1OMDA

Structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
b'ITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ONCOMODULIN
publication title Structure of oncomodulin refined at 1.85 A resolution. An example of extensive molecular aggregation via Ca2+.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium binding protein
total genus 37
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omdA00
3CR2A 5I2QA 3DVJA 2F3YA 1YVHA 4NDDA 1PK0D 1JBAA 3OP0A 5HKYA 2AUCA 2I18A 1ZACA 2ZN8A 1TNQA 2LC5A 5CSFA 4PALA 1QIVA 1M46A 3CR5X 4PHMA 3VRRA 1ZOTB 1ZMZA 2M97A 2EC6B 2CCMA 2JZIA 2WNDA 1F55A 3BUOB 1JSAA 1BR1B 1BU3A 2L4HA 5BPJA 4DS7A 1IJ6A 4ICBA 1S6IA 1QX5B 1XYDA 1J1DA 1A4PA 1EXRA 3EVRA 4DIRA 1DMOA 4HREE 3SG5A 1DJZA 2KI4C 2LVJA 2PASA 3JVTB 2FCDA 4GAOA 1FF1A 1KWOC 3CGAA 5KU1A 1Y1UA 2E30A 1IGVA 4NQGA 2NLNA 1IG5A 4HRHA 5DKNA 2MHHA 4E68A 1SR6B 4AQJA 2FOTA 2NZ0A 1TNXA 1OMDA 3GK1A 1TN4A 1WRLA 1CLMA 1FPWA 1H8BA 2O60A 2ZN9A 3SG6A 1IH0A 4FTGA 2EC6C 2K7BA 2MLFC 1KK7Y 1SNLA 2BBNA 3MSEB 4R1EA 4C0KA 1H4BA 3BOWB 1QXPA 1IKUA 1A75B 2GGMA 2I7AA 2K2AA 3IQOA 1B4CA 1F8HA 1EG4A 2JTTA 1G4YR 2L98A 4DCKA 2JOJA 1NCXA 1B8CA 1CDLA 1XFWO 2ZNDA 1RROA 1JFKA 2OTGB 1S1EA 5I2OA 3SG4A 1FBVA 1S36A 2LP2A 1GGZA 2JXCA 3JVTC 1EG3A 2OPOA 3FWBA 1UHJA 1TIZA 1CFCA 3FS7A 4CFQA 2LAPA 2CBLA 1SR6C 4CIDA 5JJGA 1Q80A 1Y6WA 4MSPA 1BOCA 4FQOA 4MRXA 1CTRA 3HX4A 1N2DA 3DD4A 1XFVO 1DGVA 2EGDA 1K8UA 4JQ0D 2Q91A 1C7WA 1SKTA 1KSMA 1EH2A 2CTNA 1J7OA 2BL0B 1M31A 3BUMB 4I5JA 4MRYA 1SY9A 1WDCC 1BR4B 1M45A 2LE9B 1TOPA 4YI9A 4HSZA 3TDZA 1CM1A 2WOSA 1SL9A 4XJKA 3SJSA 4L9MA 3D10A 2L50A 1MUXA 1IRJA 1M39A 4P2YB 1GGWA 2KYFA 2OTGC 1K9UA 3BUXB 1W7JB 1XVJA 1WY9A 1UHKA 2JNFA 2JRFA 4GGFC 5CSNA 4A4CA 1F54A 1K2HA 2BBMA 1AJ4A 3SIBA 2L2EA 1X02A 1L7ZA 3I5FB 2GV5A 3SG3A 1OZOA 2K0JA 2F3ZA 1Y0VH 1OE9B 1UUSA 5ER4X 2HPSA 1SL7A 2G9BA 1OMVA 4MBEA 2CXJA 3OB1B 1K96A 1N0YA 3VRPA 1YRTB 1AP4A 5HLOA 1ODBA 2KBIA 2BL0C 5PALA 1JFJA 4MVFA 1AVSA 1SW8A 1AJ5A 5CSIA 1F70A 1SBJA 2LCPA 1XK4A 1NP8A 3C1VA 2B1UA 2LMVA 2LMUA 1C07A 1GJYA 4GNKB 2PSRA 2EHBA 4TNCA 4I5KA 3O2PA 3DVKA 2JT3A 2JNXA 3KEVA 1S5GY 2KAXA 1UURA 3CLNA 5ER5A 3BUNB 1QIWA 1QLSA 