1OMDA

Structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
ITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of oncomodulin refined at 1.85 A resolution. An example of extensive molecular aggregation via Ca2+.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium binding protein
molecule keywords ONCOMODULIN
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omdA00
1N2DA 1YRTB 1WLZA 1DJIA 2WCEA 2NZ0A 2Y4QA 1HQVA 2BBMA 1KWOC 1IJ6A 2KI4B 1IKUA 3BOWA 1RECA 3OB2B 4ZCUA 1XFUO 3KO0A 4HRGA 1BR4B 1PSBA 1CKKA 2JC2A 1S36A 4N1FA 1FW4A 1SW8A 2CNPA 1E8AA 2GGZA 1G8IA 1DT7B 3WHTB 1QV0A 3C1VA 3M0WA 4GGFA 3OB1B 1L2OB 1OQPA 2LAPA 4XJKA 1CFFA 1F71A 4WQ2A 2L98A 2LLSA 3NSOA 1DJWA 4OCIA 1K9UA 3NSIA 1KQMC 1SMGA 1Y6WA 4YGEB 1ALWA 3TDIA 1B4CA 4PE7A 2F8PA 1IGVA 2M3WA 3FS7A 4JWQA 1SY9A 4GBAA 2JOJA 2VRGA 1CMFA 2M29A 2WORA 3VRPA 2ZN8A 1U5IA 5JJGA 1J7OA 2L51A 3FWBA 4MBEA 1BMOA 2KBIA 1S6JA 1IQ5A 5PALA 2JNXA 1UHKA 1F8HA 4QJ5B 4DIRA 3PALA 1QATA 3NSLA 2HQ8A 3LL8B 3VRNA 2F3YA 4YGAA 4YGCB 3PSRA 2HPSA 4NDBA 4GNKB 4N5XA 1XO5A 1EH2A 2LVIA 1KFXL 3I5FB 1NP8A 5AFPA 1MQ1A 2M97A 1LA3A 2MAZA 4M2PA 2EC6B 2KFFA 1BU3A 2E6WA 2FCEA 5AANA 1A03A 1A75A 2KYCA 2WCFA 4PHJA 2BE4A 2KFHA 2M7NA 4YRUA 2KI6C 2JU0A 4ZCVA 1J7QA 1PALA 1XVJA 1YX8A 4NDCA 2BL0C 4FTGA 2L0PA 1DJYA 1EXRA 5DKQA 1WRKA 2QPTA 3MSEB 3BUMB 4PHMA 2M7LA 1GGZA 5AERA 2MLEC 1YRUB 4GGFC 2PMYA 1N0YA 1MR8A 1DF0A 1JF0A 1SYMA 2AUCA 2L50A 4M2QA 4A4CA 2ZKMX 1B7TZ 3JVTC 3KPXA 4MVFA 4PHNA 4M2OA 5F6TA 1VRKA 1NWDA 1MXEA 1S6CA 4PDZA 2L4IA 1B7TY 1SNLA 3I5GC 1D1OA 4L9MA 2F2OA 2KGRA 1QIWA 1FPWA 2DOQA 2KAYA 3I5HC 4P2YB 3EKHA 2LVKA 5ER4X 3GK2A 1SPYA 2FJUB 2D8NA 1EL4A 4HREE 5DKRA 2KYFA 2NCPA 1CDLA 3I5HB 1OMRA 1OOJA 2M1KB 1SL7A 2LUXA 3CLNA 1AUIB 4OR9B 5HKZA 1OSAA 2BCBA 1B8RA 4D1EA 4YI8A 3KF9A 4HRHA 1B47A 1S3PA 2LLUA 1A4PA 1DTLA 3ICBA 4CLNA 1UHJA 4PE4A 1Y0VH 1QX5B 2KBMA 1Y1UA 2JT3A 4AQIA 1SCMC 1QXPA 2FCDA 2OS8C 1UHNA 1TRFA 2JXLA 2LP2A 3TDZA 3QRXA 1SL8A 2BCXA 2E30A 3PM8A 3ZNIA 3VGOA 2BKIB 1DVIA 2LCPA 3D0YA 3PN7C 1XA5A 1NSHA 1KK7Z 1RK9A 2KFGA 4PCWA 1UUSA 4PALA 3VRRA 1CB1A 2NCOA 2LVVA 1QV1A 4GUKA 1KSOA 2K7DA 1K94A 2OPOA 1KSMA 4F0ZB 1U5IB 2ISDA 4CPVA 2LUCA 4PE1A 4QJ4B 1WY9A 1C7WA 1BLQA 1CLBA 4DS7A 1AVSA 2H61A 1RJVA 1NX3A 2PALA 4BY4A 5IBWA 1R2UA 5HLVA 2JT0A 1CLMA 2QACA 1JFJA 1JFKA 1W7IB 4P5OE 2EC6C 4YGDB 1SK6D 1F4QA 1YVLA 4OVNF 1MHOA 2GV5A 1CM1A 1MF8B 1UWOA 1EG4A 4WQ3A 1G33A 1SR6C 2GGMA 1CDMA 2I18A 2ZFDA 1XFVO 4YI9A 2Y1MA 3BOWB 1OMVA 1J1EA 3DVJA 2LANA 3SG7A 4BY5A 1GGWA 1EJ3A 1M46A 2BECA 5FYXA 3CR4X 2KSPA 2F33A 3F45A 2ZRSA 1NCXA 1XFXO 1RROA 4DUQA 3BUNB 4OV2A 2SASA 1MUXA 2H2KA 3EVUA 1CLLA 1NCZA 2G9BA 3SG2A 2F3ZA 4XJKB 2K0JA 1YTZC 1V1GA 2JT8A 4YGBB 1QLSA 4MN0A 1PRWA 2AMIA 1F4OA 3DVKA 5I2LA 4UPGA 3RLZA 1KFUL 1NIWA 3SJSA 4R1EA 3IF7A 2RGIA 5CSFA 1DJZA 2HETA 1DF0B 5J3XA 3SIAA 1NCYA 1J7RA 3E3RA 5I2QA 3TUYC 1UP5A 5HKYA 5AEQA 1CFCA 1KK7Y 1XFWO 3CTNA 1BR1B 1V1FA 4GAOA 2K2AA 3NSKA 4GGNA 5HLOA 3I5GB 1BODA 2KHNA 3HX4A 1DJGA 1B8LA 3O4YA 5G08A 2K7CA 1Y1XA 1CFDA 1TCOB 3PATA 4IL1A 2LC5A 2Q91A 3WNXB 2BL0B 1QJTA 3TS5B 3VRQA 5DKNA 3RM1A 2LLTA 1PULA 4JPZB 3TS5C 1R6PA 1JWDA 4MRYA 2I94A 1SL9A 1MXLC 1TOPA 3PN7B 1OZSA 1QVIY 1S5GZ 1WDCB 2JTTA 2K7BA 4PHKA 2K7OA 1ODBA 1IRJA 2MA2A 1IWQA 2K61A 1A75B 1TNPA 2LVJA 3SG3A 3OX5A 1S26D 5HYDA 2K2FA 1PVAA 1KCYA 4MLWA 2LM5A 1Q80A 3JVTB 1GQMA 4ORAB 4ETOA 1FBVA 1SKTA 2KOTA 1AJ5A 3AKBA 1SCMB 1QLKA 1IQ3A 5CSNA 5KTYA 2M49B 3WXAA 1ZUZA 3WHUB 1AHRA 2M8UA 3FIAA 4A4BA 2PVBA 2JRFA 1B8CA 4N1GA 4Q04A 1KFXS 1HT9A 3CS1A 1YURA 1EG3A 4I5LB 3JTDB 5ER5A 2WCBA 4E68A 4U8DA 3CWGA 4AOMA 1QS7A 4I5KA 1UHIA 5CSJA 1KWOB 4ICBA 2ZNDA 2H61C 2CXJA 2LE9B 1KQMB 4GFTA 1B1GA 3TZ1A 1M39A 1OE9B 2BBNA 1KK8B 2BE6A 2CBLA 2PASA 5I8NA 1JUOA 1DMOA 4FQOA 4MRXA 1C7VA 3BYAA 4QJ3B 1LA0A 1ZOTB 1N65A 2Y5IA 5KU1A 3I5IB 1X02A 2BKHB 3LK0A 1F70A 3BXKA 2HQWA 1QASA 3LK1A 1AK8A 2OS8B 1S1EA 4HSZA 1PSRA 2O60A 2KGBC 1JBAA 1WLMA 1M45A 2EGDA 1C07A 1JSAA 2AAOA 2L4HA 1CDPA 2M9GA 1DGVA 1A2XA 2FOTA 2LHLA 2LNKA 3CR2A 3PFVA 1XYDA 1H8BA 1K93D 1Y1AA 3DVMA 2SCPA 1L7ZA 2MHHA 2O5GA 1QTXA 1TTXA 2JXCA 3IQQA 3K21A 1RWYA 4OKHA 1J55A 1TNWA 3DD4A 3BQ3A 2JULA 2JPTA 1DJHA 2HF5A 1TIZA 1TN4A 1JC2A 1H4BA 2WNDA 3A4UB 1XK4A 3A8RA 5GQQC 1S6IA 3EVRA 1XK4C 2I7AA 1K90D 2JWWA 2KI6D 3GK4X 5TNCA 3SG5A 4DCKA 1CFPA 3SG4A 1NX0A 1K96A 1SR6B 3TUYB 1NPQA 2LMVA 4XYNA 1AJ4A 1K9PA 1SBJA 2ZRTA 2P6BB 2BCAA 3GK1A 5D69A 2PRUA 1CDNA 2I2RE 5AXIA 2WC8A 2OTGC 1KK8C 1NUBA 4GPLB 5B8IB 2JZIA 1GJYA 3NXAA 5KSZA 2L5XB 3D10A 1IJ5A 2EHBA 2MJWB 2MLFC 2WOSA 3O78A 4MEWA 1NX2A 3OP0A 3EKJA 3TDUA 3FWCA 4PE0A 1TCFA 1L2OC 2LP3A 2JNFA 2K8MB 1W7JB 2CCMA 2F2PA 4I5JA 2KQ6A 3SIBA 1A29A 4JQ0D 1YVHA 1KFUS 3BUXB 1J1DA 1UHHA 2KAXA 3BUWB 3PLFB 2KNEA 3SG6A 1BF5A 1RFJA 3LLEA 4YBHB 2LV7A 3EK4A 2CTNA 1NX1A 1F55A 1K2HA 5CSIA 2JTZA 4CFQA 1CMGA 2A4JA 1YR5A 4ORBB 1KQVA 2L2EA 3KHEA 2IS9A 1J7PA 2CT9A 1QVIZ 1S5GY 3IQOA 1QX2A 1PVBA 5CPVA 1DGUA 1WRLA 3CZTX 4DRWA 2B1UA 1CTRA 4NDDA 1OZOA 3EVVA 1WRZA 2MBXA 3ZWHA 1K8UA 3AKAA 5D7FA 2Y1NA 3DF0A 1B9AA 3CGAA 1NYAA 3DF0B 4CIDA 4C0KA 3H4SE 2ZN9A 1DJXA 2COLB 1LXFC 3KEVA 3CR5X 2G2BA 3GOFA 1CNPA 2TN4A 2ZNEA 3I5FC 2OTGB 2PSRA 1YUSA 1SRAA 1IG5A 4NQGA 1XFYO 2R2IA 5HKWA 3EK8A 1M63B 3OHMB 1RTP1 3D0YB 1ZFSA 2Q4UA 1JF2A 2V53A 3AAKA 4ORCB 1CM4A 1YUTA 4WRIA 1AP4A 3O2PA 1YUUA 5K89A 4MSPA 1F54A 1TNQA 1WDCC 3VROA 5BPJA 3OX6A 3I5IC 4C0JA 2M1UA 1XFZO 2LMUA 3O6BA 2KQYA 1BOCA 1FI5A 1ALVA 3EK7A 4USLA 1TNXA 2LMTA 1LKJA 1IH0A 1QIVA 4MZJA 1BJFA 1UURA 1BT6A 2KI4C 2NLNA 1K95A 1YX7A 3HCMA 5I2OA 2JQ6A 1OMDA 1M31A 1SCVA 2LHIA 3LCPC 3DVEA 4AQJA 4CFRA 1FF1A 1QX7A 1K9KA 2KDHA 4I5NB 1LINA 2NXQA 4MZKA 1ZACA 2M0RA 2KAVA 1MWNA 1PK0D 1LVCD 1BG1A 3AAJA 5JOLA 1FI6A 4TNCA 4MZLA 1G4YR 3BUOB 4C0LA 3JTDC 2MRDA 1ZMZA
