1OMDA

Structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
ITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords ONCOMODULIN
publication title Structure of oncomodulin refined at 1.85 A resolution. An example of extensive molecular aggregation via Ca2+.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omdA00
3EVRA 1J7PA 1ZMZA 3EK8A 3TDIA 4FTGA 1RK9A 4GAOA 2KI4C 5ER5A 2JT3A 4MRYA 1RJVA 4CIDA 1SBJA 3BUXB 1DJXA 2JNXA 5I2QA 1EJ3A 2M29A 1Q80A 1QIVA 1Y1AA 1SK6D 2WORA 2K7OA 5I2LA 4P5OE 5CSIA 2PMYA 3AAJA 3HX4A 4GNKB 1D1OA 1DF0B 3A8RA 2F8PA 4I5LB 1R6PA 3O78A 1PALA 3I5HB 3TDZA 1YURA 1CDNA 1HT9A 4MLWA 3VRQA 4JQ0D 3DD4A 1BMOA 3DVEA 1XFZO 2LHLA 1OZOA 5KU1A 4OVNF 2P6BB 3RLZA 5HYDA 4MZLA 1LKJA 1NX3A 2M7LA 1CDPA 3SG2A 4AQJA 4QJ5B 5AERA 2LNKA 4YI9A 3FIAA 3AKAA 4PE0A 3BUOB 1WRKA 2F33A 3FWCA 1CMFA 1ALWA 3E3RA 2OTGB 4ORCB 4CFQA 3GOFA 3GK2A 1SL9A 4GUKA 1B8RA 4ORBB 2BBNA 2BBMA 2EC6B 3EKHA 3HCMA 1KSOA 3DF0B 1A29A 3ICBA 1F4QA 4M2QA 5TNCA 2M49B 4OV2A 2LMTA 2JTTA 3BUWB 3LK1A 3TS5C 3LL8B 1HQVA 2K7DA 1EL4A 3C1VA 1YRTB 3CGAA 1LVCD 2CTNA 3VRRA 3A4UB 1TN4A 2SCPA 3OB1B 1KQVA 2JWWA 1C07A 1QX2A 2H61A 3PN7B 4PE1A 4D1EA 3PALA 4YGCB 2H61C 4MVFA 1Y6WA 3CR4X 1MHOA 1QX5B 3PLFB 1DJZA 1K90D 1BU3A 2JT8A 2HF5A 1Y1UA 4ORAB 3PM8A 1B1GA 3BQ3A 4PHKA 4YI8A 1MF8B 1CDMA 1F4OA 2LANA 3CTNA 1X02A 1XA5A 2KGBC 3KHEA 2ZKMX 1IGVA 4I5KA 1C7VA 5BPJA 2V53A 2COLB 4MEWA 1LA0A 3SJSA 1EG3A 1YX7A 1NWDA 1K9KA 1EH2A 3BUNB 1ZACA 1QV0A 3NSIA 1B7TY 5D7FA 5G08A 5HKYA 5ER4X 1NIWA 1L7ZA 4N5XA 2NLNA 2JXLA 2PASA 4PALA 1YR5A 3EKJA 3JVTC 2QPTA 1QATA 1MR8A 5DKNA 5AFPA 5I8NA 2M9GA 1KFUS 1NUBA 2WCEA 4DS7A 1BR4B 3NSKA 1IJ5A 2FJUB 2Q4UA 1MQ1A 3TUYB 2R2IA 2JU0A 2I94A 2LLTA 2LP2A 2L2EA 1DMOA 4JPZB 2LLSA 1FW4A 4MRXA 2GV5A 3SIAA 4NDBA 2HQ8A 2KAVA 2PVBA 4L9MA 4QJ4B 3BOWB 1SR6C 3PSRA 4BY5A 1CTRA 4A4CA 2K7CA 1S36A 1CFFA 2CXJA 1OSAA 1SKTA 4R1EA 1WDCC 1TNWA 2LHIA 3AAKA 4PCWA 1JF2A 2CCMA 4YBHB 5B8IB 4YRUA 2K7BA 3D0YA 2M3WA 4YGBB 1B9AA 1J1DA 1S1EA 2KFGA 1H4BA 1KFXS 1G4YR 2KI4B 2KGRA 2LVVA 1QVIY 2I7AA 1PRWA 2WNDA 2WOSA 4M2OA 1A2XA 4MSPA 3ZWHA 1DJIA 4I5JA 1LA3A 2PALA 2BL0B 1TCFA 1QTXA 1B7TZ 2JT0A 1QXPA 2MAZA 4JWQA 2KI6C 2OS8B 1JC2A 4NQGA 1UHIA 3O4YA 2ZN8A 3WNXB 1SL8A 4C0LA 2KAXA 3VRNA 4MZJA 1A75A 1SPYA 5CSJA 1AUIB 3MSEB 1KK8C 1WLZA 1S5GY 3CWGA 3OX6A 3SG4A 1PVAA 1OMVA 1J7OA 4UPGA 1FI5A 1OZSA 1B8LA 3NSOA 1SCMC 1V1GA 1QV1A 2BECA 2HPSA 1K94A 1IWQA 1W7JB 1CKKA 1ALVA 3IQQA 3JTDC 2NCOA 1ODBA 2BCAA 4WQ2A 4GGFA 1XFVO 3LK0A 5HLOA 4AQIA 4GGFC 1IJ6A 3KF9A 5AEQA 2LVJA 2F2OA 1CFDA 5CSNA 2MRDA 4PDZA 2F2PA 3OX5A 4XJKA 2M97A 2L0PA 3NSLA 1QVIZ 2LM5A 1TIZA 3IQOA 1SW8A 5IBWA 2NXQA 3NXAA 3EVUA 2HQWA 1UHHA 5AXIA 1NCXA 3WXAA 1G33A 2KBIA 1TRFA 1AVSA 1SL7A 2CNPA 3I5HC 3EK4A 1JUOA 4ZCUA 1S6CA 5K89A 2GGZA 1PVBA 5AANA 2D8NA 2WCFA 1WY9A 2GGMA 1F8HA 2BKHB 5FYXA 4N1FA 1U5IA 4HRHA 2KBMA 1KK7Y 3H4SE 1JSAA 2F3ZA 1S5GZ 4N1GA 4WQ3A 1BOCA 2FCEA 1W7IB 2OTGC 1AJ4A 2LC5A 3AKBA 1RECA 1DGUA 1YVLA 1DJGA 4C0KA 4BY4A 2M8UA 1CM4A 2BKIB 1GQMA 4P2YB 1PULA 1FBVA 2ZNDA 3SG6A 1GJYA 2E30A 1CFPA 2KQYA 3I5IC 4YGEB 1KCYA 1AJ5A 1NX1A 1XFXO 2AAOA 2MLFC 1NCYA 1DTLA 1K9UA 4A4BA 1L2OC 5HKWA 1G8IA 1EXRA 2TN4A 4XYNA 2KYCA 4PE7A 1XFUO 1BLQA 1OE9B 3O6BA 1N0YA 2BE6A 1MXEA 5DKQA 2BE4A 1TNPA 3FS7A 1CLBA 2B1UA 2LVKA 1NX2A 4F0ZB 2KYFA 1DT7B 1K9PA 1R2UA 2ZN9A 4HREE 1CLMA 2K0JA 2K61A 4DRWA 4CPVA 4C0JA 1KK7Z 2Y1MA 1XO5A 1SR6B 1WRZA 3WHTB 1UHKA 2L4HA 1WDCB 4MBEA 3LLEA 5F6TA 5CPVA 4GPLB 1XK4A 1GGWA 1S3PA 3I5FC 1RWYA 1B4CA 1NSHA 1XK4C 1GGZA 1ZFSA 1M63B 2LVIA 4QJ3B 3ZNIA 1CFCA 2NZ0A 2LUXA 3EVVA 3VGOA 3I5GC 3CZTX 2ZNEA 1NP8A 4OKHA 3BXKA 2JXCA 1WLMA 1TCOB 1YUSA 2A4JA 3QRXA 2MBXA 2ISDA 1YUUA 1SRAA 1IKUA 1RTP1 2G2BA 3DVJA 3BYAA 1ZUZA 3SG3A 3TUYC 2AUCA 1KSMA 4M2PA 1PSBA 3EK7A 2MJWB 1BJFA 1PSRA 4TNCA 2SASA 1KWOC 3OB2B 4CFRA 1JF0A 1N65A 1MUXA 1NYAA 2JRFA 1F71A 3FWBA 1A75B 1KK8B 1SYMA 2WCBA 3M0WA 4U8DA 1YX8A 5JOLA 4AOMA 1TNQA 1SCMB 3RM1A 4DUQA 1AK8A 1OQPA 1BT6A 1H8BA 3JTDB 1KQMC 2KNEA 4WRIA 2CBLA 1J7QA 2RGIA 3SG5A 4CLNA 2BCXA 4E68A 4HRGA 2KOTA 2L5XB 2KQ6A 2ZFDA 1C7WA 1N2DA 1S6IA 1A4PA 5I2OA 1QJTA 5J3XA 2HETA 2O60A 1FPWA 2BL0C 2FCDA 2LMUA 1RFJA 5JJGA 1YRUB 1B47A 4OR9B 1KFXL 3OP0A 2OS8C 4XJKB 4YGDB 5D69A 1CNPA 1M39A 1IH0A 1ZOTB 2E6WA 4PHNA 1F55A 1UHNA 1IQ5A 1DF0A 2DOQA 2I18A 2LUCA 1K93D 1QASA 2LCPA 1E8AA 5KSZA 2G9BA 3TS5B 1UHJA 1V1FA 1TTXA 2PRUA 2KFFA 2JULA 1SMGA 1U5IB 3F45A 4OCIA 2NCPA 1NX0A 3CR2A 1JFJA 2M1UA 1M46A 1S6JA 2I2RE 2JNFA 2KI6D 1JFKA 5PALA 2JC2A 3BUMB 2LAPA 2M1KB 1UURA 2K2FA 1UP5A 3KO0A 1DJYA 1FF1A 1XVJA 4DCKA 5DKRA 2FOTA 1QLSA 1OMDA 2Q91A 4MN0A 1JBAA 3I5IB 1UUSA 1DJWA 3KEVA 5HKZA 1SNLA 1TOPA 1UWOA 2LE9B 1J7RA 3D10A 4MZKA 4ZCVA 5KTYA 3DF0A 1CMGA 2EC6C 2L50A 3OHMB 4PHJA 1XYDA 2H2KA 2KFHA 2MHHA 2M7NA 1BF5A 1L2OB 2Y1NA 1MXLC 1IQ3A 1NPQA 2EHBA 1LXFC 4ETOA 1QLKA 1WRLA 3GK4X 4GFTA 3TDUA 2JTZA 2VRGA 1MWNA 2L98A 3PFVA 2JQ6A 1XFWO 2M0RA 1DGVA 1TNXA 3JVTB 1QS7A 5GQQC 1CLLA 1M31A 3DVKA 5HLVA 1DVIA 3PN7C 1DJHA 2MA2A 3CS1A 2MLEC 3GK1A 1J55A 1OOJA 1YVHA 1F54A 1SCVA 1F70A 3IF7A 4GBAA 2JPTA 3O2PA 4IL1A 2ZRSA 1OMRA 4ICBA 2LLUA 2L51A 2Y5IA 4PHMA 1EG4A 3WHUB 1CM1A 4I5NB 3SG7A 1S26D 3VROA 4HSZA 3I5FB 2LP3A 1M45A 4NDDA 3TZ1A 1YTZC 1J1EA 4USLA 1AP4A 3VRPA 1JWDA 3CLNA 2ZRTA 2OPOA 3I5GB 3SIBA 2KAYA 1AHRA 1RROA 2IS9A 4FQOA 3D0YB 3LCPC 2EGDA 2CT9A 4GGNA 1BODA 2K2AA 1QIWA 4YGAA 2KDHA 4NDCA 4PE4A 1BG1A 1CB1A 2WC8A 2K8MB 2O5GA 3KPXA 3DVMA 1Y0VH 2QACA 1KWOB 1CDLA 2AMIA 2Y4QA 1LINA 1K96A 2KSPA 1IRJA 2F3YA 3CR5X 1NCZA 2PSRA 3K21A 1XFYO 2JOJA 1SY9A 1QX7A 2L4IA 2LMVA 1K95A 1KFUL 1YUTA 4DIRA 3BOWA 1VRKA 1B8CA 1BR1B 1K2HA 1Y1XA 5CSFA 1K8UA 1IG5A 1FI6A 3PATA 1KQMB 2LV7A 4Q04A 1A03A 2BCBA 2JZIA 2KHNA 1PK0D
