2KLEA

Isic refined solution structure of the calcium binding domain of the c-terminal cytosolic domain of polycystin-2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
DISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polycystin-2
publication title NMR-assignments of a cytosolic domain of the C-terminus of polycystin-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.170 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2kleA01
2KLDA 2KLEA
chains in the Genus database with same CATH superfamily
1WRZA 1LVCD 1OSAA 1PULA 2LCPA 3S0FA 2PALA 1YRTB 1YR5A 1YUUA 1VRKA 2JU0A 4USLA 1J1DA 4MZJA 3S0DA 3L47A 1NCYA 2QEOA 2KNEA 3PSRA 3RZSA 3UNWA 4DIRA 3CLNA 4MN0A 3GK2A 2K0JA 2L50A 2R2IA 1B9AA 4GNKB 1DF0A 2MA2A 1HT9A 2JULA 1JF2A 1DTLA 1KFXS 1PSBA 2HPSA 3BUNB 3KO0A 4WQ3A 4UPGA 2E30A 4OZDA 1XO5A 3H4SE 3I5HC 3O4XA 2JZIA 2JT3A 2L5XB 3KPXA 1N65A 5TNCA 2ISDA 1YVLA 1MUXA 1DJGA 1CKKA 3CZTX 2MRDA 2E6WA 1AUIB 5FI7A 5CSJA 2LUCA 1QXPA 1LA3A 3L4LA 2M7LA 3B87A 2BCBA 1NYAA 1WRKA 4WQ2A 1YUTA 4AOMA 2KPHA 3BFBA 3IQOA 1AJ5A 1PK0D 1EXRA 2FCDA 1NCXA 1PRWA 3D75A 1P28A 3R1VA 1UHKA 2BBNA 1C07A 2QDIA 1WDCB 2BCAA 4C0KA 3FS7A 1NIWA 1QV1A 3I5FB 1TOPA 1K9PA 2L2CA 1H4BA 3RLZA 1S5GY 2CBLA 3GOFA 1LXFC 2JXLA 3KHEA 3BOWB 3CZ1A 4PT1A 3A4UB 1L2OC 2Q91A 3CTNA 1QX2A 3OBVA 3I5GB 2KSPA 1AK8A 4WRIA 1NX2A 1EG4A 3I5FC 4U8DA 3BUOB 2LM5A 3PATA 1SCMB 2BE4A 4MVFA 1ALWA 1TCFA 1A75A 2H8VA 1EG3A 4NDCA 2LVIA 3DY9A 4HRGA 3EKHA 5BPJA 3SS3A 1S1EA 1J7OA 4INXA 1KFXL 3AAKA 3VRRA 3VROA 1C7VA 2JPOA 2EGDA 2PSRA 3IQQA 4MRYA 1J1EA 1R6PA 1S3PA 5GQQC 1DJHA 1NX0A 2BE6A 3OX5A 3D74A 3UO9A 1J55A 1DJZA 3ICBA 1YTZC 1CDNA 2JC2A 1UHHA 3SIBA 2BNXA 1TRFA 1Y0VH 3IVTA 1NCZA 4PE1A 2ZFDA 1M63B 1KK8B 2HQ8A 2DOQA 3EK7A 1FW4A 3PM2A 3QRXA 1TIZA 3EK8A 4C0LA 1WRLA 2OS8C 1GGWA 4PHMA 2Q4UA 1AVSA 1K94A 2P71A 2VRGA 3CR2A 3FIAA 3I5IC 2HETA 1JWDA 1IIOA 2KGRA 1NSHA 1GM0A 3NSLA 4L9MA 4BY5A 1CFCA 1TN4A 1IJ5A 2AUCA 1BF5A 3CGAA 3NSKA 2M7NA 1D1OA 1M39A 1KSOA 3LCPC 1CFPA 4Q04A 3JVTC 1PVBA 1TTXA 2BL0B 2QEHA 1BJFA 2L2EA 2OPOA 1EJ3A 1SKTA 2M49B 5HLVA 4GFTA 1KWOC 4ZCUA 3KEVA 5CSFA 1A75B 