3KHEA 3BYAA 2K8MB 3D0YB 3PM8A 1L2OB 2I2RE 1G33A 5HKZA 3BOWA 2F8PA 1MF8B 3TDIA 3ICBA 4PDZA 3I5FC 2TN4A 4I5LB 4QJ5B 3EK7A 4NDCA 2PMYA 5G08A 4UPGA 5AERA 4F0ZB 3PALA 3I5IB 4WQ2A 1QV1A 1RTP1 2MJWB 2JU0A 2JQ6A 2Y4QA 2KQ6A 3EVVA 1B8LA 2WCEA 2LHLA 4YGDB 4CLNA 3IQQA 4GGFA 1CFPA 1KFUL 4N1FA 4ETOA 1KFXL 3EK8A 2JWWA 1BLQA 4YBHB 2FCEA 1F4OA 1KQMB 1SRAA 2L4IA 2K7DA 3CS1A 4YGEB 1DF0B 2WC8A 3O4YA 2Y1MA 3NSIA 4GGNA 4MZKA 2M29A 3BXKA 1Y1AA 1BJFA 2H61C 2JXLA 2M8UA 3LLEA 1QATA 3PATA 1TCOB 1C7VA 4PHKA 4C0JA 1B9AA 1Y1XA 4M2QA 4A4BA 3DF0B 3TS5B 1WDCB 3ZWHA 4NDBA 2KAVA 1L2OC 1SK6D 1QS7A 1IQ3A 2PVBA 4P5OE 1QVIY 2O5GA 2COLB 1YTZC 3WNXB 4BY5A 5I8NA 3CZTX 3PSRA 1YX7A 2HETA 2LUCA 2ISDA 5FYXA 1NX0A 1UHHA 3I5IC 5HKWA 1CMGA 5HLVA 1K9PA 2P6BB 1K90D 4GUKA 2M3WA 2HQWA 1DJWA 3EVUA 4GBAA 1IQ5A 1NPQA 2MAZA 4Q04A 3LL8B 4CFRA 1XA5A 1JUOA 1KQMC 3EK4A 1KK7Z 1QTXA 1MXLC 1NX3A 1MWNA 1YUTA 1S6CA 2JPTA 4BY4A 2A4JA 2KFHA 2LM5A 1E8AA 1PVAA 5D69A 3KF9A 2LP3A 1B7TY 4YGBB 2KAYA 1PULA 5J3XA 5HYDA 4PHNA 1GQMA 2BCBA 2I94A 3GK4X 3TS5C 1YUSA 2LMTA 4MZJA 1YRUB 5CSJA 1QASA 2QPTA 4C0LA 1CNPA 2WCFA 4PE7A 2BE4A 4N1GA 4CPVA 2GGZA 2F2PA 2H61A 3FIAA 1WLZA 1J7QA 1DVIA 4WQ3A 4ZCUA 1TRFA 4MN0A 2M1UA 2KI6D 2KQYA 4M2PA 2BE6A 1CB1A 2AMIA 1BODA 2ZKMX 1SL8A 5TNCA 2CT9A 4D1EA 2LVKA 1CMFA 2M0RA 1OZSA 1QX7A 1SYMA 4PCWA 3CTNA 3PFVA 1XFZO 1K95A 1JF0A 3BUWB 3H4SE 5KTYA 1B8RA 1TNWA 1K9KA 1XFXO 3GOFA 2KGRA 3PN7B 1FI5A 2M49B 3EKJA 2H2KA 2ZRSA 4OR9B 4N5XA 2KNEA 2MA2A 4JPZB 1S3PA 2PRUA 4YGCB 3NSOA 1PSRA 2IS9A 3JTDC 2LHIA 1ZFSA 3AAJA 5D7FA 1V1GA 2WORA 5AANA 1F71A 4PE1A 1UHNA 2LLUA 2VRGA 3RM1A 1SCVA 2AAOA 1MXEA 2JT0A 4OKHA 1KCYA 1DJYA 4AQIA 4QJ3B 1M63B 1ZUZA 4WRIA 1IJ5A 1JF2A 3DF0A 1KQVA 4QJ4B 1N65A 2R2IA 4PE4A 1PSBA 1A75A 1S26D 1W7IB 1WLMA 3SG2A 1B47A 1UP5A 2LLTA 3NSKA 1XFUO 1SPYA 1HT9A 3AKBA 2K7CA 2BKIB 2OS8C 2KFFA 3IF7A 2SASA 2LVVA 1RJVA 1J7RA 1DJIA 1YUUA 1QV0A 1ALWA 2KSPA 3M0WA 1NCZA 1LKJA 1S5GZ 1U5IB 3PN7C 2M7NA 1CLBA 1R6PA 2BCXA 1LA3A 1YX8A 1D1OA 3TDUA 1XO5A 4GPLB 1OSAA 4M2OA 4YGAA 1DTLA 2L51A 1YURA 2LVIA 3PLFB 2BECA 1PALA 3HCMA 1KK8B 1LINA 1CDNA 1JWDA 1RFJA 3CWGA 1NX1A 4MZLA 3ZNIA 1DJGA 1FW4A 1QJTA 4GFTA 1CLLA 