2P6BB

Crystal structure of human calcineurin in complex with pvivit peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
146
structure length
146
Chain Sequence
DADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PVIVIT 14-mer Peptide
publication title Structure of calcineurin in complex with PVIVIT peptide: Portrait of a low-affinity signalling interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 54
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2p6bB00
1UUSA 1NP8A 1YR5A 2L2EA 3KHEA 2M49B 2M3WA 5AERA 1CDPA 3WXAA 1R2UA 2K2FA 1S5GZ 1UP5A 1MWNA 3CTNA 3ICBA 3MSEB 1K90D 1EL4A 1HT9A 2ZN8A 3KEVA 2KFFA 3CR4X 4MSPA 1WRKA 2H61C 3SG3A 2DOQA 5BPJA 3FS7A 1F4QA 1FPWA 3AAKA 2CNPA 3SG7A 2LHLA 1NWDA 1B9AA 1OZSA 2HF5A 1UHHA 3DVEA 4OV2A 1QASA 4PE1A 1PVBA 3WHUB 2M1KB 4MBEA 4XJKA 2L50A 2PMYA 2L98A 2LVKA 4ZCVA 2O5GA 1BJFA 1KQVA 2M9GA 2WCBA 1MQ1A 1NX0A 3WHTB 2CCMA 2KI6D 1SW8A 2VRGA 3QRXA 2EHBA 1C7WA 5DKNA 2BCXA 4JWQA 1E8AA 1J1DA 4GGNA 1ALVA 1YRTB 1KK7Y 5G08A 1K8UA 1NCZA 1S3PA 1XA5A 2KI4C 3H4SE 1QV1A 2KBIA 2IS9A 3A8RA 4JQ0D 1TNWA 3SG6A 1NCXA 1G33A 3K21A 4GPLB 2K7CA 1JF0A 2ZRTA 2Y5IA 5AXIA 3LLEA 1KCYA 2Q91A 3I5HC 1IQ5A 2MJWB 3TUYC 1IJ6A 1DJZA 2F3YA 1YUUA 2JU0A 1SKTA 3C1VA 3I5IC 3A4UB 3BQ3A 2ZKMX 5HYDA 1J55A 2LUXA 2KI6C 1WLMA 2NZ0A 1NX1A 3VROA 1FI6A 1KWOC 2KQ6A 2CTNA 1QVIZ 1CLLA 2OTGC 4MRXA 1F70A 1YTZC 3VRNA 1CFPA 2BBNA 1F8HA 4GGFA 1SRAA 2LM5A 1OMVA 3VRQA 1IKUA 2GV5A 2H61A 2BL0C 2WORA 2LLSA 3NSIA 1KQMB 1WY9A 1QIVA 2SCPA 1WDCC 5HLVA 1KSMA 5HKZA 3JTDC 1H4BA 4N1GA 1EXRA 1QX7A 2LAPA 1C7VA 3PALA 1WRLA 1KK8C 2F3ZA 1J7OA 2I18A 3FWCA 1SR6B 2LVIA 4I5NB 2JXCA 3SG4A 2WOSA 2G9BA 1BU3A 1A4PA 2BCAA 3BUWB 3AKBA 1CFDA 1XFZO 3BUMB 2AMIA 4DIRA 2F8PA 4FTGA 1NX2A 2Q4UA 1SCMC 5CSNA 4F0ZB 2M0RA 5FYXA 1B4CA 2K7BA 1B1GA 1IQ3A 1LA0A 2L51A 1QIWA 4PHNA 1ZFSA 2PALA 4C0LA 1F71A 2KYFA 2PASA 2EGDA 4E68A 3DVJA 2K8MB 2MAZA 5CSFA 4BY5A 1DVIA 4HSZA 1AHRA 3EVUA 4ETOA 2MLFC 2MLEC 1B8CA 4XJKB 3RLZA 4HRGA 4MZKA 1K9KA 1NIWA 1XK4A 3SJSA 1S36A 2K7DA 5ER5A 2JOJA 2JQ6A 3EKHA 2L0PA 3HX4A 2JXLA 2LHIA 1UHNA 4TNCA 1PVAA 3DD4A 1V1GA 4CFQA 3LCPC 1B47A 2M1UA 1MUXA 1S26D 1JUOA 2ZN9A 1M46A 2SASA 2BE6A 2O60A 1SPYA 3EVVA 1BG1A 2JULA 2KGRA 1FW4A 5HKWA 3NSKA 4MZLA 1UHKA 2QPTA 3TS5C 2WCFA 1B7TZ 1YRUB 3CR2A 2FJUB 3ZNIA 1S6CA 2KQYA 1DGVA 4QJ4B 5K89A 5DKRA 1CDMA 1J1EA 1YX8A 4ORBB 3OHMB 3JVTB 3GK2A 3NSLA 5D7FA 4N1FA 3CS1A 5J3XA 4JPZB 1CFCA 3OB2B 3M0WA 1EG4A 2KSPA 1L2OC 1KSOA 1IRJA 2LE9B 4CPVA 1PK0D 1TCOB 2BECA 1XO5A 1CDNA 1SNLA 4M2QA 1ZOTB 1RROA 1M39A 1K9UA 2KBMA 4PE4A 2ZRSA 1CNPA 1DMOA 1RWYA 1F55A 2KGBC 3GK4X 1V1FA 3VRRA 2LP2A 1ZMZA 1EJ3A 3I5FB 1BR4B 2NCPA 2GGZA 3OP0A 4YGCB 2LVVA 1CM1A 1KFXS 1M31A 1S5GY 3CGAA 2M7NA 4ICBA 4DRWA 2JC2A 2LMUA 1G4YR 4C0JA 2NLNA 1DJIA 4CLNA 1CMFA 3OX6A 4MRYA 4P5OE 5D69A 1RECA 4I5JA 2P6BB 5I8NA 1DJGA 4FQOA 1EG3A 1Y1XA 3TZ1A 1RJVA 2JNFA 1ODBA 2A4JA 1A75A 2KNEA 1OMDA 1TCFA 2L4IA 4GUKA 2M7LA 2LVJA 2BKIB 2KI4B 3HCMA 2M97A 1OE9B 2QACA 3CZTX 1B8LA 3CR5X 3BUNB 5ER4X 1M63B 2JTTA 2KYCA 1BR1B 2M29A 2PRUA 4YGDB 3I5GB 3BOWA 2Y1NA 4A4BA 4AOMA 1F4OA 1ZUZA 1BMOA 2R2IA 1JWDA 2TN4A 1AJ4A 2ZNDA 3LK0A 1KFUS 1X02A 1KQMC 2NCOA 2WNDA 5F6TA 1EH2A 2EC6C 3IQQA 4ORAB 3WNXB 1PALA 2Y4QA 1DJYA 4UPGA 3O2PA 4MN0A 2BBMA 2LLTA 4MVFA 2OTGB 2FOTA 2BKHB 1SR6C 1MXLC 3CLNA 3SG5A 2COLB 3KPXA 4PCWA 2F33A 4L9MA 1CMGA 1K2HA 1AVSA 3VRPA 3AKAA 1RTP1 1TN4A 1QATA 3KO0A 4USLA 1J7QA 1WDCB 1QVIY 2JTZA 4WQ3A 4CIDA 2WCEA 3O4YA 3GOFA 4Q04A 1J7RA 5JOLA 3FWBA 1MR8A 1BLQA 1CFFA 1KK8B 1PSBA 2K7OA 4HREE 3GK1A 1S6IA 1SL8A 2ZNEA 3ZWHA 1ALWA 3EK8A 2RGIA 1FBVA 2OS8B 4NDDA 4BY4A 5AEQA 2KDHA 5KU1A 1CLMA 5I2OA 5CSIA 5KSZA 1XFXO 1NX3A 1DJHA 1QXPA 5I2LA 4PHJA 1LKJA 1OMRA 1DF0A 3LK1A 2I7AA 1N2DA 1OSAA 1U5IA 4HRHA 1SL7A 5I2QA 1UWOA 1N0YA 4QJ5B 1IH0A 2JRFA 1PULA 4M2PA 1GGZA 1K96A 4PE7A 2LC5A 1GJYA 4YBHB 1PSRA 3NSOA 2G2BA 5KTYA 1M45A 1S6JA 4I5LB 1VRKA 1Y0VH 3E3RA 1S1EA 1Y1AA 3D0YA 1UHIA 4GNKB 1AK8A 2F2OA 1YUSA 3SIAA 3KF9A 4MEWA 1Y6WA 3PN7B 3JVTC 2K2AA 5GQQC 2JT8A 1AJ5A 1A75B 1KFXL 1SCVA 2MA2A 3DF0A 4GBAA 2E6WA 1TNXA 1DJXA 4YGEB 5HLOA 2PVBA 2LCPA 3DVMA 3EVRA 1HQVA 5CSJA 1FF1A 2AUCA 1DGUA 1DTLA 1KK7Z 2K0JA 1SYMA 3AAJA 3BOWB 3TS5B 1C07A 4PDZA 4GGFC 1W7IB 1L7ZA 1NUBA 1J7PA 1JBAA 1D1OA 1CKKA 3BXKA 4MLWA 2KAVA 1YUTA 2BCBA 3I5FC 1FI5A 4YRUA 2JT3A 4IL1A 1A29A 1B7TY 1A2XA 1L2OB 4QJ3B 3DVKA 4NQGA 1XYDA 3OX5A 1CDLA 4OR9B 4CFRA 3PATA 1QJTA 3LL8B 1PRWA 1XFUO 4YGAA 1YVHA 2PSRA 1CTRA 1MXEA 2FCDA 4N5XA 2K61A 2Y1MA 3D10A 3TDIA 1YURA 2LV7A 1KFUL 1SY9A 2HQWA 2JZIA 2LMTA 2M8UA 4DCKA 4NDBA 2F2PA 3SG2A 1XVJA 1TNQA 4OKHA 3NXAA 4M2OA 1JF2A 1OOJA 1AUIB 1N65A 5DKQA 2L5XB 1RFJA 1XFWO 3CWGA 4P2YB 1K95A 4DUQA 3BYAA 4YI9A 3I5GC 2FCEA 2LMVA 4PHMA 2MBXA 2ZFDA 1NSHA 1TIZA 2CXJA 2HQ8A 3I5HB 1QX2A 5PALA 1YVLA 1SMGA 3TUYB 1K94A 1MF8B 2B1UA 4DS7A 3I5IB 1ZACA 1XK4C 4C0KA 1DT7B 2I94A 3TDZA 1UHJA 2HETA 1LXFC 1B8RA 4ZCUA 3PFVA 1OQPA 4ORCB 1QS7A 2KHNA 3TDUA 1KWOB 1DF0B 3IF7A 4PHKA 1U5IB 2I2RE 1NPQA 4OCIA 3RM1A 4AQJA 1LVCD 1RK9A 3EK7A 1QLSA 1BF5A 2KFHA 1G8IA 1QLKA 1SL9A 1K93D 2HPSA 5JJGA 2LNKA 3PM8A 4GFTA 1BODA 2KOTA 1GQMA 3PSRA 1BOCA 2BL0B 3FIAA 1YX7A 1TOPA 1NCYA 1SK6D 5HKYA 2EC6B 2H2KA 3D0YB 3JTDB 3SIBA 4YI8A 4D1EA 2LUCA 2CT9A 5CPVA 5B8IB 2BE4A 3IQOA 2JT0A 3PLFB 1A03A 4WRIA 1JFJA 3DF0B 3F45A 2LLUA 2OPOA 3O6BA 2OS8C 1IGVA 2LP3A 3EKJA 3O78A 2CBLA 2ISDA 2L4HA 2MRDA 1JFKA 1BT6A 1MHOA 1LA3A 4MZJA 1H8BA 4YGBB 4PE0A 1R6PA 1SCMB 1SBJA 1JSAA 1Y1UA 4A4CA 1TTXA 1IJ5A 1QTXA 1XFVO 2KFGA 3BUXB 1IG5A 2MHHA 5AFPA 1WLZA 1TRFA 1K9PA 2D8NA 3VGOA 2KAXA 2KAYA 4GAOA 5AANA 1CM4A 2JWWA 3OB1B 3BUOB 4XYNA 5TNCA 1DJWA 4I5KA 1IWQA 2LANA 2NXQA 1JC2A 2GGMA 1CLBA 2JPTA 3EK4A 1F54A 1OZOA 4U8DA 2AAOA 1QX5B 1W7JB 4WQ2A 1UURA 1LINA 2JNXA 1GGWA 4PALA 1Q80A 1AP4A 1WRZA 1XFYO 3PN7C 1TNPA 1QV0A 2WC8A 4OVNF 2E30A 1NYAA 4R1EA 4NDCA 5IBWA 1CB1A 4AQIA 2V53A