4TNCA 3TS5C 2I2RE 1Y1XA 1BU3A 3A8RA 4JKTA 2I18A 1OW4A 3O78A 4CFRA 1KSMA 4XJKA 4QJ3B 1M46A 2KAXA 2ZRTA 2LVJA 3VRQA 2WCBA 3PN7B 3WHUB 1OZOA 2GGZA 1BR1B 1QIWA 1DELA 1RTP1 1J7RA 3L4AA 5D7FA 4FQOA 4MRXA 5AXIA 2JT8A 1DJIA 3VB1A 2Y5IA 2L5YA 5J3XA 4JQ0D 1ORGA 2EHBA 2SASA 4F0ZB 2BAPA 1IJ6A 2PYQA 1B4CA 1DEKA 5HKYA 1MR8A 2M29A 1BR4B 1OZSA 2LP3A 1XFRA 4PHJA 4JPZB 1AHRA 4YBHB 3WXAA 1Y1AA 1B8RA 3DXLA 3HX4A 1SYMA 2ZNEA 5JOLA 1BT6A 2KAYA 1LA0A 3K1EA 4CIDA 3CDNA 1UP5A 1ALVA 3VGOA 5I94A 3FWBA 2LLUA 1L7ZA 3OGNA 1TUJA 1QX7A 3I5HB 1OOJA 4ORAB 4NDBA 1FI5A 4PE7A 3OB1B 2A4JA 2WCFA 3O2PA 2LUXA 1X02A 1CLMA 4OKHA 4OV2A 1Y6WA 1YURA 1SCVA 2P70A 1G8IA 4ICBA 1DGVA 1WY9A 1XYDA 2NCPA 4F7FA 4XJKB 4GAOA 2COLB 2KQ6A 1JF0A 1IRJA 3ZWHA 1MHOA 1CMFA 3SG2A 2K7CA 2Y1NA 2WORA 3D0YA 4FQTA 3VRNA 3NGVA 2P6BB 3F45A 5KSZA 1G33A 1MF8B 2K7OA 1RECA 2KLDA 2KI6D 1UHJA 3CYZA 4PE0A 5DKNA 3SG7A 4DCKA 1XFXO 4DS7A 2WCLA 4GBAA 1BG1A 5FYXA 1S6JA 3EVUA 2KBIA 1SNLA 1K93D 1L2OB 1LS8A 3GK1A 2KAVA 3D77A 3CWGA 4NQGA 1F55A 1OOFA 2K60A 1XVJA 1IWQA 4YGBB 1QLKA 1KQMC 1RWYA 2G2BA 4AQJA 1K95A 5D69A 2WCHA 1B7TY 3BUMB 3C1VA 3AKBA 2QEVA 2PVBA 2NLNA 1A03A 1CFFA 3SIAA 2K8MB 4P2YB 1RJVA 3SG3A 4NDDA 1XFWO 1IG5A 4CFQA 1BLQA 1Z2CB 2O5GA 4OVNF 4PDZA 2KFFA 2BKIB 1DT7B 1DF0B 2JOJA 1B8LA 2CNPA 1JSAA 2JQ6A 1CB1A 2WC5A 2EC6C 2PQLA 2WC6A 4HRHA 2QEBA 5HL1A 3HCMA 4I5LB 1CMGA 4OR9B 1FF1A 3V2LA 1U5IA 5HLOA 2LAPA 1B7TZ 1TUZA 3S0AA 3N7HA 2LMUA 5G08A 2LLTA 1SY9A 1XFYO 3PFVA 1OMDA 1OQPA 3PJIA 4YRUA 1F4QA 5D3OA 2GTEA 1FI6A 5PALA 2OS8B 3DVJA 1F54A 1OE9B 1ZMZA 3BQ3A 2HF5A 3I5IB 5ER4X 4BY4A 1K9UA 2M1UA 4A4CA 4GGFC 5KTYA 1TNXA 2MBXA 4YGDB 5CPVA 4INWA 1SR6C 3CZ2A 1XFZO 3JTDC 3JVTB 1JFKA 3PM8A 5DKRA 2M3WA 5F6TA 3TDUA 1KWOB 1DJYA 1WLZA 2K2FA 3TS5B 1CTRA 1CLLA 1GQMA 1QV0A 4MZKA 2OTGC 2BKHB 2K2AA 3AAJA 3S0GA 1QWVA 3CR4X 2F33A 3DYEA 3LL8B 3BFHA 3LK1A 2ZNDA 1SMGA 2PASA 1TWOA 2GGMA 1M45A 2Y4QA 4M2QA 1OOHA 2ERBA 1DJXA 4N1FA 2JNXA 2KOTA 2M0RA 2ZRSA 1IH0A 3LLEA 4JWQA 5EL2A 1N0YA 2V53A 4XYNA 1U5IB 3E3RA 2WCKA 3FWCA 2M1KB 3TDZA 1JC2A 2TN4A 2LHIA 2FJUB 2FJYA 5AANA 1GGZA 1SL7A 3DVKA 1DMOA 4PE4A 1Q80A 