2NXQA 3FWCA 2JTZA 2FJUB 4ORBB 4U8DA 4YI8A 1CFFA 1J55A 1BF5A 1DJHA 1QX2A 1KSOA 3AAKA 3F45A 3I5HC 3TUYB 1NYAA 5AFPA 2KI6C 1NWDA 5GQQC 1A03A 2KHNA 3O6BA 4JWQA 2M9GA 2NCPA 2RGIA 1BT6A 2MBXA 1DJXA 2ZNEA 2K7OA 3EKHA 2DOQA 1RECA 3BQ3A 2HF5A 4ZCVA 4DRWA 1J1EA 1LXFC 2JULA 2K2FA 3QRXA 1NIWA 1PVBA 4MEWA 2E6WA 3A8RA 2PALA 2NCOA 4OV2A 1XFYO 1QVIZ 4XYNA 1KK8C 1PRWA 1KFUS 3OB2B 1KFXS 5K89A 1HQVA 1K94A 3LCPC 3AKAA 2WCBA 5JOLA 4MLWA 3LK0A 1OQPA 1YVLA 3OX6A 3RLZA 1TTXA 3VRQA 1NCYA 2M7LA 1ALVA 1NSHA 1AUIB 1MHOA 1R2UA 1SCMB 2LNKA 3WHTB 3TUYC 4HRGA 1CDPA 3CR4X 3SIAA 3JTDB 1LA0A 2LANA 1K93D 4ORAB 1WRKA 2JC2A 1CM4A 2SCPA 1WRZA 1S6JA 1XK4C 5DKRA 3DVMA 3I5GB 4USLA 3SG7A 3TZ1A 1UWOA 1IWQA 2V53A 2MRDA 3O78A 1RWYA 1SMGA 2CNPA 1A2XA 1OMRA 3OX5A 1YR5A 1JC2A 4PE0A 1B7TZ 1RK9A 3D0YA 2BKHB 2HQ8A 3K21A 1TCFA 1VRKA 3KO0A 4AOMA 2KOTA 3E3RA 3VGOA 1A29A 2M1KB 1EL4A 2KDHA 4DUQA 5AEQA 2OS8B 2LV7A 1BG1A 5CPVA 3VRNA 2Q4UA 1NUBA 4IL1A 5F6TA 2KYCA 2L5XB 1B1GA 1FI6A 3NSLA 1V1FA 2G2BA 3OHMB 2D8NA 5DKQA 1F4QA 1G8IA 1U5IA 3GK2A 3WHUB 2K61A 2Y5IA 2L0PA 1TNPA 2LUXA 3VROA 5KSZA 1AHRA 1SCMC 4ORCB 1DF0A 1QLKA 1UHIA 1CFDA 5IBWA 3DVEA 1BMOA 1CDMA 1J7PA 2QACA 1LVCD 5AXIA 2F33A 3I5GC 3LK1A 3WXAA 5I2LA 4PHJA 2JT8A 2MLEC 2ZFDA 1DGUA 2KI4B 4YRUA 3A4UB 1NX2A 4OCIA 1AK8A 2Y1NA 1CKKA 2BCAA 4I5NB 2F2OA 2KBMA 2KFGA 1DT7B 1MR8A 1OOJA 3I5HB 2LLSA 3NXAA 2ZRTA 1EJ3A 1KWOB 5B8IB 4OVNF 3KPXA 1MQ1A 2KGBC 4XJKB
chains in the Genus database with same CATH superfamily
3CR2A 5I2QA 3DVJA 2F3YA 1YVHA 1OW4A 4NDDA 1PK0D 1JBAA 3OP0A 2H8VA 5HKYA 2AUCA 2I18A 1ZACA 2ZN8A 1TNQA 2LC5A 5CSFA 4PALA 1QIVA 1M46A 3CR5X 4PHMA 1W9ZA 1ZOTB 3VRRA 1ZMZA 2M97A 2EC6B 2CCMA 2JZIA 2WNDA 1F55A 3BUOB 1JSAA 3D74A 1BR1B 1BU3A 2L4HA 5BPJA 4DS7A 1IJ6A 4ICBA 1S6IA 1QX5B 1XYDA 1T14A 2KPHA 2WCHA 1J1DA 1A4PA 1EXRA 3EVRA 4DIRA 1DMOA 4HREE 3SG5A 1DJZA 2KI4C 2LVJA 3S0BA 2PASA 2L5YA 3JVTB 2FCDA 4GAOA 1FF1A 2BAPA 1KWOC 3CGAA 5KU1A 1Y1UA 2E30A 1IGVA 4NQGA 2NLNA 1LS8A 1IG5A 3NHIA 4HRHA 3OBVA 2MHHA 5DKNA 1SR6B 4AQJA 4E68A 2FOTA 2NZ0A 1TNXA 1OMDA 3D73A 3GK1A 3K1EA 1TN4A 1WRLA 1CLMA 1FPWA 1H8BA 2O60A 3FE8A 2ZN9A 3SG6A 1IH0A 1Z4HA 4FTGA 2WC5A 2EC6C 2K7BA 