chains in the Genus database with same CATH superfamily
1N2DA 1YRTB 1WLZA 1DJIA 2WCEA 2NZ0A 2Y4QA 1HQVA 2BBMA 1KWOC 1IJ6A 2KI4B 3R1VA 1OOGA 1IKUA 3BOWA 1RECA 3OB2B 4ZCUA 1XFUO 3KO0A 4HRGA 1BR4B 1PSBA 1CKKA 2JC2A 1S36A 4N1FA 1FW4A 1SW8A 2CNPA 1E8AA 3N7HA 3QMEA 2GGZA 1G8IA 1DT7B 2P71A 3WHTB 1QV0A 3C1VA 3M0WA 4GGFA 3OB1B 1L2OB 1OQPA 2LAPA 4XJKA 1CFFA 1F71A 4WQ2A 3FE8A 2L98A 2LLSA 1ZMZA 1DJWA 3DZTA 1K9UA 3NSOA 4OCIA 5FI2A 3NSIA 1KQMC 1SMGA 1Y6WA 3UNWA 4YGEB 1ALWA 3TDIA 3R1PA 1B4CA 4PE7A 2F8PA 1IGVA 2M3WA 3FS7A 4JWQA 1SY9A 4GBAA 2JOJA 2VRGA 1CMFA 2M29A 2WORA 2WC6A 3VRPA 2ZN8A 1U5IA 5JJGA 1J7OA 3RZSA 2L51A 3FWBA 4MBEA 5D3OA 1BMOA 2KBIA 1S6JA 1IQ5A 1DEKA 5PALA 2JNXA 3CABA 1UHKA 1F8HA 1SSEB 3OGNA 4DIRA 4QJ5B 3PALA 1QATA 3NSLA 2HQ8A 3LL8B 3VRNA 2F3YA 4YGAA 4YGCB 3PSRA 2HPSA 4NDBA 4GNKB 4N5XA 1XO5A 1EH2A 2LVIA 1KFXL 3I5FB 1NP8A 5AFPA 1MQ1A 2M97A 1LA3A 2MAZA 4M2PA 5DICA 2EC6B 2KFFA 1BU3A 2E6WA 2FCEA 5AANA 1A03A 2PYQA 1A75A 2KYCA 2WCFA 4PHJA 2BE4A 2KFHA 2M7NA 4YRUA 2KI6C 2JU0A 4ZCVA 1J7QA 1PALA 1XVJA 1YX8A 4NDCA 2BL0C 1P28A 4FTGA 2L0PA 1DJYA 1EXRA 5DKQA 1WRKA 2QPTA 3MSEB 3BUMB 2KPHA 4PHMA 1LS8A 1IIOA 3DYEA 2M7LA 3L4AA 1GGZA 5AERA 2MLEC 1YRUB 3B7AA 4GGFC 2PMYA 1N0YA 1MR8A 1DF0A 1JF0A 1SYMA 2AUCA 2L50A 4M2QA 4A4CA 1DELA 2ZKMX 3UO9A 1B7TZ 3JVTC 3KPXA 4MVFA 2WCKA 4M2OA 4PHNA 1VRKA 5F6TA 1NWDA 1MXEA 1S6CA 4PDZA 2L4IA 1B7TY 1SNLA 3I5GC 1D1OA 4L9MA 4F7FA 2F2OA 2KGRA 1QIWA 1FPWA 2DOQA 2P70A 2L2CA 2KAYA 3I5HC 4P2YB 3EKHA 2LVKA 3K1EA 5ER4X 3GK2A 1SPYA 1EL4A 2D8NA 2FJUB 4HREE 4INXA 5DKRA 2KYFA 2NCPA 1CDLA 3I5HB 1OMRA 1OOJA 2M1KB 1DQEA 1SL7A 2LUXA 3CLNA 1AUIB 2QDIA 4OR9B 5HKZA 1OSAA 2BCBA 3BFHA 3D78A 1B8RA 4D1EA 4YI8A 3KF9A 4HRHA 1B47A 1S3PA 2LLUA 1A4PA 1DTLA 3ICBA 3Q8IA 1UHJA 4CLNA 4PE4A 3S0DA 1Y0VH 1QX5B 2KBMA 1Y1UA 2JT3A 4AQIA 1SCMC 1QXPA 2FCDA 2OS8C 1ORGA 1UHNA 1TRFA 2JXLA 2LP2A 3NGVA 3TDZA 3QRXA 1SL8A 2BCXA 2E30A 3PM8A 3ZNIA 2BNXA 3VGOA 2BKIB 1DVIA 2LCPA 3D0YA 3PN7C 1XA5A 1NSHA 1KK7Z 1RK9A 2KFGA 4PCWA 3NHIA 1UUSA 4PALA 3VRRA 1CB1A 2NCOA 2LVVA 1QV1A 4GUKA 2WC5A 1KSOA 2K7DA 1K94A 2OPOA 1KSMA 4F0ZB 1U5IB 2ISDA 4CPVA 2LUCA 4PE1A 4QJ4B 1WY9A 3R1OA 1C7WA 1BLQA 1CLBA 4DS7A 1AVSA 2H61A 1RJVA 1NX3A 2PALA 5HL1A 4BY4A 5IBWA 1R2UA 5HLVA 2JT0A 1CLMA 2QACA 1JFJA 1JFKA 1W7IB 1XFRA 4P5OE 2EC6C 2WCMA 4YGDB 1SK6D 1F4QA 1YVLA 4OVNF 1MHOA 2GV5A 1CM1A 3OBVA 1MF8B 2JPOA 1UWOA 1EG4A 4WQ3A 1G33A 1SR6C 2GGMA 1CDMA 2I18A 2ZFDA 1XFVO 4YI9A 2Y1MA 3BOWB 3SS3A 1OMVA 1J1EA 3DVJA 2LANA 3SG7A 4BY5A 1C3YA 1GGWA 1EJ3A 1M46A 2BECA 5FYXA 3CR4X 2KSPA 3D74A 2F33A 1OOHA 3F45A 3NHTA 2ZRSA 1NCXA 1XFXO 1RROA 1W9ZA 3BUNB 4OV2A 2QEVA 1MUXA 2H2KA 2SASA 3EVUA 4DUQA 1CLLA 1NCZA 2G9BA 3SG2A 2F3ZA 4XJKB 2K0JA 3CZ2A 1YTZC 1V1GA 2JT8A 4YGBB 1QLSA 4MN0A 1PRWA 2AMIA 1F4OA 3DVKA 5I2LA 4UPGA 3RLZA 1KFUL 3L4LA 1NIWA 3SJSA 4R1EA 3IF7A 2RGIA 5CSFA 1DJZA 1TUJA 1DF0B 2HETA 5J3XA 3SIAA 1NCYA 1J7RA 3E3RA 5I2QA 3TUYC 1UP5A 5HKYA 5AEQA 1CFCA 1KK7Y 1XFWO 3CTNA 1BR1B 1V1FA 4GAOA 2K2AA 3NSKA 4GGNA 5HLOA 3I5GB 3VB1A 2KHNA 3HX4A 1DJGA 1B8LA 3PJIA 1BODA 3O4YA 5G08A 2K7CA 1Y1XA 1CFDA 1QWVA 1TCOB 3PATA 2LC5A 2K60A 2Q91A 4IL1A 2BL0B 3WNXB 1QJTA 3TS5B 3VRQA 5DKNA 3RM1A 2LLTA 1PULA 3EG5B 4JPZB 3TS5C 1R6PA 1JWDA 4MRYA 2I94A 1SL9A 1MXLC 1TOPA 3PN7B 1OZSA 1QVIY 1S5GZ 1WDCB 2JTTA 2K7BA 4OZDA 4PHKA 2K7OA 1ODBA 1IRJA 2BAPA 2MA2A 1IWQA 2K61A 4IJ7A 1A75B 1TNPA 2LVJA 3S0AA 2FJYA 3D76A 1S26D 3OX5A 3SG3A 5HYDA 2K2FA 1PVAA 1KCYA 4MLWA 2LM5A 1Q80A 3JVTB 5FI7A 1GQMA 4ORAB 4ETOA 1FBVA 1SKTA 2KOTA 1AJ5A 3AKBA 1SCMB 1QLKA 2QEBA 1IQ3A 5CSNA 5KTYA 2M49B 3DXLA 3WXAA 1ZUZA 3WHUB 1AHRA 2M8UA 3FIAA 4A4BA 2PVBA 2JRFA 1B8CA 4N1GA 3S0GA 4Q04A 1KFXS 1HT9A 3CS1A 1YURA 1EG3A 4I5LB 5FI6A 2PQLA 2KLDA 3JTDB 1OOFA 5ER5A 2WCBA 4E68A 4U8DA 3CWGA 4AOMA 1QS7A 4I5KA 1UHIA 4FQTA 5CSJA 1KWOB 2ERBA 4ICBA 2ZNDA 3D77A 1TUZA 2H61C 2CXJA 2LE9B 1KQMB 4GFTA 1B1GA 3CDNA 2WCHA 3TZ1A 1M39A 1OE9B 2BBNA 1KK8B 2BE6A 2CBLA 2PASA 5I8NA 1JUOA 1DMOA 4FQOA 4MRXA 1C7VA 3BYAA 4QJ3B 1LA0A 1ZOTB 1N65A 2Y5IA 5KU1A 3I5IB 3FE6A 1X02A 2BKHB 3O4XA 3S0EA 3LK0A 1F70A 3BXKA 2HQWA 3DY9A 1GM0A 1QASA 3LK1A 1AK8A 2OS8B 1S1EA 4HSZA 1PSRA 2L5YA 3S0BA 2O60A 3B6XA 2KGBC 1JBAA 5EL2A 1WLMA 1M45A 2EGDA 1C07A 1JSAA 2AAOA 2L4HA 1CDPA 2M9GA 1DGVA 1A2XA 2FOTA 2LHLA 2LNKA 3CR2A 3PFVA 1XYDA 2WCJA 1K93D 3B88A 1H8BA 1Y1AA 3DVMA 2SCPA 1L7ZA 2MHHA 2O5GA 1QTXA 1Z2CB 1TTXA 2WCLA 2JXCA 3IQQA 3K21A 1RWYA 4OKHA 4KYNA 1J55A 1TNWA 3DD4A 3BQ3A 3SS4A 2JULA 2JPTA 1DJHA 2HF5A 1TIZA 1TN4A 1JC2A 1H4BA 2WNDA 3A4UB 1XK4A 3A8RA 5GQQC 1S6IA 3EVRA 1XK4C 2I7AA 1K90D 2JWWA 2KI6D 3GK4X 5TNCA 3SG5A 3FE9A 4DCKA 1CFPA 3SG4A 1NX0A 1K96A 1SR6B 1T14A 3TUYB 1NPQA 2LMVA 4XYNA 1AJ4A 1K9PA 1SBJA 2ZRTA 2P6BB 2BCAA 3GK1A 5D69A 2PRUA 4PT1A 3CYZA 1CDNA 2I2RE 5AXIA 1C3ZA 2OTGC 1KK8C 1NUBA 2WC8A 4GPLB 5B8IB 2JZIA 1GJYA 3NXAA 5KSZA 2L5XB 3D10A 1IJ5A 2EHBA 2MJWB 2MLFC 2WOSA 3O78A 4MEWA 1NX2A 3CZ0A 3OP0A 3EKJA 3TDUA 1TWOA 3FWCA 3CZ1A 4PE0A 1TCFA 1L2OC 2LP3A 2JNFA 2K8MB 1W7JB 2CCMA 2F2PA 4I5JA 