1QJTA 1W7IB 5CSIA 3DVMA 2JXCA 1F8HA 2F2OA 2I7AA 3NSIA 1JUOA 3LK0A 4AQIA 2F8PA 2KBMA 2LP2A 1CNPA 1N2DA 1GJYA 2KDHA 2WCJA 4IL1A 4PALA 4DRWA 1QVIY 2JWWA 1NX3A 1UHNA 1MXLC 1LKJA 3O6BA 1UUSA 1FBVA 2JRFA 3B88A 2O60A 2L51A 4PCWA 2FCEA 2KI4C 3OX6A 4YGEB 3S0BA 2KYFA 3D78A 4DUQA 1UWOA 2LC5A 2KHNA 3K21A 2LMTA 3BXKA 2KLEA 2H61A 4HREE 2FOTA 5I2QA 1ODBA 1OOIX 5FI2A 1LINA 2G9BA 2K7DA 4N1GA 4CLNA 4KYNA 1QS7A 1QVIZ 3OHMB 1UHIA 1DVIA 4YI9A 1CDLA 1PALA 3ZNIA 2NCOA 3R1OA 2B1UA 4I5KA 5AEQA 1IQ5A 2M8UA 1S6CA 1B8CA 2LANA 2LE9B 2LVVA 3BOWA 1YUSA 2K7BA 4GGFA 1MQ1A 4ORBB 4OCIA 3D76A 1ZACA 1UURA 5I2LA 1EL4A 1YRUB 5HKZA 4C0JA 2JT0A 3TUYC 3GK4X 1ZFSA 3CR5X 5CSNA 1MWNA 1J7QA 3SS4A 1XFVO 2M97A 4GUKA 1CFDA 1KQMB 2RGIA 3BUWB 4PHNA 1SPYA 3O4YA 1YX7A 2MLFC 2ZKMX 2JTZA 3MSEB 3SG6A 1BOCA 1NPQA 1SL8A 4M2PA 1C3YA 1A4PA 1KQVA 1CDMA 1NUBA 3NXAA 1V1FA 4YGAA 3CABA 2IS9A 1CDPA 2LMVA 1W9ZA 2PMYA 3NHIA 4YI8A 1J7PA 1A2XA 1BMOA 3SG5A 3D73A 3DD4A 2EC6B 4I5JA 5I2OA 5I8NA 5B8IB 1RFJA 3NHTA 3NSOA 2LNKA 2D8NA 4HSZA 4MSPA 5AERA 2KGBC 3EVVA 4P5OE 1SW8A 4YGCB 4GGNA 3Q8IA 1TNPA 3PLFB 2H61C 1QLSA 1NX1A 5K89A 1CM1A 1TNWA 1PSRA 1RK9A 1F70A 3BUXB 3D10A 1IGVA 3SS5A 3FE9A 1E8AA 3SG4A 3VRPA 3D0YB 1WDCC 2Y1MA 1OMVA 1ZUZA 3EK4A 2I94A 1SR6B 2LHLA 4JD9A 1SSEB 2SCPA 4GPLB 2HQWA 3EKJA 3JTDB 5DICA 4ETOA 4QJ5B 1SK6D 2AAOA 5HYDA 1IQ3A 1F71A 4E68A 2F3YA 4MEWA 3BYAA 1S6IA 4D1EA 4QJ4B 1QASA 2MHHA 1Y1UA 1DGUA 2OTGB 3OP0A 3I5GC 1XK4A 1S5GZ 1FPWA 1AJ4A 4MZLA 1OMRA 1SCMC 4MBEA 2M9GA 1ZOTB 2CTNA 1KCYA 1KFUS 1G4YR 1F4OA 1MXEA 5IBWA 1C3ZA 2JNFA 5HKWA 1W7JB 3DF0A 3M0WA 1M31A 3IF7A 1EH2A 2KI6C 3B6XA 1XFUO 1SRAA 3FE6A 1IKUA 1K90D 2F2PA 2L98A 3TDIA 3RM1A 2CT9A 2QPTA 4ORCB 3AKAA 1QX5B 4CPVA 1H8BA 1XA5A 1B47A 3CZ0A 2K61A 2WC8A 1CM4A 2MJWB 5AFPA 2MAZA 2LVKA 2LLSA 1R2UA 3TZ1A 2WOSA 3B86A 1S36A 1QTXA 4R1EA 1KK8C 1NWDA 1YVHA 2CXJA 3S0EA 1DC1A 1WLMA 2JTTA 3R1PA 1B1GA 2WNDA 1PVAA 1SBJA 1K96A 1DJWA 4ZCVA 3B7AA 3SJSA 1CLBA 3OB2B 2KQYA 1Z4HA 2BECA 2YGUA 5KU1A 1JFJA 1K9KA 1SL9A 1K2HA 2BCXA 1QATA 2KI4B 2L4IA 2LV7A 1KK7Y 4N5XA 3WNXB 2KYCA 2ZN8A 2ZN9A 4A4BA 3BFAA 2BL0C 1NP8A 3CS1A 1QIVA 