1OMDA

Structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
ITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ONCOMODULIN
publication title Structure of oncomodulin refined at 1.85 A resolution. An example of extensive molecular aggregation via Ca2+.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium binding protein
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omdA00
1QXPA 1SR6B 2ZRTA 1HQVA 1H4BA 2KDHA 1HT9A 1CB1A 5JJGA 1IRJA 4GBAA 2KYFA 2WCEA 4JQ0D 4MRXA 4WQ3A 5CSNA 3GK4X 2LV7A 1BLQA 1K9PA 3BUNB 2A4JA 1F8HA 1NIWA 4QJ4B 4MLWA 5HKWA 3VROA 1QIWA 1IH0A 1OZSA 1PULA 3O2PA 1CLMA 4JPZB 2KI4C 2OS8B 5D7FA 2M9GA 3EKHA 2M8UA 4YI9A 4PE7A 2E30A 4WQ2A 2F2OA 3DD4A 2BL0C 1CFFA 2F8PA 1K90D 1WDCB 1S6CA 3C1VA 3SG6A 2KAVA 3BUOB 4L9MA 1MWNA 2KSPA 1OMDA 1MXEA 3ZWHA 2Y1MA 1FI6A 2JZIA 1RFJA 1QX7A 1NSHA 1IKUA 1DTLA 2AMIA 1BG1A 1WRKA 2JPTA 4YGEB 1U5IA 1KWOB 2D8NA 2LE9B 4YBHB 4ICBA 3LLEA 5HKYA 2JNFA 1YUUA 4R1EA 2K7OA 4GNKB 3LK0A 3I5HC 3BUMB 1MF8B 1WRZA 2EHBA 2F3YA 2OPOA 1M39A 1S5GY 4DUQA 4U8DA 5PALA 1AP4A 3DVKA 2L98A 3D0YB 3I5IC 5KTYA 1JWDA 4YGDB 1K9UA 4PDZA 4NDDA 4OKHA 3EVVA 4OV2A 2KBMA 2KQYA 2Q4UA 2M0RA 4N1GA 2SCPA 4MZKA 4PHNA 2HF5A 3TZ1A 2LP2A 2WCBA 3ICBA 1A75A 5AANA 1JFKA 4P5OE 4ETOA 3OHMB 1IQ5A 4NQGA 1B8LA 4BY4A 4YI8A 2V53A 1YTZC 3NXAA 1SR6C 1XFZO 2WNDA 4MN0A 3D10A 2L51A 5ER5A 1SNLA 3PFVA 2LP3A 4YGAA 1D1OA 1J7QA 4MSPA 1QVIY 1KK7Y 1DJXA 4NDCA 1BOCA 1A4PA 1QIVA 1S26D 4GUKA 3KHEA 4MEWA 2VRGA 3I5FB 1JC2A 3E3RA 1ZACA 2KI4B 1TN4A 3SG2A 1A2XA 1E8AA 1EL4A 2RGIA 1N0YA 2HQWA 3QRXA 1AK8A 2BL0B 1L7ZA 4M2PA 2MAZA 3TS5B 1AHRA 1MR8A 1RJVA 1WDCC 2COLB 2K0JA 2LC5A 4ZCUA 2MJWB 3SG3A 1K94A 5B8IB 2I18A 2KNEA 1OE9B 2BE6A 1BU3A 2PRUA 2ZFDA 2LHLA 1DMOA 1S6IA 3FS7A 4DRWA 1S5GZ 1WLMA 2EC6C 4QJ3B 1LINA 1JUOA 1SBJA 2GV5A 1JF0A 3BUWB 3I5HB 1XK4A 2L0PA 1RTP1 3BUXB 4ZCVA 1TNXA 2L50A 2M7NA 2K7CA 3A8RA 1TNWA 1YUTA 4CFQA 4MVFA 1OOJA 3I5IB 1K95A 4E68A 4Q04A 2K7DA 3SG5A 2KFFA 1IJ6A 1A29A 1DVIA 2KGRA 4GGNA 1TRFA 1DF0B 4GGFA 1WRLA 4AOMA 4D1EA 3SJSA 2LMUA 1BT6A 2M7LA 2MRDA 3M0WA 5JOLA 4XJKB 2BE4A 3BXKA 4I5KA 1KK7Z 4M2QA 5AERA 2FCEA 1B4CA 1J1DA 2H61C 4TNCA 2ZN9A 2NCOA 1ALWA 1Y0VH 1KQVA 2H2KA 3CTNA 2KAXA 2G9BA 2BCXA 4CPVA 2L2EA 5AFPA 1NCYA 3D0YA 3CGAA 1DT7B 1MQ1A 2F33A 2LVVA 3PATA 5DKRA 1NPQA 3EK8A 1IWQA 2KAYA 3I5FC 3JVTB 1TNQA 2KFHA 5HLVA 2BKIB 2AAOA 3VRQA 1XFYO 1NX3A 1J55A 2CT9A 3OB2B 1QS7A 2H61A 2QPTA 1OMVA 1RWYA 2Y5IA 1Y1AA 2HQ8A 2JTTA 3HX4A 3DVJA 2LVJA 1B9AA 1ZFSA 2JQ6A 3TS5C 3KO0A 4DCKA 2E6WA 3CWGA 2LNKA 2ZNDA 1SMGA 1DGUA 4HSZA 2KI6C 3LK1A 1LKJA 1RECA 2KBIA 2JXCA 5DKQA 2JWWA 1F4QA 2EC6B 2Q91A 1M46A 1PSBA 4DIRA 1DJIA 2BCAA 2JU0A 2KOTA 1NWDA 1V1FA 1Y1UA 3I5GC 3TDZA 1TCOB 2MHHA 1A03A 2CBLA 5F6TA 1G4YR 1JBAA 1LA0A 1Q80A 3VRPA 1S6JA 3LL8B 2BKHB 3CR4X 2LCPA 1IG5A 1SL7A 2M3WA 1LXFC 1TOPA 3EVUA 1PRWA 1ZUZA 4UPGA 1BR1B 1OSAA 2JTZA 4OR9B 4CLNA 2LUCA 2CNPA 2LHIA 4I5JA 1PVAA 1M63B 1X02A 1QX2A 1SL8A 2NXQA 1EXRA 2LLUA 1CDMA 1JF2A 5G08A 3PLFB 1TIZA 2Y1NA 5HYDA 1NYAA 1UHHA 1B1GA 1F54A 1CMFA 2JT8A 1NX0A 4YRUA 4JWQA 1NUBA 4M2OA 4A4BA 4HRHA 2JNXA 1R2UA 1AJ5A 4PHMA 4PE0A 2LM5A 2OTGB 1J1EA 2P6BB 1CNPA 1QV1A 5I2OA 1H8BA 1NP8A 2K2FA 1KK8B 4ORAB 5CPVA 1NX2A 3WNXB 2MLEC 1DF0A 2CCMA 1M31A 2LANA 2WORA 3JVTC 1J7OA 3JTDC 4PALA 1BR4B 1YX7A 1IGVA 4XJKA 4XYNA 1FBVA 5FYXA 1G33A 4IL1A 2BBNA 3ZNIA 1SKTA 3CLNA 3PM8A 2R2IA 2CTNA 1GGWA 2L4IA 1TNPA 4GAOA 1XVJA 1UHKA 1CM1A 3CR5X 4FQOA 3AKBA 1SCMB 3OX6A 3VGOA 1BMOA 1QLKA 3KF9A 1U5IB 3EK7A 2ZNEA 1EG4A 4ORCB 1KFUS 1IJ5A 1B8CA 2WOSA 1KSOA 3I5GB 1EG3A 5I2LA 4CFRA 2BCBA 2ZKMX 1C7WA 1CTRA 1W7JB 2JC2A 1KFXS 1Y6WA 1S1EA 1YRUB 4N1FA 1CLBA 2BBMA 5IBWA 2AUCA 1XFUO 1S36A 1J7PA 1W7IB 3EK4A 2GGMA 3FWCA 2LAPA 2WC8A 1M45A 2JULA 3SIBA 1ZOTB 1F71A 1DJWA 2GGZA 3SIAA 4AQJA 1KSMA 1MUXA 2DOQA 1QLSA 2PALA 1DJHA 1KFXL 4QJ5B 1UURA 1YX8A 2KYCA 4PHJA 1LA3A 1QVIZ 3NSOA 1SY9A 3TDUA 3EVRA 1PALA 5HKZA 2B1UA 1WY9A 1NCZA 4C0JA 3DF0B 1YVHA 4YGCB 1SYMA 1SRAA 5I2QA 2HPSA 1CDNA 4MZLA 2SASA 2TN4A 1K9KA 2M49B 1J7RA 2OTGC 1CLLA 3PN7C 2JRFA 3JTDB 4AQIA 1G8IA 1KK8C 3MSEB 4P2YB 1CMGA 4ORBB 1FW4A 2K61A 3HCMA 5CSFA 1L2OC 4PCWA 1KQMC 2LMTA 3LCPC 3DVEA 4GPLB 1N65A 1OMRA 4FTGA 3BYAA 2MBXA 1DGVA 1F55A 1LVCD 5K89A 4NDBA 2KGBC 4OCIA 3NSIA 2HETA 1UHNA 4GFTA 1SCMC 4PE1A 3NSLA 1K2HA 1DJZA 3RLZA 5DKNA 3BOWB 1DJGA 3OX5A 2I94A 1QTXA 3SG7A 2K2AA 3AKAA 5I8NA 3TUYB 1QJTA 2M97A 1GQMA 1RK9A 3FIAA 1EJ3A 2M1KB 3A4UB 3GK2A 5KSZA 1CKKA 2NZ0A 1YUSA 3H4SE 3OP0A 1ZMZA 1QV0A 1C07A 3PALA 1QX5B 4CIDA 5CSIA 5GQQC 1XFVO 1BJFA 1N2DA 2BECA 1CFDA 5HLOA 1TCFA 1XA5A 5AEQA 1SL9A 1ODBA 1SW8A 1UP5A 1UUSA 2LMVA 3WXAA 4BY5A 2M29A 3KEVA 3K21A 2JOJA 2NCPA 3KPXA 3CS1A 1IQ3A 2CXJA 2LVKA 2FCDA 2KQ6A 3IQQA 2WCFA 1XFXO 3VRRA 2I2RE 3PN7B 2PSRA 3FWBA 4DS7A 2LUXA 4HREE 4OVNF 2L5XB 1C7VA 2EGDA 2JT3A 3AAJA 1R6PA 1FF1A 1UWOA 1B7TY 1L2OB 2FJUB 4MZJA 3WHTB 1GJYA 4F0ZB 1KQMB 3F45A 3SG4A 1ALVA 1BF5A 2G2BA 3NSKA 3O6BA 2ISDA 2PMYA 3OB1B 4PE4A 1OZOA 1MXLC 3CR2A 3EKJA 1TTXA 3DF0A 2KHNA 3PSRA 1AVSA 1SPYA 1XFWO 2F3ZA 3AAKA 3IF7A 1CFCA 3GK1A 5J3XA 2ZRSA 1YVLA 4PHKA 2LLTA 1UHJA 1SCVA 1B8RA 1PK0D 1NX1A 2LLSA 5KU1A 3DVMA 1DJYA 3O78A 2JXLA 2IS9A 1UHIA 4YGBB 1GGZA 1PVBA 1WLZA 3BQ3A 4C0KA 1K96A 2OS8C 5ER4X 2I7AA 2MLFC 2K8MB 4MBEA 3VRNA 1XK4C 1AUIB 1RROA 1OQPA 1MHOA 1S3PA 2FOTA 2O5GA 4C0LA 1YURA 3WHUB 3TUYC 1KFUL 3TDIA 2ZN8A 3GOFA 1VRKA 1SK6D 4I5NB 1CDLA 1JSAA 1YRTB 1PSRA 2NLNA 3RM1A 2PVBA 4HRGA 1B47A 4GGFC 1A75B 5TNCA 1BODA 2LVIA 4USLA 1JFJA 1F4OA 2K7BA 1KWOC 2QACA 2F2PA 4N5XA 1CDPA 3BOWA 4A4CA 1KCYA 2KI6D 1F70A 1EH2A 1XYDA 1FPWA 1V1GA 1XO5A 2M1UA 1AJ4A 2KFGA 4WRIA 5CSJA 1CFPA 2MA2A 4I5LB 1B7TZ 1K8UA 2O60A 1NCXA 1K93D 3O4YA 3CZTX 3IQOA 2JT0A 5BPJA 5D69A 2Y4QA 1CM4A 2L4HA 1Y1XA 4MRYA 1QATA 2PASA 1QASA 5AXIA 1FI5A 1YR5A