chains in the Genus database with same CATH superfamily
3EVRA 1J7PA 1ZMZA 3EK8A 4PT1A 3O4XA 3TDIA 4FTGA 1RK9A 4GAOA 2KI4C 5ER5A 2JT3A 4MRYA 1RJVA 4CIDA 1SBJA 3BUXB 1DJXA 2JNXA 5I2QA 1EJ3A 2M29A 2L2CA 1Q80A 1QIVA 1Y1AA 1GM0A 1SK6D 2WORA 2K7OA 5I2LA 4P5OE 5CSIA 2PMYA 3AAJA 3HX4A 4GNKB 1D1OA 1DF0B 3A8RA 2F8PA 4IJ7A 4I5LB 3SS5A 1R6PA 3O78A 1PALA 3I5HB 3NGVA 1YURA 3R1PA 3TDZA 1CDNA 1HT9A 4MLWA 3VRQA 5EL2A 4JQ0D 3DD4A 1BMOA 3OBVA 3DVEA 1XFZO 2LHLA 1OZOA 5KU1A 4OVNF 2P6BB 3RLZA 5HYDA 4MZLA 1LKJA 1NX3A 2M7LA 1CDPA 3SG2A 4AQJA 4QJ5B 5AERA 2LNKA 4YI9A 3FIAA 3AKAA 4PE0A 3BUOB 1WRKA 2F33A 3FWCA 1CMFA 1ALWA 3E3RA 2OTGB 4ORCB 4CFQA 3GOFA 3GK2A 1SL9A 4GUKA 1B8RA 4ORBB 2BBNA 2BBMA 2EC6B 3EKHA 3HCMA 1KSOA 3DF0B 1A29A 3ICBA 1F4QA 3V2LA 4M2QA 5TNCA 2M49B 4OV2A 2LMTA 2JTTA 3BUWB 3LK1A 3TS5C 3LL8B 3N7HA 1HQVA 2K7DA 3S0DA 1EL4A 3C1VA 1YRTB 3CGAA 1LVCD 2CTNA 3VRRA 3A4UB 1TN4A 2SCPA 3B86A 3OB1B 1KQVA 5FI2A 2JWWA 3DZTA 1Z4HA 1QX2A 1C07A 2H61A 3PN7B 4PE1A 4D1EA 3PALA 4YGCB 2H61C 4MVFA 1Y6WA 3CR4X 1MHOA 1QX5B 3PLFB 1DJZA 1K90D 1BU3A 2JT8A 2HF5A 1Y1UA 4ORAB 3PM8A 1B1GA 3BQ3A 4PHKA 4YI8A 1MF8B 1CDMA 1F4OA 2LANA 3CTNA 1X02A 1XA5A 2KGBC 3IVTA 3KHEA 2ZKMX 1IGVA 1DEKA 4I5KA 1C7VA 5BPJA 2L5YA 2V53A 2COLB 4MEWA 1LA0A 3SJSA 1EG3A 4JKTA 1YX7A 5I94A 1NWDA 1K9KA 1EH2A 3BUNB 1ZACA 1QV0A 3NSIA 1B7TY 3R72A 5D7FA 5G08A 5HKYA 5ER4X 1NIWA 1L7ZA 4N5XA 2NLNA 2JXLA 3NHIA 2PASA 4PALA 1YR5A 3EKJA 3JVTC 2QPTA 1QATA 2ERBA 1MR8A 5DKNA 5AFPA 5I8NA 1OW4A 2M9GA 1KFUS 1NUBA 2WCEA 4DS7A 1BR4B 3NSKA 1IJ5A 2WCHA 2FJUB 1OOIX 2Q4UA 1MQ1A 3L47A 2R2IA 3TUYB 2JU0A 2I94A 2LLTA 2LP2A 2L2EA 2KPHA 4JPZB 2JPOA 1DMOA 1OOHA 2LLSA 1Z2CB 2KLEA 1FW4A 4MRXA 2GV5A 3SIAA 4NDBA 3D78A 2HQ8A 2KAVA 2PVBA 4L9MA 4JD9A 4QJ4B 3BOWB 1SR6C 3PSRA 4BY5A 1CTRA 4A4CA 2K7CA 1S36A 1CFFA 2CXJA 1OSAA 1SKTA 4R1EA 1WDCC 1TNWA 2FJYA 2LHIA 3AAKA 4PCWA 1JF2A 2CCMA 3D77A 4YBHB 5B8IB 4YRUA 2K7BA 3D0YA 2QEVA 2M3WA 2YGUA 3K1EA 4YGBB 1B9AA 1J1DA 1S1EA 2KFGA 1H4BA 1KFXS 1G4YR 2KI4B 2KGRA 2LVVA 1QVIY 2I7AA 1PRWA 2WNDA 2WOSA 4FQTA 1A2XA 4INXA 4M2OA 4MSPA 3ZWHA 1DJIA 4I5JA 1LA3A 2PALA 2BL0B 1TCFA 1QTXA 1B7TZ 2JT0A 1QXPA 2MAZA 4JWQA 2KI6C 3BFBA 2OS8B 1JC2A 1C3ZA 2K60A 4NQGA 1UHIA 3O4YA 2ZN8A 3WNXB 1SL8A 2QEBA 4C0LA 2KAXA 3VRNA 4MZJA 1A75A 1SPYA 5CSJA 1AUIB 3MSEB 4KYNA 1KK8C 1WLZA 3OGNA 1S5GY 3CWGA 3OX6A 3SG4A 1PVAA 1OMVA 1J7OA 4UPGA 1FI5A 1OZSA 1B8LA 3NSOA 1SCMC 1V1GA 1QV1A 2BECA 2HPSA 1K94A 1IWQA 1W7JB 2WC5A 1ALVA 1CKKA 3IQQA 3JTDC 2NCOA 1ODBA 2BCAA 4WQ2A 5KTYA 4GGFA 1XFVO 3LK0A 5HLOA 4AQIA 1TWOA 4GGFC 1IJ6A 3KF9A 5AEQA 2LVJA 2F2OA 1ORGA 1CFDA 5CSNA 5FI7A 2MRDA 4PDZA 2F2PA 3OX5A 4XJKA 2M97A 2L0PA 3NSLA 1QVIZ 2LM5A 1TIZA 3IQOA 1SW8A 5IBWA 2NXQA 4INWA 3NXAA 3EVUA 2HQWA 2WCKA 1UHHA 5AXIA 1NCXA 3WXAA 1G33A 2WC6A 2KBIA 1TRFA 1AVSA 1SL7A 2CNPA 3I5HC 3EK4A 1IIOA 1JUOA 5DICA 4ZCUA 1S6CA 1TUZA 2GGZA 5K89A 1PVBA 3FE9A 5AANA 2D8NA 2WCFA 1WY9A 2GGMA 3D74A 1F8HA 2BKHB 5FYXA 4N1FA 1U5IA 4HRHA 3S0FA 3BFAA 2KBMA 2BAPA 1KK7Y 2WCLA 3CZ2A 3H4SE 1JSAA 2F3ZA 1S5GZ 4N1GA 4WQ3A 4OZDA 3PJIA 1BOCA 2FCEA 1W7IB 3SS4A 2OTGC 1AJ4A 2LC5A 3AKBA 1RECA 1DGUA 1YVLA 1DJGA 3B7AA 4BY4A 2M8UA 1CM4A 3S0GA 2BKIB 1GQMA 3DYEA 4P2YB 4C0KA 1PULA 1FBVA 2ZNDA 3SG6A 1GJYA 2E30A 1CFPA 2KQYA 3I5IC 4YGEB 1KCYA 1AJ5A 1NX1A 1XFXO 2AAOA 2MLFC 1NCYA 1DTLA 1K9UA 2QDIA 1C3YA 4A4BA 1L2OC 5HKWA 1G8IA 1EXRA 2TN4A 4XYNA 3BFHA 2KYCA 4PE7A 1XFUO 1BLQA 1OE9B 3O6BA 1N0YA 2BE6A 1DELA 1MXEA 5DKQA 2BE4A 1TNPA 3FS7A 1CLBA 2B1UA 5HL1A 2LVKA 1NX2A 4F0ZB 2KYFA 1DT7B 1OOFA 1K9PA 1R2UA 2ZN9A 4HREE 1CLMA 2K0JA 2K61A 4DRWA 4CPVA 4C0JA 1KK7Z 2Y1MA 1XO5A 3BJHA 1SR6B 1WRZA 3WHTB 1UHKA 2L4HA 1WDCB 4MBEA 3LLEA 5F6TA 3RZSA 1TUJA 5CPVA 4GPLB 1XK4A 1GGWA 1S3PA 3I5FC 1RWYA 1B4CA 1NSHA 1XK4C 1GGZA 1ZFSA 1M63B 2LVIA 4QJ3B 3ZNIA 1CFCA 2NZ0A 2LUXA 3EVVA 3R1VA 5D3OA 3VGOA 3I5GC 3CZTX 2ZNEA 1NP8A 4OKHA 3BXKA 2JXCA 1WLMA 1TCOB 1YUSA 2A4JA 3QRXA 2WCJA 2MBXA 2ISDA 1YUUA 1SRAA 1IKUA 1RTP1 2G2BA 3DVJA 3L4AA 3BYAA 3S0AA 1ZUZA 3SG3A 3TUYC 2AUCA 1KSMA 4M2PA 1PSBA 3CZ1A 2MJWB 1BJFA 1PSRA 3EK7A 2SASA 1KWOC 3OB2B 4TNCA 4CFRA 1DC1A 1JF0A 1N65A 1MUXA 2QEOA 1NYAA 2JRFA 1F71A 3FWBA 1A75B 1KK8B 1SYMA 2WCBA 3M0WA 4U8DA 1YX8A 5JOLA 4AOMA 3Q8IA 1TNQA 1SCMB 3RM1A 4DUQA 3D75A 1AK8A 1OQPA 2P70A 1BT6A 1H8BA 3JTDB 3CZ0A 1KQMC 2KNEA 4WRIA 2CBLA 1J7QA 2RGIA 3SG5A 4CLNA 2BCXA 4E68A 4HRGA 2KOTA 2KLDA 2KQ6A 2L5XB 1C7WA 1N2DA 1S6IA 2ZFDA 1A4PA 5I2OA 1QJTA 5J3XA 2HETA 2O60A 3UO9A 1FPWA 2BL0C 2FCDA 2LMUA 1RFJA 3VB1A 5JJGA 1YRUB 1B47A 4OR9B 1KFXL 3OP0A 2OS8C 4XJKB 4YGDB 5D69A 1CNPA 3FE6A 1M39A 1IH0A 4F7FA 1ZOTB 2E6WA 3EG5B 4PHNA 1F55A 1UHNA 1IQ5A 1DF0A 2DOQA 2I18A 2LUCA 1K93D 1QASA 2LCPA 1E8AA 5KSZA 2G9BA 3TS5B 1UHJA 1V1FA 1TTXA 2PRUA 1SSEB 2KFFA 2JULA 1SMGA 1U5IB 3CDNA 3F45A 4OCIA 2NCPA 1NX0A 3CR2A 1JFJA 3NHTA 2M1UA 1M46A 1S6JA 2I2RE 2JNFA 2KI6D 3L4LA 1JFKA 1QWVA 5PALA 2JC2A 2P71A 3BUMB 2LAPA 2M1KB 3QMEA 1UURA 2K2FA 1UP5A 3KO0A 1DJYA 1FF1A 3CABA 1XVJA 3B6XA 4DCKA 5DKRA 2FOTA 1QLSA 1T14A 1OMDA 2Q91A 4MN0A 1JBAA 3I5IB 1UUSA 1DJWA 3KEVA 5HKZA 1SNLA 