chains in the Genus database with same CATH superfamily
1UUSA 1NP8A 1YR5A 2L2EA 3KHEA 2M49B 2M3WA 5AERA 1CDPA 3D77A 3WXAA 1R2UA 2K2FA 1S5GZ 1UP5A 1MWNA 3CTNA 3ICBA 3MSEB 1K90D 1EL4A 1HT9A 2ZN8A 3KEVA 2KFFA 3CR4X 4MSPA 2KLEA 1WRKA 2H61C 3SG3A 5I94A 2DOQA 5BPJA 3FS7A 1F4QA 3S0DA 1FPWA 3AAKA 2CNPA 3SG7A 2LHLA 1NWDA 1B9AA 1OZSA 2HF5A 1UHHA 3DVEA 4OV2A 1QASA 4PE1A 1PVBA 3WHUB 2M1KB 4MBEA 4XJKA 2L50A 1XFRA 2PMYA 2L98A 2KLDA 2LVKA 2O5GA 4ZCVA 1BJFA 1KQVA 2M9GA 2WCBA 1MQ1A 1NX0A 3WHTB 2CCMA 2KI6D 2WCHA 1T14A 2P70A 1SW8A 2VRGA 3QRXA 2EHBA 1C7WA 5DKNA 2BCXA 4JWQA 1E8AA 1J1DA 4GGNA 3BFAA 1ALVA 1YRTB 1KK7Y 5G08A 1K8UA 1NCZA 1S3PA 1XA5A 2KI4C 3H4SE 3B6XA 1QV1A 2KBIA 2IS9A 3A8RA 4JQ0D 1TNWA 3SG6A 1NCXA 1G33A 3K21A 3L47A 2K7CA 4GPLB 1JF0A 3UO9A 2ZRTA 5FI2A 2Y5IA 5AXIA 3LLEA 1KCYA 2Q91A 2QEHA 3I5HC 1IQ5A 2MJWB 3NHIA 3TUYC 1DC1A 1IJ6A 1DJZA 2F3YA 1YUUA 2JU0A 1SKTA 3C1VA 3I5IC 3A4UB 3BQ3A 2ZKMX 2QEBA 5HYDA 1J55A 2LUXA 2KI6C 1WLMA 2NZ0A 1NX1A 3VROA 1FI6A 1KWOC 2KQ6A 3PM2A 2CTNA 1QVIZ 1CLLA 2OTGC 4MRXA 1F70A 1YTZC 3VRNA 1CFPA 2BBNA 1F8HA 4GGFA 1SRAA 2LM5A 1OMVA 3VRQA 1IKUA 2GV5A 2H61A 2BL0C 2WORA 2LLSA 3NSIA 1KQMB 1WY9A 1QIVA 2SCPA 1WDCC 5HLVA 1KSMA 5HKZA 3JTDC 3R1VA 1H4BA 4N1GA 5FI7A 1EXRA 1QX7A 2LAPA 1C7VA 3PALA 1WRLA 3BJHA 1KK8C 2F3ZA 1J7OA 2I18A 3FWCA 1SR6B 2LVIA 4I5NB 2JXCA 3SG4A 2WOSA 2G9BA 1BU3A 1A4PA 2BCAA 3BUWB 3AKBA 1CFDA 1XFZO 3BUMB 2AMIA 4DIRA 2F8PA 4FTGA 1NX2A 2Q4UA 3SS4A 1SCMC 5CSNA 4F0ZB 2JPOA 2M0RA 5FYXA 1B4CA 2K7BA 1B1GA 1IQ3A 1LA0A 2L51A 1QIWA 4PHNA 1ZFSA 2PALA 4C0LA 3NHTA 2KYFA 1F71A 2PASA 2EGDA 4E68A 3DVJA 2K8MB 2MAZA 2QDIA 5CSFA 3VB1A 3O4XA 4BY5A 1DVIA 4HSZA 1IIOA 1AHRA 3EVUA 4ETOA 2MLFC 2MLEC 1B8CA 4XJKB 3RLZA 4HRGA 4MZKA 1K9KA 1NIWA 1XK4A 3SJSA 3CDNA 1S36A 3L4LA 2K7DA 5ER5A 3IVTA 2JOJA 2JQ6A 3EKHA 2L0PA 3HX4A 1Z2CB 2PQLA 2WC6A 2JXLA 2LHIA 1UHNA 4TNCA 1PVAA 3DD4A 3R72A 1V1GA 4CFQA 3LCPC 1B47A 2M1UA 1MUXA 1S26D 1JUOA 2ZN9A 3D75A 1M46A 2SASA 2BE6A 2O60A 1SPYA 3EVVA 1BG1A 2JULA 2KGRA 1FW4A 5HKWA 1W9ZA 3NSKA 4MZLA 3B87A 1UHKA 2QPTA 3TS5C 2WCFA 1B7TZ 1YRUB 3CR2A 2FJUB 3ZNIA 1S6CA 2KQYA 1DGVA 4QJ4B 5K89A 5DKRA 1CDMA 1J1EA 1YX8A 4ORBB 3OHMB 3JVTB 3GK2A 3NSLA 4KYNA 5D7FA 4N1FA 3CS1A 1Z4HA 4JPZB 5J3XA 1CFCA 3OB2B 3M0WA 1EG4A 3FE9A 3DYEA 2KSPA 1L2OC 1KSOA 1IRJA 2LE9B 3K1EA 1PK0D 1SSEB 1TCOB 2BECA 4PT1A 4CPVA 1XO5A 1CDNA 1SNLA 4M2QA 1ZOTB 1RROA 1M39A 1K9UA 2KBMA 4PE4A 2ZRSA 1CNPA 3CZ2A 1DMOA 1RWYA 1F55A 2KGBC 3GK4X 1V1FA 3VRRA 2LP2A 1ZMZA 1EJ3A 3I5FB 1BR4B 1P28A 2NCPA 2GGZA 3OP0A 4YGCB 2LVVA 1CM1A 1KFXS 1M31A 1S5GY 3CGAA 2M7NA 4ICBA 3SS5A 2JC2A 4DRWA 2LMUA 1G4YR 4C0JA 2NLNA 1DJIA 4CLNA 1CMFA 3OX6A 4MRYA 4P5OE 5D69A 1RECA 3RZSA 4I5JA 2P6BB 5I8NA 1DJGA 4FQOA 1EG3A 1Y1XA 3TZ1A 1RJVA 2JNFA 1ODBA 2A4JA 1A75A 2KNEA 1OMDA 1TCFA 2L4IA 4GUKA 2M7LA 1ORGA 2LVJA 2BKIB 3R1OA 2KI4B 3HCMA 2M97A 1OE9B 2QACA 3CZTX 1B8LA 3CR5X 3BUNB 5ER4X 3DXLA 2BNXA 1M63B 2JTTA 2KYCA 1BR1B 2M29A 2PRUA 4YGDB 3I5GB 3BOWA 5HL1A 2Y1NA 4A4BA 4AOMA 2QEVA 1F4OA 1ZUZA 1BMOA 3R1PA 2R2IA 4IJ7A 1JWDA 2TN4A 1AJ4A 2ZNDA 3LK0A 1KFUS 1X02A 1KQMC 2NCOA 2WNDA 5F6TA 4F7FA 2EC6C 3IQQA 3FE6A 4ORAB 1EH2A 3WNXB 1PALA 2Y4QA 1DJYA 4UPGA 3O2PA 4MN0A 2BBMA 2LLTA 3Q8IA 4MVFA 2OTGB 2FOTA 2BKHB 1SR6C 1MXLC 1TUJA 3CLNA 3D76A 2COLB 3KPXA 3SG5A 4PCWA 2F33A 4L9MA 1CMGA 1K2HA 1AVSA 3VRPA 3AKAA 3CZ0A 1RTP1 1TN4A 1QATA 3KO0A 1TWOA 4USLA 1J7QA 1WDCB 1QVIY 2JTZA 1DEKA 4WQ3A 4CIDA 2H8VA 2WCEA 3O4YA 3GOFA 4Q04A 1J7RA 5JOLA 3FWBA 1MR8A 1BLQA 1CFFA 1KK8B 1PSBA 4FQTA 2K7OA 4HREE 3GK1A 1S6IA 1SL8A 2ZNEA 1OOGA 3ZWHA 1ALWA 3EK8A 3NGVA 2RGIA 1FBVA 2OS8B 2YGUA 4NDDA 4BY4A 1LS8A 5AEQA 2KDHA 5KU1A 3B88A 1CLMA 5I2OA 5CSIA 5KSZA 1XFXO 1NX3A 1DJHA 1QXPA 5I2LA 4PHJA 4OZDA 1LKJA 1OMRA 1DF0A 3DZTA 2I7AA 1N2DA 1OSAA 1U5IA 3LK1A 1SL7A 4HRHA 1UWOA 1N0YA 4QJ5B 5I2QA 2JRFA 1IH0A 1PULA 4M2PA 5EL2A 2QEOA 1GGZA 2BAPA 1K96A 3L4AA 4PE7A 1OOHA 2LC5A 1GJYA 4YBHB 1PSRA 3NSOA 3S0BA 2G2BA 5KTYA 1M45A 1S6JA 3OGNA 4I5LB 1VRKA 1Y0VH 3E3RA 3PJIA 1S1EA 1Y1AA 3D0YA 1UHIA 4GNKB 1AK8A 2F2OA 1YUSA 3SIAA 3KF9A 4MEWA 1Y6WA 3PN7B 3JVTC 2K2AA 5GQQC 2JT8A 1AJ5A 1A75B 1KFXL 1SCVA 2MA2A 3D74A 5DICA 3DF0A 4GBAA 2E6WA 3D78A 1TNXA 1DJXA 4YGEB 5HLOA 2PVBA 2LCPA 3DVMA 3EVRA 1HQVA 5CSJA 1FF1A 2WCJA 2AUCA 1DGUA 1DTLA 1KK7Z 2K0JA 1SYMA 3AAJA 3BOWB 3D73A 3TS5B 1C07A 4PDZA 4GGFC 1W7IB 1L7ZA 2PYQA 1NUBA 1J7PA 3B7AA 1JBAA 1D1OA 1CKKA 3BXKA 4MLWA 2KAVA 2FJYA 1YUTA 2BCBA 3EG5B 3I5FC 4YRUA 1FI5A 2JT3A 3DY9A 4IL1A 1A29A 1B7TY 1A2XA 1L2OB 1OOFA 4QJ3B 3DVKA 4NQGA 1XYDA 3OX5A 1CDLA 4OR9B 4CFRA 3PATA 1QJTA 3LL8B 2L5YA 1PRWA 1XFUO 4YGAA 1YVHA 1GM0A 2PSRA 1CTRA 1MXEA 2FCDA 4N5XA 2K61A 2Y1MA 3D10A 3TDIA 1YURA 2LV7A 1QWVA 1KFUL 1SY9A 2HQWA 2JZIA 1DQEA 2LMTA 2GTEA 2M8UA 4DCKA 4NDBA 2F2PA 3SG2A 1XVJA 1TNQA 4OKHA 3NXAA 4M2OA 1JF2A 1OOJA 1AUIB 1N65A 5DKQA 4INXA 2L5XB 1RFJA 1XFWO 3CWGA 4JKTA 4P2YB 1K95A 4DUQA 3BYAA 4YI9A 3I5GC 2FCEA 2LMVA 4PHMA 2MBXA 1OW4A 2ZFDA 