chains in the Genus database with same CATH superfamily
3R1PA 1QXPA 1SR6B 2ZRTA 1HQVA 1H4BA 3CYZA 2KDHA 1HT9A 1CB1A 5JJGA 1IRJA 4GBAA 2KYFA 2WCEA 4JQ0D 2WCKA 3V2LA 4MRXA 4WQ3A 1DEKA 3EG5B 5CSNA 3GK4X 2LV7A 1BLQA 1OOGA 1K9PA 3BUNB 2A4JA 3S0BA 1C3YA 1F8HA 1NIWA 4QJ4B 4MLWA 5HKWA 3CZ2A 3VROA 1QIWA 1IH0A 1OZSA 1PULA 3NHIA 3O2PA 1CLMA 4JPZB 2KI4C 2OS8B 5D7FA 2M9GA 3EKHA 2M8UA 4YI9A 4PE7A 2E30A 4WQ2A 2F2OA 3DD4A 3DZTA 2BL0C 3D77A 1CFFA 2F8PA 1K90D 1WDCB 1S6CA 3C1VA 2QEHA 3SG6A 1DELA 2KAVA 3BUOB 4L9MA 1MWNA 2KSPA 1OMDA 1MXEA 3ZWHA 2Y1MA 1DC1A 3BFBA 3DXLA 1FI6A 2JZIA 1RFJA 1QX7A 1NSHA 3B86A 1IKUA 3SS5A 1DTLA 2AMIA 1BG1A 1P28A 1WRKA 2JPTA 4YGEB 1U5IA 1KWOB 2D8NA 2LE9B 4YBHB 4ICBA 3LLEA 5HKYA 2JNFA 1YUUA 4R1EA 2K7OA 5FI2A 4GNKB 3LK0A 3I5HC 3BUMB 1MF8B 1WRZA 2EHBA 2F3YA 2OPOA 1M39A 1S5GY 4DUQA 3L47A 4U8DA 1TUZA 5PALA 1AP4A 3DVKA 2L98A 3N7HA 3D0YB 3I5IC 5KTYA 1JWDA 4YGDB 1K9UA 4PDZA 4NDDA 4OKHA 3EVVA 1SSEB 4OV2A 2KBMA 5FI7A 2KQYA 2Q4UA 2M0RA 4N1GA 2SCPA 4MZKA 4PHNA 2HF5A 2P71A 3TZ1A 2LP2A 2WCBA 3ICBA 1A75A 5AANA 1JFKA 4P5OE 4ETOA 3OHMB 1IQ5A 4NQGA 1B8LA 4BY4A 5HL1A 4IJ7A 2V53A 4YI8A 1YTZC 3NXAA 2QEBA 1SR6C 1XFZO 2WNDA 4MN0A 3D10A 2L51A 3CABA 5ER5A 1SNLA 3PFVA 2LP3A 4YGAA 1D1OA 2PQLA 1J7QA 4MSPA 1QVIY 3DYEA 1KK7Y 1DJXA 4NDCA 1BOCA 1A4PA 1QIVA 1S26D 4GUKA 3KHEA 4MEWA 2VRGA 3I5FB 1JC2A 3E3RA 1ZACA 2KI4B 1TN4A 3SG2A 1A2XA 1E8AA 1EL4A 2RGIA 1N0YA 2HQWA 3QRXA 3PJIA 1AK8A 2BL0B 2WCJA 1L7ZA 4M2PA 2MAZA 3TS5B 1AHRA 3CZ1A 1MR8A 1RJVA 1WDCC 2COLB 2K0JA 2LC5A 4ZCUA 1DQEA 2MJWB 3SG3A 1K94A 5B8IB 2I18A 2KNEA 1OE9B 2BE6A 1BU3A 3B6XA 3B7AA 2PRUA 2ZFDA 3D76A 2LHLA 1DMOA 1S6IA 3FS7A 4DRWA 1S5GZ 1WLMA 2EC6C 4QJ3B 1LINA 1JUOA 1SBJA 2GV5A 1JF0A 5D3OA 3BUWB 3I5HB 1XK4A 2L0PA 1RTP1 3BUXB 4ZCVA 1TNXA 2L50A 2M7NA 2K7CA 3A8RA 1TNWA 1YUTA 4CFQA 4MVFA 1OOJA 3I5IB 1K95A 4E68A 4Q04A 2K7DA 3R1VA 3SG5A 2KFFA 1IJ6A 1A29A 3L4LA 1DVIA 4PT1A 2KPHA 2KGRA 4GGNA 1TRFA 1DF0B 4GGFA 1WRLA 4AOMA 4D1EA 3SJSA 2LMUA 1BT6A 2M7LA 3VB1A 2MRDA 3M0WA 5JOLA 4XJKB 2BE4A 3BXKA 4I5KA 1KK7Z 4M2QA 5AERA 2FCEA 1B4CA 1J1DA 2H61C 4TNCA 2ZN9A 2NCOA 1ALWA 1Y0VH 1KQVA 2H2KA 3CTNA 2KAXA 2G9BA 2BCXA 4CPVA 2L2EA 5AFPA 1NCYA 3D0YA 3CGAA 1DT7B 1MQ1A 1ORGA 2F33A 2LVVA 3PATA 5DKRA 1LS8A 1NPQA 2QEVA 3B87A 3EK8A 1IWQA 2KAYA 3I5FC 3JVTB 1TNQA 2KFHA 5HLVA 2JPOA 2BKIB 2AAOA 3VRQA 1XFYO 1NX3A 1J55A 2CT9A 3OB2B 1QS7A 2H61A 2QPTA 1OMVA 1RWYA 2Y5IA 1Y1AA 2HQ8A 2JTTA 3HX4A 3DVJA 2LVJA 2P70A 1B9AA 1ZFSA 2JQ6A 3TS5C 3KO0A 4DCKA 2E6WA 3CWGA 2LNKA 2ZNDA 2WC5A 1SMGA 1DGUA 4HSZA 2KI6C 3LK1A 1LKJA 1RECA 2KBIA 2JXCA 5DKQA 2JWWA 1F4QA 2EC6B 2Q91A 1M46A 1PSBA 3B88A 4DIRA 3O4XA 1DJIA 2BCAA 2JU0A 2KOTA 1NWDA 1V1FA 1Y1UA 3I5GC 3TDZA 1TCOB 2MHHA 1A03A 2CBLA 5F6TA 1G4YR 1JBAA 1LA0A 1Q80A 3VRPA 1S6JA 3D74A 1C3ZA 3LL8B 2YGUA 2BKHB 3CR4X 3IVTA 2LCPA 1IG5A 1XFRA 1SL7A 1OW4A 2M3WA 1LXFC 1TOPA 3EVUA 2WCMA 1PRWA 1ZUZA 4UPGA 1BR1B 1OSAA 2JTZA 4OR9B 4CLNA 2LUCA 2CNPA 2LHIA 4I5JA 1PVAA 1M63B 1X02A 1QX2A 1SL8A 2NXQA 1EXRA 4OZDA 2LLUA 3D78A 1CDMA 1JF2A 4INWA 5G08A 3PLFB 1TIZA 5EL2A 2Y1NA 5HYDA 1NYAA 1UHHA 1B1GA 1F54A 1CMFA 3NHTA 2JT8A 1NX0A 4YRUA 2FJYA 1NUBA 4JWQA 4M2OA 4A4BA 4HRHA 2JNXA 1R2UA 1AJ5A 4PHMA 4PE0A 2LM5A 2OTGB 1J1EA 2P6BB 1CNPA 1QV1A 5I2OA 1H8BA 1NP8A 2K2FA 1KK8B 4ORAB 5CPVA 1NX2A 3WNXB 4FQTA 2MLEC 1DF0A 2CCMA 1M31A 2LANA 2WORA 3JVTC 1J7OA 3JTDC 4PALA 1BR4B 3UNWA 1YX7A 1IGVA 4XJKA 4XYNA 1FBVA 5FYXA 1G33A 4IL1A 2BBNA 3ZNIA 1SKTA 3CLNA 3PM8A 2R2IA 2CTNA 1GGWA 2L4IA 4KYNA 1TNPA 4GAOA 1XVJA 1UHKA 1CM1A 3CR5X 4FQOA 3AKBA 1SCMB 3OX6A 3VGOA 1BMOA 1QLKA 3KF9A 1U5IB 3EK7A 2ZNEA 3Q8IA 1EG4A 4ORCB 1KFUS 1IJ5A 1B8CA 2WOSA 1KSOA 3I5GB 1EG3A 3FE8A 5I2LA 4CFRA 2BCBA 2ZKMX 1C7WA 2KLEA 1CTRA 3RZSA 1W7JB 2JC2A 1KFXS 1Y6WA 1QWVA 1S1EA 1YRUB 4N1FA 1CLBA 2BBMA 5IBWA 2AUCA 1W9ZA 1XFUO 1S36A 1J7PA 1W7IB 2WC6A 2GGMA 3EK4A 2LAPA 2WC8A 1M45A 2JULA 2QDIA 3FWCA 5DICA 1ZOTB 1F71A 1DJWA 2GGZA 3DY9A 3SIAA 4F7FA 4AQJA 1KSMA 1MUXA 2DOQA 1QLSA 2PALA 1DJHA 1KFXL 1Z2CB 1OOHA 3BFHA 4QJ5B 1UURA 1YX8A 2KYCA 2L2CA 3FE6A 1Z4HA 4PHJA 1LA3A 1QVIZ 3NSOA 1SY9A 3TDUA 3EVRA 1PALA 5HKZA 2B1UA 1WY9A 1NCZA 3NGVA 4C0JA 3DF0B 1YVHA 4YGCB 3S0AA 1SYMA 3BJHA 4INXA 1SRAA 1TUJA 5I2QA 2HPSA 1CDNA 4MZLA 2SASA 1OOFA 2TN4A 1K9KA 2M49B 1T14A 1J7RA 2OTGC 1CLLA 3PN7C 2JRFA 3JTDB 4AQIA 1G8IA 1KK8C 3MSEB 4P2YB 1CMGA 4ORBB 1FW4A 2K61A 3HCMA 5CSFA 1L2OC 4PCWA 3S0DA 1KQMC 2LMTA 3R1OA 3LCPC 3DVEA 4GPLB 1N65A 1OMRA 4FTGA 3BYAA 2MBXA 1DGVA 1F55A 1LVCD 5K89A 4NDBA 2KGBC 4OCIA 3NSIA 3CZ0A 4JKTA 2HETA 1OOIX 1UHNA 4GFTA 1SCMC 4PE1A 3NSLA 1K2HA 1DJZA 3RLZA 3FE9A 5DKNA 3UO9A 3BOWB 1DJGA 3OX5A 2I94A 1QTXA 3SG7A 2K2AA 3AKAA 5I8NA 3TUYB 1QJTA 2M97A 3D73A 1GQMA 1RK9A 2WCHA 3FIAA 1EJ3A 2M1KB 3A4UB 3GK2A 5KSZA 1CKKA 1TWOA 2NZ0A 1YUSA 2KLDA 3H4SE 1ZMZA 1QV0A 3OGNA 3OP0A 3PALA 1C07A 1QX5B 4CIDA 5CSIA 5GQQC 1XFVO 1BJFA 1N2DA 2BECA 4JD9A 2WCLA 1CFDA 5HLOA 1TCFA 1XA5A 5AEQA 1SL9A 1ODBA 1SW8A 1UP5A 1UUSA 2LMVA 3WXAA 4BY5A 3CDNA 2M29A 3KEVA 3K21A 2JOJA 2NCPA 