1TNQA 2CCMA 4IJ7A 5JJGA 3KF9A 2KFGA 3DZTA 2WCMA 4PHKA 2WCEA 1A29A 3EVRA 1DQEA 4M2OA 2GV5A 2NZ0A 2F3ZA 2H2KA 1KFUL 2NXQA 5DKQA 1K8UA 1XK4C 3DF0B 3FE8A 2JPTA 3PN7C 1V1GA 5ER5A 2L0PA 1BODA 1RROA 1KK7Z 1T14A 1YX8A 1TCOB 2KFHA 1HQVA 2MLEC 3BJHA 4I5NB 3EG5B 1JBAA 3R72A 2BBMA 4MLWA 1S26D 3DVEA 2PRUA 1C7WA 5FI6A 3TUYB 2L4HA 2QACA 3PALA 1AP4A 3WHTB 1OOGA 4FTGA 3QMEA 2AMIA
chains in the Genus database with same CATH topology
3PM2A 4MEWA 2KLDA 5I94A 4IJ7A 1DELA 1Z2CB 3SS4A 3SS3A 4GBAA 2L5YA 2KLEA 5HL1A 4I5LB 3UNWA 1DC1A 5FI2A 2BAPA 4KYNA 1DEKA 2K60A 4I5NB 3EG5B 3SS5A 3O4XA 3UO9A 4GAOA 1W9ZA 1Z4HA 5D3OA 2YGUA 5FI6A 3KEVA 4I5KA 2BNXA 3OBVA 4JKTA 3IVTA 5FI7A 4I5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLD A;  2KLE A; 
#chains in the Genus database with same CATH topology
 1WRZ A;  1LVC D;  1OSA A;  1PUL A;  2LCP A;  3S0F A;  2PAL A;  1YRT B;  1YR5 A;  1YUU A;  1VRK A;  2JU0 A;  4USL A;  1J1D A;  4MZJ A;  3S0D A;  3L47 A;  1NCY A;  2QEO A;  2KNE A;  3PSR A;  3RZS A;  3UNW A;  4DIR A;  3CLN A;  4MN0 A;  3GK2 A;  2K0J A;  2L50 A;  2R2I A;  1B9A A;  4GNK B;  1DF0 A;  2MA2 A;  1HT9 A;  2JUL A;  1JF2 A;  1DTL A;  1KFX S;  1PSB A;  2HPS A;  3BUN B;  3KO0 A;  4WQ3 A;  4UPG A;  2E30 A;  4OZD A;  1XO5 A;  3H4S E;  3I5H C;  3O4X A;  2JZI A;  2JT3 A;  2L5X B;  3KPX A;  1N65 A;  5TNC A;  2ISD A;  1YVL A;  1MUX A;  1DJG A;  1CKK A;  3CZT X;  2MRD A;  2E6W A;  1AUI B;  5FI7 A;  5CSJ A;  2LUC A;  1QXP A;  1LA3 A;  3L4L A;  2M7L A;  3B87 A;  2BCB A;  1NYA A;  1WRK A;  4WQ2 A;  1YUT A;  4AOM A;  2KPH A;  3BFB A;  3IQO A;  1AJ5 A;  1PK0 D;  1EXR A;  2FCD A;  1NCX A;  1PRW A;  3D75 A;  1P28 A;  3R1V A;  1UHK A;  2BBN A;  1C07 A;  2QDI A;  1WDC B;  2BCA A;  4C0K A;  3FS7 A;  1NIW A;  1QV1 A;  3I5F B;  1TOP A;  1K9P A;  2L2C A;  1H4B A;  3RLZ A;  1S5G Y;  2CBL A;  3GOF A;  1LXF C;  2JXL A;  3KHE A;  3BOW B;  3CZ1 A;  4PT1 A;  3A4U B;  1L2O C;  2Q91 A;  3CTN A;  1QX2 A;  3OBV A;  3I5G B;  2KSP A;  1AK8 A;  4WRI A;  1NX2 A;  1EG4 A;  3I5F C;  4U8D A;  3BUO B;  2LM5 A;  3PAT A;  1SCM B;  2BE4 A;  4MVF A;  1ALW A;  1TCF