1NSHA 1TIZA 2CXJA 2HQ8A 2WCMA 1QX2A 3I5HB 1YVLA 1SMGA 5PALA 3TUYB 1K94A 1MF8B 1TUZA 2B1UA 4DS7A 3I5IB 1ZACA 1XK4C 4C0KA 1DT7B 3S0GA 2I94A 3TDZA 1UHJA 2HETA 1LXFC 1B8RA 4ZCUA 3PFVA 1OQPA 2WCLA 4ORCB 3V2LA 1QS7A 2KHNA 3TDUA 2WC5A 1KWOB 1DF0B 3IF7A 4PHKA 1U5IB 2I2RE 1NPQA 4OCIA 3RM1A 4AQJA 1LVCD 1RK9A 3EK7A 1QLSA 1BF5A 2KFHA 1G8IA 1QLKA 1SL9A 1K93D 3S0FA 2HPSA 3FE8A 5JJGA 2LNKA 3PM8A 4GFTA 2WCKA 2KOTA 1GQMA 1BODA 1C3ZA 3PSRA 1BOCA 2BL0B 3CZ1A 3FIAA 1YX7A 1TOPA 1NCYA 1SK6D 3OBVA 3UNWA 2EC6B 2ERBA 5HKYA 2H2KA 3D0YB 3SS3A 3JTDB 3SIBA 3N7HA 4YI8A 3CYZA 1DELA 4D1EA 1OOIX 2LUCA 2CT9A 5CPVA 5B8IB 2BE4A 4JD9A 3IQOA 2JT0A 3PLFB 3S0EA 4WRIA 3S0AA 1A03A 3DF0B 1JFJA 3F45A 2LLUA 2OPOA 3BFBA 3O6BA 2OS8C 1IGVA 2LP3A 3EKJA 3O78A 2CBLA 2ISDA 2L4HA 2MRDA 1JFKA 1BT6A 1MHOA 1LA3A 4MZJA 1H8BA 4YGBB 3CABA 1R6PA 1SCMB 4PE0A 1SBJA 5FI6A 1JSAA 1Y1UA 3B86A 4A4CA 1C3YA 1TTXA 1IJ5A 1QTXA 1XFVO 2KFGA 3BUXB 1IG5A 2MHHA 5AFPA 1WLZA 1TRFA 3BFHA 1K9PA 2D8NA 3VGOA 2KAXA 2KAYA 3QMEA 4GAOA 5AANA 1CM4A 2JWWA 3OB1B 3BUOB 4XYNA 5TNCA 1DJWA 4I5KA 1IWQA 2LANA 2NXQA 1JC2A 2GGMA 1CLBA 2JPTA 3EK4A 2L2CA 1F54A 1OZOA 4U8DA 5D3OA 2AAOA 2KPHA 1QX5B 1W7JB 2K60A 4WQ2A 2P71A 1UURA 1LINA 2JNXA 1GGWA 4PALA 1Q80A 1AP4A 1WRZA 1XFYO 3PN7C 1TNPA 1QV0A 2WC8A 4OVNF 2E30A 1NYAA 4R1EA 4INWA 4NDCA 5IBWA 1CB1A 4AQIA 2V53A
chains in the Genus database with same CATH topology
1UUSA 1NP8A 1YR5A 2L2EA 3KHEA 2M49B 2M3WA 5AERA 1CDPA 3WXAA 1R2UA 2K2FA 1S5GZ 1UP5A 1MWNA 3CTNA 3ICBA 3MSEB 1K90D 1EL4A 1HT9A 2ZN8A 3KEVA 2KFFA 3CR4X 4MSPA 1WRKA 2H61C 3SG3A 2DOQA 5BPJA 3FS7A 1F4QA 1FPWA 3AAKA 2CNPA 3SG7A 2LHLA 1NWDA 1B9AA 1OZSA 2HF5A 1UHHA 3DVEA 4OV2A 1QASA 4PE1A 1PVBA 3WHUB 2M1KB 4MBEA 4XJKA 2L50A 2PMYA 2L98A 2LVKA 4ZCVA 2O5GA 1BJFA 1KQVA 2M9GA 2WCBA 1MQ1A 1NX0A 3WHTB 2CCMA 2KI6D 1SW8A 2VRGA 3QRXA 2EHBA 1C7WA 5DKNA 2BCXA 4JWQA 1E8AA 1J1DA 4GGNA 1ALVA 1YRTB 1KK7Y 5G08A 1K8UA 1NCZA 1S3PA 1XA5A 2KI4C 3H4SE 1QV1A 2KBIA 2IS9A 3A8RA 4JQ0D 1TNWA 3SG6A 1NCXA 1G33A 3K21A 4GPLB 2K7CA 1JF0A 2ZRTA 2Y5IA 5AXIA 3LLEA 1KCYA 2Q91A 3I5HC 1IQ5A 2MJWB 3TUYC 1IJ6A 1DJZA 2F3YA 1YUUA 2JU0A 1SKTA 3C1VA 3I5IC 3A4UB 3BQ3A 2ZKMX 5HYDA 1J55A 2LUXA 2KI6C 1WLMA 2NZ0A 1NX1A 3VROA 1FI6A 1KWOC 2KQ6A 2CTNA 1QVIZ 1CLLA 2OTGC 4MRXA 1F70A 1YTZC 3VRNA 1CFPA 2BBNA 1F8HA 4GGFA 1SRAA 2LM5A 1OMVA 3VRQA 1IKUA 2GV5A 2H61A 2BL0C 2WORA 2LLSA 3NSIA 1KQMB 1WY9A 1QIVA 2SCPA 1WDCC 5HLVA 1KSMA 5HKZA 3JTDC 1H4BA 4N1GA 1EXRA 1QX7A 2LAPA 1C7VA 3PALA 1WRLA 1KK8C 2F3ZA 1J7OA 2I18A 3FWCA 1SR6B 2LVIA 4I5NB 2JXCA 3SG4A 2WOSA 2G9BA 1BU3A 1A4PA 2BCAA 3BUWB 3AKBA 1CFDA 1XFZO 3BUMB 2AMIA 4DIRA 2F8PA 4FTGA 1NX2A 2Q4UA 1SCMC 5CSNA 4F0ZB 2M0RA 5FYXA 1B4CA 2K7BA 1B1GA 1IQ3A 1LA0A 2L51A 1QIWA 4PHNA 1ZFSA 2PALA 4C0LA 1F71A 2KYFA 2PASA 2EGDA 4E68A 3DVJA 2K8MB 2MAZA 5CSFA 4BY5A 1DVIA 4HSZA 1AHRA 3EVUA 4ETOA 2MLFC 2MLEC 1B8CA 4XJKB 3RLZA 4HRGA 4MZKA 1K9KA 1NIWA 1XK4A 3SJSA 1S36A 2K7DA 5ER5A 2JOJA 2JQ6A 3EKHA 2L0PA 3HX4A 2JXLA 2LHIA 1UHNA 4TNCA 1PVAA 3DD4A 1V1GA 4CFQA 3LCPC 1B47A 2M1UA 1MUXA 1S26D 1JUOA 2ZN9A 1M46A 2SASA 2BE6A 2O60A 1SPYA 3EVVA 1BG1A 2JULA 2KGRA 1FW4A 5HKWA 3NSKA 4MZLA 1UHKA 2QPTA 3TS5C 2WCFA 1B7TZ 1YRUB 3CR2A 2FJUB 3ZNIA 1S6CA 2KQYA 1DGVA 4QJ4B 5K89A 5DKRA 1CDMA 1J1EA 1YX8A 4ORBB 3OHMB 3JVTB 3GK2A 3NSLA 5D7FA 4N1FA 3CS1A 5J3XA 4JPZB 1CFCA 3OB2B 3M0WA 1EG4A 2KSPA 1L2OC 1KSOA 1IRJA 2LE9B 4CPVA 1PK0D 1TCOB 2BECA 1XO5A 1CDNA 1SNLA 4M2QA 1ZOTB 1RROA 1M39A 1K9UA 2KBMA 4PE4A 2ZRSA 1CNPA 1DMOA 1RWYA 1F55A 2KGBC 3GK4X 1V1FA 3VRRA 2LP2A 1ZMZA 1EJ3A 3I5FB 1BR4B 2NCPA 2GGZA 3OP0A 4YGCB 2LVVA 1CM1A 1KFXS 1M31A 1S5GY 3CGAA 2M7NA 4ICBA 4DRWA 2JC2A 2LMUA 1G4YR 4C0JA 2NLNA 1DJIA 4CLNA 1CMFA 3OX6A 4MRYA 4P5OE 5D69A 1RECA 4I5JA 2P6BB 5I8NA 1DJGA 4FQOA 1EG3A 1Y1XA 3TZ1A 1RJVA 2JNFA 1ODBA 2A4JA 1A75A 2KNEA 1OMDA 1TCFA 2L4IA 4GUKA 2M7LA 2LVJA 2BKIB 2KI4B 3HCMA 2M97A 1OE9B 2QACA 3CZTX 1B8LA 3CR5X 3BUNB 5ER4X 1M63B 2JTTA 2KYCA 1BR1B 2M29A 2PRUA 4YGDB 3I5GB 3BOWA 2Y1NA 4A4BA 4AOMA 1F4OA 1ZUZA 1BMOA 2R2IA 1JWDA 2TN4A 1AJ4A 2ZNDA 3LK0A 1KFUS 1X02A 1KQMC 2NCOA 2WNDA 5F6TA 1EH2A 2EC6C 3IQQA 4ORAB 3WNXB 1PALA 2Y4QA 1DJYA 4UPGA 3O2PA 4MN0A 2BBMA 2LLTA 4MVFA 2OTGB 2FOTA 2BKHB 1SR6C 1MXLC 3CLNA 3SG5A 2COLB 3KPXA 4PCWA 2F33A 4L9MA 1CMGA 1K2HA 1AVSA 3VRPA 3AKAA 1RTP1 1TN4A 1QATA 3KO0A 4USLA 1J7QA 1WDCB 1QVIY 2JTZA 4WQ3A 4CIDA 2WCEA 3O4YA 3GOFA 4Q04A 1J7RA 5JOLA 3FWBA 1MR8A 1BLQA 1CFFA 1KK8B 1PSBA 2K7OA 4HREE 3GK1A 1S6IA 1SL8A 2ZNEA 3ZWHA 1ALWA 3EK8A 2RGIA 1FBVA 2OS8B 4NDDA 4BY4A 5AEQA 2KDHA 5KU1A 1CLMA 5I2OA 5CSIA 5KSZA 1XFXO 1NX3A 1DJHA 1QXPA 5I2LA 4PHJA 1LKJA 1OMRA 1DF0A 3LK1A 2I7AA 1N2DA 1OSAA 1U5IA 4HRHA 1SL7A 5I2QA 1UWOA 1N0YA 4QJ5B 1IH0A 2JRFA 1PULA 4M2PA 1GGZA 1K96A 4PE7A 2LC5A 1GJYA 4YBHB 1PSRA 3NSOA 2G2BA 5KTYA 1M45A 1S6JA 4I5LB 1VRKA 1Y0VH 3E3RA 1S1EA 1Y1AA 3D0YA 1UHIA 4GNKB 1AK8A 2F2OA 1YUSA 3SIAA 3KF9A 4MEWA 1Y6WA 3PN7B 3JVTC 2K2AA 5GQQC 2JT8A 1AJ5A 1A75B 1KFXL 1SCVA 2MA2A 3DF0A 4GBAA 2E6WA 1TNXA 1DJXA 4YGEB 5HLOA 2PVBA 2LCPA 3DVMA 3EVRA 1HQVA 5CSJA 1FF1A 2AUCA 1DGUA 1DTLA 1KK7Z 2K0JA 1SYMA 3AAJA 3BOWB 3TS5B 1C07A 4PDZA 4GGFC 1W7IB 1L7ZA 1NUBA 1J7PA 1JBAA 1D1OA 1CKKA 3BXKA 4MLWA 2KAVA 1YUTA 2BCBA 3I5FC 1FI5A 4YRUA 2JT3A 4IL1A 1A29A 1B7TY 1A2XA 1L2OB 4QJ3B 3DVKA 4NQGA 1XYDA 3OX5A 1CDLA 4OR9B 4CFRA 3PATA 1QJTA 3LL8B 1PRWA 1XFUO 4YGAA 1YVHA 2PSRA 1CTRA 1MXEA 2FCDA 4N5XA 2K61A 2Y1MA 3D10A 