1TOPA 1UWOA 2LE9B 1J7RA 3D10A 3R1OA 3FE8A 4MZKA 3DF0A 4ZCVA 2EC6C 2L50A 3OHMB 4PHJA 1XYDA 3SS3A 1CMGA 2H2KA 2KFHA 2MHHA 2M7NA 1BF5A 1L2OB 2Y1NA 1MXLC 1IQ3A 1NPQA 2EHBA 1LXFC 1P28A 1QLKA 1LS8A 1WRLA 3GK4X 4GFTA 4ETOA 3TDUA 2JTZA 2VRGA 1MWNA 2L98A 2QEHA 3PFVA 1W9ZA 1XFWO 2JQ6A 1DGVA 1TNXA 2M0RA 3JVTB 1QS7A 2BNXA 5GQQC 1CLLA 1M31A 3DVKA 5HLVA 1DVIA 3PN7C 3S0EA 1DJHA 2MA2A 3CS1A 2MLEC 3GK1A 1J55A 1OOJA 1YVHA 2PQLA 1SCVA 1F54A 3IF7A 1F70A 3DY9A 2JPTA 4GBAA 3O2PA 4IL1A 2ZRSA 1OMRA 4ICBA 2LLUA 2L51A 2Y5IA 4PHMA 1EG4A 3WHUB 1CM1A 4I5NB 3SG7A 1S26D 3VROA 1DQEA 4HSZA 3DXLA 3I5FB 2LP3A 1M45A 2GTEA 4NDDA 3TZ1A 1YTZC 1J1EA 3S0BA 4USLA 3D76A 2PYQA 1AP4A 3VRPA 1JWDA 3CLNA 2ZRTA 2OPOA 3I5GB 3SIBA 2KAYA 1AHRA 1RROA 2IS9A 4FQOA 3D0YB 3D73A 3LCPC 2H8VA 2EGDA 2CT9A 4GGNA 1BODA 2K2AA 1QIWA 4YGAA 2KDHA 4NDCA 4PE4A 1BG1A 3B87A 2WCMA 1OOGA 2WC8A 2K8MB 1CB1A 2O5GA 3KPXA 3DVMA 1Y0VH 2QACA 1KWOB 1CDLA 2AMIA 2Y4QA 1LINA 3CYZA 1K96A 2KSPA 1IRJA 2F3YA 3B88A 5FI6A 3UNWA 3CR5X 1NCZA 2PSRA 3K21A 1XFYO 2JOJA 1SY9A 1QX7A 2L4IA 2LMVA 1K95A 1KFUL 1YUTA 4DIRA 3BOWA 1VRKA 1B8CA 1BR1B 1K2HA 1XFRA 1Y1XA 5CSFA 1K8UA 1IG5A 3PM2A 1FI6A 3PATA 1KQMB 2LV7A 4Q04A 1A03A 2BCBA 2JZIA 2KHNA 1PK0D
chains in the Genus database with same CATH topology
3EVRA 1J7PA 1ZMZA 3EK8A 3TDIA 4FTGA 1RK9A 4GAOA 2KI4C 5ER5A 2JT3A 4MRYA 1RJVA 4CIDA 1SBJA 3BUXB 1DJXA 2JNXA 5I2QA 1EJ3A 2M29A 1Q80A 1QIVA 1Y1AA 1SK6D 2WORA 2K7OA 5I2LA 4P5OE 5CSIA 2PMYA 3AAJA 3HX4A 4GNKB 1D1OA 1DF0B 3A8RA 2F8PA 4I5LB 1R6PA 3O78A 1PALA 3I5HB 3TDZA 1YURA 1CDNA 1HT9A 4MLWA 3VRQA 4JQ0D 3DD4A 1BMOA 3DVEA 1XFZO 2LHLA 1OZOA 5KU1A 4OVNF 2P6BB 3RLZA 5HYDA 4MZLA 1LKJA 1NX3A 2M7LA 1CDPA 3SG2A 4AQJA 4QJ5B 5AERA 2LNKA 4YI9A 3FIAA 3AKAA 4PE0A 3BUOB 1WRKA 2F33A 3FWCA 1CMFA 1ALWA 3E3RA 2OTGB 4ORCB 4CFQA 3GOFA 3GK2A 1SL9A 4GUKA 1B8RA 4ORBB 2BBNA 2BBMA 2EC6B 3EKHA 3HCMA 1KSOA 3DF0B 1A29A 3ICBA 1F4QA 4M2QA 5TNCA 2M49B 4OV2A 2LMTA 2JTTA 3BUWB 3LK1A 3TS5C 3LL8B 1HQVA 2K7DA 1EL4A 3C1VA 1YRTB 3CGAA 1LVCD 2CTNA 3VRRA 3A4UB 1TN4A 2SCPA 3OB1B 1KQVA 2JWWA 1C07A 1QX2A 2H61A 3PN7B 4PE1A 4D1EA 3PALA 4YGCB 2H61C 4MVFA 1Y6WA 3CR4X 1MHOA 1QX5B 3PLFB 1DJZA 1K90D 1BU3A 2JT8A 2HF5A 1Y1UA 4ORAB 3PM8A 1B1GA 3BQ3A 4PHKA 4YI8A 1MF8B 1CDMA 1F4OA 2LANA 3CTNA 1X02A 1XA5A 2KGBC 3KHEA 2ZKMX 1IGVA 4I5KA 1C7VA 5BPJA 2V53A 2COLB 4MEWA 1LA0A 3SJSA 1EG3A 1YX7A 1NWDA 1K9KA 1EH2A 3BUNB 1ZACA 1QV0A 3NSIA 1B7TY 5D7FA 5G08A 5HKYA 5ER4X 1NIWA 1L7ZA 4N5XA 2NLNA 2JXLA 2PASA 4PALA 1YR5A 3EKJA 3JVTC 2QPTA 1QATA 1MR8A 5DKNA 5AFPA 5I8NA 2M9GA 1KFUS 1NUBA 2WCEA 4DS7A 1BR4B 3NSKA 1IJ5A 2FJUB 2Q4UA 1MQ1A 3TUYB 2R2IA 2JU0A 2I94A 2LLTA 2LP2A 2L2EA 1DMOA 4JPZB 2LLSA 1FW4A 4MRXA 2GV5A 3SIAA 4NDBA 2HQ8A 2KAVA 2PVBA 4L9MA 4QJ4B 3BOWB 1SR6C 3PSRA 4BY5A 1CTRA 4A4CA 2K7CA 1S36A 1CFFA 2CXJA 1OSAA 1SKTA 4R1EA 1WDCC 1TNWA 2LHIA 3AAKA 4PCWA 1JF2A 2CCMA 4YBHB 5B8IB 4YRUA 2K7BA 3D0YA 2M3WA 4YGBB 1B9AA 1J1DA 1S1EA 2KFGA 1H4BA 1KFXS 1G4YR 2KI4B 2KGRA 2LVVA 1QVIY 2I7AA 1PRWA 2WNDA 2WOSA 4M2OA 1A2XA 4MSPA 3ZWHA 1DJIA 4I5JA 1LA3A 2PALA 2BL0B 1TCFA 1QTXA 1B7TZ 2JT0A 1QXPA 2MAZA 4JWQA 2KI6C 2OS8B 1JC2A 4NQGA 1UHIA 3O4YA 2ZN8A 3WNXB 1SL8A 4C0LA 2KAXA 3VRNA 4MZJA 1A75A 1SPYA 5CSJA 1AUIB 3MSEB 1KK8C 1WLZA 1S5GY 3CWGA 3OX6A 3SG4A 1PVAA 1OMVA 1J7OA 4UPGA 1FI5A 1OZSA 1B8LA 3NSOA 1SCMC 1V1GA 1QV1A 2BECA 2HPSA 1K94A 1IWQA 1W7JB 1CKKA 1ALVA 3IQQA 3JTDC 2NCOA 1ODBA 2BCAA 4WQ2A 4GGFA 1XFVO 3LK0A 5HLOA 4AQIA 4GGFC 1IJ6A 3KF9A 5AEQA 2LVJA 2F2OA 1CFDA 5CSNA 2MRDA 4PDZA 2F2PA 3OX5A 4XJKA 2M97A 2L0PA 3NSLA 1QVIZ 2LM5A 1TIZA 3IQOA 1SW8A 5IBWA 2NXQA 3NXAA 3EVUA 2HQWA 1UHHA 5AXIA 1NCXA 3WXAA 1G33A 2KBIA 1TRFA 1AVSA 1SL7A 2CNPA 3I5HC 3EK4A 1JUOA 4ZCUA 1S6CA 5K89A 2GGZA 1PVBA 5AANA 2D8NA 2WCFA 1WY9A 2GGMA 1F8HA 2BKHB 5FYXA 4N1FA 1U5IA 4HRHA 2KBMA 1KK7Y 3H4SE 1JSAA 2F3ZA 1S5GZ 4N1GA 4WQ3A 1BOCA 2FCEA 1W7IB 2OTGC 1AJ4A 2LC5A 3AKBA 1RECA 1DGUA 1YVLA 1DJGA 4C0KA 4BY4A 2M8UA 1CM4A 2BKIB 1GQMA 4P2YB 1PULA 1FBVA 2ZNDA 3SG6A 1GJYA 2E30A 1CFPA 2KQYA 3I5IC 4YGEB 1KCYA 1AJ5A 1NX1A 1XFXO 2AAOA 2MLFC 1NCYA 1DTLA 1K9UA 4A4BA 1L2OC 5HKWA 1G8IA 1EXRA 2TN4A 4XYNA 2KYCA 4PE7A 1XFUO 1BLQA 1OE9B 3O6BA 1N0YA 2BE6A 1MXEA 5DKQA 2BE4A 1TNPA 3FS7A 1CLBA 2B1UA 2LVKA 1NX2A 4F0ZB 2KYFA 1DT7B 1K9PA 1R2UA 2ZN9A 4HREE 1CLMA 2K0JA 2K61A 4DRWA 4CPVA 4C0JA 1KK7Z 2Y1MA 1XO5A 1SR6B 1WRZA 3WHTB 1UHKA 2L4HA 1WDCB 4MBEA 3LLEA 5F6TA 5CPVA 4GPLB 1XK4A 1GGWA 1S3PA 3I5FC 1RWYA 1B4CA 1NSHA 1XK4C 1GGZA 1ZFSA 1M63B 2LVIA 4QJ3B 3ZNIA 1CFCA 2NZ0A 2LUXA 3EVVA 3VGOA 3I5GC 3CZTX 2ZNEA 1NP8A 4OKHA 3BXKA 2JXCA 1WLMA 1TCOB 1YUSA 2A4JA 3QRXA 2MBXA 2ISDA 1YUUA 1SRAA 1IKUA 1RTP1 2G2BA 3DVJA 3BYAA 1ZUZA 3SG3A 3TUYC 2AUCA 1KSMA 4M2PA 1PSBA 3EK7A 2MJWB 1BJFA 1PSRA 4TNCA 2SASA 1KWOC 3OB2B 4CFRA 1JF0A 1N65A 1MUXA 1NYAA 2JRFA 1F71A 3FWBA 1A75B 1KK8B 1SYMA 2WCBA 3M0WA 4U8DA 1YX8A 5JOLA 4AOMA 1TNQA 1SCMB 3RM1A 4DUQA 1AK8A 1OQPA 1BT6A 1H8BA 3JTDB 1KQMC 2KNEA 4WRIA 2CBLA 1J7QA 2RGIA 3SG5A 4CLNA 2BCXA 4E68A 4HRGA 2KOTA 2L5XB 2KQ6A 2ZFDA 1C7WA 1N2DA 1S6IA 1A4PA 5I2OA 1QJTA 5J3XA 2HETA 2O60A 1FPWA 2BL0C 2FCDA 2LMUA 1RFJA 5JJGA 1YRUB 1B47A 4OR9B 1KFXL 3OP0A 2OS8C 4XJKB 4YGDB 5D69A 1CNPA 1M39A 1IH0A 1ZOTB 2E6WA 4PHNA 1F55A 1UHNA 1IQ5A 1DF0A 2DOQA 2I18A 2LUCA 1K93D 1QASA 2LCPA 1E8AA 5KSZA 2G9BA 3TS5B 1UHJA 1V1FA 1TTXA 2PRUA 2KFFA 2JULA 1SMGA 1U5IB 3F45A 4OCIA 2NCPA 1NX0A 3CR2A 1JFJA 