3KPXA 3CS1A 1IQ3A 2CXJA 2LVKA 3SIBA 3SS3A 2FCDA 2KQ6A 3IQQA 2WCFA 1XFXO 3VRRA 2I2RE 3PN7B 5I94A 2PSRA 3FWBA 4DS7A 2LUXA 4HREE 4OVNF 2L5XB 1C7VA 2EGDA 2JT3A 3AAJA 3S0FA 1R6PA 1FF1A 1UWOA 1B7TY 1L2OB 2FJUB 4MZJA 3PM2A 3WHTB 1GJYA 4F0ZB 1KQMB 3F45A 3SG4A 1ALVA 1BF5A 2G2BA 3NSKA 3O6BA 3K1EA 2ISDA 1IIOA 2PMYA 3OB1B 2BAPA 4PE4A 1OZOA 1MXLC 3CR2A 3EKJA 1TTXA 3DF0A 2KHNA 3PSRA 2BNXA 1AVSA 1SPYA 1XFWO 2F3ZA 3AAKA 3IF7A 2ERBA 1CFCA 3GK1A 5J3XA 2ZRSA 1YVLA 4PHKA 2LLTA 1UHJA 1SCVA 3S0EA 1B8RA 1PK0D 1NX1A 2LLSA 5KU1A 2K60A 3DVMA 1DJYA 3O78A 2PYQA 2JXLA 2IS9A 1UHIA 4YGBB 1GGZA 1PVBA 1WLZA 3BQ3A 4C0KA 1K96A 2OS8C 5ER4X 2I7AA 2MLFC 2K8MB 4MBEA 3VRNA 1XK4C 1AUIB 3BFAA 1RROA 1OQPA 1MHOA 1S3PA 2FOTA 2O5GA 4C0LA 1YURA 3WHUB 3TUYC 3QMEA 1KFUL 2GTEA 1GM0A 3TDIA 2ZN8A 3GOFA 3L4AA 1VRKA 1SK6D 4I5NB 1CDLA 1JSAA 1YRTB 1PSRA 2NLNA 3RM1A 2PVBA 4HRGA 1B47A 4GGFC 3R72A 1A75B 5FI6A 5TNCA 1BODA 2LVIA 4USLA 1JFJA 1F4OA 2K7BA 1KWOC 2QACA 2F2PA 4N5XA 1CDPA 3BOWA 4A4CA 1KCYA 2KI6D 1F70A 1EH2A 1XYDA 1FPWA 1V1GA 1XO5A 2M1UA 1AJ4A 2KFGA 4WRIA 5CSJA 1CFPA 2MA2A 4I5LB 1B7TZ 1K8UA 2O60A 1NCXA 1K93D 2H8VA 2QEOA 3O4YA 3CZTX 3IQOA 2JT0A 3SS4A 3OBVA 5D69A 5BPJA 2Y4QA 1CM4A 2L4HA 2L5YA 1Y1XA 3D75A 3S0GA 4MRYA 1QATA 2PASA 1QASA 5AXIA 1FI5A 1YR5A
chains in the Genus database with same CATH topology
1QXPA 1SR6B 2ZRTA 1HQVA 1H4BA 2KDHA 1HT9A 1CB1A 5JJGA 1IRJA 4GBAA 2KYFA 2WCEA 4JQ0D 4MRXA 4WQ3A 5CSNA 3GK4X 2LV7A 1BLQA 1K9PA 3BUNB 2A4JA 1F8HA 1NIWA 4QJ4B 4MLWA 5HKWA 3VROA 1QIWA 1IH0A 1OZSA 1PULA 3O2PA 1CLMA 4JPZB 2KI4C 2OS8B 5D7FA 2M9GA 3EKHA 2M8UA 4YI9A 4PE7A 2E30A 4WQ2A 2F2OA 3DD4A 2BL0C 1CFFA 2F8PA 1K90D 1WDCB 1S6CA 3C1VA 3SG6A 2KAVA 3BUOB 4L9MA 1MWNA 2KSPA 1OMDA 1MXEA 3ZWHA 2Y1MA 1FI6A 2JZIA 1RFJA 1QX7A 1NSHA 1IKUA 1DTLA 2AMIA 1BG1A 1WRKA 2JPTA 4YGEB 1U5IA 1KWOB 2D8NA 2LE9B 4YBHB 4ICBA 3LLEA 5HKYA 2JNFA 1YUUA 4R1EA 2K7OA 4GNKB 3LK0A 3I5HC 3BUMB 1MF8B 1WRZA 2EHBA 2F3YA 2OPOA 1M39A 1S5GY 4DUQA 4U8DA 5PALA 1AP4A 3DVKA 2L98A 3D0YB 3I5IC 5KTYA 1JWDA 4YGDB 1K9UA 4PDZA 4NDDA 4OKHA 3EVVA 4OV2A 2KBMA 2KQYA 2Q4UA 2M0RA 4N1GA 2SCPA 4MZKA 4PHNA 2HF5A 3TZ1A 2LP2A 2WCBA 3ICBA 1A75A 5AANA 1JFKA 4P5OE 4ETOA 3OHMB 1IQ5A 4NQGA 1B8LA 4BY4A 4YI8A 2V53A 1YTZC 3NXAA 1SR6C 1XFZO 2WNDA 4MN0A 3D10A 2L51A 5ER5A 1SNLA 3PFVA 2LP3A 4YGAA 1D1OA 1J7QA 4MSPA 1QVIY 1KK7Y 1DJXA 4NDCA 1BOCA 1A4PA 1QIVA 1S26D 4GUKA 3KHEA 4MEWA 2VRGA 3I5FB 1JC2A 3E3RA 1ZACA 2KI4B 1TN4A 3SG2A 1A2XA 1E8AA 1EL4A 2RGIA 1N0YA 2HQWA 3QRXA 1AK8A 2BL0B 1L7ZA 4M2PA 2MAZA 3TS5B 1AHRA 1MR8A 1RJVA 1WDCC 2COLB 2K0JA 2LC5A 4ZCUA 2MJWB 3SG3A 1K94A 5B8IB 2I18A 2KNEA 1OE9B 2BE6A 1BU3A 2PRUA 2ZFDA 2LHLA 1DMOA 1S6IA 3FS7A 4DRWA 1S5GZ 1WLMA 2EC6C 4QJ3B 1LINA 1JUOA 1SBJA 2GV5A 1JF0A 3BUWB 3I5HB 1XK4A 2L0PA 1RTP1 3BUXB 4ZCVA 1TNXA 2L50A 2M7NA 2K7CA 3A8RA 1TNWA 1YUTA 4CFQA 4MVFA 1OOJA 3I5IB 1K95A 4E68A 4Q04A 2K7DA 3SG5A 2KFFA 1IJ6A 1A29A 1DVIA 2KGRA 4GGNA 1TRFA 1DF0B 4GGFA 1WRLA 4AOMA 4D1EA 3SJSA 2LMUA 1BT6A 2M7LA 2MRDA 3M0WA 5JOLA 4XJKB 2BE4A 3BXKA 4I5KA 1KK7Z 4M2QA 5AERA 2FCEA 1B4CA 1J1DA 2H61C 4TNCA 2ZN9A 2NCOA 1ALWA 1Y0VH 1KQVA 2H2KA 3CTNA 2KAXA 2G9BA 2BCXA 4CPVA 2L2EA 5AFPA 1NCYA 3D0YA 3CGAA 1DT7B 1MQ1A 2F33A 2LVVA 3PATA 5DKRA 1NPQA 3EK8A 1IWQA 2KAYA 3I5FC 3JVTB 1TNQA 2KFHA 5HLVA 2BKIB 2AAOA 3VRQA 1XFYO 1NX3A 1J55A 2CT9A 3OB2B 1QS7A 2H61A 2QPTA 1OMVA 1RWYA 2Y5IA 1Y1AA 2HQ8A 2JTTA 3HX4A 3DVJA 2LVJA 1B9AA 1ZFSA 2JQ6A 3TS5C 3KO0A 4DCKA 2E6WA 3CWGA 2LNKA 2ZNDA 1SMGA 1DGUA 4HSZA 2KI6C 3LK1A 1LKJA 1RECA 2KBIA 2JXCA 5DKQA 2JWWA 1F4QA 2EC6B 2Q91A 1M46A 1PSBA 4DIRA 1DJIA 2BCAA 2JU0A 2KOTA 1NWDA 1V1FA 1Y1UA 3I5GC 3TDZA 1TCOB 2MHHA 1A03A 2CBLA 5F6TA 1G4YR 1JBAA 1LA0A 1Q80A 3VRPA 1S6JA 3LL8B 2BKHB 3CR4X 2LCPA 1IG5A 1SL7A 2M3WA 1LXFC 1TOPA 3EVUA 1PRWA 1ZUZA 4UPGA 1BR1B 1OSAA 2JTZA 4OR9B 4CLNA 2LUCA 2CNPA 2LHIA 4I5JA 1PVAA 1M63B 1X02A 1QX2A 1SL8A 2NXQA 1EXRA 2LLUA 1CDMA 1JF2A 5G08A 3PLFB 1TIZA 2Y1NA 5HYDA 1NYAA 1UHHA 1B1GA 1F54A 1CMFA 2JT8A 1NX0A 4YRUA 4JWQA 1NUBA 4M2OA 4A4BA 4HRHA 2JNXA 1R2UA 1AJ5A 4PHMA 4PE0A 2LM5A 2OTGB 1J1EA 2P6BB 1CNPA 1QV1A 5I2OA 1H8BA 1NP8A 2K2FA 1KK8B 4ORAB 5CPVA 1NX2A 3WNXB 2MLEC 1DF0A 2CCMA 1M31A 2LANA 2WORA 3JVTC 1J7OA 3JTDC 4PALA 1BR4B 1YX7A 1IGVA 4XJKA 4XYNA 1FBVA 5FYXA 1G33A 4IL1A 2BBNA 3ZNIA 1SKTA 3CLNA 3PM8A 2R2IA 2CTNA 1GGWA 2L4IA 1TNPA 4GAOA 1XVJA 1UHKA 1CM1A 3CR5X 4FQOA 3AKBA 1SCMB 3OX6A 3VGOA 1BMOA 1QLKA 3KF9A 1U5IB 3EK7A 2ZNEA 1EG4A 4ORCB 1KFUS 1IJ5A 1B8CA 2WOSA 1KSOA 3I5GB 1EG3A 5I2LA 4CFRA 2BCBA 2ZKMX 1C7WA 1CTRA 1W7JB 2JC2A 1KFXS 1Y6WA 1S1EA 1YRUB 4N1FA 1CLBA 2BBMA 5IBWA 2AUCA 1XFUO 1S36A 1J7PA 1W7IB 3EK4A 2GGMA 3FWCA 2LAPA 2WC8A 1M45A 2JULA 3SIBA 1ZOTB 1F71A 1DJWA 2GGZA 3SIAA 4AQJA 1KSMA 1MUXA 2DOQA 1QLSA 2PALA 1DJHA 1KFXL 4QJ5B 1UURA 1YX8A 2KYCA 4PHJA 1LA3A 1QVIZ 3NSOA 1SY9A 3TDUA 3EVRA 1PALA 5HKZA 2B1UA 1WY9A 1NCZA 4C0JA 3DF0B 1YVHA 4YGCB 1SYMA 1SRAA 5I2QA 2HPSA 1CDNA 4MZLA 2SASA 2TN4A 1K9KA 2M49B 1J7RA 2OTGC 1CLLA 3PN7C 2JRFA 3JTDB 4AQIA 1G8IA 1KK8C 3MSEB 4P2YB 1CMGA 4ORBB 1FW4A 2K61A 3HCMA 5CSFA 1L2OC 4PCWA 1KQMC 2LMTA 3LCPC 3DVEA 4GPLB 1N65A 1OMRA 4FTGA 3BYAA 2MBXA 1DGVA 1F55A 1LVCD 5K89A 4NDBA 2KGBC 4OCIA 3NSIA 2HETA 1UHNA 4GFTA 1SCMC 4PE1A 3NSLA 1K2HA 1DJZA 3RLZA 5DKNA 3BOWB 1DJGA 3OX5A 2I94A 1QTXA 3SG7A 2K2AA 3AKAA 5I8NA 3TUYB 1QJTA 2M97A 1GQMA 1RK9A 3FIAA 1EJ3A 2M1KB 3A4UB 3GK2A 5KSZA 1CKKA 2NZ0A 1YUSA 3H4SE 