3TDIA 1YURA 2LV7A 1KFUL 1SY9A 2HQWA 2JZIA 2LMTA 2M8UA 4DCKA 4NDBA 2F2PA 3SG2A 1XVJA 1TNQA 4OKHA 3NXAA 4M2OA 1JF2A 1OOJA 1AUIB 1N65A 5DKQA 2L5XB 1RFJA 1XFWO 3CWGA 4P2YB 1K95A 4DUQA 3BYAA 4YI9A 3I5GC 2FCEA 2LMVA 4PHMA 2MBXA 2ZFDA 1NSHA 1TIZA 2CXJA 2HQ8A 3I5HB 1QX2A 5PALA 1YVLA 1SMGA 3TUYB 1K94A 1MF8B 2B1UA 4DS7A 3I5IB 1ZACA 1XK4C 4C0KA 1DT7B 2I94A 3TDZA 1UHJA 2HETA 1LXFC 1B8RA 4ZCUA 3PFVA 1OQPA 4ORCB 1QS7A 2KHNA 3TDUA 1KWOB 1DF0B 3IF7A 4PHKA 1U5IB 2I2RE 1NPQA 4OCIA 3RM1A 4AQJA 1LVCD 1RK9A 3EK7A 1QLSA 1BF5A 2KFHA 1G8IA 1QLKA 1SL9A 1K93D 2HPSA 5JJGA 2LNKA 3PM8A 4GFTA 1BODA 2KOTA 1GQMA 3PSRA 1BOCA 2BL0B 3FIAA 1YX7A 1TOPA 1NCYA 1SK6D 5HKYA 2EC6B 2H2KA 3D0YB 3JTDB 3SIBA 4YI8A 4D1EA 2LUCA 2CT9A 5CPVA 5B8IB 2BE4A 3IQOA 2JT0A 3PLFB 1A03A 4WRIA 1JFJA 3DF0B 3F45A 2LLUA 2OPOA 3O6BA 2OS8C 1IGVA 2LP3A 3EKJA 3O78A 2CBLA 2ISDA 2L4HA 2MRDA 1JFKA 1BT6A 1MHOA 1LA3A 4MZJA 1H8BA 4YGBB 4PE0A 1R6PA 1SCMB 1SBJA 1JSAA 1Y1UA 4A4CA 1TTXA 1IJ5A 1QTXA 1XFVO 2KFGA 3BUXB 1IG5A 2MHHA 5AFPA 1WLZA 1TRFA 1K9PA 2D8NA 3VGOA 2KAXA 2KAYA 4GAOA 5AANA 1CM4A 2JWWA 3OB1B 3BUOB 4XYNA 5TNCA 1DJWA 4I5KA 1IWQA 2LANA 2NXQA 1JC2A 2GGMA 1CLBA 2JPTA 3EK4A 1F54A 1OZOA 4U8DA 2AAOA 1QX5B 1W7JB 4WQ2A 1UURA 1LINA 2JNXA 1GGWA 4PALA 1Q80A 1AP4A 1WRZA 1XFYO 3PN7C 1TNPA 1QV0A 2WC8A 4OVNF 2E30A 1NYAA 4R1EA 4NDCA 5IBWA 1CB1A 4AQIA 2V53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUS A;  1NP8 A;  1YR5 A;  2L2E A;  3KHE A;  2M49 B;  2M3W A;  5AER A;  1CDP A;  3WXA A;  1R2U A;  2K2F A;  1S5G Z;  1UP5 A;  1MWN A;  3CTN A;  3ICB A;  3MSE B;  1K90 D;  1EL4 A;  1HT9 A;  2ZN8 A;  3KEV A;  2KFF A;  3CR4 X;  4MSP A;  1WRK A;  2H61 C;  3SG3 A;  2DOQ A;  5BPJ A;  3FS7 A;  1F4Q A;  1FPW A;  3AAK A;  2CNP A;  3SG7 A;  2LHL A;  1NWD A;  1B9A A;  1OZS A;  2HF5 A;  1UHH A;  3DVE A;  4OV2 A;  1QAS A;  4PE1 A;  1PVB A;  3WHU B;  2M1K B;  4MBE A;  4XJK A;  2L50 A;  2PMY A;  2L98 A;  2LVK A;  4ZCV A;  2O5G A;  1BJF A;  1KQV A;  2M9G A;  2WCB A;  1MQ1 A;  1NX0 A;  3WHT B;  2CCM A;  2KI6 D;  1SW8 A;  2VRG A;  3QRX A;  2EHB A;  1C7W A;  5DKN A;  2BCX A;  4JWQ A;  1E8A A;  1J1D A;  4GGN A;  1ALV A;  1YRT B;  1KK7 Y;  5G08 A;  1K8U A;  1NCZ A;  1S3P A;  1XA5 A;  2KI4 C;  3H4S E;  1QV1 A;  2KBI A;  2IS9 A;  3A8R A;  4JQ0 D;  1TNW A;  3SG6 A;  1NCX A;  1G33 A;  3K21 A;  4GPL B;  2K7C A;  1JF0 A;  2ZRT A;  2Y5I A;  5AXI A;  3LLE A;  1KCY A;  2Q91 A;  3I5H C;  1IQ5 A;  2MJW B;  3TUY C;  1IJ6 A;  1DJZ A;  2F3Y A;  1YUU A;  2JU0 A;  1SKT A;  3C1V A;  3I5I C;  3A4U B;  3BQ3 A;  2ZKM X;  5HYD A;  1J55 A;  2LUX A;  2KI6 C;  1WLM A;  2NZ0 A;  1NX1 A;  3VRO A;  1FI6 A;  1KWO C;  2KQ6 A;  2CTN A;  1QVI Z;  1CLL A;  2OTG C;  4MRX A;  1F70 A;  1YTZ C;  3VRN A;  1CFP A;  2BBN A;  1F8H A;  4GGF A;  1SRA A;  2LM5 A;  1OMV A;  3VRQ A;  1IKU A;  2GV5 A;  2H61 A;  2BL0 C;  2WOR A;  2LLS A;  3NSI A;  1KQM B;  1WY9 A;  1QIV A;  2SCP A;  1WDC C;  5HLV A;  1KSM A;  5HKZ A;  3JTD C;  1H4B A;  4N1G A;  1EXR A;  1QX7 A;  2LAP A;  1C7V A;  3PAL A;  1WRL A;  1KK8 C;  2F3Z A;  1J7O A;  2I18 A;  3FWC A;  1SR6 B;  2LVI A;  4I5N B;  2JXC A;  3SG4 A;  2WOS A;  2G9B A;  1BU3 A;  1A4P A;  2BCA A;  3BUW B;  3AKB A;  1CFD A;  1XFZ O;  3BUM B;  2AMI A;  4DIR A;  2F8P A;  4FTG A;  1NX2 A;  2Q4U A;  1SCM C;  5CSN A;  4F0Z B;  2M0R A;  5FYX A;  1B4C A;  2K7B A;  1B1G A;  1IQ3 A;  1LA0 A;  2L51 A;  1QIW A;  4PHN A;  1ZFS A;  2PAL A;  4C0L A;  1F71 A;  2KYF A;  2PAS A;  2EGD A;  4E68 A;  3DVJ A;  2K8M B;  2MAZ A;  5CSF A;  4BY5 A;  1DVI A;  4HSZ A;  1AHR A;  3EVU A;  4ETO A;  2MLF C;  2MLE C;  1B8C A;  4XJK B;  3RLZ A;  4HRG A;  4MZK A;  1K9K A;  1NIW A;  1XK4 A;  3SJS A;  1S36 A;  2K7D A;  5ER5 A;  2JOJ A;  2JQ6 A;  3EKH A;  2L0P A;  3HX4 A;  2JXL A;  2LHI A;  1UHN A;  4TNC A;  1PVA A;  3DD4 A;  1V1G A;  4CFQ A;  3LCP C;  1B47 A;  2M1U A;  1MUX A;  1S26 D;  1JUO A;  2ZN9 A;  1M46 A;  2SAS A;  2BE6 A;  2O60 A;  1SPY A;  3EVV A;  1BG1 A;  2JUL A;  2KGR A;  1FW4 A;  5HKW A;  3NSK A;  4MZL A;  1UHK A;  2QPT A;  3TS5 C;  2WCF A;  1B7T Z;  1YRU B;  3CR2 A;  2FJU B;  3ZNI A;  1S6C A;  2KQY A;  1DGV A;  4QJ4 B;  5K89 A;  5DKR A;  1CDM A;  1J1E A;  1YX8 A;  4ORB B;  3OHM B;  3JVT B;  3GK2 A;  3NSL A;  5D7F A;  4N1F A;  3CS1 A;  5J3X A;  4JPZ B;  1CFC A;  3OB2 B;  3M0W A;  1EG4 A;  2KSP A;  1L2O C;  1KSO A;  1IRJ A;  2LE9 B;  4CPV A;  1PK0 D;  1TCO B;  2BEC A;  1XO5 A;  1CDN A;  1SNL A;  4M2Q A;  1ZOT B;  1RRO A;  1M39 A;  1K9U A;  2KBM A;  4PE4 A;  2ZRS A;  1CNP A;  1DMO A;  1RWY A;  1F55 A;  2KGB C;  3GK4 X;  1V1F A;  3VRR A;  2LP2 A;  1ZMZ A;  1EJ3 A;  3I5F B;  1BR4 B;  2NCP A;  2GGZ A;  3OP0 A;  4YGC B;  2LVV A;  1CM1 A;  1KFX S;  1M31 A;  1S5G Y;  3CGA A;  2M7N A;  4ICB A;  4DRW A;  2JC2 A;  2LMU A;  1G4Y R;  4C0J A;  2NLN A;  1DJI A;  4CLN A;  1CMF A;  3OX6 A;  4MRY A;  4P5O E;  5D69 A;  1REC A;  4I5J A;  2P6B B;  5I8N A;  1DJG A;  4FQO A;  1EG3 A;  1Y1X A;  3TZ1 A;  1RJV A;  2JNF A;  1ODB A;  2A4J A;  1A75 A;  2KNE A;  1OMD A;  1TCF A;  2L4I A;  4GUK A;  2M7L A;  2LVJ A;  2BKI B;  2KI4 B;  3HCM A;  2M97 A;  1OE9 B;  2QAC A;  3CZT X;  1B8L A;  3CR5 X;  3BUN B;  5ER4 X;  1M63 B;  2JTT A;  2KYC A;  1BR1 B;  2M29 A;  2PRU A;  4YGD B;  3I5G B;  3BOW A;  2Y1N A;  4A4B A;  4AOM A;  1F4O A;  1ZUZ A;  1BMO A;  2R2I A;  1JWD A;  2TN4 A;  1AJ4 A;  2ZND A;  3LK0 A;  1KFU S;  