW8 A;  3DF0 A;  2KAX A;  3CR2 A;  3EVV A;  1J1E A;  3GOF A;  5DKR A;  1G33 A;  1WDC C;  2LLS A;  1CFF A;  1WRL A;  3O4Y A;  2MAZ A;  3PFV A;  1IGV A;  2JQ6 A;  3BUW B;  4MN0 A;  1TNP A;  1J1D A;  5IBW A;  3I5G C;  1K2H A;  5ER5 A;  3PLF B;  4XYN A;  1B7T Y;  2HQW A;  1XA5 A;  4N1G A;  1F54 A;  2I7A A;  2EC6 C;  3KEV A;  2FOT A;  4P2Y B;  1SY9 A;  2KGR A;  2NZ0 A;  3LK1 A;  3SIB A;  1RJV A;  3QRX A;  1FI5 A;  5CSI A;  1CDM A;  1CDP A;  1PRW A;  2K7C A;  4JQ0 D;  4QJ3 B;  3TS5 B;  4JPZ B;  4PHK A;  4CPV A;  2K8M B;  5CPV A;  5HYD A;  2PVB A;  3IQO A;  2MA2 A;  3VGO A;  5JJG A;  2JWW A;  1JBA A;  2F2O A;  1B4C A;  3FS7 A;  1JC2 A;  4YGC B;  1IWQ A;  1QV0 A;  3D0Y A;  2LMT A;  2Y4Q A;  1YX7 A;  1GJY A;  1SYM A;  3LK0 A;  1XYD A;  1MXL C;  1N2D A;  3LL8 B;  1ALV A;  5HKW A;  1SR6 B;  1V1G A;  2M49 B;  4I5L B;  4OVN F;  1G8I A;  2M7L A;  4BY5 A;  4PDZ A;  1ALW A;  4NDC A;  1TNW A;  3IQQ A;  1A75 A;  2M97 A;  1AHR A;  2K61 A;  5JOL A;  2L4I A;  5HKY A;  1XK4 A;  1AJ4 A;  1QXP A;  2LAP A;  1OMD A;  2BE4 A;  4MZK A;  4FTG A;  1KK7 Z;  1TIZ A;  2BKI B;  2LVI A;  4YGB B;  1QLS A;  5AXI A;  1AP4 A;  3I5F B;  3KF9 A;  1TRF A;  1K9K A;  2L5X B;  1BOC A;  2K2F A;  3EK8 A;  3PM8 A;  1UHJ A;  1MR8 A;  1CTR A;  1RTP 1;  1QX2 A;  3I5H B;  2JU0 A;  2AUC A;  1DJH A;  1LA0 A;  2GGZ A;  1CFP A;  2JC2 A;  4GBA A;  1WRK A;  1SL7 A;  4N5X A;  2BE6 A;  4DUQ A;  2JT0 A;  3CLN A;  2LMV A;  2KI6 C;  1DTL A;  3JTD C;  2NXQ A;  1DF0 B;  1OQP A;  4USL A;  5AAN A;  1AJ5 A;  1Y0V H;  1Y1X A;  4MRX A;  1KCY A;  1UP5 A;  3I5I B;  2QAC A;  1PK0 D;  2JT3 A;  2PAL A;  3SG6 A;  2G2B A;  2L4H A;  2H2K A;  1E8A A;  2Y1N A;  5PAL A;  1DJW A;  2M9G A;  3BUM B;  4GGN A;  1JSA A;  1QAT A;  2H61 A;  3SG3 A;  2K7D A;  2LVV A;  2KYC A;  1NYA A;  2SCP A;  3A8R A;  1K94 A;  1F71 A;  2P6B B;  2MLF C;  1KQV A;  1RRO A;  5GQQ C;  3ZWH A;  2JPT A;  1W7I B;  1XO5 A;  1ZMZ A;  2F8P A;  2MBX A;  1OMR A;  1F4O A;  1N65 A;  3AAK A;  4PE0 A;  2WND A;  2PSR A;  1KK7 Y;  1BR4 B;  2MHH A;  4TNC A;  1JUO A;  4WRI A;  3NSL A;  1QIV A;  1QAS A;  1YVH A;  3PN7 C;  2KHN A;  1F70 A;  1Y6W A;  2I18 A;  3RLZ A;  3EKJ A;  1SNL A;  1DMO A;  1WRZ A;  4NQG A;  1TCO B;  4N1F A;  4GUK A;  1CMF A;  5HLV A;  3LLE A;  1J7P A;  1TNX A;  3BUN B;  1AK8 A;  2O5G A;  1H8B A;  4OCI A;  2KYF A;  1YUS A;  1KQM C;  1LA3 A;  4I5N B;  1K93 D;  2CT9 A;  2KOT A;  1U5I B;  4MRY A;  2K2A A;  2FJU B;  1NX3 A;  1PVB A;  4PHJ A;  4R1E A;  2COL B;  4DRW A;  1J7R A;  1VRK A;  5K89 A;  4GNK B;  2NCP A;  1NX0 A;  2LP3 A;  