2KQ6A 3SIBA 1A29A 3IVTA 4JQ0D 1YVHA 1KFUS 3BUXB 1J1DA 1UHHA 2KAXA 3BUWB 3PLFB 2KNEA 3SG6A 1BF5A 1RFJA 3LLEA 4YBHB 2LV7A 3EK4A 2CTNA 1NX1A 1F55A 1K2HA 5CSIA 2JTZA 4CFQA 2QEHA 1CMGA 2A4JA 1YR5A 4ORBB 1KQVA 2L2EA 2GTEA 3D75A 3R72A 3KHEA 2IS9A 4JD9A 1J7PA 3BJHA 1Z4HA 1QVIZ 1S5GY 2CT9A 1QX2A 1PVBA 3IQOA 5CPVA 3SS5A 1DGUA 1WRLA 3CZTX 4DRWA 3S0FA 2B1UA 1CTRA 4NDDA 3L47A 1OZOA 3EVVA 1WRZA 2MBXA 3ZWHA 1K8UA 3BFBA 3AKAA 5D7FA 2Y1NA 3DF0A 1B9AA 3CGAA 1NYAA 3DF0B 4CIDA 4C0KA 3H4SE 2ZN9A 1DJXA 2COLB 1LXFC 1OW4A 3CR5X 3KEVA 2G2BA 3GOFA 1CNPA 2TN4A 2ZNEA 3D73A 3I5FC 2OTGB 2PSRA 1YUSA 1SRAA 1IG5A 3B87A 1XFYO 4JKTA 4NQGA 5I94A 3B86A 2R2IA 5HKWA 3EK8A 1M63B 2QEOA 3OHMB 1RTP1 3D0YB 1ZFSA 2Q4UA 1JF2A 2V53A 3AAKA 4ORCB 1CM4A 1YUTA 4WRIA 1AP4A 3O2PA 1YUUA 5K89A 4MSPA 1F54A 1TNQA 1WDCC 3VROA 5BPJA 3V2LA 3OX6A 3I5IC 4C0JA 2M1UA 1XFZO 2LMUA 3O6BA 2KQYA 1BOCA 1FI5A 1ALVA 3EK7A 4USLA 1TNXA 2LMTA 1LKJA 1IH0A 1QIVA 4INWA 4MZJA 1BJFA 1UURA 1BT6A 2KI4C 2NLNA 1K95A 1YX7A 3PM2A 3HCMA 5I2OA 2JQ6A 1DC1A 1OMDA 1M31A 1SCVA 2LHIA 3LCPC 3DVEA 2KLEA 4AQJA 4CFRA 1FF1A 1QX7A 1K9KA 2KDHA 4I5NB 1LINA 2NXQA 4MZKA 1ZACA 2M0RA 2KAVA 2YGUA 1MWNA 1PK0D 1LVCD 1BG1A 3AAJA 5JOLA 1FI6A 4TNCA 4MZLA 1G4YR 3BUOB 2H8VA 4C0LA 3JTDC 3BFAA 2MRDA 1OOIX
chains in the Genus database with same CATH topology
1N2DA 1YRTB 1WLZA 1DJIA 2WCEA 2NZ0A 2Y4QA 1HQVA 2BBMA 1KWOC 1IJ6A 2KI4B 1IKUA 3BOWA 1RECA 3OB2B 4ZCUA 1XFUO 3KO0A 4HRGA 1BR4B 1PSBA 1CKKA 2JC2A 1S36A 4N1FA 1FW4A 1SW8A 2CNPA 1E8AA 2GGZA 1G8IA 1DT7B 3WHTB 1QV0A 3C1VA 3M0WA 4GGFA 3OB1B 1L2OB 1OQPA 2LAPA 4XJKA 1CFFA 1F71A 4WQ2A 2L98A 2LLSA 3NSOA 1DJWA 4OCIA 1K9UA 3NSIA 1KQMC 1SMGA 1Y6WA 4YGEB 1ALWA 3TDIA 1B4CA 4PE7A 2F8PA 1IGVA 2M3WA 3FS7A 4JWQA 1SY9A 4GBAA 2JOJA 2VRGA 1CMFA 2M29A 2WORA 3VRPA 2ZN8A 1U5IA 5JJGA 1J7OA 2L51A 3FWBA 4MBEA 1BMOA 2KBIA 1S6JA 1IQ5A 5PALA 2JNXA 1UHKA 1F8HA 4QJ5B 4DIRA 3PALA 1QATA 3NSLA 2HQ8A 3LL8B 3VRNA 2F3YA 4YGAA 4YGCB 3PSRA 2HPSA 4NDBA 4GNKB 4N5XA 1XO5A 1EH2A 2LVIA 1KFXL 3I5FB 1NP8A 5AFPA 1MQ1A 2M97A 1LA3A 2MAZA 4M2PA 2EC6B 2KFFA 1BU3A 2E6WA 2FCEA 5AANA 1A03A 1A75A 2KYCA 2WCFA 4PHJA 2BE4A 2KFHA 2M7NA 4YRUA 2KI6C 2JU0A 4ZCVA 1J7QA 1PALA 1XVJA 1YX8A 4NDCA 2BL0C 4FTGA 2L0PA 1DJYA 1EXRA 5DKQA 1WRKA 2QPTA 3MSEB 3BUMB 4PHMA 2M7LA 1GGZA 5AERA 2MLEC 1YRUB 4GGFC 2PMYA 1N0YA 1MR8A 1DF0A 1JF0A 1SYMA 2AUCA 2L50A 4M2QA 4A4CA 2ZKMX 1B7TZ 3JVTC 3KPXA 4MVFA 4PHNA 4M2OA 5F6TA 1VRKA 1NWDA 1MXEA 1S6CA 4PDZA 2L4IA 1B7TY 1SNLA 3I5GC 1D1OA 4L9MA 2F2OA 2KGRA 1QIWA 1FPWA 2DOQA 2KAYA 3I5HC 4P2YB 3EKHA 2LVKA 5ER4X 3GK2A 1SPYA 2FJUB 2D8NA 1EL4A 4HREE 5DKRA 2KYFA 2NCPA 1CDLA 3I5HB 1OMRA 1OOJA 2M1KB 1SL7A 2LUXA 3CLNA 1AUIB 4OR9B 5HKZA 1OSAA 2BCBA 1B8RA 4D1EA 4YI8A 3KF9A 4HRHA 1B47A 1S3PA 2LLUA 1A4PA 1DTLA 3ICBA 4CLNA 1UHJA 4PE4A 1Y0VH 1QX5B 2KBMA 1Y1UA 2JT3A 4AQIA 1SCMC 1QXPA 2FCDA 2OS8C 1UHNA 1TRFA 2JXLA 2LP2A 3TDZA 3QRXA 1SL8A 2BCXA 2E30A 3PM8A 3ZNIA 3VGOA 2BKIB 1DVIA 2LCPA 3D0YA 3PN7C 1XA5A 1NSHA 1KK7Z 1RK9A 2KFGA 4PCWA 1UUSA 4PALA 3VRRA 1CB1A 2NCOA 2LVVA 1QV1A 4GUKA 1KSOA 2K7DA 1K94A 2OPOA 1KSMA 4F0ZB 1U5IB 2ISDA 4CPVA 2LUCA 4PE1A 4QJ4B 1WY9A 1C7WA 1BLQA 1CLBA 4DS7A 1AVSA 2H61A 1RJVA 1NX3A 2PALA 4BY4A 5IBWA 1R2UA 5HLVA 2JT0A 1CLMA 2QACA 1JFJA 1JFKA 1W7IB 4P5OE 2EC6C 4YGDB 1SK6D 1F4QA 1YVLA 4OVNF 1MHOA 2GV5A 1CM1A 1MF8B 1UWOA 1EG4A 4WQ3A 1G33A 1SR6C 2GGMA 1CDMA 2I18A 2ZFDA 1XFVO 4YI9A 2Y1MA 3BOWB 1OMVA 1J1EA 3DVJA 2LANA 3SG7A 4BY5A 1GGWA 1EJ3A 1M46A 2BECA 5FYXA 3CR4X 2KSPA 2F33A 3F45A 2ZRSA 1NCXA 1XFXO 1RROA 4DUQA 3BUNB 4OV2A 2SASA 1MUXA 2H2KA 3EVUA 1CLLA 1NCZA 2G9BA 3SG2A 2F3ZA 4XJKB 2K0JA 1YTZC 1V1GA 2JT8A 4YGBB 1QLSA 4MN0A 1PRWA 2AMIA 1F4OA 3DVKA 5I2LA 4UPGA 3RLZA 1KFUL 1NIWA 3SJSA 4R1EA 3IF7A 2RGIA 5CSFA 1DJZA 2HETA 1DF0B 5J3XA 3SIAA 1NCYA 1J7RA 3E3RA 5I2QA 3TUYC 1UP5A 5HKYA 5AEQA 1CFCA 1KK7Y 1XFWO 3CTNA 1BR1B 1V1FA 4GAOA 2K2AA 3NSKA 4GGNA 5HLOA 3I5GB 1BODA 2KHNA 3HX4A 1DJGA 1B8LA 3O4YA 5G08A 2K7CA 1Y1XA 1CFDA 1TCOB 3PATA 4IL1A 2LC5A 2Q91A 3WNXB 2BL0B 1QJTA 3TS5B 3VRQA 5DKNA 3RM1A 2LLTA 1PULA 4JPZB 3TS5C 1R6PA 1JWDA 4MRYA 2I94A 1SL9A 1MXLC 1TOPA 3PN7B 1OZSA 1QVIY 1S5GZ 1WDCB 2JTTA 2K7BA 4PHKA 2K7OA 1ODBA 1IRJA 2MA2A 1IWQA 2K61A 1A75B 1TNPA 2LVJA 3SG3A 3OX5A 1S26D 5HYDA 2K2FA 1PVAA 1KCYA 4MLWA 2LM5A 1Q80A 3JVTB 1GQMA 4ORAB 4ETOA 1FBVA 1SKTA 2KOTA 1AJ5A 3AKBA 1SCMB 1QLKA 1IQ3A 5CSNA 5KTYA 2M49B 3WXAA 1ZUZA 3WHUB 1AHRA 2M8UA 3FIAA 4A4BA 2PVBA 2JRFA 1B8CA 4N1GA 4Q04A 1KFXS 1HT9A 3CS1A 1YURA 1EG3A 4I5LB 3JTDB 5ER5A 2WCBA 4E68A 4U8DA 3CWGA 4AOMA 1QS7A 4I5KA 1UHIA 5CSJA 1KWOB 4ICBA 2ZNDA 2H61C 2CXJA 2LE9B 1KQMB 4GFTA 1B1GA 3TZ1A 1M39A 1OE9B 2BBNA 1KK8B 2BE6A 2CBLA 2PASA 5I8NA 1JUOA 1DMOA 4FQOA 4MRXA 1C7VA 3BYAA 4QJ3B 1LA0A 1ZOTB 1N65A 2Y5IA 5KU1A 3I5IB 1X02A 2BKHB 3LK0A 1F70A 3BXKA 2HQWA 1QASA 3LK1A 1AK8A 2OS8B 1S1EA 4HSZA 1PSRA 2O60A 2KGBC 1JBAA 1WLMA 1M45A 2EGDA 1C07A 1JSAA 2AAOA 2L4HA 1CDPA 2M9GA 1DGVA 1A2XA 2FOTA 2LHLA 2LNKA 3CR2A 3PFVA 1XYDA 1H8BA 1K93D 1Y1AA 3DVMA 2SCPA 1L7ZA 2MHHA 2O5GA 1QTXA 1TTXA 2JXCA 3IQQA 3K21A 1RWYA 4OKHA 1J55A 1TNWA 3DD4A 3BQ3A 2JULA 2JPTA 1DJHA 2HF5A 1TIZA 1TN4A 1JC2A 1H4BA 2WNDA 3A4UB 1XK4A 3A8RA 5GQQC 1S6IA 3EVRA 1XK4C 2I7AA 1K90D 2JWWA 2KI6D 3GK4X 5TNCA 3SG5A 4DCKA 1CFPA 3SG4A 1NX0A 1K96A 1SR6B 3TUYB 1NPQA 2LMVA 4XYNA 1AJ4A 1K9PA 1SBJA 2ZRTA 2P6BB 2BCAA 3GK1A 5D69A 2PRUA 1CDNA 2I2RE 5AXIA 2WC8A 2OTGC 1KK8C 