1X02 A;  1KQM C;  2NCO A;  2WND A;  5F6T A;  1EH2 A;  2EC6 C;  3IQQ A;  4ORA B;  3WNX B;  1PAL A;  2Y4Q A;  1DJY A;  4UPG A;  3O2P A;  4MN0 A;  2BBM A;  2LLT A;  4MVF A;  2OTG B;  2FOT A;  2BKH B;  1SR6 C;  1MXL C;  3CLN A;  3SG5 A;  2COL B;  3KPX A;  4PCW A;  2F33 A;  4L9M A;  1CMG A;  1K2H A;  1AVS A;  3VRP A;  3AKA A;  1RTP 1;  1TN4 A;  1QAT A;  3KO0 A;  4USL A;  1J7Q A;  1WDC B;  1QVI Y;  2JTZ A;  4WQ3 A;  4CID A;  2WCE A;  3O4Y A;  3GOF A;  4Q04 A;  1J7R A;  5JOL A;  3FWB A;  1MR8 A;  1BLQ A;  1CFF A;  1KK8 B;  1PSB A;  2K7O A;  4HRE E;  3GK1 A;  1S6I A;  1SL8 A;  2ZNE A;  3ZWH A;  1ALW A;  3EK8 A;  2RGI A;  1FBV A;  2OS8 B;  4NDD A;  4BY4 A;  5AEQ A;  2KDH A;  5KU1 A;  1CLM A;  5I2O A;  5CSI A;  5KSZ A;  1XFX O;  1NX3 A;  1DJH A;  1QXP A;  5I2L A;  4PHJ A;  1LKJ A;  1OMR A;  1DF0 A;  3LK1 A;  2I7A A;  1N2D A;  1OSA A;  1U5I A;  4HRH A;  1SL7 A;  5I2Q A;  1UWO A;  1N0Y A;  4QJ5 B;  1IH0 A;  2JRF A;  1PUL A;  4M2P A;  1GGZ A;  1K96 A;  4PE7 A;  2LC5 A;  1GJY A;  4YBH B;  1PSR A;  3NSO A;  2G2B A;  5KTY A;  1M45 A;  1S6J A;  4I5L B;  1VRK A;  1Y0V H;  3E3R A;  1S1E A;  1Y1A A;  3D0Y A;  1UHI A;  4GNK B;  1AK8 A;  2F2O A;  1YUS A;  3SIA A;  3KF9 A;  4MEW A;  1Y6W A;  3PN7 B;  3JVT C;  2K2A A;  5GQQ C;  2JT8 A;  1AJ5 A;  1A75 B;  1KFX L;  1SCV A;  2MA2 A;  3DF0 A;  4GBA A;  2E6W A;  1TNX A;  1DJX A;  4YGE B;  5HLO A;  2PVB A;  2LCP A;  3DVM A;  3EVR A;  1HQV A;  5CSJ A;  1FF1 A;  2AUC A;  1DGU A;  1DTL A;  1KK7 Z;  2K0J A;  1SYM A;  3AAJ A;  3BOW B;  3TS5 B;  1C07 A;  4PDZ A;  4GGF C;  1W7I B;  1L7Z A;  1NUB A;  1J7P A;  1JBA A;  1D1O A;  1CKK A;  3BXK A;  4MLW A;  2KAV A;  1YUT A;  2BCB A;  3I5F C;  1FI5 A;  4YRU A;  2JT3 A;  4IL1 A;  1A29 A;  1B7T Y;  1A2X A;  1L2O B;  4QJ3 B;  3DVK A;  4NQG A;  1XYD A;  3OX5 A;  1CDL A;  4OR9 B;  4CFR A;  3PAT A;  1QJT A;  3LL8 B;  1PRW A;  1XFU O;  4YGA A;  1YVH A;  2PSR A;  1CTR A;  1MXE A;  2FCD A;  4N5X A;  2K61 A;  2Y1M A;  3D10 A;  3TDI A;  1YUR A;  2LV7 A;  1KFU L;  1SY9 A;  2HQW A;  2JZI A;  2LMT A;  2M8U A;  4DCK A;  4NDB A;  2F2P A;  3SG2 A;  1XVJ A;  1TNQ A;  4OKH A;  3NXA A;  4M2O A;  1JF2 A;  1OOJ A;  1AUI B;  1N65 A;  5DKQ A;  2L5X B;  1RFJ A;  1XFW O;  3CWG A;  4P2Y B;  1K95 A;  4DUQ A;  3BYA A;  4YI9 A;  3I5G C;  2FCE A;  2LMV A;  4PHM A;  2MBX A;  2ZFD A;  1NSH A;  1TIZ A;  2CXJ A;  2HQ8 A;  3I5H B;  1QX2 A;  5PAL A;  1YVL A;  1SMG A;  3TUY B;  1K94 A;  1MF8 B;  2B1U A;  4DS7 A;  3I5I B;  1ZAC A;  1XK4 C;  4C0K A;  1DT7 B;  2I94 A;  3TDZ A;  1UHJ A;  2HET A;  1LXF C;  1B8R A;  4ZCU A;  3PFV A;  1OQP A;  4ORC B;  1QS7 A;  2KHN A;  3TDU A;  1KWO B;  1DF0 B;  3IF7 A;  4PHK A;  1U5I B;  2I2R E;  1NPQ A;  4OCI A;  3RM1 A;  4AQJ A;  1LVC D;  1RK9 A;  3EK7 A;  1QLS A;  1BF5 A;  2KFH A;  1G8I A;  1QLK A;  1SL9 A;  1K93 D;  2HPS A;  5JJG A;  2LNK A;  3PM8 A;  4GFT A;  1BOD A;  2KOT A;  1GQM A;  3PSR A;  1BOC A;  2BL0 B;  3FIA A;  1YX7 A;  1TOP A;  1NCY A;  1SK6 D;  5HKY A;  2EC6 B;  2H2K A;  3D0Y B;  3JTD B;  3SIB A;  4YI8 A;  4D1E A;  2LUC A;  2CT9 A;  5CPV A;  5B8I B;  2BE4 A;  3IQO A;  2JT0 A;  3PLF B;  1A03 A;  4WRI A;  1JFJ A;  3DF0 B;  3F45 A;  2LLU A;  2OPO A;  3O6B A;  2OS8 C;  1IGV A;  2LP3 A;  3EKJ A;  3O78 A;  2CBL A;  2ISD A;  2L4H A;  2MRD A;  1JFK A;  1BT6 A;  1MHO A;  1LA3 A;  4MZJ A;  1H8B A;  4YGB B;  4PE0 A;  1R6P A;  1SCM B;  1SBJ A;  1JSA A;  1Y1U A;  4A4C A;  1TTX A;  1IJ5 A;  1QTX A;  1XFV O;  2KFG A;  3BUX B;  1IG5 A;  2MHH A;  5AFP A;  1WLZ A;  1TRF A;  1K9P A;  2D8N A;  3VGO A;  2KAX A;  2KAY A;  4GAO A;  5AAN A;  1CM4 A;  2JWW A;  3OB1 B;  3BUO B;  4XYN A;  5TNC A;  1DJW A;  4I5K A;  1IWQ A;  2LAN A;  2NXQ A;  1JC2 A;  2GGM A;  1CLB A;  2JPT A;  3EK4 A;  1F54 A;  1OZO A;  4U8D A;  2AAO A;  1QX5 B;  1W7J B;  4WQ2 A;  1UUR A;  1LIN A;  2JNX A;  1GGW A;  4PAL A;  1Q80 A;  1AP4 A;  1WRZ A;  1XFY O;  3PN7 C;  1TNP A;  1QV0 A;  2WC8 A;  4OVN F;  2E30 A;  1NYA A;  4R1E A;  4NDC A;  5IBW A;  1CB1 A;  4AQI A;  2V53 A; 
#chains in the Genus database with same CATH topology
 1UUS A;  1NP8 A;  1YR5 A;  2L2E A;  3KHE A;  2M49 B;  2M3W A;  5AER A;  1CDP A;  3D77 A;  3WXA A;  1R2U A;  2K2F A;  1S5G Z;  1UP5 A;  1MWN A;  3CTN A;  3ICB A;  3MSE B;  1K90 D;  1EL4 A;  1HT9 A;  2ZN8 A;  3KEV A;  2KFF A;  3CR4 X;  4MSP A;  2KLE A;  1WRK A;  2H61 C;  3SG3 A;  5I94 A;  2DOQ A;  5BPJ A;  3FS7 A;  1F4Q A;  3S0D A;  1FPW A;  3AAK A;  2CNP A;  3SG7 A;  2LHL A;  1NWD A;  1B9A A;  1OZS A;  2HF5 A;  1UHH A;  3DVE A;  4OV2 A;  1QAS A;  4PE1 A;  1PVB A;  3WHU B;  2M1K B;  4MBE A;  4XJK A;  2L50 A;  1XFR A;  2PMY A;  2L98 A;  2KLD A;  2LVK A;  2O5G A;  4ZCV A;  1BJF A;  1KQV A;  2M9G A;  2WCB A;  1MQ1 A;  1NX0 A;  3WHT B;  2CCM A;  2KI6 D;  2WCH A;  1T14 A;  2P70 A;  1SW8 A;  2VRG A;  3QRX A;  2EHB A;  1C7W A;  5DKN A;  2BCX A;  4JWQ A;  1E8A A;  1J1D A;  4GGN A;  3BFA A;  1ALV A;  1YRT B;  1KK7 Y;  5G08 A;  1K8U A;  1NCZ A;  1S3P A;  1XA5 A;  2KI4 C;  3H4S E;  3B6X A;  1QV1 A;  2KBI A;  2IS9 A;  3A8R A;  4JQ0 D;  1TNW A;  3SG6 A;  1NCX A;  1G33 A;  3K21 A;  3L47 A;  2K7C A;  4GPL B;  1JF0 A;  3UO9 A;  2ZRT A;  5FI2 A;  2Y5I A;  5AXI A;  3LLE A;  1KCY A;  2Q91 A;  2QEH A;  3I5H C;  1IQ5 A;  2MJW B;  3NHI A;  3TUY C;  1DC1 A;  1IJ6 A;  1DJZ A;  2F3Y A;  1YUU A;  2JU0 A;  1SKT A;  3C1V A;  3I5I C;  