3NXA A;  2LM5 A;  2OS8 B;  1NP8 A;  4A4C A;  4DS7 A;  1LIN A;  3LCP C;  1MHO A;  1XFY O;  2L98 A;  1DJX A;  4E68 A;  1PUL A;  1JF0 A;  1CFC A;  1UHI A;  5AFP A;  2F3Z A;  3TDZ A;  4MSP A;  1S6C A;  5KSZ A;  1ZFS A;  2LHL A;  1BF5 A;  4ZCU A;  1UUS A;  2ZKM X;  1KWO B;  1B47 A;  2HPS A;  2LAN A;  4P5O E;  2L0P A;  2M29 A;  1OMV A;  1QJT A;  4YGE B;  1EXR A;  1YR5 A;  2E6W A;  3TDU A;  1Q80 A;  1S5G Y;  3JVT B;  5ER4 X;  2BBM A;  3TUY B;  1H4B A;  1GGZ A;  1UHK A;  2A4J A;  1QX5 B;  1TN4 A;  3CWG A;  2CCM A;  4ICB A;  3BYA A;  1XVJ A;  2K7O A;  1KK8 B;  1IRJ A;  3SIA A; 
#chains in the Genus database with same CATH topology
 2KI6 D;  1IG5 A;  3D0Y B;  1IJ5 A;  2JTZ A;  2D8N A;  3CTN A;  1CDL A;  4CID A;  2M1U A;  4AQI A;  2AAO A;  1SPY A;  1NSH A;  2SAS A;  4MEW A;  1Z4H A;  2JOJ A;  1BT6 A;  1DJI A;  1R2U A;  2P70 A;  3BOW A;  4M2P A;  4FQT A;  1A75 B;  3GK2 A;  1CLM A;  2GV5 A;  4IJ7 A;  2TN4 A;  2M8U A;  1S6I A;  2LP2 A;  3KPX A;  5G08 A;  2AMI A;  3NSK A;  4HSZ A;  1HQV A;  1OOF A;  3OB1 B;  1WY9 A;  1J55 A;  2BL0 B;  2YGU A;  1YRU B;  1M39 A;  3PM2 A;  1IQ3 A;  1MXE A;  1EG4 A;  1QV1 A;  5DKQ A;  3WNX B;  3IVT A;  1QX7 A;  4C0K A;  1FBV A;  1J7O A;  3B86 A;  4HRH A;  4YI8 A;  1OOH A;  1DJG A;  1K8U A;  2BCX A;  2IS9 A;  2JPO A;  2LMU A;  2ZND A;  3EKH A;  4MZL A;  3VRN A;  2KAY A;  4YRU A;  4GGF C;  1WLZ A;  1MQ1 A;  1ZOT B;  3RZS A;  1B1G A;  5I94 A;  3OHM B;  1S36 A;  1FW4 A;  1L2O B;  1M31 A;  2NLN A;  5I2L A;  1JWD A;  3CZ1 A;  3AAJ A;  1B8L A;  1JF2 A;  5HL1 A;  1S6J A;  1SBJ A;  1S26 D;  4A4B A;  3TS5 C;  2KFG A;  1Z2C B;  1BOD A;  3SJS A;  2JZI A;  1YUR A;  1B9A A;  1SCV A;  1ZUZ A;  2O60 A;  3VRR A;  2M7N A;  4I5K A;  1REC A;  1PSB A;  1UUR A;  3NSO A;  2WC5 A;  5KU1 A;  2OTG B;  2RGI A;  3SG7 A;  1AUI B;  2M3W A;  2LNK A;  3AKB A;  4PHM A;  2QEH A;  1NWD A;  5AER A;  1RWY A;  3B88 A;  4FQO A;  2KI4 B;  3WXA A;  2M1K B;  3KO0 A;  1Y1U A;  4ORC B;  2LVK A;  1SR6 C;  1DT7 B;  2FCD A;  3NSI A;  4GPL B;  5CSF A;  1M46 A;  1K9U A;  1QS7 A;  2FCE A;  3DXL A;  3IF7 A;  1PVA A;  1MUX A;  5HKZ A;  3OGN A;  1TTX A;  2BBN A;  2BL0 C;  1WDC B;  4PHN A;  5B8I B;  2JNF A;  1S5G Z;  3DYE A;  2LLU A;  3VRP A;  3TDI A;  1C3Y A;  4XJK A;  4MZJ A;  1C7W A;  3I5F C;  5BPJ A;  1ODB A;  4MLW A;  3D73 A;  1SK6 D;  1L7Z A;  2EC6 B;  2K0J A;  1YRT B;  3I5H C;  5EL2 A;  4HRG A;  1JFK A;  2OPO A;  4PCW A;  1K9P A;  2V53 A;  1BR1 B;  3SG4 A;  3GK4 X;  2Y1M A;  3SG5 A;  2MLE C;  3EK4 A;  4YBH B;  3FE6 A;  3FE8 A;  1K95 A;  2I2R E;  2ZNE