A;  1A75 A;  2H8V A;  1EG3 A;  4NDC A;  2LVI A;  3DY9 A;  4HRG A;  3EKH A;  5BPJ A;  3SS3 A;  1S1E A;  1J7O A;  4INX A;  1KFX L;  3AAK A;  3VRR A;  3VRO A;  1C7V A;  2JPO A;  2EGD A;  2PSR A;  3IQQ A;  4MRY A;  1J1E A;  1R6P A;  1S3P A;  5GQQ C;  1DJH A;  1NX0 A;  2BE6 A;  3OX5 A;  3D74 A;  3UO9 A;  1J55 A;  1DJZ A;  3ICB A;  1YTZ C;  1CDN A;  2JC2 A;  1UHH A;  3SIB A;  2BNX A;  1TRF A;  1Y0V H;  3IVT A;  1NCZ A;  4PE1 A;  2ZFD A;  1M63 B;  1KK8 B;  2HQ8 A;  2DOQ A;  3EK7 A;  1FW4 A;  3PM2 A;  3QRX A;  1TIZ A;  3EK8 A;  4C0L A;  1WRL A;  2OS8 C;  1GGW A;  4PHM A;  2Q4U A;  1AVS A;  1K94 A;  2P71 A;  2VRG A;  3CR2 A;  3FIA A;  3I5I C;  2HET A;  1JWD A;  1IIO A;  2KGR A;  1NSH A;  1GM0 A;  3NSL A;  4L9M A;  4BY5 A;  1CFC A;  1TN4 A;  1IJ5 A;  2AUC A;  1BF5 A;  3CGA A;  3NSK A;  2M7N A;  1D1O A;  1M39 A;  1KSO A;  3LCP C;  1CFP A;  4Q04 A;  3JVT C;  1PVB A;  1TTX A;  2BL0 B;  2QEH A;  1BJF A;  2L2E A;  2OPO A;  1EJ3 A;  1SKT A;  2M49 B;  5HLV A;  4GFT A;  1KWO C;  4ZCU A;  3KEV A;  5CSF A;  1A75 B;  4TNC A;  3TS5 C;  2I2R E;  1Y1X A;  1BU3 A;  3A8R A;  4JKT A;  2I18 A;  1OW4 A;  3O78 A;  4CFR A;  1KSM A;  4XJK A;  4QJ3 B;  1M46 A;  2KAX A;  2ZRT A;  2LVJ A;  3VRQ A;  2WCB A;  3PN7 B;  3WHU B;  1OZO A;  2GGZ A;  1BR1 B;  1QIW A;  1DEL A;  1RTP 1;  1J7R A;  3L4A A;  5D7F A;  4FQO A;  4MRX A;  5AXI A;  2JT8 A;  1DJI A;  3VB1 A;  2Y5I A;  2L5Y A;  5J3X A;  4JQ0 D;  1ORG A;  2EHB A;  2SAS A;  4F0Z B;  2BAP A;  1IJ6 A;  2PYQ A;  1B4C A;  1DEK A;  5HKY A;  1MR8 A;  2M29 A;  1BR4 B;  1OZS A;  2LP3 A;  1XFR A;  4PHJ A;  4JPZ B;  1AHR A;  4YBH B;  3WXA A;  1Y1A A;  1B8R A;  3DXL A;  3HX4 A;  1SYM A;  2ZNE A;  5JOL A;  1BT6 A;  2KAY A;  1LA0 A;  3K1E A;  4CID A;  3CDN A;  1UP5 A;  1ALV A;  3VGO A;  5I94 A;  3FWB A;  2LLU A;  1L7Z A;  3OGN A;  1TUJ A;  1QX7 A;  3I5H B;  1OOJ A;  4ORA B;  4NDB A;  1FI5 A;  4PE7 A;  3OB1 B;  2A4J A;  2WCF A;  3O2P A;  2LUX A;  1X02 A;  1CLM A;  4OKH A;  4OV2 A;  1Y6W A;  1YUR A;  1SCV A;  2P70 A;  1G8I A;  4ICB A;  1DGV A;  1WY9 A;  1XYD A;  2NCP A;  4F7F A;  4XJK B;  