3A4U B;  3BQ3 A;  2ZKM X;  2QEB A;  5HYD A;  1J55 A;  2LUX A;  2KI6 C;  1WLM A;  2NZ0 A;  1NX1 A;  3VRO A;  1FI6 A;  1KWO C;  2KQ6 A;  3PM2 A;  2CTN A;  1QVI Z;  1CLL A;  2OTG C;  4MRX A;  1F70 A;  1YTZ C;  3VRN A;  1CFP A;  2BBN A;  1F8H A;  4GGF A;  1SRA A;  2LM5 A;  1OMV A;  3VRQ A;  1IKU A;  2GV5 A;  2H61 A;  2BL0 C;  2WOR A;  2LLS A;  3NSI A;  1KQM B;  1WY9 A;  1QIV A;  2SCP A;  1WDC C;  5HLV A;  1KSM A;  5HKZ A;  3JTD C;  3R1V A;  1H4B A;  4N1G A;  5FI7 A;  1EXR A;  1QX7 A;  2LAP A;  1C7V A;  3PAL A;  1WRL A;  3BJH A;  1KK8 C;  2F3Z A;  1J7O A;  2I18 A;  3FWC A;  1SR6 B;  2LVI A;  4I5N B;  2JXC A;  3SG4 A;  2WOS A;  2G9B A;  1BU3 A;  1A4P A;  2BCA A;  3BUW B;  3AKB A;  1CFD A;  1XFZ O;  3BUM B;  2AMI A;  4DIR A;  2F8P A;  4FTG A;  1NX2 A;  2Q4U A;  3SS4 A;  1SCM C;  5CSN A;  4F0Z B;  2JPO A;  2M0R A;  5FYX A;  1B4C A;  2K7B A;  1B1G A;  1IQ3 A;  1LA0 A;  2L51 A;  1QIW A;  4PHN A;  1ZFS A;  2PAL A;  4C0L A;  3NHT A;  2KYF A;  1F71 A;  2PAS A;  2EGD A;  4E68 A;  3DVJ A;  2K8M B;  2MAZ A;  2QDI A;  5CSF A;  3VB1 A;  3O4X A;  4BY5 A;  1DVI A;  4HSZ A;  1IIO A;  1AHR A;  3EVU A;  4ETO A;  2MLF C;  2MLE C;  1B8C A;  4XJK B;  3RLZ A;  4HRG A;  4MZK A;  1K9K A;  1NIW A;  1XK4 A;  3SJS A;  3CDN A;  1S36 A;  3L4L A;  2K7D A;  5ER5 A;  3IVT A;  2JOJ A;  2JQ6 A;  3EKH A;  2L0P A;  3HX4 A;  1Z2C B;  2PQL A;  2WC6 A;  2JXL A;  2LHI A;  1UHN A;  4TNC A;  1PVA A;  3DD4 A;  3R72 A;  1V1G A;  4CFQ A;  3LCP C;  1B47 A;  2M1U A;  1MUX A;  1S26 D;  1JUO A;  2ZN9 A;  3D75 A;  1M46 A;  2SAS A;  2BE6 A;  2O60 A;  1SPY A;  3EVV A;  1BG1 A;  2JUL A;  2KGR A;  1FW4 A;  5HKW A;  1W9Z A;  3NSK A;  4MZL A;  3B87 A;  1UHK A;  2QPT A;  3TS5 C;  2WCF A;  1B7T Z;  1YRU B;  3CR2 A;  2FJU B;  3ZNI A;  1S6C A;  2KQY A;  1DGV A;  4QJ4 B;  5K89 A;  5DKR A;  1CDM A;  1J1E A;  1YX8 A;  4ORB B;  3OHM B;  3JVT B;  3GK2 A;  3NSL A;  4KYN A;  5D7F A;  4N1F A;  3CS1 A;  1Z4H A;  4JPZ B;  5J3X A;  1CFC A;  3OB2 B;  3M0W A;  1EG4 A;  3FE9 A;  3DYE A;  2KSP A;  1L2O C;  1KSO A;  1IRJ A;  2LE9 B;  3K1E A;  1PK0 D;  1SSE B;  1TCO B;  2BEC A;  4PT1 A;  4CPV A;  1XO5 A;  1CDN A;  1SNL A;  4M2Q A;  1ZOT B;  1RRO A;  1M39 A;  1K9U A;  2KBM A;  4PE4 A;  2ZRS A;  1CNP A;  3CZ2 A;  1DMO A;  1RWY A;  1F55 A;  2KGB C;  3GK4 X;  1V1F A;  3VRR A;  2LP2 A;  1ZMZ A;  1EJ3 A;  3I5F B;  1BR4 B;  1P28 A;  2NCP A;  2GGZ A;  3OP0 A;  4YGC B;  2LVV A;  1CM1 A;  1KFX S;  1M31 A;  1S5G Y;  3CGA A;  2M7N A;  4ICB A;  3SS5 A;  2JC2 A;  4DRW A;  2LMU A;  1G4Y R;  4C0J A;  2NLN A;  1DJI A;  4CLN A;  1CMF A;  3OX6 A;  4MRY A;  4P5O E;  5D69 A;  1REC A;  3RZS A;  4I5J A;  2P6B B;  5I8N A;  1DJG A;  4FQO A;  1EG3 A;  1Y1X A;  3TZ1 A;  1RJV A;  2JNF A;  1ODB A;  2A4J A;  1A75 A;  2KNE A;  1OMD A;  1TCF A;  2L4I A;  4GUK A;  2M7L A;  1ORG A;  2LVJ A;  2BKI B;  3R1O A;  2KI4 B;  3HCM A;  2M97 A;  1OE9 B;  2QAC A;  3CZT X;  1B8L A;  3CR5 X;  3BUN B;  5ER4 X;  3DXL A;  2BNX A;  1M63 B;  2JTT A;  2KYC A;  1BR1 B;  2M29 A;  2PRU A;  4YGD B;  3I5G B;  3BOW A;  5HL1 A;  2Y1N A;  4A4B A;  4AOM A;  2QEV A;  1F4O A;  1ZUZ A;  1BMO A;  3R1P A;  2R2I A;  4IJ7 A;  1JWD A;  2TN4 A;  1AJ4 A;  2ZND A;  3LK0 A;  1KFU S;  1X02 A;  1KQM C;  2NCO A;  2WND A;  5F6T A;  4F7F A;  2EC6 C;  3IQQ A;  3FE6 A;  4ORA B;  1EH2 A;  3WNX B;  1PAL A;  2Y4Q A;  1DJY A;  4UPG A;  3O2P A;  4MN0 A;  2BBM A;  2LLT A;  3Q8I A;  4MVF A;  2OTG B;  2FOT A;  2BKH B;  1SR6 C;  1MXL C;  1TUJ A;  3CLN A;  3D76 A;  2COL B;  3KPX A;  3SG5 A;  4PCW A;  2F33 A;  4L9M A;  1CMG A;  1K2H A;  1AVS A;  3VRP A;  3AKA A;  3CZ0 A;  1RTP 1;  1TN4 A;  1QAT A;  3KO0 A;  1TWO A;  4USL A;  1J7Q A;  1WDC B;  1QVI Y;  2JTZ A;  1DEK A;  4WQ3 A;  4CID A;  2H8V A;  2WCE A;  3O4Y A;  3GOF A;  4Q04 A;  1J7R A;  5JOL A;  3FWB A;  1MR8 A;  1BLQ A;  1CFF A;  1KK8 B;  1PSB A;  4FQT A;  2K7O A;  4HRE E;  3GK1 A;  1S6I A;  1SL8 A;  2ZNE A;  1OOG A;  3ZWH A;  1ALW A;  3EK8 A;  3NGV A;  2RGI A;  1FBV A;  2OS8 B;  2YGU A;  4NDD A;  4BY4 A;  1LS8 A;  5AEQ A;  2KDH A;  5KU1 A;  3B88 A;  1CLM A;  5I2O A;  5CSI A;  5KSZ A;  1XFX O;  1NX3 A;  1DJH A;  1QXP A;  5I2L A;  4PHJ A;  4OZD A;  1LKJ A;  1OMR A;  1DF0 A;  3DZT A;  2I7A A;  1N2D A;  1OSA A;  1U5I A;  3LK1 A;  1SL7 A;  4HRH A;  1UWO A;  1N0Y A;  4QJ5 B;  5I2Q A;  2JRF A;  1IH0 A;  1PUL A;  4M2P A;  5EL2 A;  2QEO A;  1GGZ A;  2BAP A;  1K96 A;  3L4A A;  4PE7 A;  1OOH A;  2LC5 A;  1GJY A;  4YBH B;  1PSR A;  3NSO A;  3S0B A;  2G2B A;  5KTY A;  1M45 A;  1S6J A;  3OGN A;  4I5L B;  1VRK A;  1Y0V H;  3E3R A;  3PJI A;  1S1E A;  1Y1A A;  3D0Y A;  1UHI A;  4GNK B;  1AK8 A;  2F2O A;  1YUS A;  3SIA A;  3KF9 A;  4MEW A;  1Y6W A;  3PN7 B;  3JVT C;  2K2A A;  5GQQ C;  2JT8 A;  1AJ5 A;  1A75 B;  1KFX L;  1SCV A;  2MA2 A;  3D74 A;  5DIC A;  3DF0 A;  4GBA A;  2E6W A;  3D78 A;  1TNX A;  1DJX A;  4YGE B;  5HLO A;  2PVB A;  2LCP A;  3DVM A;  3EVR A;  1HQV A;  5CSJ A;  1FF1 A;  2WCJ A;  2AUC A;  1DGU A;  1DTL A;  1KK7 Z;  2K0J A;  1SYM A;  3AAJ A;  3BOW B;  3D73 A;  3TS5 B;  1C07 A;  4PDZ A;  4GGF C;  1W7I B;  1L7Z A;  2PYQ A;  1NUB A;  1J7P A;  3B7A A;  1JBA A;  1D1O A;  1CKK A;  3BXK A;  4MLW A;  2KAV A;  2FJY A;  1YUT A;  2BCB A;  3EG5 B;  3I5F C;  4YRU A;  1FI5 A;  2JT3 A;  3DY9 A;  4IL1 A;  1A29 A;  1B7T Y;  1A2X A;  1L2O B;  1OOF A;  4QJ3 B;  3DVK A;  