2MLFC 1KK7Y 1SNLA 2BBNA 3MSEB 3R1OA 4R1EA 3S0DA 4C0KA 1H4BA 3BOWB 1QXPA 1IKUA 1A75B 2GGMA 2I7AA 2K2AA 3IQOA 1B4CA 1F8HA 3V2LA 1EG4A 2JTTA 1G4YR 2L98A 4DCKA 2JOJA 1NCXA 1B8CA 1CDLA 1XFWO 2ZNDA 1RROA 1JFKA 2OTGB 1S1EA 5I2OA 3R1VA 3SG4A 1FBVA 1S36A 2LP2A 1GGZA 2JXCA 3JVTC 1EG3A 2OPOA 3FWBA 1UHJA 1TIZA 1CFCA 3FS7A 4CFQA 2LAPA 2CBLA 1SR6C 4CIDA 5JJGA 1Q80A 1Y6WA 4MSPA 1BOCA 3PJIA 4FQOA 4MRXA 1CTRA 3HX4A 1N2DA 3DD4A 1XFVO 1DGVA 2EGDA 1K8UA 4JQ0D 1P28A 2Q91A 1C7WA 1SKTA 2P70A 5FI2A 1KSMA 1EH2A 2CTNA 1J7OA 2BL0B 1M31A 3BUMB 4I5JA 4MRYA 1SY9A 1WDCC 1BR4B 1M45A 2LE9B 1TOPA 4YI9A 4HSZA 3TDZA 1CM1A 2WOSA 3NGVA 1SL9A 4XJKA 3SJSA 2PQLA 4L9MA 3D10A 2L50A 1MUXA 1IRJA 1M39A 4P2YB 1GGWA 2KYFA 2OTGC 1K9UA 3BUXB 2YGUA 1W7JB 1XVJA 1WY9A 1UHKA 2JNFA 2JRFA 4GGFC 5CSNA 4A4CA 3CDNA 1F54A 1K2HA 3FE9A 4INWA 2BBMA 1AJ4A 3CYZA 3SIBA 2L2EA 1X02A 1L7ZA 3I5FB 2GV5A 4OZDA 3SG3A 1OZOA 1OOIX 2K0JA 2F3ZA 3CABA 1Y0VH 2QEOA 5DICA 1OE9B 1UUSA 5ER4X 2HPSA 1SL7A 3R1PA 2G9BA 1OMVA 4MBEA 2CXJA 3OB1B 1K96A 1N0YA 3SS4A 3VRPA 1YRTB 1AP4A 5HLOA 1C3YA 3FE6A 1ODBA 2KBIA 2QEVA 2BL0C 5PALA 1JFJA 1GM0A 4MVFA 1AVSA 1SW8A 1AJ5A 5CSIA 1F70A 1SBJA 2KLDA 2LCPA 1XK4A 1NP8A 3C1VA 2B1UA 2LMVA 2LMUA 1C07A 1GJYA 4GNKB 2PSRA 2WCKA 2EHBA 4TNCA 4I5KA 3O2PA 3DVKA 2JT3A 2JNXA 3KEVA 1S5GY 2KAXA 1UURA 3CLNA 5ER5A 3BUNB 1QIWA 1QLSA 3KHEA 3BYAA 2K8MB 3D0YB 3PM8A 1L2OB 2I2RE 1G33A 5HKZA 3BOWA 2F8PA 1MF8B 1OOHA 3TDIA 3ICBA 3R72A 4PDZA 3I5FC 2TN4A 4I5LB 4QJ5B 2QEBA 3EK7A 4NDCA 2PMYA 5G08A 4UPGA 5AERA 4F0ZB 3PALA 3I5IB 3IVTA 4WQ2A 1QV1A 1RTP1 2MJWB 2JU0A 2JQ6A 2Y4QA 2KQ6A 3EVVA 1B8LA 2WCEA 2LHLA 4YGDB 4CLNA 3IQQA 3DYEA 4GGFA 2BNXA 1CFPA 1KFUL 4N1FA 3OGNA 4ETOA 1KFXL 3EK8A 3N7HA 2JWWA 1BLQA 4YBHB 2FCEA 1F4OA 1KQMB 1SRAA 2L4IA 2K7DA 3CS1A 4YGEB 1DF0B 2WC8A 2ERBA 1CKKA 3O4YA 3D75A 2Y1MA 3NSIA 4GGNA 4MZKA 2M29A 3BXKA 1Y1AA 1BJFA 2H61C 2JXLA 2M8UA 3LLEA 1QATA 3PATA 1TCOB 3SS3A 1C7VA 1IIOA 4PHKA 4C0JA 1B9AA 1Y1XA 4M2QA 4A4BA 3DF0B 3TS5B 1WDCB 3ZWHA 4NDBA 2KAVA 3CZ1A 1L2OC 1SK6D 1QS7A 1IQ3A 2PVBA 3PM2A 4P5OE 1QVIY 2O5GA 2COLB 1YTZC 3WNXB 4BY5A 5I8NA 3CZTX 3PSRA 1YX7A 2HETA 2LUCA 2ISDA 5FYXA 1NX0A 3S0GA 1UHHA 3I5IC 