4GAO A;  2COL B;  2KQ6 A;  1JF0 A;  1IRJ A;  3ZWH A;  1MHO A;  1CMF A;  3SG2 A;  2K7C A;  2Y1N A;  2WOR A;  3D0Y A;  4FQT A;  3VRN A;  3NGV A;  2P6B B;  3F45 A;  5KSZ A;  1G33 A;  1MF8 B;  2K7O A;  1REC A;  2KLD A;  2KI6 D;  1UHJ A;  3CYZ A;  4PE0 A;  5DKN A;  3SG7 A;  4DCK A;  1XFX O;  4DS7 A;  2WCL A;  4GBA A;  1BG1 A;  5FYX A;  1S6J A;  3EVU A;  2KBI A;  1SNL A;  1K93 D;  1L2O B;  1LS8 A;  3GK1 A;  2KAV A;  3D77 A;  3CWG A;  4NQG A;  1F55 A;  1OOF A;  2K60 A;  1XVJ A;  1IWQ A;  4YGB B;  1QLK A;  1KQM C;  1RWY A;  2G2B A;  4AQJ A;  1K95 A;  5D69 A;  2WCH A;  1B7T Y;  3BUM B;  3C1V A;  3AKB A;  2QEV A;  2PVB A;  2NLN A;  1A03 A;  1CFF A;  3SIA A;  2K8M B;  4P2Y B;  1RJV A;  3SG3 A;  4NDD A;  1XFW O;  1IG5 A;  4CFQ A;  1BLQ A;  1Z2C B;  2O5G A;  4OVN F;  4PDZ A;  2KFF A;  2BKI B;  1DT7 B;  1DF0 B;  2JOJ A;  1B8L A;  2CNP A;  1JSA A;  2JQ6 A;  1CB1 A;  2WC5 A;  2EC6 C;  2PQL A;  2WC6 A;  4HRH A;  2QEB A;  5HL1 A;  3HCM A;  4I5L B;  1CMG A;  4OR9 B;  1FF1 A;  3V2L A;  1U5I A;  5HLO A;  2LAP A;  1B7T Z;  1TUZ A;  3S0A A;  3N7H A;  2LMU A;  5G08 A;  2LLT A;  1SY9 A;  1XFY O;  3PFV A;  1OMD A;  1OQP A;  3PJI A;  4YRU A;  1F4Q A;  5D3O A;  2GTE A;  1FI6 A;  5PAL A;  2OS8 B;  3DVJ A;  1F54 A;  1OE9 B;  1ZMZ A;  3BQ3 A;  2HF5 A;  3I5I B;  5ER4 X;  4BY4 A;  1K9U A;  2M1U A;  4A4C A;  4GGF C;  5KTY A;  1TNX A;  2MBX A;  4YGD B;  5CPV A;  4INW A;  1SR6 C;  3CZ2 A;  1XFZ O;  3JTD C;  3JVT B;  1JFK A;  3PM8 A;  5DKR A;  2M3W A;  5F6T A;  3TDU A;  1KWO B;  1DJY A;  1WLZ A;  2K2F A;  3TS5 B;  1CTR A;  1CLL A;  1GQM A;  1QV0 A;  4MZK A;  2OTG C;  2BKH B;  2K2A A;  3AAJ A;  3S0G A;  1QWV A;  3CR4 X;  2F33 A;  3DYE A;  3LL8 B;  3BFH A;  3LK1 A;  2ZND A;  1SMG A;  2PAS A;  1TWO A;  2GGM A;  1M45 A;  2Y4Q A;  4M2Q A;  1OOH A;  2ERB A;  1DJX A;  4N1F A;  2JNX A;  2KOT A;  2M0R A;  2ZRS A;  1IH0 A;  3LLE A;  4JWQ A;  5EL2 A;  1N0Y A;  2V53 A;  4XYN A;  1U5I B;  3E3R A;  2WCK A;  3FWC A;  2M1K B;  3TDZ A;  1JC2 A;  2TN4 A;  2LHI A;  2FJU B;  2FJY A;  5AAN A;  1GGZ A;  1SL7 A;  3DVK A;  1DMO A;  4PE4 A;  1Q80 A;  