3OP0A 1ZMZA 1QV0A 1C07A 3PALA 1QX5B 4CIDA 5CSIA 5GQQC 1XFVO 1BJFA 1N2DA 2BECA 1CFDA 5HLOA 1TCFA 1XA5A 5AEQA 1SL9A 1ODBA 1SW8A 1UP5A 1UUSA 2LMVA 3WXAA 4BY5A 2M29A 3KEVA 3K21A 2JOJA 2NCPA 3KPXA 3CS1A 1IQ3A 2CXJA 2LVKA 2FCDA 2KQ6A 3IQQA 2WCFA 1XFXO 3VRRA 2I2RE 3PN7B 2PSRA 3FWBA 4DS7A 2LUXA 4HREE 4OVNF 2L5XB 1C7VA 2EGDA 2JT3A 3AAJA 1R6PA 1FF1A 1UWOA 1B7TY 1L2OB 2FJUB 4MZJA 3WHTB 1GJYA 4F0ZB 1KQMB 3F45A 3SG4A 1ALVA 1BF5A 2G2BA 3NSKA 3O6BA 2ISDA 2PMYA 3OB1B 4PE4A 1OZOA 1MXLC 3CR2A 3EKJA 1TTXA 3DF0A 2KHNA 3PSRA 1AVSA 1SPYA 1XFWO 2F3ZA 3AAKA 3IF7A 1CFCA 3GK1A 5J3XA 2ZRSA 1YVLA 4PHKA 2LLTA 1UHJA 1SCVA 1B8RA 1PK0D 1NX1A 2LLSA 5KU1A 3DVMA 1DJYA 3O78A 2JXLA 2IS9A 1UHIA 4YGBB 1GGZA 1PVBA 1WLZA 3BQ3A 4C0KA 1K96A 2OS8C 5ER4X 2I7AA 2MLFC 2K8MB 4MBEA 3VRNA 1XK4C 1AUIB 1RROA 1OQPA 1MHOA 1S3PA 2FOTA 2O5GA 4C0LA 1YURA 3WHUB 3TUYC 1KFUL 3TDIA 2ZN8A 3GOFA 1VRKA 1SK6D 4I5NB 1CDLA 1JSAA 1YRTB 1PSRA 2NLNA 3RM1A 2PVBA 4HRGA 1B47A 4GGFC 1A75B 5TNCA 1BODA 2LVIA 4USLA 1JFJA 1F4OA 2K7BA 1KWOC 2QACA 2F2PA 4N5XA 1CDPA 3BOWA 4A4CA 1KCYA 2KI6D 1F70A 1EH2A 1XYDA 1FPWA 1V1GA 1XO5A 2M1UA 1AJ4A 2KFGA 4WRIA 5CSJA 1CFPA 2MA2A 4I5LB 1B7TZ 1K8UA 2O60A 1NCXA 1K93D 3O4YA 3CZTX 3IQOA 2JT0A 5BPJA 5D69A 2Y4QA 1CM4A 2L4HA 1Y1XA 4MRYA 1QATA 2PASA 1QASA 5AXIA 1FI5A 1YR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXP A;  1SR6 B;  2ZRT A;  1HQV A;  1H4B A;  2KDH A;  1HT9 A;  1CB1 A;  5JJG A;  1IRJ A;  4GBA A;  2KYF A;  2WCE A;  4JQ0 D;  4MRX A;  4WQ3 A;  5CSN A;  3GK4 X;  2LV7 A;  1BLQ A;  1K9P A;  3BUN B;  2A4J A;  1F8H A;  1NIW A;  4QJ4 B;  4MLW A;  5HKW A;  3VRO A;  1QIW A;  1IH0 A;  1OZS A;  1PUL A;  3O2P A;  1CLM A;  4JPZ B;  2KI4 C;  2OS8 B;  5D7F A;  2M9G A;  3EKH A;  2M8U A;  4YI9 A;  4PE7 A;  2E30 A;  4WQ2 A;  2F2O A;  3DD4 A;  2BL0 C;  1CFF A;  2F8P A;  1K90 D;  1WDC B;  1S6C A;  3C1V A;  3SG6 A;  2KAV A;  3BUO B;  4L9M A;  1MWN A;  2KSP A;  1OMD A;  1MXE A;  3ZWH A;  2Y1M A;  1FI6 A;  2JZI A;  1RFJ A;  1QX7 A;  1NSH A;  1IKU A;  1DTL A;  2AMI A;  1BG1 A;  1WRK A;  2JPT A;  4YGE B;  1U5I A;  1KWO B;  2D8N A;  2LE9 B;  4YBH B;  4ICB A;  3LLE A;  5HKY A;  2JNF A;  1YUU A;  4R1E A;  2K7O A;  4GNK B;  3LK0 A;  3I5H C;  3BUM B;  1MF8 B;  1WRZ A;  2EHB A;  2F3Y A;  2OPO A;  1M39 A;  1S5G Y;  4DUQ A;  4U8D A;  5PAL A;  1AP4 A;  3DVK A;  2L98 A;  3D0Y B;  3I5I C;  5KTY A;  1JWD A;  4YGD B;  1K9U A;  4PDZ A;  4NDD A;  4OKH A;  3EVV A;  4OV2 A;  2KBM A;  2KQY A;  2Q4U A;  2M0R A;  4N1G A;  2SCP A;  4MZK A;  4PHN A;  2HF5 A;  3TZ1 A;  2LP2 A;  2WCB A;  3ICB A;  1A75 A;  5AAN A;  1JFK A;  4P5O E;  4ETO A;  3OHM B;  1IQ5 A;  4NQG A;  1B8L A;  4BY4 A;  4YI8 A;  2V53 A;  1YTZ C;  3NXA A;  1SR6 C;  1XFZ O;  2WND A;  4MN0 A;  3D10 A;  2L51 A;  5ER5 A;  1SNL A;  3PFV A;  2LP3 A;  4YGA A;  1D1O A;  1J7Q A;  4MSP A;  1QVI Y;  1KK7 Y;  1DJX A;  4NDC A;  1BOC A;  1A4P A;  1QIV A;  1S26 D;  4GUK A;  3KHE A;  4MEW A;  2VRG A;  3I5F B;  1JC2 A;  3E3R A;  1ZAC A;  2KI4 B;  1TN4 A;  3SG2 A;  1A2X A;  1E8A A;  1EL4 A;  2RGI A;  1N0Y A;  2HQW A;  3QRX A;  1AK8 A;  2BL0 B;  1L7Z A;  4M2P A;  2MAZ A;  3TS5 B;  1AHR A;  1MR8 A;  1RJV A;  1WDC C;  2COL B;  2K0J A;  2LC5 A;  4ZCU A;  2MJW B;  3SG3 A;  1K94 A;  5B8I B;  2I18 A;  2KNE A;  1OE9 B;  2BE6 A;  1BU3 A;  2PRU A;  2ZFD A;  2LHL A;  1DMO A;  1S6I A;  3FS7 A;  4DRW A;  1S5G Z;  1WLM A;  2EC6 C;  4QJ3 B;  1LIN A;  1JUO A;  1SBJ A;  2GV5 A;  1JF0 A;  3BUW B;  3I5H B;  1XK4 A;  2L0P A;  1RTP 1;  3BUX B;  4ZCV A;  1TNX A;  2L50 A;  2M7N A;  2K7C A;  3A8R A;  1TNW A;  1YUT A;  4CFQ A;  4MVF A;  1OOJ A;  3I5I B;  1K95 A;  4E68 A;  4Q04 A;  2K7D A;  3SG5 A;  2KFF A;  1IJ6 A;  1A29 A;  1DVI A;  2KGR A;  4GGN A;  1TRF A;  1DF0 B;  4GGF A;  1WRL A;  4AOM A;  4D1E A;  3SJS A;  2LMU A;  1BT6 A;  2M7L A;  2MRD A;  3M0W A;  5JOL A;  4XJK B;  2BE4 A;  3BXK A;  4I5K A;  1KK7 Z;  4M2Q A;  5AER A;  2FCE A;  1B4C A;  1J1D A;  2H61 C;  4TNC A;  2ZN9 A;  2NCO A;  1ALW A;  1Y0V H;  1KQV A;  2H2K A;  3CTN A;  2KAX A;  2G9B A;  2BCX A;  4CPV A;  2L2E A;  5AFP A;  1NCY A;  3D0Y A;  3CGA A;  1DT7 B;  1MQ1 A;  2F33 A;  2LVV A;  3PAT A;  5DKR A;  1NPQ A;  3EK8 A;  1IWQ A;  2KAY A;  3I5F C;  3JVT B;  1TNQ A;  2KFH A;  5HLV A;  2BKI B;  2AAO A;  3VRQ A;  1XFY O;  1NX3 A;  1J55 A;  2CT9 A;  3OB2 B;  1QS7 A;  2H61 A;  2QPT A;  1OMV A;  1RWY A;  2Y5I A;  1Y1A A;  2HQ8 A;  2JTT A;  3HX4 A;  3DVJ A;  2LVJ A;  1B9A A;  1ZFS A;  2JQ6 A;  3TS5 C;  3KO0 A;  4DCK A;  2E6W A;  3CWG A;  2LNK A;  2ZND A;  1SMG A;  1DGU A;  4HSZ A;  2KI6 C;  3LK1 A;  1LKJ A;  1REC A;  2KBI A;  2JXC A;  5DKQ A;  2JWW A;  1F4Q A;  2EC6 B;  2Q91 A;  1M46 A;  1PSB A;  4DIR A;  1DJI A;  2BCA A;  2JU0 A;  2KOT A;  1NWD A;  1V1F A;  1Y1U A;  3I5G C;  3TDZ A;  1TCO B;  2MHH A;  1A03 A;  2CBL A;  5F6T A;  1G4Y R;  1JBA A;  1LA0 A;  1Q80 A;  3VRP A;  1S6J A;  3LL8 B;  2BKH B;  3CR4 X;  2LCP A;  1IG5 A;  1SL7 A;  2M3W A;  1LXF C;  1TOP A;  3EVU A;  1PRW A;  1ZUZ A;  4UPG A;  1BR1 B;  1OSA A;  2JTZ A;  4OR9 B;  4CLN A;  2LUC A;  2CNP A;  2LHI A;  4I5J A;  1PVA A;  1M63 B;  1X02 A;  1QX2 A;  1SL8 A;  2NXQ A;  1EXR A;  2LLU A;  1CDM A;  1JF2 A;  5G08 A;  3PLF B;  1TIZ A;  2Y1N A;  5HYD A;  1NYA A;  1UHH A;  1B1G A;  1F54 A;  1CMF A;  2JT8 A;  1NX0 A;  4YRU A;  4JWQ A;  1NUB A;  4M2O A;  4A4B A;  4HRH A;  2JNX