2M1UA 1M46A 1S6JA 2I2RE 2JNFA 2KI6D 1JFKA 5PALA 2JC2A 3BUMB 2LAPA 2M1KB 1UURA 2K2FA 1UP5A 3KO0A 1DJYA 1FF1A 1XVJA 4DCKA 5DKRA 2FOTA 1QLSA 1OMDA 2Q91A 4MN0A 1JBAA 3I5IB 1UUSA 1DJWA 3KEVA 5HKZA 1SNLA 1TOPA 1UWOA 2LE9B 1J7RA 3D10A 4MZKA 4ZCVA 5KTYA 3DF0A 1CMGA 2EC6C 2L50A 3OHMB 4PHJA 1XYDA 2H2KA 2KFHA 2MHHA 2M7NA 1BF5A 1L2OB 2Y1NA 1MXLC 1IQ3A 1NPQA 2EHBA 1LXFC 4ETOA 1QLKA 1WRLA 3GK4X 4GFTA 3TDUA 2JTZA 2VRGA 1MWNA 2L98A 3PFVA 2JQ6A 1XFWO 2M0RA 1DGVA 1TNXA 3JVTB 1QS7A 5GQQC 1CLLA 1M31A 3DVKA 5HLVA 1DVIA 3PN7C 1DJHA 2MA2A 3CS1A 2MLEC 3GK1A 1J55A 1OOJA 1YVHA 1F54A 1SCVA 1F70A 3IF7A 4GBAA 2JPTA 3O2PA 4IL1A 2ZRSA 1OMRA 4ICBA 2LLUA 2L51A 2Y5IA 4PHMA 1EG4A 3WHUB 1CM1A 4I5NB 3SG7A 1S26D 3VROA 4HSZA 3I5FB 2LP3A 1M45A 4NDDA 3TZ1A 1YTZC 1J1EA 4USLA 1AP4A 3VRPA 1JWDA 3CLNA 2ZRTA 2OPOA 3I5GB 3SIBA 2KAYA 1AHRA 1RROA 2IS9A 4FQOA 3D0YB 3LCPC 2EGDA 2CT9A 4GGNA 1BODA 2K2AA 1QIWA 4YGAA 2KDHA 4NDCA 4PE4A 1BG1A 1CB1A 2WC8A 2K8MB 2O5GA 3KPXA 3DVMA 1Y0VH 2QACA 1KWOB 1CDLA 2AMIA 2Y4QA 1LINA 1K96A 2KSPA 1IRJA 2F3YA 3CR5X 1NCZA 2PSRA 3K21A 1XFYO 2JOJA 1SY9A 1QX7A 2L4IA 2LMVA 1K95A 1KFUL 1YUTA 4DIRA 3BOWA 1VRKA 1B8CA 1BR1B 1K2HA 1Y1XA 5CSFA 1K8UA 1IG5A 1FI6A 3PATA 1KQMB 2LV7A 4Q04A 1A03A 2BCBA 2JZIA 2KHNA 1PK0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVR A;  1J7P A;  1ZMZ A;  3EK8 A;  3TDI A;  4FTG A;  1RK9 A;  4GAO A;  2KI4 C;  5ER5 A;  2JT3 A;  4MRY A;  1RJV A;  4CID A;  1SBJ A;  3BUX B;  1DJX A;  2JNX A;  5I2Q A;  1EJ3 A;  2M29 A;  1Q80 A;  1QIV A;  1Y1A A;  1SK6 D;  2WOR A;  2K7O A;  5I2L A;  4P5O E;  5CSI A;  2PMY A;  3AAJ A;  3HX4 A;  4GNK B;  1D1O A;  1DF0 B;  3A8R A;  2F8P A;  4I5L B;  1R6P A;  3O78 A;  1PAL A;  3I5H B;  3TDZ A;  1YUR A;  1CDN A;  1HT9 A;  4MLW A;  3VRQ A;  4JQ0 D;  3DD4 A;  1BMO A;  3DVE A;  1XFZ O;  2LHL A;  1OZO A;  5KU1 A;  4OVN F;  2P6B B;  3RLZ A;  5HYD A;  4MZL A;  1LKJ A;  1NX3 A;  2M7L A;  1CDP A;  3SG2 A;  4AQJ A;  4QJ5 B;  5AER A;  2LNK A;  4YI9 A;  3FIA A;  3AKA A;  4PE0 A;  3BUO B;  1WRK A;  2F33 A;  3FWC A;  1CMF A;  1ALW A;  3E3R A;  2OTG B;  4ORC B;  4CFQ A;  3GOF A;  3GK2 A;  1SL9 A;  4GUK A;  1B8R A;  4ORB B;  2BBN A;  2BBM A;  2EC6 B;  3EKH A;  3HCM A;  1KSO A;  3DF0 B;  1A29 A;  3ICB A;  1F4Q A;  4M2Q A;  5TNC A;  2M49 B;  4OV2 A;  2LMT A;  2JTT A;  3BUW B;  3LK1 A;  3TS5 C;  3LL8 B;  1HQV A;  2K7D A;  1EL4 A;  3C1V A;  1YRT B;  3CGA A;  1LVC D;  2CTN A;  3VRR A;  3A4U B;  1TN4 A;  2SCP A;  3OB1 B;  1KQV A;  2JWW A;  1C07 A;  1QX2 A;  2H61 A;  3PN7 B;  4PE1 A;  4D1E A;  3PAL A;  4YGC B;  2H61 C;  4MVF A;  1Y6W A;  3CR4 X;  1MHO A;  1QX5 B;  3PLF B;  1DJZ A;  1K90 D;  1BU3 A;  2JT8 A;  2HF5 A;  1Y1U A;  4ORA B;  3PM8 A;  1B1G A;  3BQ3 A;  4PHK A;  4YI8 A;  1MF8 B;  1CDM A;  1F4O A;  2LAN A;  3CTN A;  1X02 A;  1XA5 A;  2KGB C;  3KHE A;  2ZKM X;  1IGV A;  4I5K A;  1C7V A;  5BPJ A;  2V53 A;  2COL B;  4MEW A;  1LA0 A;  3SJS A;  1EG3 A;  1YX7 A;  1NWD A;  1K9K A;  1EH2 A;  3BUN B;  1ZAC A;  1QV0 A;  3NSI A;  1B7T Y;  5D7F A;  5G08 A;  5HKY A;  5ER4 X;  1NIW A;  1L7Z A;  4N5X A;  2NLN A;  2JXL A;  2PAS A;  4PAL A;  1YR5 A;  3EKJ A;  3JVT C;  2QPT A;  1QAT A;  1MR8 A;  5DKN A;  5AFP A;  5I8N A;  2M9G A;  1KFU S;  1NUB A;  2WCE A;  4DS7 A;  1BR4 B;  3NSK A;  1IJ5 A;  2FJU B;  2Q4U A;  1MQ1 A;  3TUY B;  2R2I A;  2JU0 A;  2I94 A;  2LLT A;  2LP2 A;  2L2E A;  1DMO A;  4JPZ B;  2LLS A;  1FW4 A;  4MRX A;  2GV5 A;  3SIA A;  4NDB A;  2HQ8 A;  2KAV A;  2PVB A;  4L9M A;  4QJ4 B;  3BOW B;  1SR6 C;  3PSR A;  4BY5 A;  1CTR A;  4A4C A;  2K7C A;  1S36 A;  1CFF A;  2CXJ A;  1OSA A;  1SKT A;  4R1E A;  1WDC C;  1TNW A;  2LHI A;  3AAK A;  4PCW A;  1JF2 A;  2CCM A;  4YBH B;  5B8I B;  4YRU A;  2K7B A;  3D0Y A;  2M3W A;  4YGB B;  1B9A A;  1J1D A;  1S1E A;  2KFG A;  1H4B A;  1KFX S;  1G4Y R;  2KI4 B;  2KGR A;  2LVV A;  1QVI Y;  2I7A A;  1PRW A;  2WND A;  2WOS A;  4M2O A;  1A2X A;  4MSP A;  3ZWH A;  1DJI A;  4I5J A;  1LA3 A;  2PAL A;  2BL0 B;  1TCF A;  1QTX A;  1B7T Z;  2JT0 A;  1QXP A;  2MAZ A;  4JWQ A;  2KI6 C;  2OS8 B;  1JC2 A;  4NQG A;  1UHI A;  3O4Y A;  2ZN8 A;  3WNX B;  1SL8 A;  4C0L A;  2KAX A;  3VRN A;  4MZJ A;  1A75 A;  1SPY A;  5CSJ A;  1AUI B;  3MSE B;  1KK8 C;  1WLZ A;  1S5G Y;  3CWG A;  3OX6 A;  3SG4 A;  1PVA A;  1OMV A;  1J7O A;  4UPG A;  1FI5 A;  1OZS A;  1B8L A;  3NSO A;  1SCM C;  1V1G A;  1QV1 A;  2BEC A;  2HPS A;  1K94 A;  1IWQ A;  1W7J B;  1CKK A;  1ALV A;  3IQQ A;  3JTD C;  2NCO A;  1ODB A;  2BCA A;  4WQ2 A;  4GGF A;  1XFV O;  3LK0 A;  5HLO A;  4AQI A;  4GGF C;  1IJ6 A;  3KF9 A;  5AEQ A;  2LVJ A;  2F2O A;  1CFD A;  5CSN A;  2MRD A;  4PDZ A;  2F2P A;  3OX5 A;  4XJK A;  2M97 A;  2L0P A;  3NSL A;  1QVI Z;  2LM5 A;  1TIZ A;  3IQO A;  1SW8 A;  5IBW A;  2NXQ A;  3NXA A;  3EVU A;  2HQW A;  1UHH A;  5AXI A;  1NCX A;  3WXA A;  1G33 A;  2KBI A;  1TRF A;  1AVS A;  1SL7 A;  2CNP A;  3I5H C;  3EK4 A;  1JUO A;  4ZCU A;  1S6C A;  5K89 A;  2GGZ A;  1PVB A;  5AAN A;  2D8N A;  2WCF A;  1WY9 A;  2GGM A;  1F8H A;  2BKH B;  5FYX A;  4N1F A;  1U5I A;  4HRH A;  2KBM A;  1KK7 Y;  3H4S E;  1JSA A;  2F3Z A;  1S5G Z;  4N1G A;  4WQ3 A;  1BOC A;  2FCE A;  1W7I B;  2OTG C;  1AJ4 A;  2LC5 A;  3AKB A;  1REC A;  1DGU A;  1YVL A;  1DJG A;  4C0K A;  4BY4 A;  2M8U A;  1CM4 A;  2BKI B;  1GQM A;  4P2Y B;  1PUL A;  1FBV A;  2ZND A;  3SG6 A;  1GJY