4NQG A;  1XYD A;  3OX5 A;  1CDL A;  4OR9 B;  4CFR A;  3PAT A;  1QJT A;  3LL8 B;  2L5Y A;  1PRW A;  1XFU O;  4YGA A;  1YVH A;  1GM0 A;  2PSR A;  1CTR A;  1MXE A;  2FCD A;  4N5X A;  2K61 A;  2Y1M A;  3D10 A;  3TDI A;  1YUR A;  2LV7 A;  1QWV A;  1KFU L;  1SY9 A;  2HQW A;  2JZI A;  1DQE A;  2LMT A;  2GTE A;  2M8U A;  4DCK A;  4NDB A;  2F2P A;  3SG2 A;  1XVJ A;  1TNQ A;  4OKH A;  3NXA A;  4M2O A;  1JF2 A;  1OOJ A;  1AUI B;  1N65 A;  5DKQ A;  4INX A;  2L5X B;  1RFJ A;  1XFW O;  3CWG A;  4JKT A;  4P2Y B;  1K95 A;  4DUQ A;  3BYA A;  4YI9 A;  3I5G C;  2FCE A;  2LMV A;  4PHM A;  2MBX A;  1OW4 A;  2ZFD A;  1NSH A;  1TIZ A;  2CXJ A;  2HQ8 A;  2WCM A;  1QX2 A;  3I5H B;  1YVL A;  1SMG A;  5PAL A;  3TUY B;  1K94 A;  1MF8 B;  1TUZ A;  2B1U A;  4DS7 A;  3I5I B;  1ZAC A;  1XK4 C;  4C0K A;  1DT7 B;  3S0G A;  2I94 A;  3TDZ A;  1UHJ A;  2HET A;  1LXF C;  1B8R A;  4ZCU A;  3PFV A;  1OQP A;  2WCL A;  4ORC B;  3V2L A;  1QS7 A;  2KHN A;  3TDU A;  2WC5 A;  1KWO B;  1DF0 B;  3IF7 A;  4PHK A;  1U5I B;  2I2R E;  1NPQ A;  4OCI A;  3RM1 A;  4AQJ A;  1LVC D;  1RK9 A;  3EK7 A;  1QLS A;  1BF5 A;  2KFH A;  1G8I A;  1QLK A;  1SL9 A;  1K93 D;  3S0F A;  2HPS A;  3FE8 A;  5JJG A;  2LNK A;  3PM8 A;  4GFT A;  2WCK A;  2KOT A;  1GQM A;  1BOD A;  1C3Z A;  3PSR A;  1BOC A;  2BL0 B;  3CZ1 A;  3FIA A;  1YX7 A;  1TOP A;  1NCY A;  1SK6 D;  3OBV A;  3UNW A;  2EC6 B;  2ERB A;  5HKY A;  2H2K A;  3D0Y B;  3SS3 A;  3JTD B;  3SIB A;  3N7H A;  4YI8 A;  3CYZ A;  1DEL A;  4D1E A;  1OOI X;  2LUC A;  2CT9 A;  5CPV A;  5B8I B;  2BE4 A;  4JD9 A;  3IQO A;  2JT0 A;  3PLF B;  3S0E A;  4WRI A;  3S0A A;  1A03 A;  3DF0 B;  1JFJ A;  3F45 A;  2LLU A;  2OPO A;  3BFB A;  3O6B A;  2OS8 C;  1IGV A;  2LP3 A;  3EKJ A;  3O78 A;  2CBL A;  2ISD A;  2L4H A;  2MRD A;  1JFK A;  1BT6 A;  1MHO A;  1LA3 A;  4MZJ A;  1H8B A;  4YGB B;  3CAB A;  1R6P A;  1SCM B;  4PE0 A;  1SBJ A;  5FI6 A;  1JSA A;  1Y1U A;  3B86 A;  4A4C A;  1C3Y A;  1TTX A;  1IJ5 A;  1QTX A;  1XFV O;  2KFG A;  3BUX B;  1IG5 A;  2MHH A;  5AFP A;  1WLZ A;  1TRF A;  3BFH A;  1K9P A;  2D8N A;  3VGO A;  2KAX A;  2KAY A;  3QME A;  4GAO A;  5AAN A;  1CM4 A;  2JWW A;  3OB1 B;  3BUO B;  4XYN A;  5TNC A;  1DJW A;  4I5K A;  1IWQ A;  2LAN A;  2NXQ A;  1JC2 A;  2GGM A;  1CLB A;  2JPT A;  3EK4 A;  2L2C A;  1F54 A;  1OZO A;  4U8D A;  5D3O A;  2AAO A;  2KPH A;  1QX5 B;  1W7J B;  2K60 A;  4WQ2 A;  2P71 A;  1UUR A;  1LIN A;  2JNX A;  1GGW A;  4PAL A;  1Q80 A;  1AP4 A;  1WRZ A;  1XFY O;  3PN7 C;  1TNP A;  1QV0 A;  2WC8 A;  4OVN F;  2E30 A;  1NYA A;  4R1E A;  4INW A;  4NDC A;  5IBW A;  1CB1 A;  4AQI A;  2V53 A; 
#chains in the Genus database with same CATH homology
 1UUS A;  1NP8 A;  1YR5 A;  2L2E A;  3KHE A;  2M49 B;  2M3W A;  5AER A;  1CDP A;  3WXA A;  1R2U A;  2K2F A;  1S5G Z;  1UP5 A;  1MWN A;  3CTN A;  3ICB A;  3MSE B;  1K90 D;  1EL4 A;  1HT9 A;  2ZN8 A;  3KEV A;  2KFF A;  3CR4 X;  4MSP A;  1WRK A;  2H61 C;  3SG3 A;  2DOQ A;  5BPJ A;  3FS7 A;  1F4Q A;  1FPW A;  3AAK A;  2CNP A;  3SG7 A;  2LHL A;  1NWD A;  1B9A A;  1OZS A;  2HF5 A;  1UHH A;  3DVE A;  4OV2 A;  1QAS A;  4PE1 A;  1PVB A;  3WHU B;  2M1K B;  4MBE A;  4XJK A;  2L50 A;  2PMY A;  2L98 A;  2LVK A;  4ZCV A;  2O5G A;  1BJF A;  1KQV A;  2M9G A;  2WCB A;  1MQ1 A;  1NX0 A;  3WHT B;  2CCM A;  2KI6 D;  1SW8 A;  2VRG A;  3QRX A;  2EHB A;  1C7W A;  5DKN A;  2BCX A;  4JWQ A;  1E8A A;  1J1D A;  4GGN A;  1ALV A;  1YRT B;  1KK7 Y;  5G08 A;  1K8U A;  1NCZ A;  1S3P A;  1XA5 A;  2KI4 C;  3H4S E;  1QV1 A;  2KBI A;  2IS9 A;  3A8R A;  4JQ0 D;  1TNW A;  3SG6 A;  1NCX A;  1G33 A;  3K21 A;  4GPL B;  2K7C A;  1JF0 A;  2ZRT A;  2Y5I A;  5AXI A;  3LLE A;  1KCY A;  2Q91 A;  3I5H C;  1IQ5 A;  2MJW B;  3TUY C;  1IJ6 A;  1DJZ A;  2F3Y A;  1YUU A;  2JU0 A;  1SKT A;  3C1V A;  3I5I C;  3A4U B;  3BQ3 A;  2ZKM X;  5HYD A;  1J55 A;  2LUX A;  2KI6 C;  1WLM A;  2NZ0 A;  1NX1 A;  3VRO A;  1FI6 A;  1KWO C;  2KQ6 A;  2CTN A;  1QVI Z;  1CLL A;  2OTG C;  4MRX A;  1F70 A;  1YTZ C;  3VRN A;  1CFP A;  2BBN A;  1F8H A;  4GGF A;  1SRA A;  2LM5 A;  1OMV A;  3VRQ A;  1IKU A;  2GV5 A;  2H61 A;  2BL0 C;  2WOR A;  2LLS A;  3NSI A;  1KQM B;  1WY9 A;  1QIV A;  2SCP A;  1WDC C;  5HLV A;  1KSM A;  5HKZ A;  3JTD C;  1H4B A;  4N1G A;  1EXR A;  1QX7 A;  2LAP A;  1C7V A;  3PAL A;  1WRL A;  1KK8 C;  2F3Z A;  1J7O A;  2I18 A;  3FWC A;  1SR6 B;  2LVI A;  4I5N B;  2JXC A;  3SG4 A;  2WOS A;  2G9B A;  1BU3 A;  1A4P A;  2BCA A;  3BUW B;  3AKB A;  1CFD A;  1XFZ O;  3BUM B;  2AMI A;  4DIR A;  2F8P A;  4FTG A;  1NX2 A;  2Q4U A;  1SCM C;  5CSN A;  4F0Z B;  2M0R A;  5FYX A;  1B4C A;  2K7B A;  1B1G A;  1IQ3 A;  1LA0 A;  2L51 A;  1QIW A;  4PHN A;  1ZFS A;  2PAL A;  4C0L A;  1F71 A;  2KYF A;  2PAS A;  2EGD A;  4E68 A;  3DVJ A;  2K8M B;  2MAZ A;  5CSF A;  4BY5 A;  1DVI A;  4HSZ A;  1AHR A;  3EVU A;  4ETO A;  2MLF C;  2MLE C;  1B8C A;  4XJK B;  3RLZ A;  4HRG A;  4MZK A;  1K9K A;  1NIW A;  1XK4 A;  3SJS A;  1S36 A;  2K7D A;  5ER5 A;  2JOJ A;  2JQ6 A;  3EKH A;  2L0P A;  3HX4 A;  2JXL A;  2LHI A;  1UHN A;  4TNC A;  1PVA A;  3DD4 A;  1V1G A;  4CFQ A;  3LCP C;  1B47 A;  2M1U A;  1MUX A;  1S26 D;  1JUO A;  2ZN9 A;  1M46 A;  2SAS A;  2BE6 A;  2O60 A;  1SPY A;  3EVV A;  1BG1 A;  2JUL A;  2KGR A;  1FW4 A;  5HKW A;  3NSK A;  4MZL A;  1UHK A;  2QPT A;  3TS5 C;  2WCF A;  1B7T Z;  1YRU B;  3CR2 A;  2FJU