A;  1R2U A;  1AJ5 A;  4PHM A;  4PE0 A;  2LM5 A;  2OTG B;  1J1E A;  2P6B B;  1CNP A;  1QV1 A;  5I2O A;  1H8B A;  1NP8 A;  2K2F A;  1KK8 B;  4ORA B;  5CPV A;  1NX2 A;  3WNX B;  2MLE C;  1DF0 A;  2CCM A;  1M31 A;  2LAN A;  2WOR A;  3JVT C;  1J7O A;  3JTD C;  4PAL A;  1BR4 B;  1YX7 A;  1IGV A;  4XJK A;  4XYN A;  1FBV A;  5FYX A;  1G33 A;  4IL1 A;  2BBN A;  3ZNI A;  1SKT A;  3CLN A;  3PM8 A;  2R2I A;  2CTN A;  1GGW A;  2L4I A;  1TNP A;  4GAO A;  1XVJ A;  1UHK A;  1CM1 A;  3CR5 X;  4FQO A;  3AKB A;  1SCM B;  3OX6 A;  3VGO A;  1BMO A;  1QLK A;  3KF9 A;  1U5I B;  3EK7 A;  2ZNE A;  1EG4 A;  4ORC B;  1KFU S;  1IJ5 A;  1B8C A;  2WOS A;  1KSO A;  3I5G B;  1EG3 A;  5I2L A;  4CFR A;  2BCB A;  2ZKM X;  1C7W A;  1CTR A;  1W7J B;  2JC2 A;  1KFX S;  1Y6W A;  1S1E A;  1YRU B;  4N1F A;  1CLB A;  2BBM A;  5IBW A;  2AUC A;  1XFU O;  1S36 A;  1J7P A;  1W7I B;  3EK4 A;  2GGM A;  3FWC A;  2LAP A;  2WC8 A;  1M45 A;  2JUL A;  3SIB A;  1ZOT B;  1F71 A;  1DJW A;  2GGZ A;  3SIA A;  4AQJ A;  1KSM A;  1MUX A;  2DOQ A;  1QLS A;  2PAL A;  1DJH A;  1KFX L;  4QJ5 B;  1UUR A;  1YX8 A;  2KYC A;  4PHJ A;  1LA3 A;  1QVI Z;  3NSO A;  1SY9 A;  3TDU A;  3EVR A;  1PAL A;  5HKZ A;  2B1U A;  1WY9 A;  1NCZ A;  4C0J A;  3DF0 B;  1YVH A;  4YGC B;  1SYM A;  1SRA A;  5I2Q A;  2HPS A;  1CDN A;  4MZL A;  2SAS A;  2TN4 A;  1K9K A;  2M49 B;  1J7R A;  2OTG C;  1CLL A;  3PN7 C;  2JRF A;  3JTD B;  4AQI A;  1G8I A;  1KK8 C;  3MSE B;  4P2Y B;  1CMG A;  4ORB B;  1FW4 A;  2K61 A;  3HCM A;  5CSF A;  1L2O C;  4PCW A;  1KQM C;  2LMT A;  3LCP C;  3DVE A;  4GPL B;  1N65 A;  1OMR A;  4FTG A;  3BYA A;  2MBX A;  1DGV A;  1F55 A;  1LVC D;  5K89 A;  4NDB A;  2KGB C;  4OCI A;  3NSI A;  2HET A;  1UHN A;  4GFT A;  1SCM C;  4PE1 A;  3NSL A;  1K2H A;  1DJZ A;  3RLZ A;  5DKN A;  3BOW B;  1DJG A;  3OX5 A;  2I94 A;  1QTX A;  3SG7 A;  2K2A A;  3AKA A;  5I8N A;  3TUY B;  1QJT A;  2M97 A;  1GQM A;  1RK9 A;  3FIA A;  1EJ3 A;  2M1K B;  3A4U B;  3GK2 A;  5KSZ A;  1CKK A;  2NZ0 A;  1YUS A;  3H4S E;  3OP0 A;  1ZMZ A;  1QV0 A;  1C07 A;  3PAL A;  1QX5 B;  4CID A;  5CSI A;  5GQQ C;  1XFV O;  1BJF A;  1N2D A;  2BEC A;  1CFD A;  5HLO A;  1TCF A;  1XA5 A;  5AEQ A;  1SL9 A;  1ODB A;  1SW8 A;  1UP5 A;  1UUS A;  2LMV A;  3WXA A;  4BY5 A;  2M29 A;  3KEV A;  3K21 A;  2JOJ A;  2NCP A;  3KPX A;  3CS1 A;  1IQ3 A;  2CXJ A;  2LVK A;  2FCD A;  2KQ6 A;  3IQQ A;  2WCF A;  1XFX O;  3VRR A;  2I2R E;  3PN7 B;  2PSR A;  3FWB A;  4DS7 A;  2LUX A;  4HRE E;  4OVN F;  2L5X B;  1C7V A;  2EGD A;  2JT3 A;  3AAJ A;  1R6P A;  1FF1 A;  1UWO A;  1B7T Y;  1L2O B;  2FJU B;  4MZJ A;  3WHT B;  1GJY A;  4F0Z B;  1KQM B;  3F45 A;  3SG4 A;  1ALV A;  1BF5 A;  2G2B A;  3NSK A;  3O6B A;  2ISD A;  2PMY A;  3OB1 B;  4PE4 A;  1OZO A;  1MXL C;  3CR2 A;  3EKJ A;  1TTX A;  3DF0 A;  2KHN A;  3PSR A;  1AVS A;  1SPY A;  1XFW O;  2F3Z A;  3AAK A;  3IF7 A;  1CFC A;  3GK1 A;  5J3X A;  2ZRS A;  1YVL A;  4PHK A;  2LLT A;  1UHJ A;  1SCV A;  1B8R A;  1PK0 D;  1NX1 A;  2LLS A;  5KU1 A;  3DVM A;  1DJY A;  3O78 A;  2JXL A;  2IS9 A;  1UHI A;  4YGB B;  1GGZ A;  1PVB A;  1WLZ A;  3BQ3 A;  4C0K A;  1K96 A;  2OS8 C;  5ER4 X;  2I7A A;  2MLF C;  2K8M B;  4MBE A;  3VRN A;  1XK4 C;  1AUI B;  1RRO A;  1OQP A;  1MHO A;  1S3P A;  2FOT A;  2O5G A;  4C0L A;  1YUR A;  3WHU B;  3TUY C;  1KFU L;  3TDI A;  2ZN8 A;  3GOF A;  1VRK A;  1SK6 D;  4I5N B;  1CDL A;  1JSA A;  1YRT B;  1PSR A;  2NLN A;  3RM1 A;  2PVB A;  4HRG A;  1B47 A;  4GGF C;  1A75 B;  5TNC A;  1BOD A;  2LVI A;  4USL A;  1JFJ A;  1F4O A;  2K7B A;  1KWO C;  2QAC A;  2F2P A;  4N5X A;  1CDP A;  3BOW A;  4A4C A;  1KCY A;  2KI6 D;  1F70 A;  1EH2 A;  1XYD A;  1FPW A;  1V1G A;  1XO5 A;  2M1U A;  1AJ4 A;  2KFG A;  4WRI A;  5CSJ A;  1CFP A;  2MA2 A;  4I5L B;  1B7T Z;  1K8U A;  2O60 A;  1NCX A;  1K93 D;  3O4Y A;  3CZT X;  3IQO A;  2JT0 A;  5BPJ A;  5D69 A;  2Y4Q A;  1CM4 A;  2L4H A;  1Y1X A;  4MRY A;  1QAT A;  2PAS A;  1QAS A;  5AXI A;  1FI5 A;  1YR5 A; 
#chains in the Genus database with same CATH topology
 3R1P A;  1QXP A;  1SR6 B;  2ZRT A;  1HQV A;  1H4B A;  3CYZ A;  2KDH A;  1HT9 A;  1CB1 A;  5JJG A;  1IRJ A;  4GBA A;  2KYF A;  2WCE A;  4JQ0 D;  2WCK A;  3V2L A;  4MRX A;  4WQ3 A;  1DEK A;  3EG5 B;  5CSN A;  3GK4 X;  2LV7 A;  1BLQ A;  1OOG A;  1K9P A;  3BUN B;  2A4J A;  3S0B A;  1C3Y A;  1F8H A;  1NIW A;  4QJ4 B;  4MLW A;  5HKW A;  3CZ2 A;  3VRO A;  1QIW A;  1IH0 A;  1OZS A;  1PUL A;  3NHI A;  3O2P A;  1CLM A;  4JPZ B;  2KI4 C;  2OS8 B;  5D7F A;  2M9G A;  3EKH A;  2M8U A;  4YI9 A;  4PE7 A;  2E30 A;  4WQ2 A;  2F2O A;  3DD4 A;  3DZT A;  2BL0 C;  3D77 A;  1CFF A;  2F8P A;  1K90 D;  1WDC B;  1S6C A;  3C1V A;  2QEH A;  3SG6 A;  1DEL A;  2KAV A;  3BUO B;  4L9M A;  1MWN A;  2KSP A;  1OMD A;  1MXE A;  3ZWH A;  2Y1M A;  1DC1 A;  3BFB A;  3DXL A;  1FI6 A;  2JZI A;  1RFJ A;  1QX7 A;  1NSH A;  3B86 A;  1IKU A;  3SS5 A;  1DTL A;  2AMI A;  1BG1 A;  1P28 A;  1WRK A;  2JPT A;  4YGE B;  1U5I A;  1KWO B;  2D8N A;  2LE9 B;  4YBH B;  4ICB A;  3LLE A;  5HKY A;  2JNF A;  1YUU A;  4R1E A;  2K7O A;  5FI2 A;  4GNK B;  3LK0 A;  3I5H C;  3BUM B;  1MF8 B;  1WRZ A;  2EHB A;  2F3Y A;  2OPO A;  1M39 A;  1S5G Y;  4DUQ A;  3L47 A;  4U8D A;  1TUZ A;  5PAL A;  1AP4 A;  3DVK A;  2L98 A;  3N7H A;  3D0Y B;  3I5I C;  5KTY A;  1JWD A;  4YGD B;  1K9U A;  4PDZ A;  4NDD A;  4OKH