A;  2E30 A;  1CFP A;  2KQY A;  3I5I C;  4YGE B;  1KCY A;  1AJ5 A;  1NX1 A;  1XFX O;  2AAO A;  2MLF C;  1NCY A;  1DTL A;  1K9U A;  4A4B A;  1L2O C;  5HKW A;  1G8I A;  1EXR A;  2TN4 A;  4XYN A;  2KYC A;  4PE7 A;  1XFU O;  1BLQ A;  1OE9 B;  3O6B A;  1N0Y A;  2BE6 A;  1MXE A;  5DKQ A;  2BE4 A;  1TNP A;  3FS7 A;  1CLB A;  2B1U A;  2LVK A;  1NX2 A;  4F0Z B;  2KYF A;  1DT7 B;  1K9P A;  1R2U A;  2ZN9 A;  4HRE E;  1CLM A;  2K0J A;  2K61 A;  4DRW A;  4CPV A;  4C0J A;  1KK7 Z;  2Y1M A;  1XO5 A;  1SR6 B;  1WRZ A;  3WHT B;  1UHK A;  2L4H A;  1WDC B;  4MBE A;  3LLE A;  5F6T A;  5CPV A;  4GPL B;  1XK4 A;  1GGW A;  1S3P A;  3I5F C;  1RWY A;  1B4C A;  1NSH A;  1XK4 C;  1GGZ A;  1ZFS A;  1M63 B;  2LVI A;  4QJ3 B;  3ZNI A;  1CFC A;  2NZ0 A;  2LUX A;  3EVV A;  3VGO A;  3I5G C;  3CZT X;  2ZNE A;  1NP8 A;  4OKH A;  3BXK A;  2JXC A;  1WLM A;  1TCO B;  1YUS A;  2A4J A;  3QRX A;  2MBX A;  2ISD A;  1YUU A;  1SRA A;  1IKU A;  1RTP 1;  2G2B A;  3DVJ A;  3BYA A;  1ZUZ A;  3SG3 A;  3TUY C;  2AUC A;  1KSM A;  4M2P A;  1PSB A;  3EK7 A;  2MJW B;  1BJF A;  1PSR A;  4TNC A;  2SAS A;  1KWO C;  3OB2 B;  4CFR A;  1JF0 A;  1N65 A;  1MUX A;  1NYA A;  2JRF A;  1F71 A;  3FWB A;  1A75 B;  1KK8 B;  1SYM A;  2WCB A;  3M0W A;  4U8D A;  1YX8 A;  5JOL A;  4AOM A;  1TNQ A;  1SCM B;  3RM1 A;  4DUQ A;  1AK8 A;  1OQP A;  1BT6 A;  1H8B A;  3JTD B;  1KQM C;  2KNE A;  4WRI A;  2CBL A;  1J7Q A;  2RGI A;  3SG5 A;  4CLN A;  2BCX A;  4E68 A;  4HRG A;  2KOT A;  2L5X B;  2KQ6 A;  2ZFD A;  1C7W A;  1N2D A;  1S6I A;  1A4P A;  5I2O A;  1QJT A;  5J3X A;  2HET A;  2O60 A;  1FPW A;  2BL0 C;  2FCD A;  2LMU A;  1RFJ A;  5JJG A;  1YRU B;  1B47 A;  4OR9 B;  1KFX L;  3OP0 A;  2OS8 C;  4XJK B;  4YGD B;  5D69 A;  1CNP A;  1M39 A;  1IH0 A;  1ZOT B;  2E6W A;  4PHN A;  1F55 A;  1UHN A;  1IQ5 A;  1DF0 A;  2DOQ A;  2I18 A;  2LUC A;  1K93 D;  1QAS A;  2LCP A;  1E8A A;  5KSZ A;  2G9B A;  3TS5 B;  1UHJ A;  1V1F A;  1TTX A;  2PRU A;  2KFF A;  2JUL A;  1SMG A;  1U5I B;  3F45 A;  4OCI A;  2NCP A;  1NX0 A;  3CR2 A;  1JFJ A;  2M1U A;  1M46 A;  1S6J A;  2I2R E;  2JNF A;  2KI6 D;  1JFK A;  5PAL A;  2JC2 A;  3BUM B;  2LAP A;  2M1K B;  1UUR A;  2K2F A;  1UP5 A;  3KO0 A;  1DJY A;  1FF1 A;  1XVJ A;  4DCK A;  5DKR A;  2FOT A;  1QLS A;  1OMD A;  2Q91 A;  4MN0 A;  1JBA A;  3I5I B;  1UUS A;  1DJW A;  3KEV A;  5HKZ A;  1SNL A;  1TOP A;  1UWO A;  2LE9 B;  1J7R A;  3D10 A;  4MZK A;  4ZCV A;  5KTY A;  3DF0 A;  1CMG A;  2EC6 C;  2L50 A;  3OHM B;  4PHJ A;  1XYD A;  2H2K A;  2KFH A;  2MHH A;  2M7N A;  1BF5 A;  1L2O B;  2Y1N A;  1MXL C;  1IQ3 A;  1NPQ A;  2EHB A;  1LXF C;  4ETO A;  1QLK A;  1WRL A;  3GK4 X;  4GFT A;  3TDU A;  2JTZ A;  2VRG A;  1MWN A;  2L98 A;  3PFV A;  2JQ6 A;  1XFW O;  2M0R A;  1DGV A;  1TNX A;  3JVT B;  1QS7 A;  5GQQ C;  1CLL A;  1M31 A;  3DVK A;  5HLV A;  1DVI A;  3PN7 C;  1DJH A;  2MA2 A;  3CS1 A;  2MLE C;  3GK1 A;  1J55 A;  1OOJ A;  1YVH A;  1F54 A;  1SCV A;  1F70 A;  3IF7 A;  4GBA A;  2JPT A;  3O2P A;  4IL1 A;  2ZRS A;  1OMR A;  4ICB A;  2LLU A;  2L51 A;  2Y5I A;  4PHM A;  1EG4 A;  3WHU B;  1CM1 A;  4I5N B;  3SG7 A;  1S26 D;  3VRO A;  4HSZ A;  3I5F B;  2LP3 A;  1M45 A;  4NDD A;  3TZ1 A;  1YTZ C;  1J1E A;  4USL A;  1AP4 A;  3VRP A;  1JWD A;  3CLN A;  2ZRT A;  2OPO A;  3I5G B;  3SIB A;  2KAY A;  1AHR A;  1RRO A;  2IS9 A;  4FQO A;  3D0Y B;  3LCP C;  2EGD A;  2CT9 A;  4GGN A;  1BOD A;  2K2A A;  1QIW A;  4YGA A;  2KDH A;  4NDC A;  4PE4 A;  1BG1 A;  1CB1 A;  2WC8 A;  2K8M B;  2O5G A;  3KPX A;  3DVM A;  1Y0V H;  2QAC A;  1KWO B;  1CDL A;  2AMI A;  2Y4Q A;  1LIN A;  1K96 A;  2KSP A;  1IRJ A;  2F3Y A;  3CR5 X;  1NCZ A;  2PSR A;  3K21 A;  1XFY O;  2JOJ A;  1SY9 A;  1QX7 A;  2L4I A;  2LMV A;  1K95 A;  1KFU L;  1YUT A;  4DIR A;  3BOW A;  1VRK A;  1B8C A;  1BR1 B;  1K2H A;  1Y1X A;  5CSF A;  1K8U A;  1IG5 A;  1FI6 A;  3PAT A;  1KQM B;  2LV7 A;  4Q04 A;  1A03 A;  2BCB A;  2JZI A;  2KHN A;  1PK0 D; 
#chains in the Genus database with same CATH topology
 3EVR A;  1J7P A;  1ZMZ A;  3EK8 A;  4PT1 A;  3O4X A;  3TDI A;  4FTG A;  1RK9 A;  4GAO A;  2KI4 C;  5ER5 A;  2JT3 A;  4MRY A;  1RJV A;  4CID A;  1SBJ A;  3BUX B;  1DJX A;  2JNX A;  5I2Q A;  1EJ3 A;  2M29 A;  2L2C A;  1Q80 A;  1QIV A;  1Y1A A;  1GM0 A;  1SK6 D;  2WOR A;  2K7O A;  5I2L A;  4P5O E;  5CSI A;  2PMY A;  3AAJ A;  3HX4 A;  4GNK B;  1D1O A;  1DF0 B;  3A8R A;  2F8P A;  4IJ7 A;  4I5L B;  3SS5 A;  1R6P A;  3O78 A;  1PAL A;  3I5H B;  3NGV A;  1YUR A;  3R1P A;  3TDZ A;  1CDN A;  1HT9 A;  4MLW A;  3VRQ A;  5EL2 A;  4JQ0 D;  3DD4 A;  1BMO A;  3OBV A;  3DVE A;  1XFZ O;  2LHL A;  1OZO A;  5KU1 A;  4OVN F;  2P6B B;  3RLZ A;  5HYD A;  4MZL A;  1LKJ A;  1NX3 A;  2M7L A;  1CDP A;  3SG2 A;  4AQJ A;  4QJ5 B;  5AER A;  2LNK A;  4YI9 A;  3FIA A;  3AKA A;  4PE0 A;  3BUO B;  1WRK A;  2F33 A;  3FWC A;  1CMF A;  1ALW A;  3E3R A;  2OTG B;  4ORC B;  4CFQ A;  3GOF A;  3GK2 A;  1SL9 A;  4GUK A;  1B8R A;  4ORB B;  2BBN A;  2BBM A;  2EC6 B;  3EKH A;  3HCM A;  1KSO A;  3DF0 B;  1A29 A;  3ICB A;  1F4Q A;  3V2L A;  4M2Q A;  5TNC A;  2M49 B;  4OV2 A;  2LMT A;  2JTT A;  3BUW B;  3LK1 A;  3TS5 C;  3LL8 B;  3N7H A;  1HQV A;  2K7D A;  3S0D A;  1EL4 A;  3C1V A;  1YRT B;  3CGA A;  1LVC D;  2CTN A;  3VRR A;  3A4U B;  1TN4 A;  2SCP A;  3B86 A;  3OB1 B;  1KQV A;  5FI2 A;  2JWW A;  3DZT A;  1Z4H