5HKWA 5I94A 3L47A 1DC1A 1CMGA 5HLVA 1K9PA 2P6BB 1K90D 1DEKA 2M3WA 4GUKA 2HQWA 1DJWA 3EVUA 4GBAA 1IQ5A 1NPQA 2MAZA 4Q04A 3LL8B 4CFRA 1XA5A 1JUOA 1KQMC 2QDIA 1KK7Z 3EK4A 1QTXA 3RZSA 1MXLC 1NX3A 1MWNA 1YUTA 1S6CA 2JPTA 4BY4A 2A4JA 2KFHA 2LM5A 1E8AA 1PVAA 5D69A 3KF9A 2LP3A 1B7TY 3B86A 4YGBB 2KAYA 1PULA 5J3XA 5HYDA 4PHNA 3B6XA 1GQMA 2BCBA 3BFAA 3QMEA 2I94A 3GK4X 3TS5C 1YUSA 2LMTA 4MZJA 1YRUB 5CSJA 1QASA 2QPTA 4C0LA 1CNPA 2WCFA 4PE7A 2BE4A 1C3ZA 4N1GA 4CPVA 2GGZA 2F2PA 2H61A 3FIAA 1WLZA 1J7QA 1DVIA 4WQ3A 4ZCUA 1TRFA 4MN0A 2M1UA 1DELA 2KI6D 2KQYA 4M2PA 2BE6A 1CB1A 2AMIA 1BODA 2ZKMX 1SL8A 5TNCA 2CT9A 4D1EA 2LVKA 1CMFA 2M0RA 1OZSA 1QX7A 1SYMA 4PCWA 3B87A 3CTNA 3PFVA 3BJHA 1XFZO 4INXA 1K95A 1JF0A 3BUWB 3H4SE 5EL2A 5KTYA 1B8RA 1TNWA 1K9KA 1XFXO 3GOFA 2KGRA 3PN7B 1FI5A 2M49B 3EKJA 1ORGA 3D76A 2H2KA 2ZRSA 4OR9B 2GTEA 4N5XA 2KNEA 1TWOA 2MA2A 4JPZB 1S3PA 2PRUA 4YGCB 3NSOA 1SSEB 3CZ2A 1PSRA 2IS9A 3JTDC 2LHIA 1ZFSA 3AAJA 3Q8IA 5D7FA 1V1GA 2PYQA 2WORA 5AANA 1F71A 4PE1A 1UHNA 2LLUA 2VRGA 3RM1A 1SCVA 2AAOA 1MXEA 2JT0A 4OKHA 1KCYA 1DJYA 4AQIA 4QJ3B 1M63B 1ZUZA 4WRIA 1IJ5A 1JF2A 3DF0A 1KQVA 4QJ4B 1N65A 2R2IA 4PE4A 1PSBA 1A75A 1S26D 1W7IB 1WLMA 3SG2A 1B47A 1UP5A 2LLTA 3NSKA 1XFUO 1SPYA 1DQEA 1HT9A 3AKBA 2WCLA 2K7CA 2BKIB 2JPOA 2OS8C 2KFFA 3IF7A 2SASA 2LVVA 1RJVA 1J7RA 1DJIA 1YUUA 1QV0A 1ALWA 2KSPA 3M0WA 1NCZA 4KYNA 1LKJA 1S5GZ 1U5IB 3PN7C 2M7NA 1CLBA 1R6PA 5FI7A 5FI6A 2BCXA 1LA3A 3BFHA 1YX8A 2WCJA 3TDUA 1D1OA 1XO5A 2L2CA 4GPLB 1XFRA 1OSAA 4M2OA 4YGAA 1DTLA 2L51A 1YURA 2LVIA 3PLFB 4PT1A 2BECA 1PALA 3HCMA 1KK8B 1LINA 1CDNA 1JWDA 1RFJA 3CWGA 1NX1A 4MZLA 3ZNIA 1DJGA 1FW4A 1QJTA 4GFTA 1CLLA 2NXQA 3FWCA 2JTZA 2FJUB 4ORBB 2QEHA 4U8DA 4YI8A 1J55A 1CFFA 1BF5A 1DJHA 1QX2A 1KSOA 3AAKA 3F45A 3I5HC 3TUYB 1NYAA 2FJYA 5AFPA 3D78A 3D77A 3S0FA 2KI6C 1NWDA 5GQQC 1A03A 1Z2CB 2KHNA 3O6BA 4JWQA 2M9GA 2NCPA 2RGIA 1BT6A 2MBXA 1DJXA 2ZNEA 2K7OA 3EKHA 2DOQA 1RECA 3BQ3A 2HF5A 4ZCVA 4DRWA 1J1EA 1LXFC 2JULA 2K2FA 3QRXA 1NIWA 1PVBA 4MEWA 2E6WA 3A8RA 3O4XA 2PALA 3SS5A 2NCOA 1OOGA 4OV2A 4JD9A 1XFYO 1OOFA 1QVIZ 4XYNA 1KK8C 1PRWA 1KFUS 3OB2B 1KFXS 1QWVA 5K89A 1HQVA 1K94A 3LCPC 3AKAA 4IJ7A 2WCBA 