A;  3EVV A;  1SSE B;  4OV2 A;  2KBM A;  5FI7 A;  2KQY A;  2Q4U A;  2M0R A;  4N1G A;  2SCP A;  4MZK A;  4PHN A;  2HF5 A;  2P71 A;  3TZ1 A;  2LP2 A;  2WCB A;  3ICB A;  1A75 A;  5AAN A;  1JFK A;  4P5O E;  4ETO A;  3OHM B;  1IQ5 A;  4NQG A;  1B8L A;  4BY4 A;  5HL1 A;  4IJ7 A;  2V53 A;  4YI8 A;  1YTZ C;  3NXA A;  2QEB A;  1SR6 C;  1XFZ O;  2WND A;  4MN0 A;  3D10 A;  2L51 A;  3CAB A;  5ER5 A;  1SNL A;  3PFV A;  2LP3 A;  4YGA A;  1D1O A;  2PQL A;  1J7Q A;  4MSP A;  1QVI Y;  3DYE A;  1KK7 Y;  1DJX A;  4NDC A;  1BOC A;  1A4P A;  1QIV A;  1S26 D;  4GUK A;  3KHE A;  4MEW A;  2VRG A;  3I5F B;  1JC2 A;  3E3R A;  1ZAC A;  2KI4 B;  1TN4 A;  3SG2 A;  1A2X A;  1E8A A;  1EL4 A;  2RGI A;  1N0Y A;  2HQW A;  3QRX A;  3PJI A;  1AK8 A;  2BL0 B;  2WCJ A;  1L7Z A;  4M2P A;  2MAZ A;  3TS5 B;  1AHR A;  3CZ1 A;  1MR8 A;  1RJV A;  1WDC C;  2COL B;  2K0J A;  2LC5 A;  4ZCU A;  1DQE A;  2MJW B;  3SG3 A;  1K94 A;  5B8I B;  2I18 A;  2KNE A;  1OE9 B;  2BE6 A;  1BU3 A;  3B6X A;  3B7A A;  2PRU A;  2ZFD A;  3D76 A;  2LHL A;  1DMO A;  1S6I A;  3FS7 A;  4DRW A;  1S5G Z;  1WLM A;  2EC6 C;  4QJ3 B;  1LIN A;  1JUO A;  1SBJ A;  2GV5 A;  1JF0 A;  5D3O A;  3BUW B;  3I5H B;  1XK4 A;  2L0P A;  1RTP 1;  3BUX B;  4ZCV A;  1TNX A;  2L50 A;  2M7N A;  2K7C A;  3A8R A;  1TNW A;  1YUT A;  4CFQ A;  4MVF A;  1OOJ A;  3I5I B;  1K95 A;  4E68 A;  4Q04 A;  2K7D A;  3R1V A;  3SG5 A;  2KFF A;  1IJ6 A;  1A29 A;  3L4L A;  1DVI A;  4PT1 A;  2KPH A;  2KGR A;  4GGN A;  1TRF A;  1DF0 B;  4GGF A;  1WRL A;  4AOM A;  4D1E A;  3SJS A;  2LMU A;  1BT6 A;  2M7L A;  3VB1 A;  2MRD A;  3M0W A;  5JOL A;  4XJK B;  2BE4 A;  3BXK A;  4I5K A;  1KK7 Z;  4M2Q A;  5AER A;  2FCE A;  1B4C A;  1J1D A;  2H61 C;  4TNC A;  2ZN9 A;  2NCO A;  1ALW A;  1Y0V H;  1KQV A;  2H2K A;  3CTN A;  2KAX A;  2G9B A;  2BCX A;  4CPV A;  2L2E A;  5AFP A;  1NCY A;  3D0Y A;  3CGA A;  1DT7 B;  1MQ1 A;  1ORG A;  2F33 A;  2LVV A;  3PAT A;  5DKR A;  1LS8 A;  1NPQ A;  2QEV A;  3B87 A;  3EK8 A;  1IWQ A;  2KAY A;  3I5F C;  3JVT B;  1TNQ A;  2KFH A;  5HLV A;  2JPO A;  2BKI B;  2AAO A;  3VRQ A;  1XFY O;  1NX3 A;  1J55 A;  2CT9 A;  3OB2 B;  1QS7 A;  2H61 A;  2QPT A;  1OMV A;  1RWY A;  2Y5I A;  1Y1A A;  2HQ8 A;  2JTT A;  3HX4 A;  3DVJ A;  2LVJ A;  2P70 A;  1B9A A;  1ZFS A;  2JQ6 A;  3TS5 C;  3KO0 A;  4DCK A;  2E6W A;  3CWG A;  2LNK A;  2ZND A;  2WC5 A;  1SMG A;  1DGU A;  4HSZ A;  2KI6 C;  3LK1 A;  1LKJ A;  1REC A;  2KBI A;  2JXC A;  5DKQ A;  2JWW A;  1F4Q A;  2EC6 B;  2Q91 A;  1M46 A;  1PSB A;  3B88 A;  4DIR A;  3O4X A;  1DJI A;  2BCA A;  2JU0 A;  2KOT A;  1NWD A;  1V1F A;  1Y1U A;  3I5G C;  3TDZ A;  1TCO B;  2MHH A;  1A03 A;  2CBL A;  5F6T A;  1G4Y R;  1JBA A;  1LA0 A;  1Q80 A;  3VRP A;  1S6J A;  3D74 A;  1C3Z A;  3LL8 B;  2YGU A;  2BKH B;  3CR4 X;  3IVT A;  2LCP A;  1IG5 A;  1XFR A;  1SL7 A;  1OW4 A;  2M3W A;  1LXF C;  1TOP A;  3EVU A;  2WCM A;  1PRW A;  1ZUZ A;  4UPG A;  1BR1 B;  1OSA A;  2JTZ A;  4OR9 B;  4CLN A;  2LUC A;  2CNP A;  2LHI A;  4I5J A;  1PVA A;  1M63 B;  1X02 A;  1QX2 A;  1SL8 A;  2NXQ A;  1EXR A;  4OZD A;  2LLU A;  3D78 A;  1CDM A;  1JF2 A;  4INW A;  5G08 A;  3PLF B;  1TIZ A;  5EL2 A;  2Y1N A;  5HYD A;  1NYA A;  1UHH A;  1B1G A;  1F54 A;  1CMF A;  3NHT A;  2JT8 A;  1NX0 A;  4YRU A;  2FJY A;  1NUB A;  4JWQ A;  4M2O A;  4A4B A;  4HRH A;  2JNX A;  1R2U A;  1AJ5 A;  4PHM A;  4PE0 A;  2LM5 A;  2OTG B;  1J1E A;  2P6B B;  1CNP A;  1QV1 A;  5I2O A;  1H8B A;  1NP8 A;  2K2F A;  1KK8 B;  4ORA B;  5CPV A;  1NX2 A;  3WNX B;  4FQT A;  2MLE C;  1DF0 A;  2CCM A;  1M31 A;  2LAN A;  2WOR A;  3JVT C;  1J7O A;  3JTD C;  4PAL A;  1BR4 B;  3UNW A;  1YX7 A;  1IGV A;  4XJK A;  4XYN A;  1FBV A;  5FYX A;  1G33 A;  4IL1 A;  2BBN A;  3ZNI A;  1SKT A;  3CLN A;  3PM8 A;  2R2I A;  2CTN A;  1GGW A;  2L4I A;  4KYN A;  1TNP A;  4GAO A;  1XVJ A;  1UHK A;  1CM1 A;  3CR5 X;  4FQO A;  3AKB A;  1SCM B;  3OX6 A;  3VGO A;  1BMO A;  1QLK A;  3KF9 A;  1U5I B;  3EK7 A;  2ZNE A;  3Q8I A;  1EG4 A;  4ORC B;  1KFU S;  1IJ5 A;  1B8C A;  2WOS A;  1KSO A;  3I5G B;  1EG3 A;  3FE8 A;  5I2L A;  4CFR A;  2BCB A;  2ZKM X;  1C7W A;  2KLE A;  1CTR A;  3RZS A;  1W7J B;  2JC2 A;  1KFX S;  1Y6W A;  1QWV A;  1S1E A;  1YRU B;  4N1F A;  1CLB A;  2BBM A;  5IBW A;  2AUC A;  1W9Z A;  1XFU O;  1S36 A;  1J7P A;  1W7I B;  2WC6 A;  2GGM A;  3EK4 A;  2LAP A;  2WC8 A;  1M45 A;  2JUL A;  2QDI A;  3FWC A;  5DIC A;  1ZOT B;  1F71 A;  1DJW A;  2GGZ A;  3DY9 A;  3SIA A;  4F7F A;  4AQJ A;  1KSM A;  1MUX A;  2DOQ A;  1QLS A;  2PAL A;  1DJH A;  1KFX L;  1Z2C B;  1OOH A;  3BFH A;  4QJ5 B;  1UUR A;  1YX8 A;  2KYC A;  2L2C A;  3FE6 A;  1Z4H A;  4PHJ A;  1LA3 A;  1QVI Z;  3NSO A;  1SY9 A;  3TDU A;  3EVR A;  1PAL A;  5HKZ A;  2B1U A;  1WY9 A;  1NCZ A;  3NGV A;  4C0J A;  3DF0 B;  1YVH A;  4YGC B;  3S0A A;  1SYM A;  3BJH A;  4INX A;  1SRA A;  1TUJ A;  5I2Q A;  2HPS A;  1CDN A;  4MZL A;  2SAS A;  1OOF A;  2TN4 A;  1K9K A;  2M49 B;  1T14 A;  1J7R A;  2OTG C;  1CLL A;  3PN7 C;  2JRF A;  3JTD B;  4AQI A;  1G8I A;  1KK8 C;  3MSE B;  4P2Y B;  1CMG A;  4ORB B;  1FW4 A;  2K61 A;  3HCM A;  5CSF A;  1L2O C;  4PCW A;  3S0D A;  1KQM C;  2LMT A;  3R1O A;  3LCP C;  3DVE A;  4GPL B;  1N65 A;  1OMR A;  4FTG A;  3BYA A;  2MBX A;  1DGV A;  1F55 A;  1LVC D;  5K89 A;  4NDB A;  2KGB C;  4OCI A;  3NSI A;  3CZ0 A;  4JKT A;  2HET A;  1OOI