A;  1QX2 A;  1C07 A;  2H61 A;  3PN7 B;  4PE1 A;  4D1E A;  3PAL A;  4YGC B;  2H61 C;  4MVF A;  1Y6W A;  3CR4 X;  1MHO A;  1QX5 B;  3PLF B;  1DJZ A;  1K90 D;  1BU3 A;  2JT8 A;  2HF5 A;  1Y1U A;  4ORA B;  3PM8 A;  1B1G A;  3BQ3 A;  4PHK A;  4YI8 A;  1MF8 B;  1CDM A;  1F4O A;  2LAN A;  3CTN A;  1X02 A;  1XA5 A;  2KGB C;  3IVT A;  3KHE A;  2ZKM X;  1IGV A;  1DEK A;  4I5K A;  1C7V A;  5BPJ A;  2L5Y A;  2V53 A;  2COL B;  4MEW A;  1LA0 A;  3SJS A;  1EG3 A;  4JKT A;  1YX7 A;  5I94 A;  1NWD A;  1K9K A;  1EH2 A;  3BUN B;  1ZAC A;  1QV0 A;  3NSI A;  1B7T Y;  3R72 A;  5D7F A;  5G08 A;  5HKY A;  5ER4 X;  1NIW A;  1L7Z A;  4N5X A;  2NLN A;  2JXL A;  3NHI A;  2PAS A;  4PAL A;  1YR5 A;  3EKJ A;  3JVT C;  2QPT A;  1QAT A;  2ERB A;  1MR8 A;  5DKN A;  5AFP A;  5I8N A;  1OW4 A;  2M9G A;  1KFU S;  1NUB A;  2WCE A;  4DS7 A;  1BR4 B;  3NSK A;  1IJ5 A;  2WCH A;  2FJU B;  1OOI X;  2Q4U A;  1MQ1 A;  3L47 A;  2R2I A;  3TUY B;  2JU0 A;  2I94 A;  2LLT A;  2LP2 A;  2L2E A;  2KPH A;  4JPZ B;  2JPO A;  1DMO A;  1OOH A;  2LLS A;  1Z2C B;  2KLE A;  1FW4 A;  4MRX A;  2GV5 A;  3SIA A;  4NDB A;  3D78 A;  2HQ8 A;  2KAV A;  2PVB A;  4L9M A;  4JD9 A;  4QJ4 B;  3BOW B;  1SR6 C;  3PSR A;  4BY5 A;  1CTR A;  4A4C A;  2K7C A;  1S36 A;  1CFF A;  2CXJ A;  1OSA A;  1SKT A;  4R1E A;  1WDC C;  1TNW A;  2FJY A;  2LHI A;  3AAK A;  4PCW A;  1JF2 A;  2CCM A;  3D77 A;  4YBH B;  5B8I B;  4YRU A;  2K7B A;  3D0Y A;  2QEV A;  2M3W A;  2YGU A;  3K1E A;  4YGB B;  1B9A A;  1J1D A;  1S1E A;  2KFG A;  1H4B A;  1KFX S;  1G4Y R;  2KI4 B;  2KGR A;  2LVV A;  1QVI Y;  2I7A A;  1PRW A;  2WND A;  2WOS A;  4FQT A;  1A2X A;  4INX A;  4M2O A;  4MSP A;  3ZWH A;  1DJI A;  4I5J A;  1LA3 A;  2PAL A;  2BL0 B;  1TCF A;  1QTX A;  1B7T Z;  2JT0 A;  1QXP A;  2MAZ A;  4JWQ A;  2KI6 C;  3BFB A;  2OS8 B;  1JC2 A;  1C3Z A;  2K60 A;  4NQG A;  1UHI A;  3O4Y A;  2ZN8 A;  3WNX B;  1SL8 A;  2QEB A;  4C0L A;  2KAX A;  3VRN A;  4MZJ A;  1A75 A;  1SPY A;  5CSJ A;  1AUI B;  3MSE B;  4KYN A;  1KK8 C;  1WLZ A;  3OGN A;  1S5G Y;  3CWG A;  3OX6 A;  3SG4 A;  1PVA A;  1OMV A;  1J7O A;  4UPG A;  1FI5 A;  1OZS A;  1B8L A;  3NSO A;  1SCM C;  1V1G A;  1QV1 A;  2BEC A;  2HPS A;  1K94 A;  1IWQ A;  1W7J B;  2WC5 A;  1ALV A;  1CKK A;  3IQQ A;  3JTD C;  2NCO A;  1ODB A;  2BCA A;  4WQ2 A;  5KTY A;  4GGF A;  1XFV O;  3LK0 A;  5HLO A;  4AQI A;  1TWO A;  4GGF C;  1IJ6 A;  3KF9 A;  5AEQ A;  2LVJ A;  2F2O A;  1ORG A;  1CFD A;  5CSN A;  5FI7 A;  2MRD A;  4PDZ A;  2F2P A;  3OX5 A;  4XJK A;  2M97 A;  2L0P A;  3NSL A;  1QVI Z;  2LM5 A;  1TIZ A;  3IQO A;  1SW8 A;  5IBW A;  2NXQ A;  4INW A;  3NXA A;  3EVU A;  2HQW A;  2WCK A;  1UHH A;  5AXI A;  1NCX A;  3WXA A;  1G33 A;  2WC6 A;  2KBI A;  1TRF A;  1AVS A;  1SL7 A;  2CNP A;  3I5H C;  3EK4 A;  1IIO A;  1JUO A;  5DIC A;  4ZCU A;  1S6C A;  1TUZ A;  2GGZ A;  5K89 A;  1PVB A;  3FE9 A;  5AAN A;  2D8N A;  2WCF A;  1WY9 A;  2GGM A;  3D74 A;  1F8H A;  2BKH B;  5FYX A;  4N1F A;  1U5I A;  4HRH A;  3S0F A;  3BFA A;  2KBM A;  2BAP A;  1KK7 Y;  2WCL A;  3CZ2 A;  3H4S E;  1JSA A;  2F3Z A;  1S5G Z;  4N1G A;  4WQ3 A;  4OZD A;  3PJI A;  1BOC A;  2FCE A;  1W7I B;  3SS4 A;  2OTG C;  1AJ4 A;  2LC5 A;  3AKB A;  1REC A;  1DGU A;  1YVL A;  1DJG A;  3B7A A;  4BY4 A;  2M8U A;  1CM4 A;  3S0G A;  2BKI B;  1GQM A;  3DYE A;  4P2Y B;  4C0K A;  1PUL A;  1FBV A;  2ZND A;  3SG6 A;  1GJY A;  2E30 A;  1CFP A;  2KQY A;  3I5I C;  4YGE B;  1KCY A;  1AJ5 A;  1NX1 A;  1XFX O;  2AAO A;  2MLF C;  1NCY A;  1DTL A;  1K9U A;  2QDI A;  1C3Y A;  4A4B A;  1L2O C;  5HKW A;  1G8I A;  1EXR A;  2TN4 A;  4XYN A;  3BFH A;  2KYC A;  4PE7 A;  1XFU O;  1BLQ A;  1OE9 B;  3O6B A;  1N0Y A;  2BE6 A;  1DEL A;  1MXE A;  5DKQ A;  2BE4 A;  1TNP A;  3FS7 A;  1CLB A;  2B1U A;  5HL1 A;  2LVK A;  1NX2 A;  4F0Z B;  2KYF A;  1DT7 B;  1OOF A;  1K9P A;  1R2U A;  2ZN9 A;  4HRE E;  1CLM A;  2K0J A;  2K61 A;  4DRW A;  4CPV A;  4C0J A;  1KK7 Z;  2Y1M A;  1XO5 A;  3BJH A;  1SR6 B;  1WRZ A;  3WHT B;  1UHK A;  2L4H A;  1WDC B;  4MBE A;  3LLE A;  5F6T A;  3RZS A;  1TUJ A;  5CPV A;  4GPL B;  1XK4 A;  1GGW A;  1S3P A;  3I5F C;  1RWY A;  1B4C A;  1NSH A;  1XK4 C;  1GGZ A;  1ZFS A;  1M63 B;  2LVI A;  4QJ3 B;  3ZNI A;  1CFC A;  2NZ0 A;  2LUX A;  3EVV A;  3R1V A;  5D3O A;  3VGO A;  3I5G C;  3CZT X;  2ZNE A;  1NP8 A;  4OKH A;  3BXK A;  2JXC A;  1WLM A;  1TCO B;  1YUS A;  2A4J A;  3QRX A;  2WCJ A;  2MBX A;  2ISD A;  1YUU A;  1SRA A;  1IKU A;  1RTP 1;  2G2B A;  3DVJ A;  3L4A A;  3BYA A;  3S0A A;  1ZUZ A;  3SG3 A;  3TUY C;  2AUC A;  1KSM A;  4M2P A;  1PSB A;  3CZ1 A;  2MJW B;  1BJF A;  1PSR A;  3EK7 A;  2SAS A;  1KWO C;  3OB2 B;  4TNC A;  4CFR A;  1DC1 A;  1JF0 A;  1N65 A;  1MUX A;  2QEO A;  1NYA A;  2JRF A;  1F71 A;  3FWB A;  1A75 B;  1KK8 B;  1SYM A;  2WCB A;  3M0W A;  4U8D A;  1YX8 A;  5JOL A;  4AOM A;  3Q8I A;  1TNQ A;  1SCM B;  3RM1 A;  4DUQ A;  3D75 A;  1AK8 A;  1OQP A;  2P70 A;  1BT6 A;  1H8B A;  3JTD B;  3CZ0 A;  1KQM C;  2KNE A;  4WRI A;  2CBL A;  1J7Q A;  2RGI A;  3SG5 A;  4CLN A;  2BCX A;  4E68 A;  4HRG A;  2KOT A;  2KLD A;  2KQ6 A;  2L5X B;  1C7W A;  1N2D A;  1S6I A;  2ZFD A;  1A4P A;  5I2O A;  1QJT A;  5J3X A;  2HET A;  2O60 A;  3UO9 A;  1FPW A;  2BL0 C;  2FCD A;  2LMU A;  1RFJ A;  3VB1 A;  5JJG A;  1YRU B;  1B47 A;  4OR9 B;  1KFX L;  3OP0 A;  2OS8 C;  4XJK B;  4YGD