1QJT A;  1W7I B;  5CSI A;  3DVM A;  2JXC A;  1F8H A;  2F2O A;  2I7A A;  3NSI A;  1JUO A;  3LK0 A;  4AQI A;  2F8P A;  2KBM A;  2LP2 A;  1CNP A;  1N2D A;  1GJY A;  2KDH A;  2WCJ A;  4IL1 A;  4PAL A;  4DRW A;  1QVI Y;  2JWW A;  1NX3 A;  1UHN A;  1MXL C;  1LKJ A;  3O6B A;  1UUS A;  1FBV A;  2JRF A;  3B88 A;  2O60 A;  2L51 A;  4PCW A;  2FCE A;  2KI4 C;  3OX6 A;  4YGE B;  3S0B A;  2KYF A;  3D78 A;  4DUQ A;  1UWO A;  2LC5 A;  2KHN A;  3K21 A;  2LMT A;  3BXK A;  2KLE A;  2H61 A;  4HRE E;  2FOT A;  5I2Q A;  1ODB A;  1OOI X;  5FI2 A;  1LIN A;  2G9B A;  2K7D A;  4N1G A;  4CLN A;  4KYN A;  1QS7 A;  1QVI Z;  3OHM B;  1UHI A;  1DVI A;  4YI9 A;  1CDL A;  1PAL A;  3ZNI A;  2NCO A;  3R1O A;  2B1U A;  4I5K A;  5AEQ A;  1IQ5 A;  2M8U A;  1S6C A;  1B8C A;  2LAN A;  2LE9 B;  2LVV A;  3BOW A;  1YUS A;  2K7B A;  4GGF A;  1MQ1 A;  4ORB B;  4OCI A;  3D76 A;  1ZAC A;  1UUR A;  5I2L A;  1EL4 A;  1YRU B;  5HKZ A;  4C0J A;  2JT0 A;  3TUY C;  3GK4 X;  1ZFS A;  3CR5 X;  5CSN A;  1MWN A;  1J7Q A;  3SS4 A;  1XFV O;  2M97 A;  4GUK A;  1CFD A;  1KQM B;  2RGI A;  3BUW B;  4PHN A;  1SPY A;  3O4Y A;  1YX7 A;  2MLF C;  2ZKM X;  2JTZ A;  3MSE B;  3SG6 A;  1BOC A;  1NPQ A;  1SL8 A;  4M2P A;  1C3Y A;  1A4P A;  1KQV A;  1CDM A;  1NUB A;  3NXA A;  1V1F A;  4YGA A;  3CAB A;  2IS9 A;  1CDP A;  2LMV A;  1W9Z A;  2PMY A;  3NHI A;  4YI8 A;  1J7P A;  1A2X A;  1BMO A;  3SG5 A;  3D73 A;  3DD4 A;  2EC6 B;  4I5J A;  5I2O A;  5I8N A;  5B8I B;  1RFJ A;  3NHT A;  3NSO A;  2LNK A;  2D8N A;  4HSZ A;  4MSP A;  5AER A;  2KGB C;  3EVV A;  4P5O E;  1SW8 A;  4YGC B;  4GGN A;  3Q8I A;  1TNP A;  3PLF B;  2H61 C;  1QLS A;  1NX1 A;  5K89 A;  1CM1 A;  1TNW A;  1PSR A;  1RK9 A;  1F70 A;  3BUX B;  3D10 A;  1IGV A;  3SS5 A;  3FE9 A;  1E8A A;  3SG4 A;  3VRP A;  3D0Y B;  1WDC C;  2Y1M A;  1OMV A;  1ZUZ A;  3EK4 A;  2I94 A;  1SR6 B;  2LHL A;  4JD9 A;  1SSE B;  2SCP A;  4GPL B;  2HQW A;  3EKJ A;  3JTD B;  5DIC A;  4ETO A;  4QJ5 B;  1SK6 D;  2AAO A;  5HYD A;  1IQ3 A;  1F71 A;  4E68 A;  2F3Y A;  4MEW A;  3BYA A;  1S6I A;  4D1E A;  4QJ4 B;  1QAS A;  2MHH A;  1Y1U A;  