1NUBA 4GPLB 5B8IB 2JZIA 1GJYA 3NXAA 5KSZA 2L5XB 3D10A 1IJ5A 2EHBA 2MJWB 2MLFC 2WOSA 3O78A 4MEWA 1NX2A 3OP0A 3EKJA 3TDUA 3FWCA 4PE0A 1TCFA 1L2OC 2LP3A 2JNFA 2K8MB 1W7JB 2CCMA 2F2PA 4I5JA 2KQ6A 3SIBA 1A29A 4JQ0D 1YVHA 1KFUS 3BUXB 1J1DA 1UHHA 2KAXA 3BUWB 3PLFB 2KNEA 3SG6A 1BF5A 1RFJA 3LLEA 4YBHB 2LV7A 3EK4A 2CTNA 1NX1A 1F55A 1K2HA 5CSIA 2JTZA 4CFQA 1CMGA 2A4JA 1YR5A 4ORBB 1KQVA 2L2EA 3KHEA 2IS9A 1J7PA 2CT9A 1QVIZ 1S5GY 3IQOA 1QX2A 1PVBA 5CPVA 1DGUA 1WRLA 3CZTX 4DRWA 2B1UA 1CTRA 4NDDA 1OZOA 3EVVA 1WRZA 2MBXA 3ZWHA 1K8UA 3AKAA 5D7FA 2Y1NA 3DF0A 1B9AA 3CGAA 1NYAA 3DF0B 4CIDA 4C0KA 3H4SE 2ZN9A 1DJXA 2COLB 1LXFC 3KEVA 3CR5X 2G2BA 3GOFA 1CNPA 2TN4A 2ZNEA 3I5FC 2OTGB 2PSRA 1YUSA 1SRAA 1IG5A 4NQGA 1XFYO 2R2IA 5HKWA 3EK8A 1M63B 3OHMB 1RTP1 3D0YB 1ZFSA 2Q4UA 1JF2A 2V53A 3AAKA 4ORCB 1CM4A 1YUTA 4WRIA 1AP4A 3O2PA 1YUUA 5K89A 4MSPA 1F54A 1TNQA 1WDCC 3VROA 5BPJA 3OX6A 3I5IC 4C0JA 2M1UA 1XFZO 2LMUA 3O6BA 2KQYA 1BOCA 1FI5A 1ALVA 3EK7A 4USLA 1TNXA 2LMTA 1LKJA 1IH0A 1QIVA 4MZJA 1BJFA 1UURA 1BT6A 2KI4C 2NLNA 1K95A 1YX7A 3HCMA 5I2OA 2JQ6A 1OMDA 1M31A 1SCVA 2LHIA 3LCPC 3DVEA 4AQJA 4CFRA 1FF1A 1QX7A 1K9KA 2KDHA 4I5NB 1LINA 2NXQA 4MZKA 1ZACA 2M0RA 2KAVA 1MWNA 1PK0D 1LVCD 1BG1A 3AAJA 5JOLA 1FI6A 4TNCA 4MZLA 1G4YR 3BUOB 4C0LA 3JTDC 2MRDA 1ZMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2D A;  1YRT B;  1WLZ A;  1DJI A;  2WCE A;  2NZ0 A;  2Y4Q A;  1HQV A;  2BBM A;  1KWO C;  1IJ6 A;  2KI4 B;  1IKU A;  3BOW A;  1REC A;  3OB2 B;  4ZCU A;  1XFU O;  3KO0 A;  4HRG A;  1BR4 B;  1PSB A;  1CKK A;  2JC2 A;  1S36 A;  4N1F A;  1FW4 A;  1SW8 A;  2CNP A;  1E8A A;  2GGZ A;  1G8I A;  1DT7 B;  3WHT B;  1QV0 A;  3C1V A;  3M0W A;  4GGF A;  3OB1 B;  1L2O B;  1OQP A;  2LAP A;  4XJK A;  1CFF A;  1F71 A;  4WQ2 A;  2L98 A;  2LLS A;  3NSO A;  1DJW A;  4OCI A;  1K9U A;  3NSI A;  1KQM C;  1SMG A;  1Y6W A;  4YGE B;  1ALW A;  3TDI A;  1B4C A;  4PE7 A;  2F8P A;  1IGV A;  2M3W A;  3FS7 A;  4JWQ A;  1SY9 A;  4GBA A;  2JOJ A;  2VRG A;  1CMF A;  2M29 A;  2WOR A;  3VRP A;  2ZN8 A;  1U5I A;  5JJG A;  1J7O A;  2L51 A;  3FWB A;  4MBE A;  1BMO A;  2KBI A;  1S6J A;  1IQ5 A;  5PAL A;  2JNX A;  1UHK A;  1F8H A;  4QJ5 B;  4DIR A;  3PAL A;  1QAT A;  3NSL A;  2HQ8 A;  3LL8 B;  3VRN A;  2F3Y A;  4YGA A;  4YGC B;  3PSR A;  2HPS A;  4NDB A;  4GNK B;  4N5X A;  1XO5 A;  1EH2 A;  2LVI A;  1KFX L;  3I5F B;  1NP8 A;  5AFP A;  1MQ1 A;  2M97 A;  1LA3 A;  2MAZ A;  4M2P A;  2EC6 B;  2KFF A;  1BU3 A;  2E6W A;  2FCE A;  5AAN A;  1A03 A;  1A75 A;  2KYC A;  2WCF A;  4PHJ A;  2BE4 A;  2KFH A;  2M7N A;  4YRU A;  2KI6 C;  2JU0 A;  4ZCV A;  1J7Q A;  1PAL A;  1XVJ A;  1YX8 A;  4NDC A;  2BL0 C;  4FTG A;  2L0P A;  1DJY A;  1EXR A;  5DKQ A;  1WRK A;  2QPT A;  3MSE B;  3BUM B;  4PHM A;  2M7L A;  1GGZ A;  5AER A;  2MLE C;  1YRU B;  4GGF C;  2PMY A;  1N0Y A;  1MR8 A;  1DF0 A;  1JF0 A;  1SYM A;  2AUC A;  2L50 A;  4M2Q A;  4A4C A;  2ZKM X;  1B7T Z;  3JVT C;  3KPX A;  4MVF A;  4PHN A;  4M2O A;  5F6T A;  1VRK A;  1NWD A;  1MXE A;  1S6C A;  4PDZ A;  2L4I A;  1B7T Y;  1SNL A;  3I5G C;  1D1O A;  4L9M A;  2F2O A;  2KGR A;  1QIW A;  1FPW A;  2DOQ A;  2KAY A;  3I5H C;  4P2Y B;  3EKH A;  2LVK A;  5ER4 X;  3GK2 A;  1SPY A;  2FJU B;  2D8N A;  1EL4 A;  4HRE E;  5DKR A;  2KYF A;  2NCP A;  1CDL A;  3I5H B;  1OMR A;  1OOJ A;  2M1K B;  1SL7 A;  2LUX A;  3CLN A;  1AUI B;  4OR9 B;  5HKZ A;  1OSA A;  2BCB A;  1B8R A;  4D1E A;  4YI8 A;  3KF9 A;  4HRH A;  1B47 A;  1S3P A;  2LLU A;  1A4P A;  1DTL A;  3ICB A;  4CLN A;  1UHJ A;  4PE4 A;  1Y0V H;  1QX5 B;  2KBM A;  1Y1U A;  2JT3 A;  4AQI A;  1SCM C;  1QXP A;  2FCD A;  2OS8 C;  1UHN A;  1TRF A;  2JXL A;  2LP2 A;  3TDZ A;  3QRX A;  1SL8 A;  2BCX A;  2E30 A;  3PM8 A;  3ZNI A;  3VGO A;  2BKI B;  1DVI A;  2LCP A;  3D0Y A;  3PN7 C;  1XA5 A;  1NSH A;  1KK7 Z;  1RK9 A;  2KFG A;  4PCW A;  1UUS A;  4PAL A;  3VRR A;  1CB1 A;  2NCO A;  2LVV A;  1QV1 A;  4GUK A;  1KSO A;  2K7D A;  1K94 A;  2OPO A;  1KSM A;  4F0Z B;  1U5I B;  2ISD A;  4CPV A;  2LUC A;  4PE1 A;  4QJ4 B;  1WY9 A;  1C7W A;  1BLQ A;  1CLB A;  4DS7 A;  1AVS A;  2H61 A;  1RJV A;  1NX3 A;  2PAL A;  4BY4 A;  5IBW A;  1R2U A;  5HLV A;  2JT0 A;  1CLM A;  2QAC A;  1JFJ A;  1JFK A;  1W7I B;  4P5O E;  2EC6 C;  4YGD B;  1SK6 D;  1F4Q A;  1YVL A;  4OVN F;  1MHO A;  2GV5 A;  1CM1 A;  1MF8 B;  1UWO A;  1EG4 A;  4WQ3 A;  1G33 A;  1SR6 C;  2GGM A;  1CDM A;  2I18 A;  2ZFD A;  1XFV O;  4YI9 A;  2Y1M A;  3BOW B;  1OMV A;  1J1E A;  3DVJ A;  2LAN A;  3SG7 A;  4BY5 A;  1GGW A;  1EJ3 A;  1M46 A;  2BEC A;  5FYX A;  3CR4 X;  2KSP A;  2F33 A;  3F45 A;  2ZRS A;  1NCX A;  1XFX O;  1RRO A;  4DUQ A;  3BUN B;  4OV2 A;  2SAS A;  1MUX A;  2H2K A;  3EVU A;  1CLL A;  1NCZ A;  2G9B A;  3SG2 A;  2F3Z A;  4XJK B;  2K0J A;  1YTZ C;  1V1G A;  2JT8 A;  4YGB B;  1QLS A;  4MN0 A;  1PRW A;  2AMI A;  1F4O A;  3DVK A;  5I2L A;  4UPG A;  3RLZ A;  1KFU L;  1NIW A;  3SJS A;  4R1E A;  3IF7 A;  2RGI A;  5CSF A;  1DJZ A;  2HET A;  1DF0 B;  5J3X A;  3SIA A;  1NCY A;  1J7R A;  3E3R A;  5I2Q A;  3TUY C;  1UP5 A;  5HKY A;  5AEQ A;  1CFC A;  1KK7 Y;  1XFW O;  3CTN A;  1BR1 B;  1V1F A;  4GAO A;  2K2A A;  3NSK A;  4GGN A;  5HLO A;  3I5G B;  1BOD A;  2KHN A;  3HX4 A;  1DJG A;  1B8L A;  3O4Y A;  5G08 A;  2K7C A;  1Y1X A;  1CFD A;  1TCO B;  3PAT A;  4IL1 A;  2LC5 A;  2Q91 A;  3WNX B;  2BL0 B;  1QJT A;  