5JOLA 5D3OA 4MLWA 3LK0A 1OQPA 1YVLA 3OX6A 3RLZA 1TTXA 5HL1A 3B88A 3VRQA 1NCYA 2M7LA 1ALVA 1NSHA 1AUIB 1MHOA 1R2UA 1SCMB 2LNKA 3WHTB 3TUYC 4HRGA 1TUJA 1CDPA 3CR4X 3SIAA 3JTDB 1LA0A 2LANA 3CZ0A 1K93D 4ORAB 3S0AA 1WRKA 2JC2A 1CM4A 2SCPA 1WRZA 1S6JA 1XK4C 5DKRA 3DVMA 3DY9A 3I5GB 4USLA 3SG7A 3BFBA 1UWOA 1IWQA 2V53A 3TZ1A 2MRDA 3O78A 1RWYA 1SMGA 3UO9A 4F7FA 2CNPA 1A2XA 1OMRA 3OX5A 1YR5A 1JC2A 4PE0A 1B7TZ 1RK9A 3VB1A 2WCMA 3D0YA 2BKHB 2HQ8A 3K21A 1TCFA 1VRKA 3KO0A 4AOMA 2KOTA 3E3RA 3VGOA 1A29A 3DZTA 2KLEA 2M1KB 1EL4A 2KDHA 4DUQA 4JKTA 5AEQA 2OS8B 2LV7A 1BG1A 5CPVA 3VRNA 2Q4UA 2K60A 1NUBA 4IL1A 5F6TA 1TUZA 3L4LA 2KYCA 2L5XB 1B1GA 1FI6A 3NSLA 1V1FA 2G2BA 3OHMB 2D8NA 5DKQA 1F4QA 1G8IA 1U5IA 3B7AA 3GK2A 2K61A 2Y5IA 3WHUB 2L0PA 1TNPA 2LUXA 3VROA 5KSZA 1AHRA 1SCMC 4ORCB 1DF0A 1QLKA 1UHIA 1CFDA 5IBWA 3DVEA 1BMOA 1CDMA 1J7PA 2QACA 1LVCD 3UNWA 5AXIA 2F33A 3I5GC 3LK1A 3DXLA 3WXAA 5I2LA 4PHJA 2JT8A 2MLEC 2ZFDA 1DGUA 2KI4B 4YRUA 3A4UB 1NX2A 4OCIA 1AK8A 2WC6A 2Y1NA 2BCAA 4I5NB 2F2OA 2KBMA 2KFGA 1DT7B 1MR8A 1OOJA 2P71A 3EG5B 3I5HB 2LLSA 3NXAA 2ZRTA 1EJ3A 1KWOB 5B8IB 3L4AA 4OVNF 3S0EA 3KPXA 1MQ1A 2KGBC 4FQTA 4XJKB 3NHTA
chains in the Genus database with same CATH topology
3CR2A 5I2QA 3DVJA 2F3YA 1YVHA 4NDDA 1PK0D 1JBAA 3OP0A 5HKYA 2AUCA 2I18A 1ZACA 2ZN8A 1TNQA 2LC5A 5CSFA 4PALA 1QIVA 1M46A 3CR5X 4PHMA 3VRRA 1ZOTB 1ZMZA 2M97A 2EC6B 2CCMA 2JZIA 2WNDA 1F55A 3BUOB 1JSAA 1BR1B 1BU3A 2L4HA 5BPJA 4DS7A 1IJ6A 4ICBA 1S6IA 1QX5B 1XYDA 1J1DA 1A4PA 1EXRA 3EVRA 4DIRA 1DMOA 4HREE 3SG5A 1DJZA 2KI4C 2LVJA 2PASA 3JVTB 2FCDA 4GAOA 1FF1A 1KWOC 3CGAA 5KU1A 1Y1UA 2E30A 1IGVA 4NQGA 2NLNA 1IG5A 4HRHA 5DKNA 2MHHA 4E68A 1SR6B 4AQJA 2FOTA 2NZ0A 1TNXA 1OMDA 3GK1A 1TN4A 1WRLA 1CLMA 1FPWA 1H8BA 2O60A 2ZN9A 3SG6A 1IH0A 4FTGA 2EC6C 2K7BA 2MLFC 1KK7Y 1SNLA 2BBNA 3MSEB 4R1EA 4C0KA 1H4BA 3BOWB 1QXPA 1IKUA 1A75B 2GGMA 2I7AA 2K2AA 3IQOA 1B4CA 1F8HA 1EG4A 2JTTA 1G4YR 2L98A 4DCKA 2JOJA 1NCXA 1B8CA 1CDLA 1XFWO 2ZNDA 1RROA 1JFKA 2OTGB 1S1EA 5I2OA 3SG4A 1FBVA 1S36A 2LP2A 1GGZA 2JXCA 3JVTC 1EG3A 2OPOA 3FWBA 1UHJA 1TIZA 1CFCA 3FS7A 4CFQA 2LAPA 2CBLA 1SR6C 4CIDA 5JJGA 1Q80A 1Y6WA 4MSPA 1BOCA 4FQOA 