1DGU A;  2OTG B;  3OP0 A;  3I5G C;  1XK4 A;  1S5G Z;  1FPW A;  1AJ4 A;  4MZL A;  1OMR A;  1SCM C;  4MBE A;  2M9G A;  1ZOT B;  2CTN A;  1KCY A;  1KFU S;  1G4Y R;  1F4O A;  1MXE A;  5IBW A;  1C3Z A;  2JNF A;  5HKW A;  1W7J B;  3DF0 A;  3M0W A;  1M31 A;  3IF7 A;  1EH2 A;  2KI6 C;  3B6X A;  1XFU O;  1SRA A;  3FE6 A;  1IKU A;  1K90 D;  2F2P A;  2L98 A;  3TDI A;  3RM1 A;  2CT9 A;  2QPT A;  4ORC B;  3AKA A;  1QX5 B;  4CPV A;  1H8B A;  1XA5 A;  1B47 A;  3CZ0 A;  2K61 A;  2WC8 A;  1CM4 A;  2MJW B;  5AFP A;  2MAZ A;  2LVK A;  2LLS A;  1R2U A;  3TZ1 A;  2WOS A;  3B86 A;  1S36 A;  1QTX A;  4R1E A;  1KK8 C;  1NWD A;  1YVH A;  2CXJ A;  3S0E A;  1DC1 A;  1WLM A;  2JTT A;  3R1P A;  1B1G A;  2WND A;  1PVA A;  1SBJ A;  1K96 A;  1DJW A;  4ZCV A;  3B7A A;  3SJS A;  1CLB A;  3OB2 B;  2KQY A;  1Z4H A;  2BEC A;  2YGU A;  5KU1 A;  1JFJ A;  1K9K A;  1SL9 A;  1K2H A;  2BCX A;  1QAT A;  2KI4 B;  2L4I A;  2LV7 A;  1KK7 Y;  4N5X A;  3WNX B;  2KYC A;  2ZN8 A;  2ZN9 A;  4A4B A;  3BFA A;  2BL0 C;  1NP8 A;  3CS1 A;  1QIV A;  1TNQ A;  2CCM A;  4IJ7 A;  5JJG A;  3KF9 A;  2KFG A;  3DZT A;  2WCM A;  4PHK A;  2WCE A;  1A29 A;  3EVR A;  1DQE A;  4M2O A;  2GV5 A;  2NZ0 A;  2F3Z A;  2H2K A;  1KFU L;  2NXQ A;  5DKQ A;  1K8U A;  1XK4 C;  3DF0 B;  3FE8 A;  2JPT A;  3PN7 C;  1V1G A;  5ER5 A;  2L0P A;  1BOD A;  1RRO A;  1KK7 Z;  1T14 A;  1YX8 A;  1TCO B;  2KFH A;  1HQV A;  2MLE C;  3BJH A;  4I5N B;  3EG5 B;  1JBA A;  3R72 A;  2BBM A;  4MLW A;  1S26 D;  3DVE A;  2PRU A;  1C7W A;  5FI6 A;  3TUY B;  2L4H A;  2QAC A;  3PAL A;  1AP4 A;  3WHT B;  1OOG A;  4FTG A;  3QME A;  2AMI A; 
#chains in the Genus database with same CATH homology
 3PM2 A;  4MEW A;  2KLD A;  5I94 A;  4IJ7 A;  1DEL A;  1Z2C B;  3SS4 A;  3SS3 A;  4GBA A;  2L5Y A;  2KLE A;  5HL1 A;  4I5L B;  3UNW A;  1DC1 A;  5FI2 A;  2BAP A;  4KYN A;  1DEK A;  2K60 A;  4I5N B;  3EG5 B;  3SS5 A;  3O4X A;  3UO9 A;  4GAO A;  1W9Z A;  1Z4H A;  5D3O A;  2YGU A;  5FI6 A;  3KEV A;  4I5K A;  2BNX A;  3OBV A;  4JKT A;  3IVT A;  5FI7 A;  4I5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...