X;  1UHN A;  4GFT A;  1SCM C;  4PE1 A;  3NSL A;  1K2H A;  1DJZ A;  3RLZ A;  3FE9 A;  5DKN A;  3UO9 A;  3BOW B;  1DJG A;  3OX5 A;  2I94 A;  1QTX A;  3SG7 A;  2K2A A;  3AKA A;  5I8N A;  3TUY B;  1QJT A;  2M97 A;  3D73 A;  1GQM A;  1RK9 A;  2WCH A;  3FIA A;  1EJ3 A;  2M1K B;  3A4U B;  3GK2 A;  5KSZ A;  1CKK A;  1TWO A;  2NZ0 A;  1YUS A;  2KLD A;  3H4S E;  1ZMZ A;  1QV0 A;  3OGN A;  3OP0 A;  3PAL A;  1C07 A;  1QX5 B;  4CID A;  5CSI A;  5GQQ C;  1XFV O;  1BJF A;  1N2D A;  2BEC A;  4JD9 A;  2WCL A;  1CFD A;  5HLO A;  1TCF A;  1XA5 A;  5AEQ A;  1SL9 A;  1ODB A;  1SW8 A;  1UP5 A;  1UUS A;  2LMV A;  3WXA A;  4BY5 A;  3CDN A;  2M29 A;  3KEV A;  3K21 A;  2JOJ A;  2NCP A;  3KPX A;  3CS1 A;  1IQ3 A;  2CXJ A;  2LVK A;  3SIB A;  3SS3 A;  2FCD A;  2KQ6 A;  3IQQ A;  2WCF A;  1XFX O;  3VRR A;  2I2R E;  3PN7 B;  5I94 A;  2PSR A;  3FWB A;  4DS7 A;  2LUX A;  4HRE E;  4OVN F;  2L5X B;  1C7V A;  2EGD A;  2JT3 A;  3AAJ A;  3S0F A;  1R6P A;  1FF1 A;  1UWO A;  1B7T Y;  1L2O B;  2FJU B;  4MZJ A;  3PM2 A;  3WHT B;  1GJY A;  4F0Z B;  1KQM B;  3F45 A;  3SG4 A;  1ALV A;  1BF5 A;  2G2B A;  3NSK A;  3O6B A;  3K1E A;  2ISD A;  1IIO A;  2PMY A;  3OB1 B;  2BAP A;  4PE4 A;  1OZO A;  1MXL C;  3CR2 A;  3EKJ A;  1TTX A;  3DF0 A;  2KHN A;  3PSR A;  2BNX A;  1AVS A;  1SPY A;  1XFW O;  2F3Z A;  3AAK A;  3IF7 A;  2ERB A;  1CFC A;  3GK1 A;  5J3X A;  2ZRS A;  1YVL A;  4PHK A;  2LLT A;  1UHJ A;  1SCV A;  3S0E A;  1B8R A;  1PK0 D;  1NX1 A;  2LLS A;  5KU1 A;  2K60 A;  3DVM A;  1DJY A;  3O78 A;  2PYQ A;  2JXL A;  2IS9 A;  1UHI A;  4YGB B;  1GGZ A;  1PVB A;  1WLZ A;  3BQ3 A;  4C0K A;  1K96 A;  2OS8 C;  5ER4 X;  2I7A A;  2MLF C;  2K8M B;  4MBE A;  3VRN A;  1XK4 C;  1AUI B;  3BFA A;  1RRO A;  1OQP A;  1MHO A;  1S3P A;  2FOT A;  2O5G A;  4C0L A;  1YUR A;  3WHU B;  3TUY C;  3QME A;  1KFU L;  2GTE A;  1GM0 A;  3TDI A;  2ZN8 A;  3GOF A;  3L4A A;  1VRK A;  1SK6 D;  4I5N B;  1CDL A;  1JSA A;  1YRT B;  1PSR A;  2NLN A;  3RM1 A;  2PVB A;  4HRG A;  1B47 A;  4GGF C;  3R72 A;  1A75 B;  5FI6 A;  5TNC A;  1BOD A;  2LVI A;  4USL A;  1JFJ A;  1F4O A;  2K7B A;  1KWO C;  2QAC A;  2F2P A;  4N5X A;  1CDP A;  3BOW A;  4A4C A;  1KCY A;  2KI6 D;  1F70 A;  1EH2 A;  1XYD A;  1FPW A;  1V1G A;  1XO5 A;  2M1U A;  1AJ4 A;  2KFG A;  4WRI A;  5CSJ A;  1CFP A;  2MA2 A;  4I5L B;  1B7T Z;  1K8U A;  2O60 A;  1NCX A;  1K93 D;  2H8V A;  2QEO A;  3O4Y A;  3CZT X;  3IQO A;  2JT0 A;  3SS4 A;  3OBV A;  5D69 A;  5BPJ A;  2Y4Q A;  1CM4 A;  2L4H A;  2L5Y A;  1Y1X A;  3D75 A;  3S0G A;  4MRY A;  1QAT A;  2PAS A;  1QAS A;  5AXI A;  1FI5 A;  1YR5 A; 
#chains in the Genus database with same CATH homology
 1QXP A;  1SR6 B;  2ZRT A;  1HQV A;  1H4B A;  2KDH A;  1HT9 A;  1CB1 A;  5JJG A;  1IRJ A;  4GBA A;  2KYF A;  2WCE A;  4JQ0 D;  4MRX A;  4WQ3 A;  5CSN A;  3GK4 X;  2LV7 A;  1BLQ A;  1K9P A;  3BUN B;  2A4J A;  1F8H A;  1NIW A;  4QJ4 B;  4MLW A;  5HKW A;  3VRO A;  1QIW A;  1IH0 A;  1OZS A;  1PUL A;  3O2P A;  1CLM A;  4JPZ B;  2KI4 C;  2OS8 B;  5D7F A;  2M9G A;  3EKH A;  2M8U A;  4YI9 A;  4PE7 A;  2E30 A;  4WQ2 A;  2F2O A;  3DD4 A;  2BL0 C;  1CFF A;  2F8P A;  1K90 D;  1WDC B;  1S6C A;  3C1V A;  3SG6 A;  2KAV A;  3BUO B;  4L9M A;  1MWN A;  2KSP A;  1OMD A;  1MXE A;  3ZWH A;  2Y1M A;  1FI6 A;  2JZI A;  1RFJ A;  1QX7 A;  1NSH A;  1IKU A;  1DTL A;  2AMI A;  1BG1 A;  1WRK A;  2JPT A;  4YGE B;  1U5I A;  1KWO B;  2D8N A;  2LE9 B;  4YBH B;  4ICB A;  3LLE A;  5HKY A;  2JNF A;  1YUU A;  4R1E A;  2K7O A;  4GNK B;  3LK0 A;  3I5H C;  3BUM B;  1MF8 B;  1WRZ A;  2EHB A;  2F3Y A;  2OPO A;  1M39 A;  1S5G Y;  4DUQ A;  4U8D A;  5PAL A;  1AP4 A;  3DVK A;  2L98 A;  3D0Y B;  3I5I C;  5KTY A;  1JWD A;  4YGD B;  1K9U A;  4PDZ A;  4NDD A;  4OKH A;  3EVV A;  4OV2 A;  2KBM A;  2KQY A;  2Q4U A;  2M0R A;  4N1G A;  2SCP A;  4MZK A;  4PHN A;  2HF5 A;  3TZ1 A;  2LP2 A;  2WCB A;  3ICB A;  1A75 A;  5AAN A;  1JFK A;  4P5O E;  4ETO A;  3OHM B;  1IQ5 A;  4NQG A;  1B8L A;  4BY4 A;  4YI8 A;  2V53 A;  1YTZ C;  3NXA A;  1SR6 C;  1XFZ O;  2WND A;  4MN0 A;  3D10 A;  2L51 A;  5ER5 A;  1SNL A;  3PFV A;  2LP3 A;  4YGA A;  1D1O A;  1J7Q A;  4MSP A;  1QVI Y;  1KK7 Y;  1DJX A;  4NDC A;  1BOC A;  1A4P A;  1QIV A;  1S26 D;  4GUK A;  3KHE A;  4MEW A;  2VRG A;  3I5F B;  1JC2 A;  3E3R A;  1ZAC A;  2KI4 B;  1TN4 A;  3SG2 A;  1A2X A;  1E8A A;  1EL4 A;  2RGI A;  1N0Y A;  2HQW A;  3QRX A;  1AK8 A;  2BL0 B;  1L7Z A;  4M2P A;  2MAZ A;  3TS5 B;  1AHR A;  1MR8 A;  1RJV A;  1WDC C;  2COL B;  2K0J A;  2LC5 A;  4ZCU A;  2MJW B;  3SG3 A;  1K94 A;  5B8I B;  2I18 A;  2KNE A;  1OE9 B;  2BE6 A;  1BU3 A;  2PRU A;  2ZFD A;  2LHL A;  1DMO A;  1S6I A;  3FS7 A;  4DRW A;  1S5G Z;  1WLM A;  2EC6 C;  4QJ3 B;  1LIN A;  1JUO A;  1SBJ A;  2GV5 A;  1JF0 A;  3BUW B;  3I5H B;  1XK4 A;  2L0P A;  1RTP 1;  3BUX B;  4ZCV A;  1TNX A;  2L50 A;  2M7N A;  2K7C A;  3A8R A;  1TNW A;  1YUT A;  4CFQ A;  4MVF A;  1OOJ A;  3I5I B;  1K95 A;  4E68 A;  4Q04 A;  2K7D A;  3SG5 A;  2KFF A;  1IJ6 A;  1A29 A;  1DVI A;  2KGR A;  4GGN A;  1TRF A;  1DF0 B;  4GGF A;  1WRL A;  4AOM A;  4D1E A;  3SJS A;  2LMU A;  1BT6 A;  2M7L A;  2MRD A;  3M0W A;  5JOL A;  4XJK B;  2BE4 A;  3BXK A;  4I5K A;  1KK7 Z;  4M2Q A;  5AER A;  2FCE A;  1B4C A;  1J1D A;  2H61 C;  4TNC A;  2ZN9 A;  2NCO A;  1ALW A;  1Y0V H;  1KQV A;  2H2K A;  3CTN A;  2KAX A;  2G9B