B;  3ZNI A;  1S6C A;  2KQY A;  1DGV A;  4QJ4 B;  5K89 A;  5DKR A;  1CDM A;  1J1E A;  1YX8 A;  4ORB B;  3OHM B;  3JVT B;  3GK2 A;  3NSL A;  5D7F A;  4N1F A;  3CS1 A;  5J3X A;  4JPZ B;  1CFC A;  3OB2 B;  3M0W A;  1EG4 A;  2KSP A;  1L2O C;  1KSO A;  1IRJ A;  2LE9 B;  4CPV A;  1PK0 D;  1TCO B;  2BEC A;  1XO5 A;  1CDN A;  1SNL A;  4M2Q A;  1ZOT B;  1RRO A;  1M39 A;  1K9U A;  2KBM A;  4PE4 A;  2ZRS A;  1CNP A;  1DMO A;  1RWY A;  1F55 A;  2KGB C;  3GK4 X;  1V1F A;  3VRR A;  2LP2 A;  1ZMZ A;  1EJ3 A;  3I5F B;  1BR4 B;  2NCP A;  2GGZ A;  3OP0 A;  4YGC B;  2LVV A;  1CM1 A;  1KFX S;  1M31 A;  1S5G Y;  3CGA A;  2M7N A;  4ICB A;  4DRW A;  2JC2 A;  2LMU A;  1G4Y R;  4C0J A;  2NLN A;  1DJI A;  4CLN A;  1CMF A;  3OX6 A;  4MRY A;  4P5O E;  5D69 A;  1REC A;  4I5J A;  2P6B B;  5I8N A;  1DJG A;  4FQO A;  1EG3 A;  1Y1X A;  3TZ1 A;  1RJV A;  2JNF A;  1ODB A;  2A4J A;  1A75 A;  2KNE A;  1OMD A;  1TCF A;  2L4I A;  4GUK A;  2M7L A;  2LVJ A;  2BKI B;  2KI4 B;  3HCM A;  2M97 A;  1OE9 B;  2QAC A;  3CZT X;  1B8L A;  3CR5 X;  3BUN B;  5ER4 X;  1M63 B;  2JTT A;  2KYC A;  1BR1 B;  2M29 A;  2PRU A;  4YGD B;  3I5G B;  3BOW A;  2Y1N A;  4A4B A;  4AOM A;  1F4O A;  1ZUZ A;  1BMO A;  2R2I A;  1JWD A;  2TN4 A;  1AJ4 A;  2ZND A;  3LK0 A;  1KFU S;  1X02 A;  1KQM C;  2NCO A;  2WND A;  5F6T A;  1EH2 A;  2EC6 C;  3IQQ A;  4ORA B;  3WNX B;  1PAL A;  2Y4Q A;  1DJY A;  4UPG A;  3O2P A;  4MN0 A;  2BBM A;  2LLT A;  4MVF A;  2OTG B;  2FOT A;  2BKH B;  1SR6 C;  1MXL C;  3CLN A;  3SG5 A;  2COL B;  3KPX A;  4PCW A;  2F33 A;  4L9M A;  1CMG A;  1K2H A;  1AVS A;  3VRP A;  3AKA A;  1RTP 1;  1TN4 A;  1QAT A;  3KO0 A;  4USL A;  1J7Q A;  1WDC B;  1QVI Y;  2JTZ A;  4WQ3 A;  4CID A;  2WCE A;  3O4Y A;  3GOF A;  4Q04 A;  1J7R A;  5JOL A;  3FWB A;  1MR8 A;  1BLQ A;  1CFF A;  1KK8 B;  1PSB A;  2K7O A;  4HRE E;  3GK1 A;  1S6I A;  1SL8 A;  2ZNE A;  3ZWH A;  1ALW A;  3EK8 A;  2RGI A;  1FBV A;  2OS8 B;  4NDD A;  4BY4 A;  5AEQ A;  2KDH A;  5KU1 A;  1CLM A;  5I2O A;  5CSI A;  5KSZ A;  1XFX O;  1NX3 A;  1DJH A;  1QXP A;  5I2L A;  4PHJ A;  1LKJ A;  1OMR A;  1DF0 A;  3LK1 A;  2I7A A;  1N2D A;  1OSA A;  1U5I A;  4HRH A;  1SL7 A;  5I2Q A;  1UWO A;  1N0Y A;  4QJ5 B;  1IH0 A;  2JRF A;  1PUL A;  4M2P A;  1GGZ A;  1K96 A;  4PE7 A;  2LC5 A;  1GJY A;  4YBH B;  1PSR A;  3NSO A;  2G2B A;  5KTY A;  1M45 A;  1S6J A;  4I5L B;  1VRK A;  1Y0V H;  3E3R A;  1S1E A;  1Y1A A;  3D0Y A;  1UHI A;  4GNK B;  1AK8 A;  2F2O A;  1YUS A;  3SIA A;  3KF9 A;  4MEW A;  1Y6W A;  3PN7 B;  3JVT C;  2K2A A;  5GQQ C;  2JT8 A;  1AJ5 A;  1A75 B;  1KFX L;  1SCV A;  2MA2 A;  3DF0 A;  4GBA A;  2E6W A;  1TNX A;  1DJX A;  4YGE B;  5HLO A;  2PVB A;  2LCP A;  3DVM A;  3EVR A;  1HQV A;  5CSJ A;  1FF1 A;  2AUC A;  1DGU A;  1DTL A;  1KK7 Z;  2K0J A;  1SYM A;  3AAJ A;  3BOW B;  3TS5 B;  1C07 A;  4PDZ A;  4GGF C;  1W7I B;  1L7Z A;  1NUB A;  1J7P A;  1JBA A;  1D1O A;  1CKK A;  3BXK A;  4MLW A;  2KAV A;  1YUT A;  2BCB A;  3I5F C;  1FI5 A;  4YRU A;  2JT3 A;  4IL1 A;  1A29 A;  1B7T Y;  1A2X A;  1L2O B;  4QJ3 B;  3DVK A;  4NQG A;  1XYD A;  3OX5 A;  1CDL A;  4OR9 B;  4CFR A;  3PAT A;  1QJT A;  3LL8 B;  1PRW A;  1XFU O;  4YGA A;  1YVH A;  2PSR A;  1CTR A;  1MXE A;  2FCD A;  4N5X A;  2K61 A;  2Y1M A;  3D10 A;  3TDI A;  1YUR A;  2LV7 A;  1KFU L;  1SY9 A;  2HQW A;  2JZI A;  2LMT A;  2M8U A;  4DCK A;  4NDB A;  2F2P A;  3SG2 A;  1XVJ A;  1TNQ A;  4OKH A;  3NXA A;  4M2O A;  1JF2 A;  1OOJ A;  1AUI B;  1N65 A;  5DKQ A;  2L5X B;  1RFJ A;  1XFW O;  3CWG A;  4P2Y B;  1K95 A;  4DUQ A;  3BYA A;  4YI9 A;  3I5G C;  2FCE A;  2LMV A;  4PHM A;  2MBX A;  2ZFD A;  1NSH A;  1TIZ A;  2CXJ A;  2HQ8 A;  3I5H B;  1QX2 A;  5PAL A;  1YVL A;  1SMG A;  3TUY B;  1K94 A;  1MF8 B;  2B1U A;  4DS7 A;  3I5I B;  1ZAC A;  1XK4 C;  4C0K A;  1DT7 B;  2I94 A;  3TDZ A;  1UHJ A;  2HET A;  1LXF C;  1B8R A;  4ZCU A;  3PFV A;  1OQP A;  4ORC B;  1QS7 A;  2KHN A;  3TDU A;  1KWO B;  1DF0 B;  3IF7 A;  4PHK A;  1U5I B;  2I2R E;  1NPQ A;  4OCI A;  3RM1 A;  4AQJ A;  1LVC D;  1RK9 A;  3EK7 A;  1QLS A;  1BF5 A;  2KFH A;  1G8I A;  1QLK A;  1SL9 A;  1K93 D;  2HPS A;  5JJG A;  2LNK A;  3PM8 A;  4GFT A;  1BOD A;  2KOT A;  1GQM A;  3PSR A;  1BOC A;  2BL0 B;  3FIA A;  1YX7 A;  1TOP A;  1NCY A;  1SK6 D;  5HKY A;  2EC6 B;  2H2K A;  3D0Y B;  3JTD B;  3SIB A;  4YI8 A;  4D1E A;  2LUC A;  2CT9 A;  5CPV A;  5B8I B;  2BE4 A;  3IQO A;  2JT0 A;  3PLF B;  1A03 A;  4WRI A;  1JFJ A;  3DF0 B;  3F45 A;  2LLU A;  2OPO A;  3O6B A;  2OS8 C;  1IGV A;  2LP3 A;  3EKJ A;  3O78 A;  2CBL A;  2ISD A;  2L4H A;  2MRD A;  1JFK A;  1BT6 A;  1MHO A;  1LA3 A;  4MZJ A;  1H8B A;  4YGB B;  4PE0 A;  1R6P A;  1SCM B;  1SBJ A;  1JSA A;  1Y1U A;  4A4C A;  1TTX A;  1IJ5 A;  1QTX A;  1XFV O;  2KFG A;  3BUX B;  1IG5 A;  2MHH A;  5AFP A;  1WLZ A;  1TRF A;  1K9P A;  2D8N A;  3VGO A;  2KAX A;  2KAY A;  4GAO A;  5AAN A;  1CM4 A;  2JWW A;  3OB1 B;  3BUO B;  4XYN A;  5TNC A;  1DJW A;  4I5K A;  1IWQ A;  2LAN A;  2NXQ A;  1JC2 A;  2GGM A;  1CLB A;  2JPT A;  3EK4 A;  1F54 A;  1OZO A;  4U8D A;  2AAO A;  1QX5 B;  1W7J B;  4WQ2 A;  1UUR A;  1LIN A;  2JNX A;  1GGW A;  4PAL A;  1Q80 A;  1AP4 A;  1WRZ A;  1XFY O;  3PN7 C;  1TNP A;  1QV0 A;  2WC8 A;  4OVN F;  2E30 A;  1NYA A;  4R1E A;  4NDC A;  5IBW A;  1CB1 A;  4AQI A;  2V53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...