A;  1KSM A;  1V1F A;  1CDN A;  1DJZ A;  1SRA A;  2Q91 A;  3DVK A;  1EJ3 A;  3ICB A;  4CLN A;  4AQJ A;  1EG3 A;  3D10 A;  4ORB B;  2FJY A;  2LLT A;  3S0A A;  1CKK A;  2B1U A;  4D1E A;  1OZO A;  3K21 A;  1BLQ A;  1OOJ A;  3D74 A;  4GFT A;  1GQM A;  2WCK A;  3I5I C;  4YGD B;  4PT1 A;  2K7B A;  2KGB C;  2WOS A;  1CM1 A;  4YI9 A;  2CBL A;  4OV2 A;  4CFQ A;  1BJF A;  2LE9 B;  1OE9 B;  1R6P A;  2PAS A;  2ZFD A;  3DVM A;  3TZ1 A;  1FPW A;  1KSO A;  1GGW A;  2GGM A;  2L51 A;  3VRQ A;  4ZCV A;  2KNE A;  2NCO A;  3H4S E;  1C7V A;  2CNP A;  1CB1 A;  1RK9 A;  1DEK A;  3L47 A;  4F7F A;  1DJY A;  1SKT A;  3DVJ A;  4C0J A;  4GAO A;  4IL1 A;  1N0Y A;  1IKU A;  2BAP A;  2R2I A;  2ZRS A;  1JFJ A;  1PSR A;  3O4X A;  3O78 A;  1FI6 A;  1XFU O;  2M0R A;  1B8R A;  3GK1 A;  5HLO A;  1TUJ A;  3CS1 A;  2WCE A;  1NIW A;  4JKT A;  4F0Z B;  2Q4U A;  3OX6 A;  2HET A;  1RFJ A;  4KYN A;  4BY4 A;  1A29 A;  1EL4 A;  2PYQ A;  4HRE E;  4OKH A;  4PE7 A;  1A4P A;  1NUB A;  1A2X A;  1TOP A;  3D75 A;  1LVC D;  4M2Q A;  3CZ0 A;  3PSR A;  3UNW A;  3SS4 A;  1DGV A;  4GGF A;  1LXF C;  1SL8 A;  1ZAC A;  3S0G A;  1OSA A;  5F6T A;  2KDH A;  2WCJ A;  1CLL A;  5CSN A;  1F55 A;  4OZD A;  1DVI A;  3BOW B;  5TNC A;  1NCX A;  3L4A A;  3BFB A;  1WLM A;  4L9M A;  3VRO A;  1HT9 A;  3JTD B;  4QJ4 B;  1P28 A;  1F4Q A;  3BUX B;  1SCM B;  4AOM A;  2LUC A;  1IH0 A;  1OOG A;  1M45 A;  2DOQ A;  1DC1 A;  1BG1 A;  1X02 A;  1KFX S;  1Y1A A;  4M2O A;  3BXK A;  1OW4 A;  3S0D A;  2GTE A;  2BEC A;  2KAV A;  1QIW A;  1XFW O;  2G9B A;  4WQ2 A;  2OS8 C;  5FYX A;  1CM4 A;  1QVI Z;  2BCB A;  3EK7 A;  3OB2 B;  2LV7 A;  2JNX A;  4WQ3 A;  1IIO A;  1KFX L;  2PRU A;  1QLK A;  2EHB A;  1NX1 A;  4U8D A;  5CSJ A;  2ZN8 A;  3FWB A;  1DGU A;  1NCZ A;  2WOR A;  2JXL A;  1XFX O;  4DIR A;  3BUO B;  1NPQ A;  3V2L A;  1KWO C;  1XFR A;  2PMY A;  3EVU A;  3HCM A;  5KTY A;  3ZNI A;  3CDN A;  2BKH B;  3FIA A;  5D69 A;  4YGA A;  4INW A;  2KQY A;  2F2P A;  2JXC A;  3B6X A;  2F3Y A;  3JVT C;  4OR9 B;  3TUY C;  2QDI A;  3PN7 B;  2WCB A;  1YTZ C;  3CZT X;  3EG5 B;  1BMO A;  1MWN A;  1UHN A;  1LKJ A;  3AKA A;  1YUU A;  1YUT A;  2VRG A;  4PE4 A;  1F8H A;  3R1O A;  1KK8 C;  1CMG A;  3HX4 A;  1G4Y R;  1CFD A;  4UPG A;  5AEQ A;  2LCP A;  3PAT A;  1C07 A;  1IJ6 A;  2EGD A;  4ETO A;  2QPT A;  1KQM B;  3L4L A;  2KBI A;  1EH2 A;  4Q04 A;  2I94 A;  3N7H A;  2LVJ A;  4DCK A;  1NX2 A;  1SMG A;  2HQ8 A;  1SCM C;  3CGA A;  2KFF A;  3M0W A;  4MVF A;  1DF0 A;  1K90 D;  1XK4 C;  2WCF A;  5I8N A;  2L50 A;  1KFU S;  1S1E A;  3F45 A;  1TCF