4MRXA 1CTRA 3HX4A 1N2DA 3DD4A 1XFVO 1DGVA 2EGDA 1K8UA 4JQ0D 2Q91A 1C7WA 1SKTA 1KSMA 1EH2A 2CTNA 1J7OA 2BL0B 1M31A 3BUMB 4I5JA 4MRYA 1SY9A 1WDCC 1BR4B 1M45A 2LE9B 1TOPA 4YI9A 4HSZA 3TDZA 1CM1A 2WOSA 1SL9A 4XJKA 3SJSA 4L9MA 3D10A 2L50A 1MUXA 1IRJA 1M39A 4P2YB 1GGWA 2KYFA 2OTGC 1K9UA 3BUXB 1W7JB 1XVJA 1WY9A 1UHKA 2JNFA 2JRFA 4GGFC 5CSNA 4A4CA 1F54A 1K2HA 2BBMA 1AJ4A 3SIBA 2L2EA 1X02A 1L7ZA 3I5FB 2GV5A 3SG3A 1OZOA 2K0JA 2F3ZA 1Y0VH 1OE9B 1UUSA 5ER4X 2HPSA 1SL7A 2G9BA 1OMVA 4MBEA 2CXJA 3OB1B 1K96A 1N0YA 3VRPA 1YRTB 1AP4A 5HLOA 1ODBA 2KBIA 2BL0C 5PALA 1JFJA 4MVFA 1AVSA 1SW8A 1AJ5A 5CSIA 1F70A 1SBJA 2LCPA 1XK4A 1NP8A 3C1VA 2B1UA 2LMVA 2LMUA 1C07A 1GJYA 4GNKB 2PSRA 2EHBA 4TNCA 4I5KA 3O2PA 3DVKA 2JT3A 2JNXA 3KEVA 1S5GY 2KAXA 1UURA 3CLNA 5ER5A 3BUNB 1QIWA 1QLSA 3KHEA 3BYAA 2K8MB 3D0YB 3PM8A 1L2OB 2I2RE 1G33A 5HKZA 3BOWA 2F8PA 1MF8B 3TDIA 3ICBA 4PDZA 3I5FC 2TN4A 4I5LB 4QJ5B 3EK7A 4NDCA 2PMYA 5G08A 4UPGA 5AERA 4F0ZB 3PALA 3I5IB 4WQ2A 1QV1A 1RTP1 2MJWB 2JU0A 2JQ6A 2Y4QA 2KQ6A 3EVVA 1B8LA 2WCEA 2LHLA 4YGDB 4CLNA 3IQQA 4GGFA 1CFPA 1KFUL 4N1FA 4ETOA 1KFXL 3EK8A 2JWWA 1BLQA 4YBHB 2FCEA 1F4OA 1KQMB 1SRAA 2L4IA 2K7DA 3CS1A 4YGEB 1DF0B 2WC8A 3O4YA 2Y1MA 3NSIA 4GGNA 4MZKA 2M29A 3BXKA 1Y1AA 1BJFA 2H61C 2JXLA 2M8UA 3LLEA 1QATA 3PATA 1TCOB 1C7VA 4PHKA 4C0JA 1B9AA 1Y1XA 4M2QA 4A4BA 3DF0B 3TS5B 1WDCB 3ZWHA 4NDBA 2KAVA 1L2OC 1SK6D 1QS7A 1IQ3A 2PVBA 4P5OE 1QVIY 2O5GA 2COLB 1YTZC 3WNXB 4BY5A 5I8NA 3CZTX 3PSRA 1YX7A 2HETA 2LUCA 2ISDA 5FYXA 1NX0A 1UHHA 3I5IC 5HKWA 1CMGA 5HLVA 1K9PA 2P6BB 1K90D 4GUKA 2M3WA 2HQWA 1DJWA 3EVUA 4GBAA 1IQ5A 1NPQA 2MAZA 4Q04A 3LL8B 4CFRA 1XA5A 1JUOA 1KQMC 3EK4A 1KK7Z 1QTXA 1MXLC 1NX3A 1MWNA 1YUTA 1S6CA 2JPTA 4BY4A 2A4JA 2KFHA 2LM5A 1E8AA 1PVAA 5D69A 3KF9A 2LP3A 1B7TY 4YGBB 2KAYA 1PULA 5J3XA 5HYDA 4PHNA 1GQMA 2BCBA 2I94A 3GK4X 3TS5C 1YUSA 2LMTA 4MZJA 1YRUB 5CSJA 1QASA 2QPTA 4C0LA 1CNPA 2WCFA 4PE7A 2BE4A 4N1GA 4CPVA 2GGZA 2F2PA 2H61A 3FIAA 1WLZA 1J7QA 1DVIA 4WQ3A 4ZCUA 1TRFA 4MN0A 2M1UA 2KI6D 2KQYA 4M2PA 2BE6A 1CB1A 2AMIA 1BODA 2ZKMX 1SL8A 5TNCA 2CT9A 4D1EA 2LVKA 1CMFA 2M0RA 1OZSA 1QX7A 1SYMA 4PCWA 3CTNA 3PFVA 1XFZO 1K95A 1JF0A 3BUWB 3H4SE 5KTYA 