3TS5 B;  3VRQ A;  5DKN A;  3RM1 A;  2LLT A;  1PUL A;  4JPZ B;  3TS5 C;  1R6P A;  1JWD A;  4MRY A;  2I94 A;  1SL9 A;  1MXL C;  1TOP A;  3PN7 B;  1OZS A;  1QVI Y;  1S5G Z;  1WDC B;  2JTT A;  2K7B A;  4PHK A;  2K7O A;  1ODB A;  1IRJ A;  2MA2 A;  1IWQ A;  2K61 A;  1A75 B;  1TNP A;  2LVJ A;  3SG3 A;  3OX5 A;  1S26 D;  5HYD A;  2K2F A;  1PVA A;  1KCY A;  4MLW A;  2LM5 A;  1Q80 A;  3JVT B;  1GQM A;  4ORA B;  4ETO A;  1FBV A;  1SKT A;  2KOT A;  1AJ5 A;  3AKB A;  1SCM B;  1QLK A;  1IQ3 A;  5CSN A;  5KTY A;  2M49 B;  3WXA A;  1ZUZ A;  3WHU B;  1AHR A;  2M8U A;  3FIA A;  4A4B A;  2PVB A;  2JRF A;  1B8C A;  4N1G A;  4Q04 A;  1KFX S;  1HT9 A;  3CS1 A;  1YUR A;  1EG3 A;  4I5L B;  3JTD B;  5ER5 A;  2WCB A;  4E68 A;  4U8D A;  3CWG A;  4AOM A;  1QS7 A;  4I5K A;  1UHI A;  5CSJ A;  1KWO B;  4ICB A;  2ZND A;  2H61 C;  2CXJ A;  2LE9 B;  1KQM B;  4GFT A;  1B1G A;  3TZ1 A;  1M39 A;  1OE9 B;  2BBN A;  1KK8 B;  2BE6 A;  2CBL A;  2PAS A;  5I8N A;  1JUO A;  1DMO A;  4FQO A;  4MRX A;  1C7V A;  3BYA A;  4QJ3 B;  1LA0 A;  1ZOT B;  1N65 A;  2Y5I A;  5KU1 A;  3I5I B;  1X02 A;  2BKH B;  3LK0 A;  1F70 A;  3BXK A;  2HQW A;  1QAS A;  3LK1 A;  1AK8 A;  2OS8 B;  1S1E A;  4HSZ A;  1PSR A;  2O60 A;  2KGB C;  1JBA A;  1WLM A;  1M45 A;  2EGD A;  1C07 A;  1JSA A;  2AAO A;  2L4H A;  1CDP A;  2M9G A;  1DGV A;  1A2X A;  2FOT A;  2LHL A;  2LNK A;  3CR2 A;  3PFV A;  1XYD A;  1H8B A;  1K93 D;  1Y1A A;  3DVM A;  2SCP A;  1L7Z A;  2MHH A;  2O5G A;  1QTX A;  1TTX A;  2JXC A;  3IQQ A;  3K21 A;  1RWY A;  4OKH A;  1J55 A;  1TNW A;  3DD4 A;  3BQ3 A;  2JUL A;  2JPT A;  1DJH A;  2HF5 A;  1TIZ A;  1TN4 A;  1JC2 A;  1H4B A;  2WND A;  3A4U B;  1XK4 A;  3A8R A;  5GQQ C;  1S6I A;  3EVR A;  1XK4 C;  2I7A A;  1K90 D;  2JWW A;  2KI6 D;  3GK4 X;  5TNC A;  3SG5 A;  4DCK A;  1CFP A;  3SG4 A;  1NX0 A;  1K96 A;  1SR6 B;  3TUY B;  1NPQ A;  2LMV A;  4XYN A;  1AJ4 A;  1K9P A;  1SBJ A;  2ZRT A;  2P6B B;  2BCA A;  3GK1 A;  5D69 A;  2PRU A;  1CDN A;  2I2R E;  5AXI A;  2WC8 A;  2OTG C;  1KK8 C;  1NUB A;  4GPL B;  5B8I B;  2JZI A;  1GJY A;  3NXA A;  5KSZ A;  2L5X B;  3D10 A;  1IJ5 A;  2EHB A;  2MJW B;  2MLF C;  2WOS A;  3O78 A;  4MEW A;  1NX2 A;  3OP0 A;  3EKJ A;  3TDU A;  3FWC A;  4PE0 A;  1TCF A;  1L2O C;  2LP3 A;  2JNF A;  2K8M B;  1W7J B;  2CCM A;  2F2P A;  4I5J A;  2KQ6 A;  3SIB A;  1A29 A;  4JQ0 D;  1YVH A;  1KFU S;  3BUX B;  1J1D A;  1UHH A;  2KAX A;  3BUW B;  3PLF B;  2KNE A;  3SG6 A;  1BF5 A;  1RFJ A;  3LLE A;  4YBH B;  2LV7 A;  3EK4 A;  2CTN A;  1NX1 A;  1F55 A;  1K2H A;  5CSI A;  2JTZ A;  4CFQ A;  1CMG A;  2A4J A;  1YR5 A;  4ORB B;  1KQV A;  2L2E A;  3KHE A;  2IS9 A;  1J7P A;  2CT9 A;  1QVI Z;  1S5G Y;  3IQO A;  1QX2 A;  1PVB A;  5CPV A;  1DGU A;  1WRL A;  3CZT X;  4DRW A;  2B1U A;  1CTR A;  4NDD A;  1OZO A;  3EVV A;  1WRZ A;  2MBX A;  3ZWH A;  1K8U A;  3AKA A;  5D7F A;  2Y1N A;  3DF0 A;  1B9A A;  3CGA A;  1NYA A;  3DF0 B;  4CID A;  4C0K A;  3H4S E;  2ZN9 A;  1DJX A;  2COL B;  1LXF C;  3KEV A;  3CR5 X;  2G2B A;  3GOF A;  1CNP A;  2TN4 A;  2ZNE A;  3I5F C;  2OTG B;  2PSR A;  1YUS A;  1SRA A;  1IG5 A;  4NQG A;  1XFY O;  2R2I A;  5HKW A;  3EK8 A;  1M63 B;  3OHM B;  1RTP 1;  3D0Y B;  1ZFS A;  2Q4U A;  1JF2 A;  2V53 A;  3AAK A;  4ORC B;  1CM4 A;  1YUT A;  4WRI A;  1AP4 A;  3O2P A;  1YUU A;  5K89 A;  4MSP A;  1F54 A;  1TNQ A;  1WDC C;  3VRO A;  5BPJ A;  3OX6 A;  3I5I C;  4C0J A;  2M1U A;  1XFZ O;  2LMU A;  3O6B A;  2KQY A;  1BOC A;  1FI5 A;  1ALV A;  3EK7 A;  4USL A;  1TNX A;  2LMT A;  1LKJ A;  1IH0 A;  1QIV A;  4MZJ A;  1BJF A;  1UUR A;  1BT6 A;  2KI4 C;  2NLN A;  1K95 A;  1YX7 A;  3HCM A;  5I2O A;  2JQ6 A;  1OMD A;  1M31 A;  1SCV A;  2LHI A;  3LCP C;  3DVE A;  4AQJ A;  4CFR A;  1FF1 A;  1QX7 A;  1K9K A;  2KDH A;  4I5N B;  1LIN A;  2NXQ A;  4MZK A;  1ZAC A;  2M0R A;  2KAV A;  1MWN A;  1PK0 D;  1LVC D;  1BG1 A;  3AAJ A;  5JOL A;  1FI6 A;  4TNC A;  4MZL A;  1G4Y R;  3BUO B;  4C0L A;  3JTD C;  2MRD A;  1ZMZ A; 
#chains in the Genus database with same CATH topology
 1N2D A;  1YRT B;  1WLZ A;  1DJI A;  2WCE A;  2NZ0 A;  2Y4Q A;  1HQV A;  2BBM A;  1KWO C;  1IJ6 A;  2KI4 B;  3R1V A;  1OOG A;  1IKU A;  3BOW A;  1REC A;  3OB2 B;  4ZCU A;  1XFU O;  3KO0 A;  4HRG A;  1BR4 B;  1PSB A;  1CKK A;  2JC2 A;  1S36 A;  4N1F A;  1FW4 A;  1SW8 A;  2CNP A;  1E8A A;  3N7H A;  3QME A;  2GGZ A;  1G8I A;  1DT7 B;  2P71 A;  3WHT B;  1QV0 A;  3C1V A;  3M0W A;  4GGF A;  3OB1 B;  1L2O B;  1OQP A;  2LAP A;  4XJK A;  1CFF A;  1F71 A;  4WQ2 A;  3FE8 A;  2L98 A;  2LLS A;  1ZMZ A;  1DJW A;  3DZT A;  1K9U A;  3NSO A;  4OCI A;  5FI2 A;  3NSI A;  1KQM C;  1SMG A;  1Y6W A;  3UNW A;  4YGE B;  1ALW A;  3TDI A;  3R1P A;  1B4C A;  4PE7 A;  2F8P A;  1IGV A;  2M3W A;  3FS7 A;  4JWQ A;  1SY9 A;  4GBA A;  2JOJ A;  2VRG A;  1CMF A;  2M29 A;  2WOR A;  2WC6 A;  3VRP A;  2ZN8 A;  1U5I A;  5JJG A;  1J7O A;  3RZS A;  2L51 A;  3FWB A;  4MBE A;  5D3O A;  1BMO A;  2KBI A;  1S6J A;  1IQ5 A;  1DEK A;  5PAL A;  2JNX A;  3CAB A;  1UHK A;  1F8H A;  1SSE B;  3OGN A;  4DIR A;  4QJ5 B;  3PAL A;  1QAT A;  3NSL A;  2HQ8 A;  3LL8 B;  3VRN A;  2F3Y A;  4YGA A;  4YGC B;  3PSR A;  2HPS A;  4NDB A;  4GNK B;  4N5X A;  1XO5 A;  1EH2 A;  2LVI A;  1KFX L;  3I5F B;  1NP8 A;  5AFP A;  1MQ1 A;  2M97 A;  1LA3 A;  2MAZ A;  4M2P A;  5DIC A;  2EC6 B;  2KFF A;  1BU3 A;  2E6W A;  