A;  2CTN A;  3MSE B;  2LHI A;  3O6B A;  4XJK B;  1QVI Y;  1S3P A;  3SG2 A;  1J7Q A;  2KSP A;  2KFH A;  2LUX A;  2ZRT A;  4I5J A;  3KHE A;  1NCY A;  1DEL A;  5FI7 A;  3I5G B;  3DVE A;  2WCL A;  4PAL A;  2JT8 A;  1BU3 A;  1YVL A;  1UHH A;  1PAL A;  1KFU L;  2JRF A;  2L2C A;  3EVR A;  1YX8 A;  2Y5I A;  1B7T Z;  3C1V A;  4NDB A;  3BQ3 A;  3CR5 X;  1QTX A;  3RM1 A;  1UWO A;  5I2Q A;  1SL9 A;  1TUZ A;  1C3Z A;  1TNQ A;  1L2O C;  2JUL A;  3WHU B;  1LS8 A;  2L5Y A;  2MJW B;  3DD4 A;  3E3R A;  1K96 A;  5DKN A;  1OZS A;  1CNP A;  1FF1 A;  3OX5 A;  2KPH A;  2H8V A;  4NDD A;  2WC8 A;  4JWQ A;  4MBE A;  3B87 A;  5J3X A;  3O2P A;  2ZN9 A;  3SS3 A;  1MF8 B;  2HF5 A;  2LC5 A;  5I2O A;  2OTG C;  2BNX A;  2MRD A;  3CR4 X;  5D7F A;  1IQ5 A;  3NGV A;  1XFZ O;  1D1O A;  2KLD A;  2H61 C;  3FWC A;  4CFR A;  4QJ5 B;  2JTT A;  4C0L A;  2KI4 C;  2QEO A;  3Q8I A;  3PAL A;  1XFV O;  3OP0 A;  4PE1 A;  3A4U B;  2ISD A;  1M63 B;  2E30 A;  1U5I A;  2CXJ A;  1A03 A;  1AVS A;  3WHT B;  2KBM A;  2KQ6 A;  2BCA A;  1B8C A;  2F33 A;  3DF0 B;  1DQE A;  1W7J B;  4ORA B;  2L2E A;  1CLB A;  1SW8 A;  3DF0 A;  2KAX A;  3CR2 A;  3EVV A;  1J1E A;  3GOF A;  5DKR A;  1G33 A;  1WDC C;  2LLS A;  1CFF A;  5FI6 A;  1WRL A;  5DIC A;  3O4Y A;  2MAZ A;  2QEB A;  3PFV A;  1IGV A;  1W9Z A;  2JQ6 A;  3BUW B;  4MN0 A;  1TNP A;  1J1D A;  5IBW A;  3I5G C;  1K2H A;  5ER5 A;  3PLF B;  4XYN A;  1B7T Y;  2HQW A;  3NHI A;  5D3O A;  1XA5 A;  4N1G A;  1F54 A;  2I7A A;  2EC6 C;  3KEV A;  3CZ2 A;  2FOT A;  4P2Y B;  1SY9 A;  2KGR A;  2NZ0 A;  3DZT A;  3LK1 A;  3SIB A;  1RJV A;  3QRX A;  1FI5 A;  5CSI A;  1CDM A;  3QME A;  1CDP A;  1PRW A;  2K7C A;  4JQ0 D;  4QJ3 B;  3TS5 B;  4JPZ B;  3B7A A;  3CAB A;  4PHK A;  4CPV A;  2K8M B;  5CPV A;  5HYD A;  2PVB A;  3IQO A;  2MA2 A;  3VGO A;  5JJG A;  2JWW A;  1JBA A;  2F2O A;  1B4C A;  3FS7 A;  1JC2 A;  4YGC B;  1IWQ A;  1QV0 A;  3D0Y A;  2LMT A;  2Y4Q A;  2KLE A;  1YX7 A;  1GJY A;  3D77 A;  1SYM A;  3LK0 A;  1XYD A;  1MXL C;  1N2D A;  3LL8 B;  1ALV A;  5HKW A;  1SR6 B;  1V1G A;  2M49 B;  4I5L B;  4OVN F;  1G8I A;  2M7L A;  4BY5 A;  4PDZ A;  1ALW A;  4NDC A;  1TNW A;  3IQQ A;  1A75 A;  2M97 A;  3CYZ A;  1AHR A;  2K61 A;  3PJI A;  5JOL A;  2L4I A;  5HKY A;  1XK4 A;  1AJ4 A;  1QXP A;  2LAP A;  1OMD A;  2BE4 A;  1OOI X;  4FTG A;  4MZK A;  1KK7 Z;  1TIZ A;  1T14 A;  2BKI B;  2LVI A;  4YGB B;  1QLS A;  5AXI A;  1AP4 A;  3I5F B;  3KF9 A;  1TRF A;  1K9K A;  2L5X B;  3S0E A;  2K2F A;  3EK8 A;  3PM8 A;  1BOC A;  1UHJ A;  1MR8 A;  1CTR A;  1RTP 1;  1QX2 A;  3I5H