A;  2BCX A;  4CPV A;  2L2E A;  5AFP A;  1NCY A;  3D0Y A;  3CGA A;  1DT7 B;  1MQ1 A;  2F33 A;  2LVV A;  3PAT A;  5DKR A;  1NPQ A;  3EK8 A;  1IWQ A;  2KAY A;  3I5F C;  3JVT B;  1TNQ A;  2KFH A;  5HLV A;  2BKI B;  2AAO A;  3VRQ A;  1XFY O;  1NX3 A;  1J55 A;  2CT9 A;  3OB2 B;  1QS7 A;  2H61 A;  2QPT A;  1OMV A;  1RWY A;  2Y5I A;  1Y1A A;  2HQ8 A;  2JTT A;  3HX4 A;  3DVJ A;  2LVJ A;  1B9A A;  1ZFS A;  2JQ6 A;  3TS5 C;  3KO0 A;  4DCK A;  2E6W A;  3CWG A;  2LNK A;  2ZND A;  1SMG A;  1DGU A;  4HSZ A;  2KI6 C;  3LK1 A;  1LKJ A;  1REC A;  2KBI A;  2JXC A;  5DKQ A;  2JWW A;  1F4Q A;  2EC6 B;  2Q91 A;  1M46 A;  1PSB A;  4DIR A;  1DJI A;  2BCA A;  2JU0 A;  2KOT A;  1NWD A;  1V1F A;  1Y1U A;  3I5G C;  3TDZ A;  1TCO B;  2MHH A;  1A03 A;  2CBL A;  5F6T A;  1G4Y R;  1JBA A;  1LA0 A;  1Q80 A;  3VRP A;  1S6J A;  3LL8 B;  2BKH B;  3CR4 X;  2LCP A;  1IG5 A;  1SL7 A;  2M3W A;  1LXF C;  1TOP A;  3EVU A;  1PRW A;  1ZUZ A;  4UPG A;  1BR1 B;  1OSA A;  2JTZ A;  4OR9 B;  4CLN A;  2LUC A;  2CNP A;  2LHI A;  4I5J A;  1PVA A;  1M63 B;  1X02 A;  1QX2 A;  1SL8 A;  2NXQ A;  1EXR A;  2LLU A;  1CDM A;  1JF2 A;  5G08 A;  3PLF B;  1TIZ A;  2Y1N A;  5HYD A;  1NYA A;  1UHH A;  1B1G A;  1F54 A;  1CMF A;  2JT8 A;  1NX0 A;  4YRU A;  4JWQ A;  1NUB A;  4M2O A;  4A4B A;  4HRH A;  2JNX A;  1R2U A;  1AJ5 A;  4PHM A;  4PE0 A;  2LM5 A;  2OTG B;  1J1E A;  2P6B B;  1CNP A;  1QV1 A;  5I2O A;  1H8B A;  1NP8 A;  2K2F A;  1KK8 B;  4ORA B;  5CPV A;  1NX2 A;  3WNX B;  2MLE C;  1DF0 A;  2CCM A;  1M31 A;  2LAN A;  2WOR A;  3JVT C;  1J7O A;  3JTD C;  4PAL A;  1BR4 B;  1YX7 A;  1IGV A;  4XJK A;  4XYN A;  1FBV A;  5FYX A;  1G33 A;  4IL1 A;  2BBN A;  3ZNI A;  1SKT A;  3CLN A;  3PM8 A;  2R2I A;  2CTN A;  1GGW A;  2L4I A;  1TNP A;  4GAO A;  1XVJ A;  1UHK A;  1CM1 A;  3CR5 X;  4FQO A;  3AKB A;  1SCM B;  3OX6 A;  3VGO A;  1BMO A;  1QLK A;  3KF9 A;  1U5I B;  3EK7 A;  2ZNE A;  1EG4 A;  4ORC B;  1KFU S;  1IJ5 A;  1B8C A;  2WOS A;  1KSO A;  3I5G B;  1EG3 A;  5I2L A;  4CFR A;  2BCB A;  2ZKM X;  1C7W A;  1CTR A;  1W7J B;  2JC2 A;  1KFX S;  1Y6W A;  1S1E A;  1YRU B;  4N1F A;  1CLB A;  2BBM A;  5IBW A;  2AUC A;  1XFU O;  1S36 A;  1J7P A;  1W7I B;  3EK4 A;  2GGM A;  3FWC A;  2LAP A;  2WC8 A;  1M45 A;  2JUL A;  3SIB A;  1ZOT B;  1F71 A;  1DJW A;  2GGZ A;  3SIA A;  4AQJ A;  1KSM A;  1MUX A;  2DOQ A;  1QLS A;  2PAL A;  1DJH A;  1KFX L;  4QJ5 B;  1UUR A;  1YX8 A;  2KYC A;  4PHJ A;  1LA3 A;  1QVI Z;  3NSO A;  1SY9 A;  3TDU A;  3EVR A;  1PAL A;  5HKZ A;  2B1U A;  1WY9 A;  1NCZ A;  4C0J A;  3DF0 B;  1YVH A;  4YGC B;  1SYM A;  1SRA A;  5I2Q A;  2HPS A;  1CDN A;  4MZL A;  2SAS A;  2TN4 A;  1K9K A;  2M49 B;  1J7R A;  2OTG C;  1CLL A;  3PN7 C;  2JRF A;  3JTD B;  4AQI A;  1G8I A;  1KK8 C;  3MSE B;  4P2Y B;  1CMG A;  4ORB B;  1FW4 A;  2K61 A;  3HCM A;  5CSF A;  1L2O C;  4PCW A;  1KQM C;  2LMT A;  3LCP C;  3DVE A;  4GPL B;  1N65 A;  1OMR A;  4FTG A;  3BYA A;  2MBX A;  1DGV A;  1F55 A;  1LVC D;  5K89 A;  4NDB A;  2KGB C;  4OCI A;  3NSI A;  2HET A;  1UHN A;  4GFT A;  1SCM C;  4PE1 A;  3NSL A;  1K2H A;  1DJZ A;  3RLZ A;  5DKN A;  3BOW B;  1DJG A;  3OX5 A;  2I94 A;  1QTX A;  3SG7 A;  2K2A A;  3AKA A;  5I8N A;  3TUY B;  1QJT A;  2M97 A;  1GQM A;  1RK9 A;  3FIA A;  1EJ3 A;  2M1K B;  3A4U B;  3GK2 A;  5KSZ A;  1CKK A;  2NZ0 A;  1YUS A;  3H4S E;  3OP0 A;  1ZMZ A;  1QV0 A;  1C07 A;  3PAL A;  1QX5 B;  4CID A;  5CSI A;  5GQQ C;  1XFV O;  1BJF A;  1N2D A;  2BEC A;  1CFD A;  5HLO A;  1TCF A;  1XA5 A;  5AEQ A;  1SL9 A;  1ODB A;  1SW8 A;  1UP5 A;  1UUS A;  2LMV A;  3WXA A;  4BY5 A;  2M29 A;  3KEV A;  3K21 A;  2JOJ A;  2NCP A;  3KPX A;  3CS1 A;  1IQ3 A;  2CXJ A;  2LVK A;  2FCD A;  2KQ6 A;  3IQQ A;  2WCF A;  1XFX O;  3VRR A;  2I2R E;  3PN7 B;  2PSR A;  3FWB A;  4DS7 A;  2LUX A;  4HRE E;  4OVN F;  2L5X B;  1C7V A;  2EGD A;  2JT3 A;  3AAJ A;  1R6P A;  1FF1 A;  1UWO A;  1B7T Y;  1L2O B;  2FJU B;  4MZJ A;  3WHT B;  1GJY A;  4F0Z B;  1KQM B;  3F45 A;  3SG4 A;  1ALV A;  1BF5 A;  2G2B A;  3NSK A;  3O6B A;  2ISD A;  2PMY A;  3OB1 B;  4PE4 A;  1OZO A;  1MXL C;  3CR2 A;  3EKJ A;  1TTX A;  3DF0 A;  2KHN A;  3PSR A;  1AVS A;  1SPY A;  1XFW O;  2F3Z A;  3AAK A;  3IF7 A;  1CFC A;  3GK1 A;  5J3X A;  2ZRS A;  1YVL A;  4PHK A;  2LLT A;  1UHJ A;  1SCV A;  1B8R A;  1PK0 D;  1NX1 A;  2LLS A;  5KU1 A;  3DVM A;  1DJY A;  3O78 A;  2JXL A;  2IS9 A;  1UHI A;  4YGB B;  1GGZ A;  1PVB A;  1WLZ A;  3BQ3 A;  4C0K A;  1K96 A;  2OS8 C;  5ER4 X;  2I7A A;  2MLF C;  2K8M B;  4MBE A;  3VRN A;  1XK4 C;  1AUI B;  1RRO A;  1OQP A;  1MHO A;  1S3P A;  2FOT A;  2O5G A;  4C0L A;  1YUR A;  3WHU B;  3TUY C;  1KFU L;  3TDI A;  2ZN8 A;  3GOF A;  1VRK A;  1SK6 D;  4I5N B;  1CDL A;  1JSA A;  1YRT B;  1PSR A;  2NLN A;  3RM1 A;  2PVB A;  4HRG A;  1B47 A;  4GGF C;  1A75 B;  5TNC A;  1BOD A;  2LVI A;  4USL A;  1JFJ A;  1F4O A;  2K7B A;  1KWO C;  2QAC A;  2F2P A;  4N5X A;  1CDP A;  3BOW A;  4A4C A;  1KCY A;  2KI6 D;  1F70 A;  1EH2 A;  1XYD A;  1FPW A;  1V1G A;  1XO5 A;  2M1U A;  1AJ4 A;  2KFG A;  4WRI A;  5CSJ A;  1CFP A;  2MA2 A;  4I5L B;  1B7T Z;  1K8U A;  2O60 A;  1NCX A;  1K93 D;  3O4Y A;  3CZT X;  3IQO A;  2JT0 A;  5BPJ A;  5D69 A;  2Y4Q A;  1CM4 A;  2L4H A;  1Y1X A;  4MRY A;  1QAT A;  2PAS A;  1QAS A;  5AXI A;  1FI5 A;  1YR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...