B;  5D69 A;  1CNP A;  3FE6 A;  1M39 A;  1IH0 A;  4F7F A;  1ZOT B;  2E6W A;  3EG5 B;  4PHN A;  1F55 A;  1UHN A;  1IQ5 A;  1DF0 A;  2DOQ A;  2I18 A;  2LUC A;  1K93 D;  1QAS A;  2LCP A;  1E8A A;  5KSZ A;  2G9B A;  3TS5 B;  1UHJ A;  1V1F A;  1TTX A;  2PRU A;  1SSE B;  2KFF A;  2JUL A;  1SMG A;  1U5I B;  3CDN A;  3F45 A;  4OCI A;  2NCP A;  1NX0 A;  3CR2 A;  1JFJ A;  3NHT A;  2M1U A;  1M46 A;  1S6J A;  2I2R E;  2JNF A;  2KI6 D;  3L4L A;  1JFK A;  1QWV A;  5PAL A;  2JC2 A;  2P71 A;  3BUM B;  2LAP A;  2M1K B;  3QME A;  1UUR A;  2K2F A;  1UP5 A;  3KO0 A;  1DJY A;  1FF1 A;  3CAB A;  1XVJ A;  3B6X A;  4DCK A;  5DKR A;  2FOT A;  1QLS A;  1T14 A;  1OMD A;  2Q91 A;  4MN0 A;  1JBA A;  3I5I B;  1UUS A;  1DJW A;  3KEV A;  5HKZ A;  1SNL A;  1TOP A;  1UWO A;  2LE9 B;  1J7R A;  3D10 A;  3R1O A;  3FE8 A;  4MZK A;  3DF0 A;  4ZCV A;  2EC6 C;  2L50 A;  3OHM B;  4PHJ A;  1XYD A;  3SS3 A;  1CMG A;  2H2K A;  2KFH A;  2MHH A;  2M7N A;  1BF5 A;  1L2O B;  2Y1N A;  1MXL C;  1IQ3 A;  1NPQ A;  2EHB A;  1LXF C;  1P28 A;  1QLK A;  1LS8 A;  1WRL A;  3GK4 X;  4GFT A;  4ETO A;  3TDU A;  2JTZ A;  2VRG A;  1MWN A;  2L98 A;  2QEH A;  3PFV A;  1W9Z A;  1XFW O;  2JQ6 A;  1DGV A;  1TNX A;  2M0R A;  3JVT B;  1QS7 A;  2BNX A;  5GQQ C;  1CLL A;  1M31 A;  3DVK A;  5HLV A;  1DVI A;  3PN7 C;  3S0E A;  1DJH A;  2MA2 A;  3CS1 A;  2MLE C;  3GK1 A;  1J55 A;  1OOJ A;  1YVH A;  2PQL A;  1SCV A;  1F54 A;  3IF7 A;  1F70 A;  3DY9 A;  2JPT A;  4GBA A;  3O2P A;  4IL1 A;  2ZRS A;  1OMR A;  4ICB A;  2LLU A;  2L51 A;  2Y5I A;  4PHM A;  1EG4 A;  3WHU B;  1CM1 A;  4I5N B;  3SG7 A;  1S26 D;  3VRO A;  1DQE A;  4HSZ A;  3DXL A;  3I5F B;  2LP3 A;  1M45 A;  2GTE A;  4NDD A;  3TZ1 A;  1YTZ C;  1J1E A;  3S0B A;  4USL A;  3D76 A;  2PYQ A;  1AP4 A;  3VRP A;  1JWD A;  3CLN A;  2ZRT A;  2OPO A;  3I5G B;  3SIB A;  2KAY A;  1AHR A;  1RRO A;  2IS9 A;  4FQO A;  3D0Y B;  3D73 A;  3LCP C;  2H8V A;  2EGD A;  2CT9 A;  4GGN A;  1BOD A;  2K2A A;  1QIW A;  4YGA A;  2KDH A;  4NDC A;  4PE4 A;  1BG1 A;  3B87 A;  2WCM A;  1OOG A;  2WC8 A;  2K8M B;  1CB1 A;  2O5G A;  3KPX A;  3DVM A;  1Y0V H;  2QAC A;  1KWO B;  1CDL A;  2AMI A;  2Y4Q A;  1LIN A;  3CYZ A;  1K96 A;  2KSP A;  1IRJ A;  2F3Y A;  3B88 A;  5FI6 A;  3UNW A;  3CR5 X;  1NCZ A;  2PSR A;  3K21 A;  1XFY O;  2JOJ A;  1SY9 A;  1QX7 A;  2L4I A;  2LMV A;  1K95 A;  1KFU L;  1YUT A;  4DIR A;  3BOW A;  1VRK A;  1B8C A;  1BR1 B;  1K2H A;  1XFR A;  1Y1X A;  5CSF A;  1K8U A;  1IG5 A;  3PM2 A;  1FI6 A;  3PAT A;  1KQM B;  2LV7 A;  4Q04 A;  1A03 A;  2BCB A;  2JZI A;  2KHN A;  1PK0 D; 
#chains in the Genus database with same CATH homology
 3EVR A;  1J7P A;  1ZMZ A;  3EK8 A;  3TDI A;  4FTG A;  1RK9 A;  4GAO A;  2KI4 C;  5ER5 A;  2JT3 A;  4MRY A;  1RJV A;  4CID A;  1SBJ A;  3BUX B;  1DJX A;  2JNX A;  5I2Q A;  1EJ3 A;  2M29 A;  1Q80 A;  1QIV A;  1Y1A A;  1SK6 D;  2WOR A;  2K7O A;  5I2L A;  4P5O E;  5CSI A;  2PMY A;  3AAJ A;  3HX4 A;  4GNK B;  1D1O A;  1DF0 B;  3A8R A;  2F8P A;  4I5L B;  1R6P A;  3O78 A;  1PAL A;  3I5H B;  3TDZ A;  1YUR A;  1CDN A;  1HT9 A;  4MLW A;  3VRQ A;  4JQ0 D;  3DD4 A;  1BMO A;  3DVE A;  1XFZ O;  2LHL A;  1OZO A;  5KU1 A;  4OVN F;  2P6B B;  3RLZ A;  5HYD A;  4MZL A;  1LKJ A;  1NX3 A;  2M7L A;  1CDP A;  3SG2 A;  4AQJ A;  4QJ5 B;  5AER A;  2LNK A;  4YI9 A;  3FIA A;  3AKA A;  4PE0 A;  3BUO B;  1WRK A;  2F33 A;  3FWC A;  1CMF A;  1ALW A;  3E3R A;  2OTG B;  4ORC B;  4CFQ A;  3GOF A;  3GK2 A;  1SL9 A;  4GUK A;  1B8R A;  4ORB B;  2BBN A;  2BBM A;  2EC6 B;  3EKH A;  3HCM A;  1KSO A;  3DF0 B;  1A29 A;  3ICB A;  1F4Q A;  4M2Q A;  5TNC A;  2M49 B;  4OV2 A;  2LMT A;  2JTT A;  3BUW B;  3LK1 A;  3TS5 C;  3LL8 B;  1HQV A;  2K7D A;  1EL4 A;  3C1V A;  1YRT B;  3CGA A;  1LVC D;  2CTN A;  3VRR A;  3A4U B;  1TN4 A;  2SCP A;  3OB1 B;  1KQV A;  2JWW A;  1C07 A;  1QX2 A;  2H61 A;  3PN7 B;  4PE1 A;  4D1E A;  3PAL A;  4YGC B;  2H61 C;  4MVF A;  1Y6W A;  3CR4 X;  1MHO A;  1QX5 B;  3PLF B;  1DJZ A;  1K90 D;  1BU3 A;  2JT8 A;  2HF5 A;  1Y1U A;  4ORA B;  3PM8 A;  1B1G A;  3BQ3 A;  4PHK A;  4YI8 A;  1MF8 B;  1CDM A;  1F4O A;  2LAN A;  3CTN A;  1X02 A;  1XA5 A;  2KGB C;  3KHE A;  2ZKM X;  1IGV A;  4I5K A;  1C7V A;  5BPJ A;  2V53 A;  2COL B;  4MEW A;  1LA0 A;  3SJS A;  1EG3 A;  1YX7 A;  1NWD A;  1K9K A;  1EH2 A;  3BUN B;  1ZAC A;  1QV0 A;  3NSI A;  1B7T Y;  5D7F A;  5G08 A;  5HKY A;  5ER4 X;  1NIW A;  1L7Z A;  4N5X A;  2NLN A;  2JXL A;  2PAS A;  4PAL A;  1YR5 A;  3EKJ A;  3JVT C;  2QPT A;  1QAT A;  1MR8 A;  5DKN A;  5AFP A;  5I8N A;  2M9G A;  1KFU S;  1NUB A;  2WCE A;  4DS7 A;  1BR4 B;  3NSK A;  1IJ5 A;  2FJU B;  2Q4U A;  1MQ1 A;  3TUY B;  2R2I A;  2JU0 A;  2I94 A;  2LLT A;  2LP2 A;  2L2E A;  1DMO A;  4JPZ B;  2LLS A;  1FW4 A;  4MRX A;  2GV5 A;  3SIA A;  4NDB A;  2HQ8 A;  2KAV A;  2PVB A;  4L9M A;  4QJ4 B;  3BOW B;  1SR6 C;  3PSR A;  4BY5 A;  1CTR A;  4A4C A;  2K7C A;  1S36 A;  1CFF A;  2CXJ A;  1OSA A;  1SKT A;  4R1E A;  1WDC C;  1TNW A;  2LHI A;  3AAK A;  4PCW A;  1JF2 A;  2CCM A;  4YBH B;  5B8I B;  4YRU A;  2K7B A;  3D0Y A;  2M3W A;  4YGB B;  1B9A A;  1J1D A;  1S1E A;  2KFG A;  1H4B A;  1KFX S;  1G4Y R;  2KI4 B;  2KGR A;  2LVV A;  1QVI Y;  2I7A A;  1PRW A;  2WND A;  2WOS A;  4M2O A;  1A2X A;  4MSP A;  3ZWH A;  1DJI A;  4I5J A;  1LA3 A;  2PAL A;  2BL0 B;  1TCF A;  1QTX A;  1B7T