B;  2JU0 A;  2AUC A;  1DJH A;  1LA0 A;  2GGZ A;  1CFP A;  2JC2 A;  4GBA A;  1WRK A;  1SL7 A;  4N5X A;  2BE6 A;  3BJH A;  4INX A;  2JT0 A;  4DUQ A;  3CLN A;  2LMV A;  2KI6 C;  1DTL A;  3JTD C;  2NXQ A;  1DF0 B;  1OQP A;  2PQL A;  4USL A;  5AAN A;  1AJ5 A;  1Y0V H;  1Y1X A;  3BFH A;  4MRX A;  1UP5 A;  1KCY A;  3I5I B;  2QAC A;  3NHT A;  1PK0 D;  2JT3 A;  2PAL A;  3SG6 A;  2G2B A;  2L4H A;  2H2K A;  1E8A A;  2WCH A;  2Y1N A;  5PAL A;  1DJW A;  2M9G A;  3BUM B;  4GGN A;  2QEV A;  1JSA A;  1QAT A;  2H61 A;  3SG3 A;  2K7D A;  2LVV A;  2KYC A;  1NYA A;  2SCP A;  3A8R A;  5FI2 A;  1K94 A;  1F71 A;  2P6B B;  2MLF C;  3R72 A;  1KQV A;  1RRO A;  5GQQ C;  3ZWH A;  2JPT A;  1W7I B;  3S0B A;  1XO5 A;  1ZMZ A;  2F8P A;  2MBX A;  1OMR A;  1F4O A;  1N65 A;  3AAK A;  4PE0 A;  3OBV A;  2WND A;  2PSR A;  1KK7 Y;  1BR4 B;  2MHH A;  4TNC A;  1JUO A;  3R1V A;  4WRI A;  3NSL A;  1QIV A;  2WCM A;  1QAS A;  1YVH A;  3PN7 C;  2KHN A;  1F70 A;  1Y6W A;  2I18 A;  1GM0 A;  4JD9 A;  3RLZ A;  3EKJ A;  1SNL A;  1DMO A;  1WRZ A;  3FE9 A;  4NQG A;  1TCO B;  4N1F A;  4GUK A;  1CMF A;  5HLV A;  3LLE A;  1J7P A;  1TNX A;  1TWO A;  3BUN B;  1AK8 A;  2O5G A;  1H8B A;  4OCI A;  2KYF A;  1YUS A;  1KQM C;  1LA3 A;  4I5N B;  1K93 D;  2CT9 A;  2KOT A;  3BFA A;  1U5I B;  4MRY A;  2K2A A;  2FJU B;  1NX3 A;  1PVB A;  3K1E A;  4PHJ A;  4R1E A;  2COL B;  2WC6 A;  3UO9 A;  4DRW A;  1J7R A;  1VRK A;  5K89 A;  4GNK B;  2NCP A;  1NX0 A;  2LP3 A;  2K60 A;  2LM5 A;  3D78 A;  2OS8 B;  3NXA A;  1NP8 A;  4A4C A;  4DS7 A;  1LIN A;  1ORG A;  1MHO A;  1XFY O;  2L98 A;  3LCP C;  1DJX A;  2P71 A;  4E68 A;  1PUL A;  1JF0 A;  1CFC A;  2ERB A;  1UHI A;  5AFP A;  2F3Z A;  3TDZ A;  3R1P A;  4MSP A;  1S6C A;  5KSZ A;  1ZFS A;  1SSE B;  2LHL A;  1BF5 A;  3S0F A;  4ZCU A;  1UUS A;  2ZKM X;  1KWO B;  1B47 A;  2HPS A;  3SS5 A;  2LAN A;  4P5O E;  2L0P A;  2M29 A;  3D76 A;  1OMV A;  1QJT A;  4YGE B;  1EXR A;  1YR5 A;  2E6W A;  3TDU A;  1Q80 A;  1S5G Y;  3JVT B;  5ER4 X;  1QWV A;  2BBM A;  3TUY B;  1H4B A;  3VB1 A;  1GGZ A;  1UHK A;  2A4J A;  1QX5 B;  1TN4 A;  3CWG A;  2CCM A;  4ICB A;  3BYA A;  1XVJ A;  2K7O A;  1KK8 B;  1IRJ A;  3SIA A;  3DY9 A; 
#chains in the Genus database with same CATH homology