2FCE A;  5AAN A;  1A03 A;  2PYQ A;  1A75 A;  2KYC A;  2WCF A;  4PHJ A;  2BE4 A;  2KFH A;  2M7N A;  4YRU A;  2KI6 C;  2JU0 A;  4ZCV A;  1J7Q A;  1PAL A;  1XVJ A;  1YX8 A;  4NDC A;  2BL0 C;  1P28 A;  4FTG A;  2L0P A;  1DJY A;  1EXR A;  5DKQ A;  1WRK A;  2QPT A;  3MSE B;  3BUM B;  2KPH A;  4PHM A;  1LS8 A;  1IIO A;  3DYE A;  2M7L A;  3L4A A;  1GGZ A;  5AER A;  2MLE C;  1YRU B;  3B7A A;  4GGF C;  2PMY A;  1N0Y A;  1MR8 A;  1DF0 A;  1JF0 A;  1SYM A;  2AUC A;  2L50 A;  4M2Q A;  4A4C A;  1DEL A;  2ZKM X;  3UO9 A;  1B7T Z;  3JVT C;  3KPX A;  4MVF A;  2WCK A;  4M2O A;  4PHN A;  1VRK A;  5F6T A;  1NWD A;  1MXE A;  1S6C A;  4PDZ A;  2L4I A;  1B7T Y;  1SNL A;  3I5G C;  1D1O A;  4L9M A;  4F7F A;  2F2O A;  2KGR A;  1QIW A;  1FPW A;  2DOQ A;  2P70 A;  2L2C A;  2KAY A;  3I5H C;  4P2Y B;  3EKH A;  2LVK A;  3K1E A;  5ER4 X;  3GK2 A;  1SPY A;  1EL4 A;  2D8N A;  2FJU B;  4HRE E;  4INX A;  5DKR A;  2KYF A;  2NCP A;  1CDL A;  3I5H B;  1OMR A;  1OOJ A;  2M1K B;  1DQE A;  1SL7 A;  2LUX A;  3CLN A;  1AUI B;  2QDI A;  4OR9 B;  5HKZ A;  1OSA A;  2BCB A;  3BFH A;  3D78 A;  1B8R A;  4D1E A;  4YI8 A;  3KF9 A;  4HRH A;  1B47 A;  1S3P A;  2LLU A;  1A4P A;  1DTL A;  3ICB A;  3Q8I A;  1UHJ A;  4CLN A;  4PE4 A;  3S0D A;  1Y0V H;  1QX5 B;  2KBM A;  1Y1U A;  2JT3 A;  4AQI A;  1SCM C;  1QXP A;  2FCD A;  2OS8 C;  1ORG A;  1UHN A;  1TRF A;  2JXL A;  2LP2 A;  3NGV A;  3TDZ A;  3QRX A;  1SL8 A;  2BCX A;  2E30 A;  3PM8 A;  3ZNI A;  2BNX A;  3VGO A;  2BKI B;  1DVI A;  2LCP A;  3D0Y A;  3PN7 C;  1XA5 A;  1NSH A;  1KK7 Z;  1RK9 A;  2KFG A;  4PCW A;  3NHI A;  1UUS A;  4PAL A;  3VRR A;  1CB1 A;  2NCO A;  2LVV A;  1QV1 A;  4GUK A;  2WC5 A;  1KSO A;  2K7D A;  1K94 A;  2OPO A;  1KSM A;  4F0Z B;  1U5I B;  2ISD A;  4CPV A;  2LUC A;  4PE1 A;  4QJ4 B;  1WY9 A;  3R1O A;  1C7W A;  1BLQ A;  1CLB A;  4DS7 A;  1AVS A;  2H61 A;  1RJV A;  1NX3 A;  2PAL A;  5HL1 A;  4BY4 A;  5IBW A;  1R2U A;  5HLV A;  2JT0 A;  1CLM A;  2QAC A;  1JFJ A;  1JFK A;  1W7I B;  1XFR A;  4P5O E;  2EC6 C;  2WCM A;  4YGD B;  1SK6 D;  1F4Q A;  1YVL A;  4OVN F;  1MHO A;  2GV5 A;  1CM1 A;  3OBV A;  1MF8 B;  2JPO A;  1UWO A;  1EG4 A;  4WQ3 A;  1G33 A;  1SR6 C;  2GGM A;  1CDM A;  2I18 A;  2ZFD A;  1XFV O;  4YI9 A;  2Y1M A;  3BOW B;  3SS3 A;  1OMV A;  1J1E A;  3DVJ A;  2LAN A;  3SG7 A;  4BY5 A;  1C3Y A;  1GGW A;  1EJ3 A;  1M46 A;  2BEC A;  5FYX A;  3CR4 X;  2KSP A;  3D74 A;  2F33 A;  1OOH A;  3F45 A;  3NHT A;  2ZRS A;  1NCX A;  1XFX O;  1RRO A;  1W9Z A;  3BUN B;  4OV2 A;  2QEV A;  1MUX A;  2H2K A;  2SAS A;  3EVU A;  4DUQ A;  1CLL A;  1NCZ A;  2G9B A;  3SG2 A;  2F3Z A;  4XJK B;  2K0J A;  3CZ2 A;  1YTZ C;  1V1G A;  2JT8 A;  4YGB B;  1QLS A;  4MN0 A;  1PRW A;  2AMI A;  1F4O A;  3DVK A;  5I2L A;  4UPG A;  3RLZ A;  1KFU L;  3L4L A;  1NIW A;  3SJS A;  4R1E A;  3IF7 A;  2RGI A;  5CSF A;  1DJZ A;  1TUJ A;  1DF0 B;  2HET A;  5J3X A;  3SIA A;  1NCY A;  1J7R A;  3E3R A;  5I2Q A;  3TUY C;  1UP5 A;  5HKY A;  5AEQ A;  1CFC A;  1KK7 Y;  1XFW O;  3CTN A;  1BR1 B;  1V1F A;  4GAO A;  2K2A A;  3NSK A;  4GGN A;  5HLO A;  3I5G B;  3VB1 A;  2KHN A;  3HX4 A;  1DJG A;  1B8L A;  3PJI A;  1BOD A;  3O4Y A;  5G08 A;  2K7C A;  1Y1X A;  1CFD A;  1QWV A;  1TCO B;  3PAT A;  2LC5 A;  2K60 A;  2Q91 A;  4IL1 A;  2BL0 B;  3WNX B;  1QJT A;  3TS5 B;  3VRQ A;  5DKN A;  3RM1 A;  2LLT A;  1PUL A;  3EG5 B;  4JPZ B;  3TS5 C;  1R6P A;  1JWD A;  4MRY A;  2I94 A;  1SL9 A;  1MXL C;  1TOP A;  3PN7 B;  1OZS A;  1QVI Y;  1S5G Z;  1WDC B;  2JTT A;  2K7B A;  4OZD A;  4PHK A;  2K7O A;  1ODB A;  1IRJ A;  2BAP A;  2MA2 A;  1IWQ A;  2K61 A;  4IJ7 A;  1A75 B;  1TNP A;  2LVJ A;  3S0A A;  2FJY A;  3D76 A;  1S26 D;  3OX5 A;  3SG3 A;  5HYD A;  2K2F A;  1PVA A;  1KCY A;  4MLW A;  2LM5 A;  1Q80 A;  3JVT B;  5FI7 A;  1GQM A;  4ORA B;  4ETO A;  1FBV A;  1SKT A;  2KOT A;  1AJ5 A;  3AKB A;  1SCM B;  1QLK A;  2QEB A;  1IQ3 A;  5CSN A;  5KTY A;  2M49 B;  3DXL A;  3WXA A;  1ZUZ A;  3WHU B;  1AHR A;  2M8U A;  3FIA A;  4A4B A;  2PVB A;  2JRF A;  1B8C A;  4N1G A;  3S0G A;  4Q04 A;  1KFX S;  1HT9 A;  3CS1 A;  1YUR A;  1EG3 A;  4I5L B;  5FI6 A;  2PQL A;  2KLD A;  3JTD B;  1OOF A;  5ER5 A;  2WCB A;  4E68 A;  4U8D A;  3CWG A;  4AOM A;  1QS7 A;  4I5K A;  1UHI A;  4FQT A;  5CSJ A;  1KWO B;  2ERB A;  4ICB A;  2ZND A;  3D77 A;  1TUZ A;  2H61 C;  2CXJ A;  2LE9 B;  1KQM B;  4GFT A;  1B1G A;  3CDN A;  2WCH A;  3TZ1 A;  1M39 A;  1OE9 B;  2BBN A;  1KK8 B;  2BE6 A;  2CBL A;  2PAS A;  5I8N A;  1JUO A;  1DMO A;  4FQO A;  4MRX A;  1C7V A;  3BYA A;  4QJ3 B;  1LA0 A;  1ZOT B;  1N65 A;  2Y5I A;  5KU1 A;  3I5I B;  3FE6 A;  1X02 A;  2BKH B;  3O4X A;  3S0E A;  3LK0 A;  1F70 A;  3BXK A;  2HQW A;  3DY9 A;  1GM0 A;  1QAS A;  3LK1 A;  1AK8 A;  2OS8 B;  1S1E A;  4HSZ A;  1PSR A;  2L5Y A;  3S0B A;  2O60 A;  3B6X A;  2KGB C;  1JBA A;  5EL2 A;  1WLM A;  1M45 A;  2EGD A;  1C07 A;  1JSA A;  2AAO A;  2L4H A;  1CDP A;  2M9G A;  1DGV A;  1A2X A;  2FOT A;  2LHL A;  2LNK A;  3CR2 A;  3PFV A;  1XYD A;  2WCJ A;  1K93 D;  3B88 A;  1H8B A;  1Y1A A;  3DVM A;  2SCP A;  1L7Z A;  2MHH A;  2O5G A;  1QTX A;  1Z2C B;  1TTX A;  2WCL A;  2JXC A;  3IQQ A;  3K21 A;  1RWY A;  4OKH A;  4KYN A;  1J55 A;  1TNW A;  3DD4 A;  3BQ3 A;  3SS4 A;  2JUL A;  2JPT A;  1DJH A;  2HF5 A;  1TIZ A;  1TN4 A;  1JC2 A;  1H4B A;  2WND A;  3A4U B;  1XK4 A;  3A8R A;  