Z;  2JT0 A;  1QXP A;  2MAZ A;  4JWQ A;  2KI6 C;  2OS8 B;  1JC2 A;  4NQG A;  1UHI A;  3O4Y A;  2ZN8 A;  3WNX B;  1SL8 A;  4C0L A;  2KAX A;  3VRN A;  4MZJ A;  1A75 A;  1SPY A;  5CSJ A;  1AUI B;  3MSE B;  1KK8 C;  1WLZ A;  1S5G Y;  3CWG A;  3OX6 A;  3SG4 A;  1PVA A;  1OMV A;  1J7O A;  4UPG A;  1FI5 A;  1OZS A;  1B8L A;  3NSO A;  1SCM C;  1V1G A;  1QV1 A;  2BEC A;  2HPS A;  1K94 A;  1IWQ A;  1W7J B;  1CKK A;  1ALV A;  3IQQ A;  3JTD C;  2NCO A;  1ODB A;  2BCA A;  4WQ2 A;  4GGF A;  1XFV O;  3LK0 A;  5HLO A;  4AQI A;  4GGF C;  1IJ6 A;  3KF9 A;  5AEQ A;  2LVJ A;  2F2O A;  1CFD A;  5CSN A;  2MRD A;  4PDZ A;  2F2P A;  3OX5 A;  4XJK A;  2M97 A;  2L0P A;  3NSL A;  1QVI Z;  2LM5 A;  1TIZ A;  3IQO A;  1SW8 A;  5IBW A;  2NXQ A;  3NXA A;  3EVU A;  2HQW A;  1UHH A;  5AXI A;  1NCX A;  3WXA A;  1G33 A;  2KBI A;  1TRF A;  1AVS A;  1SL7 A;  2CNP A;  3I5H C;  3EK4 A;  1JUO A;  4ZCU A;  1S6C A;  5K89 A;  2GGZ A;  1PVB A;  5AAN A;  2D8N A;  2WCF A;  1WY9 A;  2GGM A;  1F8H A;  2BKH B;  5FYX A;  4N1F A;  1U5I A;  4HRH A;  2KBM A;  1KK7 Y;  3H4S E;  1JSA A;  2F3Z A;  1S5G Z;  4N1G A;  4WQ3 A;  1BOC A;  2FCE A;  1W7I B;  2OTG C;  1AJ4 A;  2LC5 A;  3AKB A;  1REC A;  1DGU A;  1YVL A;  1DJG A;  4C0K A;  4BY4 A;  2M8U A;  1CM4 A;  2BKI B;  1GQM A;  4P2Y B;  1PUL A;  1FBV A;  2ZND A;  3SG6 A;  1GJY A;  2E30 A;  1CFP A;  2KQY A;  3I5I C;  4YGE B;  1KCY A;  1AJ5 A;  1NX1 A;  1XFX O;  2AAO A;  2MLF C;  1NCY A;  1DTL A;  1K9U A;  4A4B A;  1L2O C;  5HKW A;  1G8I A;  1EXR A;  2TN4 A;  4XYN A;  2KYC A;  4PE7 A;  1XFU O;  1BLQ A;  1OE9 B;  3O6B A;  1N0Y A;  2BE6 A;  1MXE A;  5DKQ A;  2BE4 A;  1TNP A;  3FS7 A;  1CLB A;  2B1U A;  2LVK A;  1NX2 A;  4F0Z B;  2KYF A;  1DT7 B;  1K9P A;  1R2U A;  2ZN9 A;  4HRE E;  1CLM A;  2K0J A;  2K61 A;  4DRW A;  4CPV A;  4C0J A;  1KK7 Z;  2Y1M A;  1XO5 A;  1SR6 B;  1WRZ A;  3WHT B;  1UHK A;  2L4H A;  1WDC B;  4MBE A;  3LLE A;  5F6T A;  5CPV A;  4GPL B;  1XK4 A;  1GGW A;  1S3P A;  3I5F C;  1RWY A;  1B4C A;  1NSH A;  1XK4 C;  1GGZ A;  1ZFS A;  1M63 B;  2LVI A;  4QJ3 B;  3ZNI A;  1CFC A;  2NZ0 A;  2LUX A;  3EVV A;  3VGO A;  3I5G C;  3CZT X;  2ZNE A;  1NP8 A;  4OKH A;  3BXK A;  2JXC A;  1WLM A;  1TCO B;  1YUS A;  2A4J A;  3QRX A;  2MBX A;  2ISD A;  1YUU A;  1SRA A;  1IKU A;  1RTP 1;  2G2B A;  3DVJ A;  3BYA A;  1ZUZ A;  3SG3 A;  3TUY C;  2AUC A;  1KSM A;  4M2P A;  1PSB A;  3EK7 A;  2MJW B;  1BJF A;  1PSR A;  4TNC A;  2SAS A;  1KWO C;  3OB2 B;  4CFR A;  1JF0 A;  1N65 A;  1MUX A;  1NYA A;  2JRF A;  1F71 A;  3FWB A;  1A75 B;  1KK8 B;  1SYM A;  2WCB A;  3M0W A;  4U8D A;  1YX8 A;  5JOL A;  4AOM A;  1TNQ A;  1SCM B;  3RM1 A;  4DUQ A;  1AK8 A;  1OQP A;  1BT6 A;  1H8B A;  3JTD B;  1KQM C;  2KNE A;  4WRI A;  2CBL A;  1J7Q A;  2RGI A;  3SG5 A;  4CLN A;  2BCX A;  4E68 A;  4HRG A;  2KOT A;  2L5X B;  2KQ6 A;  2ZFD A;  1C7W A;  1N2D A;  1S6I A;  1A4P A;  5I2O A;  1QJT A;  5J3X A;  2HET A;  2O60 A;  1FPW A;  2BL0 C;  2FCD A;  2LMU A;  1RFJ A;  5JJG A;  1YRU B;  1B47 A;  4OR9 B;  1KFX L;  3OP0 A;  2OS8 C;  4XJK B;  4YGD B;  5D69 A;  1CNP A;  1M39 A;  1IH0 A;  1ZOT B;  2E6W A;  4PHN A;  1F55 A;  1UHN A;  1IQ5 A;  1DF0 A;  2DOQ A;  2I18 A;  2LUC A;  1K93 D;  1QAS A;  2LCP A;  1E8A A;  5KSZ A;  2G9B A;  3TS5 B;  1UHJ A;  1V1F A;  1TTX A;  2PRU A;  2KFF A;  2JUL A;  1SMG A;  1U5I B;  3F45 A;  4OCI A;  2NCP A;  1NX0 A;  3CR2 A;  1JFJ A;  2M1U A;  1M46 A;  1S6J A;  2I2R E;  2JNF A;  2KI6 D;  1JFK A;  5PAL A;  2JC2 A;  3BUM B;  2LAP A;  2M1K B;  1UUR A;  2K2F A;  1UP5 A;  3KO0 A;  1DJY A;  1FF1 A;  1XVJ A;  4DCK A;  5DKR A;  2FOT A;  1QLS A;  1OMD A;  2Q91 A;  4MN0 A;  1JBA A;  3I5I B;  1UUS A;  1DJW A;  3KEV A;  5HKZ A;  1SNL A;  1TOP A;  1UWO A;  2LE9 B;  1J7R A;  3D10 A;  4MZK A;  4ZCV A;  5KTY A;  3DF0 A;  1CMG A;  2EC6 C;  2L50 A;  3OHM B;  4PHJ A;  1XYD A;  2H2K A;  2KFH A;  2MHH A;  2M7N A;  1BF5 A;  1L2O B;  2Y1N A;  1MXL C;  1IQ3 A;  1NPQ A;  2EHB A;  1LXF C;  4ETO A;  1QLK A;  1WRL A;  3GK4 X;  4GFT A;  3TDU A;  2JTZ A;  2VRG A;  1MWN A;  2L98 A;  3PFV A;  2JQ6 A;  1XFW O;  2M0R A;  1DGV A;  1TNX A;  3JVT B;  1QS7 A;  5GQQ C;  1CLL A;  1M31 A;  3DVK A;  5HLV A;  1DVI A;  3PN7 C;  1DJH A;  2MA2 A;  3CS1 A;  2MLE C;  3GK1 A;  1J55 A;  1OOJ A;  1YVH A;  1F54 A;  1SCV A;  1F70 A;  3IF7 A;  4GBA A;  2JPT A;  3O2P A;  4IL1 A;  2ZRS A;  1OMR A;  4ICB A;  2LLU A;  2L51 A;  2Y5I A;  4PHM A;  1EG4 A;  3WHU B;  1CM1 A;  4I5N B;  3SG7 A;  1S26 D;  3VRO A;  4HSZ A;  3I5F B;  2LP3 A;  1M45 A;  4NDD A;  3TZ1 A;  1YTZ C;  1J1E A;  4USL A;  1AP4 A;  3VRP A;  1JWD A;  3CLN A;  2ZRT A;  2OPO A;  3I5G B;  3SIB A;  2KAY A;  1AHR A;  1RRO A;  2IS9 A;  4FQO A;  3D0Y B;  3LCP C;  2EGD A;  2CT9 A;  4GGN A;  1BOD A;  2K2A A;  1QIW A;  4YGA A;  2KDH A;  4NDC A;  4PE4 A;  1BG1 A;  1CB1 A;  2WC8 A;  2K8M B;  2O5G A;  3KPX A;  3DVM A;  1Y0V H;  2QAC A;  1KWO B;  1CDL A;  2AMI A;  2Y4Q A;  1LIN A;  1K96 A;  2KSP A;  1IRJ A;  2F3Y A;  3CR5 X;  1NCZ A;  2PSR A;  3K21 A;  1XFY O;  2JOJ A;  1SY9 A;  1QX7 A;  2L4I A;  2LMV A;  1K95 A;  1KFU L;  1YUT A;  4DIR A;  3BOW A;  1VRK A;  1B8C A;  1BR1 B;  1K2H A;  1Y1X A;  5CSF A;  1K8U A;  1IG5 A;  1FI6 A;  3PAT A;  1KQM B;  2LV7 A;  4Q04 A;  1A03 A;  2BCB A;  2JZI A;  2KHN A;  1PK0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...