 2KI6 D;  1IG5 A;  3D0Y B;  1IJ5 A;  2JTZ A;  2D8N A;  3CTN A;  1CDL A;  4CID A;  2M1U A;  4AQI A;  2AAO A;  1SPY A;  1NSH A;  2SAS A;  4MEW A;  2JOJ A;  1BT6 A;  1DJI A;  1R2U A;  4M2P A;  3BOW A;  1A75 B;  3GK2 A;  1CLM A;  2GV5 A;  2TN4 A;  2M8U A;  1S6I A;  2LP2 A;  3KPX A;  5G08 A;  2AMI A;  3NSK A;  4HSZ A;  1HQV A;  3OB1 B;  1WY9 A;  1J55 A;  2BL0 B;  1YRU B;  1M39 A;  1IQ3 A;  1MXE A;  1EG4 A;  1QV1 A;  5DKQ A;  3WNX B;  4C0K A;  1QX7 A;  1FBV A;  1J7O A;  4HRH A;  4YI8 A;  1DJG A;  1K8U A;  2BCX A;  2IS9 A;  2LMU A;  2ZND A;  3EKH A;  4MZL A;  3VRN A;  2KAY A;  4YRU A;  4GGF C;  1WLZ A;  1MQ1 A;  1ZOT B;  1B1G A;  3OHM B;  1S36 A;  1FW4 A;  1L2O B;  1M31 A;  2NLN A;  5I2L A;  1JWD A;  3AAJ A;  1B8L A;  1JF2 A;  1S6J A;  1SBJ A;  1S26 D;  4A4B A;  3TS5 C;  2KFG A;  1BOD A;  3SJS A;  2JZI A;  1YUR A;  1B9A A;  1SCV A;  1ZUZ A;  2O60 A;  3VRR A;  2M7N A;  4I5K A;  1REC A;  1PSB A;  1UUR A;  3NSO A;  5KU1 A;  2OTG B;  2RGI A;  3SG7 A;  1AUI B;  2M3W A;  2LNK A;  3AKB A;  4PHM A;  1NWD A;  5AER A;  1RWY A;  4FQO A;  2KI4 B;  3WXA A;  2M1K B;  3KO0 A;  1Y1U A;  4ORC B;  2LVK A;  1SR6 C;  1DT7 B;  2FCD A;  3NSI A;  4GPL B;  5CSF A;  1M46 A;  1K9U A;  1QS7 A;  2FCE A;  3IF7 A;  1PVA A;  1MUX A;  5HKZ A;  1TTX A;  2BBN A;  2BL0 C;  1WDC B;  4PHN A;  5B8I B;  2JNF A;  1S5G Z;  3VRP A;  2LLU A;  3TDI A;  4XJK A;  4MZJ A;  1C7W A;  3I5F C;  5BPJ A;  1ODB A;  4MLW A;  1SK6 D;  1L7Z A;  2EC6 B;  2K0J A;  1YRT B;  3I5H C;  4HRG A;  1JFK A;  2OPO A;  4PCW A;  1K9P A;  2V53 A;  1BR1 B;  3SG4 A;  3GK4 X;  2Y1M A;  3SG5 A;  2MLE C;  3EK4 A;  4YBH B;  1K95 A;  2I2R E;  2ZNE A;  1KSM A;  1V1F A;  1CDN A;  1DJZ A;  1SRA A;  2Q91 A;  3DVK A;  1EJ3 A;  3ICB A;  4CLN A;  4AQJ A;  1EG3 A;  3D10 A;  4ORB B;  2LLT A;  1CKK A;  2B1U A;  4D1E A;  1OZO A;  3K21 A;  1BLQ A;  1OOJ A;  4GFT A;  1GQM A;  3I5I C;  4YGD B;  2K7B A;  2KGB C;  2WOS A;  1CM1 A;  4YI9 A;  2CBL A;  4OV2 A;  4CFQ A;  1BJF A;  2LE9 B;  1OE9 B;  1R6P A;  2PAS A;  2ZFD A;  3DVM A;  3TZ1 A;  1FPW A;  1KSO A;  1GGW A;  2GGM A;  2L51 A;  3VRQ A;  4ZCV A;  2KNE A;  2NCO A;  3H4S E;  1C7V A;  2CNP A;  1CB1 A;  1RK9 A;  1DJY A;  1SKT A;  3DVJ A;  4C0J A;  4GAO A;  4IL1 A;  1N0Y A;  1IKU A;  2R2I A;  1JFJ A;  2ZRS A;  1PSR A;  3O78 A;  1FI6 A;  1XFU O;  2M0R A;  1B8R A;  3GK1 A;  5HLO A;  3CS1 A;  2WCE A;  1NIW A;  4F0Z B;  2Q4U A;  3OX6 A;  2HET A;  1RFJ A;  4BY4 A;  1A29 A;  1EL4 A;  4HRE E;  4OKH A;  4PE7 A;  1A4P A;  1NUB A;  1A2X A;  1TOP A;  1LVC D;  4M2Q A;  3PSR A;  1DGV A;  4GGF A;  1LXF C;  1SL8 A;  1ZAC A;  1OSA A;  5F6T A;  2KDH A;  1CLL A;  5CSN A;  1F55 A;  1DVI A;  3BOW B;  5TNC A;  1NCX A;  3VRO A;  4L9M A;  1WLM A;  4QJ4 B;  1HT9 A;  3JTD B;  4AOM A;  1F4Q A;  3BUX B;  1SCM B;  1IH0 A;  2LUC A;  1M45 A;  2DOQ A;  1BG1 A;  1X02 A;  1KFX S;  1Y1A A;  4M2O A;  