5GQQ C;  1S6I A;  3EVR A;  1XK4 C;  2I7A A;  1K90 D;  2JWW A;  2KI6 D;  3GK4 X;  5TNC A;  3SG5 A;  3FE9 A;  4DCK A;  1CFP A;  3SG4 A;  1NX0 A;  1K96 A;  1SR6 B;  1T14 A;  3TUY B;  1NPQ A;  2LMV A;  4XYN A;  1AJ4 A;  1K9P A;  1SBJ A;  2ZRT A;  2P6B B;  2BCA A;  3GK1 A;  5D69 A;  2PRU A;  4PT1 A;  3CYZ A;  1CDN A;  2I2R E;  5AXI A;  1C3Z A;  2OTG C;  1KK8 C;  1NUB A;  2WC8 A;  4GPL B;  5B8I B;  2JZI A;  1GJY A;  3NXA A;  5KSZ A;  2L5X B;  3D10 A;  1IJ5 A;  2EHB A;  2MJW B;  2MLF C;  2WOS A;  3O78 A;  4MEW A;  1NX2 A;  3CZ0 A;  3OP0 A;  3EKJ A;  3TDU A;  1TWO A;  3FWC A;  3CZ1 A;  4PE0 A;  1TCF A;  1L2O C;  2LP3 A;  2JNF A;  2K8M B;  1W7J B;  2CCM A;  2F2P A;  4I5J A;  2KQ6 A;  3SIB A;  1A29 A;  3IVT A;  4JQ0 D;  1YVH A;  1KFU S;  3BUX B;  1J1D A;  1UHH A;  2KAX A;  3BUW B;  3PLF B;  2KNE A;  3SG6 A;  1BF5 A;  1RFJ A;  3LLE A;  4YBH B;  2LV7 A;  3EK4 A;  2CTN A;  1NX1 A;  1F55 A;  1K2H A;  5CSI A;  2JTZ A;  4CFQ A;  2QEH A;  1CMG A;  2A4J A;  1YR5 A;  4ORB B;  1KQV A;  2L2E A;  2GTE A;  3D75 A;  3R72 A;  3KHE A;  2IS9 A;  4JD9 A;  1J7P A;  3BJH A;  1Z4H A;  1QVI Z;  1S5G Y;  2CT9 A;  1QX2 A;  1PVB A;  3IQO A;  5CPV A;  3SS5 A;  1DGU A;  1WRL A;  3CZT X;  4DRW A;  3S0F A;  2B1U A;  1CTR A;  4NDD A;  3L47 A;  1OZO A;  3EVV A;  1WRZ A;  2MBX A;  3ZWH A;  1K8U A;  3BFB A;  3AKA A;  5D7F A;  2Y1N A;  3DF0 A;  1B9A A;  3CGA A;  1NYA A;  3DF0 B;  4CID A;  4C0K A;  3H4S E;  2ZN9 A;  1DJX A;  2COL B;  1LXF C;  1OW4 A;  3CR5 X;  3KEV A;  2G2B A;  3GOF A;  1CNP A;  2TN4 A;  2ZNE A;  3D73 A;  3I5F C;  2OTG B;  2PSR A;  1YUS A;  1SRA A;  1IG5 A;  3B87 A;  1XFY O;  4JKT A;  4NQG A;  5I94 A;  3B86 A;  2R2I A;  5HKW A;  3EK8 A;  1M63 B;  2QEO A;  3OHM B;  1RTP 1;  3D0Y B;  1ZFS A;  2Q4U A;  1JF2 A;  2V53 A;  3AAK A;  4ORC B;  1CM4 A;  1YUT A;  4WRI A;  1AP4 A;  3O2P A;  1YUU A;  5K89 A;  4MSP A;  1F54 A;  1TNQ A;  1WDC C;  3VRO A;  5BPJ A;  3V2L A;  3OX6 A;  3I5I C;  4C0J A;  2M1U A;  1XFZ O;  2LMU A;  3O6B A;  2KQY A;  1BOC A;  1FI5 A;  1ALV A;  3EK7 A;  4USL A;  1TNX A;  2LMT A;  1LKJ A;  1IH0 A;  1QIV A;  4INW A;  4MZJ A;  1BJF A;  1UUR A;  1BT6 A;  2KI4 C;  2NLN A;  1K95 A;  1YX7 A;  3PM2 A;  3HCM A;  5I2O A;  2JQ6 A;  1DC1 A;  1OMD A;  1M31 A;  1SCV A;  2LHI A;  3LCP C;  3DVE A;  2KLE A;  4AQJ A;  4CFR A;  1FF1 A;  1QX7 A;  1K9K A;  2KDH A;  4I5N B;  1LIN A;  2NXQ A;  4MZK A;  1ZAC A;  2M0R A;  2KAV A;  2YGU A;  1MWN A;  1PK0 D;  1LVC D;  1BG1 A;  3AAJ A;  5JOL A;  1FI6 A;  4TNC A;  4MZL A;  1G4Y R;  3BUO B;  2H8V A;  4C0L A;  3JTD C;  3BFA A;  2MRD A;  1OOI X; 
#chains in the Genus database with same CATH homology
 1N2D A;  1YRT B;  1WLZ A;  1DJI A;  2WCE A;  2NZ0 A;  2Y4Q A;  1HQV A;  2BBM A;  1KWO C;  1IJ6 A;  2KI4 B;  1IKU A;  3BOW A;  1REC A;  3OB2 B;  4ZCU A;  1XFU O;  3KO0 A;  4HRG A;  1BR4 B;  1PSB A;  1CKK A;  2JC2 A;  1S36 A;  4N1F A;  1FW4 A;  1SW8 A;  2CNP A;  1E8A A;  2GGZ A;  1G8I A;  1DT7 B;  3WHT B;  1QV0 A;  3C1V A;  3M0W A;  4GGF A;  3OB1 B;  1L2O B;  1OQP A;  2LAP A;  4XJK A;  1CFF A;  1F71 A;  4WQ2 A;  2L98 A;  2LLS A;  3NSO A;  1DJW A;  4OCI A;  1K9U A;  3NSI A;  1KQM C;  1SMG A;  1Y6W A;  4YGE B;  1ALW A;  3TDI A;  1B4C A;  4PE7 A;  2F8P A;  1IGV A;  2M3W A;  3FS7 A;  4JWQ A;  1SY9 A;  4GBA A;  2JOJ A;  2VRG A;  1CMF A;  2M29 A;  2WOR A;  3VRP A;  2ZN8 A;  1U5I A;  5JJG A;  1J7O A;  2L51 A;  3FWB A;  4MBE A;  1BMO A;  2KBI A;  1S6J A;  1IQ5 A;  5PAL A;  2JNX A;  1UHK A;  1F8H A;  4QJ5 B;  4DIR A;  3PAL A;  1QAT A;  3NSL A;  2HQ8 A;  3LL8 B;  3VRN A;  2F3Y A;  4YGA A;  4YGC B;  3PSR A;  2HPS A;  4NDB A;  4GNK B;  4N5X A;  1XO5 A;  1EH2 A;  2LVI A;  1KFX L;  3I5F B;  1NP8 A;  5AFP A;  1MQ1 A;  2M97 A;  1LA3 A;  2MAZ A;  4M2P A;  2EC6 B;  2KFF A;  1BU3 A;  2E6W A;  2FCE A;  5AAN A;  1A03 A;  1A75 A;  2KYC A;  2WCF A;  4PHJ A;  2BE4 A;  2KFH A;  2M7N A;  4YRU A;  2KI6 C;  2JU0 A;  4ZCV A;  1J7Q A;  1PAL A;  1XVJ A;  1YX8 A;  4NDC A;  2BL0 C;  4FTG A;  2L0P A;  1DJY A;  1EXR A;  5DKQ A;  1WRK A;  2QPT A;  3MSE B;  3BUM B;  4PHM A;  2M7L A;  1GGZ A;  5AER A;  2MLE C;  1YRU B;  4GGF C;  2PMY A;  1N0Y A;  1MR8 A;  1DF0 A;  1JF0 A;  1SYM A;  2AUC A;  2L50 A;  4M2Q A;  4A4C A;  2ZKM X;  1B7T Z;  3JVT C;  3KPX A;  4MVF A;  4PHN A;  4M2O A;  5F6T A;  1VRK A;  1NWD A;  1MXE A;  1S6C A;  4PDZ A;  2L4I A;  1B7T Y;  1SNL A;  3I5G C;  1D1O A;  4L9M A;  2F2O A;  2KGR A;  1QIW A;  1FPW A;  2DOQ A;  2KAY A;  3I5H C;  4P2Y B;  3EKH A;  2LVK A;  5ER4 X;  3GK2 A;  1SPY A;  2FJU B;  2D8N A;  1EL4 A;  4HRE E;  5DKR A;  2KYF A;  2NCP A;  1CDL A;  3I5H B;  1OMR A;  1OOJ A;  2M1K B;  1SL7 A;  2LUX A;  3CLN A;  1AUI B;  4OR9 B;  5HKZ A;  1OSA A;  2BCB A;  1B8R A;  4D1E A;  4YI8 A;  3KF9 A;  4HRH A;  1B47 A;  1S3P A;  2LLU A;  1A4P A;  1DTL A;  3ICB A;  4CLN A;  1UHJ A;  4PE4 A;  1Y0V H;  1QX5 B;  2KBM A;  1Y1U A;  2JT3 A;  4AQI A;  1SCM C;  1QXP A;  2FCD A;  2OS8 C;  1UHN A;  1TRF A;  2JXL A;  2LP2 A;  3TDZ A;  3QRX A;  1SL8 A;  2BCX A;  2E30 A;  3PM8 A;  3ZNI A;  3VGO A;  2BKI B;  1DVI A;  2LCP A;  3D0Y A;  3PN7 C;  1XA5 A;  1NSH A;  1KK7 Z;  1RK9 A;  2KFG A;  4PCW A;  1UUS A;  4PAL A;  3VRR A;  1CB1 A;  2NCO A;  2LVV A;  1QV1 A;  4GUK A;  1KSO A;  2K7D A;  1K94 A;  2OPO A;  1KSM A;  4F0Z B;  1U5I B;  2ISD A;  4CPV A;  2LUC A;  4PE1 A;  4QJ4 B;  1WY9 A;  1C7W A;  1BLQ A;  1CLB A;  4DS7 A;  1AVS A;  2H61 A;  1RJV A;  1NX3 A;  2PAL A;  4BY4 A;  5IBW A;  1R2U A;  5HLV A;  2JT0 A;  1CLM A;  2QAC A;  1JFJ A;  1JFK A;  1W7I B;  4P5O E;  2EC6 C;  4YGD B;  1SK6 D;  1F4Q A;  1YVL A;  4OVN F;  1MHO A;  2GV5 A;  1CM1 A;  1MF8 B;  1UWO A;  1EG4 A;  4WQ3 A;  1G33 A;  1SR6 C;  2GGM A;  1CDM A;  2I18 A;  2ZFD A;  1XFV O;  4YI9 A;  2Y1M A;  3BOW B;  1OMV A;  1J1E A;  3DVJ A;  2LAN A;  3SG7 A;  4BY5 A;  1GGW A;  1EJ3 A;  1M46 A;  2BEC A;  5FYX A;  3CR4 X;  2KSP A;  2F33 A;  3F45 A;  2ZRS A;  1NCX A;  1XFX O;  1RRO A;  4DUQ A;  3BUN B;  4OV2 A;  2SAS A;  1MUX A;  2H2K A;  3EVU A;  1CLL A;  1NCZ A;  2G9B A;  3SG2 A;  2F3Z A;  4XJK B;  2K0J A;  1YTZ C;  1V1G A;  2JT8 A;  4YGB B;  1QLS A;  4MN0 A;  1PRW A;  2AMI A;  1F4O A;  3DVK A;  5I2L A;  4UPG A;  3RLZ A;  1KFU L;  1NIW A;  3SJS A;  4R1E A;  3IF7 A;  2RGI A;  5CSF A;  1DJZ A;  2HET A;  1DF0 B;  5J3X A;  3SIA A;  1NCY A;  1J7R A;  3E3R A;  5I2Q A;  3TUY C;  1UP5 A;  5HKY A;  5AEQ A;  1CFC A;  1KK7 Y;  1XFW O;  3CTN A;  1BR1 B;  1V1F A;  4GAO A;  2K2A A;  3NSK A;  4GGN A;  5HLO A;  3I5G B;  1BOD A;  2KHN A;  3HX4 A;  1DJG A;  1B8L A;  3O4Y A;  5G08 A;  2K7C A;  1Y1X A;  1CFD A;  1TCO B;  3PAT A;  4IL1 A;  2LC5 A;  2Q91 A;  3WNX B;  2BL0 B;  1QJT A;  3TS5 B;  3VRQ A;  5DKN A;  3RM1 A;  2LLT A;  1PUL A;  4JPZ B;  3TS5 C;  1R6P A;  1JWD A;  4MRY A;  2I94 A;  1SL9 A;  1MXL C;  1TOP A;  3PN7 B;  1OZS A;  1QVI Y;  1S5G Z;  1WDC B;  2JTT A;  2K7B A;  4PHK A;  2K7O A;  1ODB A;  1IRJ A;  2MA2 A;  1IWQ A;  2K61 A;  1A75 B;  1TNP A;  2LVJ A;  3SG3 A;  3OX5 A;  1S26 D;  5HYD A;  2K2F A;  1PVA A;  1KCY A;  4MLW A;  2LM5 A;  1Q80 A;  3JVT B;  1GQM A;  4ORA B;  4ETO A;  1FBV A;  1SKT A;  2KOT A;  1AJ5 A;  3AKB A;  1SCM B;  1QLK A;  1IQ3 A;  5CSN A;  5KTY A;  2M49 B;  3WXA A;  1ZUZ A;  3WHU B;  1AHR A;  2M8U A;  3FIA A;  4A4B A;  2PVB A;  2JRF A;  1B8C A;  4N1G A;  4Q04 A;  1KFX S;  1HT9 A;  3CS1 A;  1YUR A;  1EG3 A;  4I5L B;  3JTD B;  5ER5 A;  2WCB A;  4E68 A;  4U8D A;  3CWG A;  4AOM A;  1QS7 A;  4I5K A;  1UHI A;  5CSJ A;  1KWO B;  4ICB A;  2ZND A;  2H61 C;  2CXJ A;  2LE9 B;  1KQM B;  4GFT A;  1B1G A;  3TZ1 A;  1M39 A;  1OE9 B;  2BBN A;  1KK8 B;  2BE6 A;  2CBL A;  2PAS A;  5I8N A;  1JUO A;  1DMO A;  4FQO A;  4MRX A;  1C7V A;  3BYA A;  4QJ3 B;  1LA0 A;  1ZOT B;  1N65 A;  2Y5I A;  5KU1 A;  3I5I B;  1X02 A;  2BKH B;  3LK0 A;  1F70 A;  3BXK A;  2HQW A;  1QAS A;  3LK1 A;  1AK8 A;  2OS8 B;  1S1E A;  4HSZ A;  1PSR A;  2O60 A;  2KGB C;  1JBA A;  1WLM A;  1M45 A;  2EGD A;  1C07 A;  1JSA A;  2AAO A;  2L4H A;  1CDP A;  2M9G A;  1DGV A;  1A2X A;  2FOT A;  2LHL A;  2LNK A;  3CR2 A;  3PFV A;  1XYD A;  1H8B A;  1K93 D;  1Y1A A;  3DVM A;  2SCP A;  1L7Z A;  2MHH A;  2O5G A;  1QTX A;  1TTX A;  2JXC A;  3IQQ A;  3K21 A;  1RWY A;  4OKH A;  1J55 A;  1TNW A;  3DD4 A;  3BQ3 A;  2JUL A;  2JPT A;  1DJH A;  2HF5 A;  1TIZ A;  1TN4 A;  1JC2 A;  1H4B A;  2WND A;  3A4U B;  1XK4 A;  3A8R A;  5GQQ C;  1S6I A;  3EVR A;  1XK4 C;  2I7A A;  1K90 D;  2JWW A;  2KI6 D;  3GK4 X;  5TNC A;  3SG5 A;  4DCK A;  1CFP A;  3SG4 A;  1NX0 A;  1K96 A;  1SR6 B;  3TUY B;  1NPQ A;  2LMV A;  4XYN A;  1AJ4 A;  1K9P A;  1SBJ A;  2ZRT A;  2P6B B;  2BCA A;  3GK1 A;  5D69 A;  2PRU A;  1CDN A;  2I2R E;  5AXI A;  2WC8 A;  2OTG C;  1KK8 C;  1NUB A;  4GPL B;  5B8I B;  2JZI A;  1GJY A;  3NXA A;  5KSZ A;  2L5X B;  3D10 A;  1IJ5 A;  2EHB A;  2MJW B;  2MLF C;  2WOS A;  3O78 A;  4MEW A;  1NX2 A;  3OP0 A;  3EKJ A;  3TDU A;  3FWC A;  4PE0 A;  1TCF A;  1L2O C;  2LP3 A;  2JNF A;  2K8M B;  1W7J B;  2CCM A;  2F2P A;  4I5J A;  2KQ6 A;  3SIB A;  1A29 A;  4JQ0 D;  1YVH A;  1KFU S;  3BUX B;  1J1D A;  1UHH A;  2KAX A;  3BUW B;  3PLF B;  2KNE A;  3SG6 A;  1BF5 A;  1RFJ A;  3LLE A;  4YBH B;  2LV7 A;  3EK4 A;  2CTN A;  1NX1 A;  1F55 A;  1K2H A;  5CSI A;  2JTZ A;  4CFQ A;  1CMG A;  2A4J A;  1YR5 A;  4ORB B;  1KQV A;  2L2E A;  3KHE A;  2IS9 A;  1J7P A;  2CT9 A;  1QVI Z;  1S5G Y;  3IQO A;  1QX2 A;  1PVB A;  5CPV A;  1DGU A;  1WRL A;  3CZT X;  4DRW A;  2B1U A;  1CTR A;  4NDD A;  1OZO A;  3EVV A;  1WRZ A;  2MBX A;  3ZWH A;  1K8U A;  3AKA A;  5D7F A;  2Y1N A;  3DF0 A;  1B9A A;  3CGA A;  1NYA A;  3DF0 B;  4CID A;  4C0K A;  3H4S E;  2ZN9 A;  1DJX A;  2COL B;  1LXF C;  3KEV A;  3CR5 X;  2G2B A;  3GOF A;  1CNP A;  2TN4 A;  2ZNE A;  3I5F C;  2OTG B;  2PSR A;  1YUS A;  1SRA A;  1IG5 A;  4NQG A;  1XFY O;  2R2I A;  5HKW A;  3EK8 A;  1M63 B;  3OHM B;  1RTP 1;  3D0Y B;  1ZFS A;  2Q4U A;  1JF2 A;  2V53 A;  3AAK A;  4ORC B;  1CM4 A;  1YUT A;  4WRI A;  1AP4 A;  3O2P A;  1YUU A;  5K89 A;  4MSP A;  1F54 A;  1TNQ A;  1WDC C;  3VRO A;  5BPJ A;  3OX6 A;  3I5I C;  4C0J A;  2M1U A;  1XFZ O;  2LMU A;  3O6B A;  2KQY A;  1BOC A;  1FI5 A;  1ALV A;  3EK7 A;  4USL A;  1TNX A;  2LMT A;  1LKJ A;  1IH0 A;  1QIV A;  4MZJ A;  1BJF A;  1UUR A;  1BT6 A;  2KI4 C;  2NLN A;  1K95 A;  1YX7 A;  3HCM A;  5I2O A;  2JQ6 A;  1OMD A;  1M31 A;  1SCV A;  2LHI A;  3LCP C;  3DVE A;  4AQJ A;  4CFR A;  1FF1 A;  1QX7 A;  1K9K A;  2KDH A;  4I5N B;  1LIN A;  2NXQ A;  4MZK A;  1ZAC A;  2M0R A;  2KAV A;  1MWN A;  1PK0 D;  1LVC D;  1BG1 A;  3AAJ A;  5JOL A;  1FI6 A;  4TNC A;  4MZL A;  1G4Y R;  3BUO B;  4C0L A;  3JTD C;  2MRD A;  1ZMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...