3BXK A;  2KAV A;  2BEC A;  1QIW A;  1XFW O;  2G9B A;  4WQ2 A;  2OS8 C;  5FYX A;  1CM4 A;  1QVI Z;  2BCB A;  3EK7 A;  3OB2 B;  2LV7 A;  2JNX A;  4WQ3 A;  1KFX L;  2PRU A;  1QLK A;  2EHB A;  1NX1 A;  4U8D A;  5CSJ A;  2ZN8 A;  3FWB A;  1DGU A;  1NCZ A;  2WOR A;  2JXL A;  1XFX O;  4DIR A;  3BUO B;  1NPQ A;  1KWO C;  2PMY A;  3EVU A;  3HCM A;  5KTY A;  3ZNI A;  2BKH B;  3FIA A;  5D69 A;  4YGA A;  2KQY A;  2F2P A;  2JXC A;  2F3Y A;  3JVT C;  4OR9 B;  3TUY C;  3PN7 B;  2WCB A;  1YTZ C;  3CZT X;  1BMO A;  1MWN A;  1UHN A;  1LKJ A;  3AKA A;  1YUU A;  1YUT A;  2VRG A;  4PE4 A;  1F8H A;  1KK8 C;  1CMG A;  3HX4 A;  1G4Y R;  1CFD A;  4UPG A;  5AEQ A;  2LCP A;  3PAT A;  1C07 A;  1IJ6 A;  2EGD A;  4ETO A;  2QPT A;  1KQM B;  1EH2 A;  2KBI A;  4Q04 A;  2I94 A;  2LVJ A;  4DCK A;  1NX2 A;  1SMG A;  2HQ8 A;  1SCM C;  3CGA A;  2KFF A;  3M0W A;  4MVF A;  1DF0 A;  1K90 D;  1XK4 C;  2WCF A;  5I8N A;  2L50 A;  1KFU S;  1S1E A;  3F45 A;  1TCF A;  2CTN A;  3MSE B;  2LHI A;  3O6B A;  4XJK B;  1QVI Y;  1S3P A;  3SG2 A;  1J7Q A;  2KSP A;  2KFH A;  2LUX A;  2ZRT A;  4I5J A;  3KHE A;  1NCY A;  3I5G B;  3DVE A;  4PAL A;  2JT8 A;  1BU3 A;  1YVL A;  1UHH A;  1PAL A;  1KFU L;  2JRF A;  3EVR A;  1YX8 A;  2Y5I A;  1B7T Z;  3C1V A;  4NDB A;  3BQ3 A;  3CR5 X;  1QTX A;  3RM1 A;  1UWO A;  5I2Q A;  1SL9 A;  1TNQ A;  1L2O C;  2JUL A;  3WHU B;  3DD4 A;  3E3R A;  2MJW B;  1CNP A;  1K96 A;  5DKN A;  1OZS A;  1FF1 A;  3OX5 A;  4NDD A;  2WC8 A;  4JWQ A;  4MBE A;  5J3X A;  3O2P A;  2ZN9 A;  1MF8 B;  2HF5 A;  2LC5 A;  5I2O A;  2OTG C;  2MRD A;  3CR4 X;  5D7F A;  1IQ5 A;  1D1O A;  1XFZ O;  2H61 C;  3FWC A;  4CFR A;  4QJ5 B;  2JTT A;  4C0L A;  2KI4 C;  3PAL A;  1XFV O;  3OP0 A;  4PE1 A;  3A4U B;  2ISD A;  1M63 B;  2E30 A;  1U5I A;  2CXJ A;  1A03 A;  1AVS A;  3WHT B;  2KBM A;  2KQ6 A;  2BCA A;  1B8C A;  2F33 A;  3DF0 B;  4ORA B;  1W7J B;  1CLB A;  2L2E A;  1SW8 A;  3DF0 A;  2KAX A;  3CR2 A;  3EVV A;  1J1E A;  3GOF A;  5DKR A;  1G33 A;  1WDC C;  2LLS A;  1CFF A;  1WRL A;  3O4Y A;  2MAZ A;  3PFV A;  1IGV A;  2JQ6 A;  3BUW B;  4MN0 A;  1TNP A;  1J1D A;  5IBW A;  3I5G C;  1K2H A;  5ER5 A;  3PLF B;  4XYN A;  1B7T Y;  2HQW A;  1XA5 A;  4N1G A;  1F54 A;  2I7A A;  2EC6 C;  3KEV A;  2FOT A;  4P2Y B;  1SY9 A;  2KGR A;  2NZ0 A;  3LK1 A;  3SIB A;  1RJV A;  3QRX A;  1FI5 A;  5CSI A;  1CDM A;  1CDP A;  1PRW A;  2K7C A;  4JQ0 D;  4QJ3 B;  3TS5 B;  4JPZ B;  4PHK A;  4CPV A;  2K8M B;  5CPV A;  5HYD A;  2PVB A;  3IQO A;  2MA2 A;  3VGO A;  5JJG A;  2JWW A;  1JBA A;  2F2O A;  1B4C A;  3FS7 A;  1JC2 A;  4YGC B;  1IWQ A;  1QV0 A;  3D0Y A;  2LMT A;  2Y4Q A;  1YX7 A;  1GJY A;  1SYM A;  3LK0 A;  1XYD A;  1MXL C;  1N2D A;  3LL8 B;  1ALV A;  5HKW A;  1SR6 B;  1V1G A;  2M49 B;  4I5L B;  4OVN F;  1G8I A;  2M7L A;  4BY5 A;  4PDZ A;  1ALW A;  4NDC A;  1TNW A;  3IQQ A;  1A75 A;  2M97 A;  1AHR A;  2K61 A;  5JOL A;  2L4I A;  5HKY A;  1XK4 A;  1AJ4 A;  1QXP A;  2LAP A;  1OMD A;  2BE4 A;  4MZK A;  4FTG A;  1KK7 Z;  1TIZ A;  2BKI B;  2LVI A;  4YGB B;  1QLS A;  5AXI A;  1AP4 A;  3I5F B;  3KF9 A;  1TRF A;  1K9K A;  2L5X B;  1BOC A;  2K2F A;  3EK8 A;  3PM8 A;  1UHJ A;  1MR8 A;  1CTR A;  1RTP 1;  1QX2 A;  3I5H B;  2JU0 A;  2AUC A;  1DJH A;  1LA0 A;  2GGZ A;  1CFP A;  2JC2 A;  4GBA A;  1WRK A;  1SL7 A;  4N5X A;  2BE6 A;  4DUQ A;  2JT0 A;  3CLN A;  2LMV A;  2KI6 C;  1DTL A;  3JTD C;  2NXQ A;  1DF0 B;  1OQP A;  4USL A;  5AAN A;  1AJ5 A;  1Y0V H;  1Y1X A;  4MRX A;  1KCY A;  1UP5 A;  3I5I B;  2QAC A;  1PK0 D;  2JT3 A;  2PAL A;  3SG6 A;  2G2B A;  2L4H A;  2H2K A;  1E8A A;  2Y1N A;  5PAL A;  1DJW A;  2M9G A;  3BUM B;  4GGN A;  1JSA A;  1QAT A;  2H61 A;  3SG3 A;  2K7D A;  2LVV A;  2KYC A;  1NYA A;  2SCP A;  3A8R A;  1K94 A;  1F71 A;  2P6B B;  2MLF C;  1KQV A;  1RRO A;  5GQQ C;  3ZWH A;  2JPT A;  1W7I B;  1XO5 A;  1ZMZ A;  2F8P A;  2MBX A;  1OMR A;  1F4O A;  1N65 A;  3AAK A;  4PE0 A;  2WND A;  2PSR A;  1KK7 Y;  1BR4 B;  2MHH A;  4TNC A;  1JUO A;  4WRI A;  3NSL A;  1QIV A;  1QAS A;  1YVH A;  3PN7 C;  2KHN A;  1F70 A;  1Y6W A;  2I18 A;  3RLZ A;  3EKJ A;  1SNL A;  1DMO A;  1WRZ A;  4NQG A;  1TCO B;  4N1F A;  4GUK A;  1CMF A;  5HLV A;  3LLE A;  1J7P A;  1TNX A;  3BUN B;  1AK8 A;  2O5G A;  1H8B A;  4OCI A;  2KYF A;  1YUS A;  1KQM C;  1LA3 A;  4I5N B;  1K93 D;  2CT9 A;  2KOT A;  1U5I B;  4MRY A;  2K2A A;  2FJU B;  1NX3 A;  1PVB A;  4PHJ A;  4R1E A;  2COL B;  4DRW A;  1J7R A;  1VRK A;  5K89 A;  4GNK B;  2NCP A;  1NX0 A;  2LP3 A;  3NXA A;  2LM5 A;  2OS8 B;  1NP8 A;  4A4C A;  4DS7 A;  1LIN A;  3LCP C;  1MHO A;  1XFY O;  2L98 A;  1DJX A;  4E68 A;  1PUL A;  1JF0 A;  1CFC A;  1UHI A;  5AFP A;  2F3Z A;  3TDZ A;  4MSP A;  1S6C A;  5KSZ A;  1ZFS A;  2LHL A;  1BF5 A;  4ZCU A;  1UUS A;  2ZKM X;  1KWO B;  1B47 A;  2HPS A;  2LAN A;  4P5O E;  2L0P A;  2M29 A;  1OMV A;  1QJT A;  4YGE B;  1EXR A;  1YR5 A;  2E6W A;  3TDU A;  1Q80 A;  1S5G Y;  3JVT B;  5ER4 X;  2BBM A;  3TUY B;  1H4B A;  1GGZ A;  1UHK A;  2A4J A;  1QX5 B;  1TN4 A;  3CWG A;  2CCM A;  4ICB A;  3BYA A;  1XVJ A;  2K7O A;  1KK8 B;  1IRJ A;  3SIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...