1B8RA 1TNWA 1K9KA 1XFXO 3GOFA 2KGRA 3PN7B 1FI5A 2M49B 3EKJA 2H2KA 2ZRSA 4OR9B 4N5XA 2KNEA 2MA2A 4JPZB 1S3PA 2PRUA 4YGCB 3NSOA 1PSRA 2IS9A 3JTDC 2LHIA 1ZFSA 3AAJA 5D7FA 1V1GA 2WORA 5AANA 1F71A 4PE1A 1UHNA 2LLUA 2VRGA 3RM1A 1SCVA 2AAOA 1MXEA 2JT0A 4OKHA 1KCYA 1DJYA 4AQIA 4QJ3B 1M63B 1ZUZA 4WRIA 1IJ5A 1JF2A 3DF0A 1KQVA 4QJ4B 1N65A 2R2IA 4PE4A 1PSBA 1A75A 1S26D 1W7IB 1WLMA 3SG2A 1B47A 1UP5A 2LLTA 3NSKA 1XFUO 1SPYA 1HT9A 3AKBA 2K7CA 2BKIB 2OS8C 2KFFA 3IF7A 2SASA 2LVVA 1RJVA 1J7RA 1DJIA 1YUUA 1QV0A 1ALWA 2KSPA 3M0WA 1NCZA 1LKJA 1S5GZ 1U5IB 3PN7C 2M7NA 1CLBA 1R6PA 2BCXA 1LA3A 1YX8A 1D1OA 3TDUA 1XO5A 4GPLB 1OSAA 4M2OA 4YGAA 1DTLA 2L51A 1YURA 2LVIA 3PLFB 2BECA 1PALA 3HCMA 1KK8B 1LINA 1CDNA 1JWDA 1RFJA 3CWGA 1NX1A 4MZLA 3ZNIA 1DJGA 1FW4A 1QJTA 4GFTA 1CLLA 2NXQA 3FWCA 2JTZA 2FJUB 4ORBB 4U8DA 4YI8A 1CFFA 1J55A 1BF5A 1DJHA 1QX2A 1KSOA 3AAKA 3F45A 3I5HC 3TUYB 1NYAA 5AFPA 2KI6C 1NWDA 5GQQC 1A03A 2KHNA 3O6BA 4JWQA 2M9GA 2NCPA 2RGIA 1BT6A 2MBXA 1DJXA 2ZNEA 2K7OA 3EKHA 2DOQA 1RECA 3BQ3A 2HF5A 4ZCVA 4DRWA 1J1EA 1LXFC 2JULA 2K2FA 3QRXA 1NIWA 1PVBA 4MEWA 2E6WA 3A8RA 2PALA 2NCOA 4OV2A 1XFYO 1QVIZ 4XYNA 1KK8C 1PRWA 1KFUS 3OB2B 1KFXS 5K89A 1HQVA 1K94A 3LCPC 3AKAA 2WCBA 5JOLA 4MLWA 3LK0A 1OQPA 1YVLA 3OX6A 3RLZA 1TTXA 3VRQA 1NCYA 2M7LA 1ALVA 1NSHA 1AUIB 1MHOA 1R2UA 1SCMB 2LNKA 3WHTB 3TUYC 4HRGA 1CDPA 3CR4X 3SIAA 3JTDB 1LA0A 2LANA 1K93D 4ORAB 1WRKA 2JC2A 1CM4A 2SCPA 1WRZA 1S6JA 1XK4C 5DKRA 3DVMA 3I5GB 4USLA 3SG7A 3TZ1A 1UWOA 1IWQA 2V53A 2MRDA 3O78A 1RWYA 1SMGA 2CNPA 1A2XA 1OMRA 3OX5A 1YR5A 1JC2A 4PE0A 1B7TZ 1RK9A 3D0YA 2BKHB 2HQ8A 3K21A 1TCFA 1VRKA 3KO0A 4AOMA 2KOTA 3E3RA 3VGOA 1A29A 2M1KB 1EL4A 2KDHA 4DUQA 5AEQA 2OS8B 2LV7A 1BG1A 5CPVA 3VRNA 2Q4UA 1NUBA 4IL1A 5F6TA 2KYCA 2L5XB 1B1GA 1FI6A 3NSLA 1V1FA 2G2BA 3OHMB 2D8NA 5DKQA 1F4QA 1G8IA 1U5IA 3GK2A 3WHUB 2K61A 2Y5IA 2L0PA 1TNPA 2LUXA 3VROA 5KSZA 1AHRA 1SCMC 4ORCB 1DF0A 1QLKA 1UHIA 1CFDA 5IBWA 3DVEA 1BMOA 1CDMA 1J7PA 2QACA 1LVCD 5AXIA 2F33A 3I5GC 3LK1A 3WXAA 5I2LA 4PHJA 2JT8A 2MLEC 2ZFDA 1DGUA 2KI4B 4YRUA 3A4UB 1NX2A 4OCIA 1AK8A 2Y1NA 1CKKA 2BCAA 4I5NB 2F2OA 2KBMA 2KFGA 1DT7B 1MR8A 1OOJA 3I5HB 2LLSA 3NXAA 2ZRTA 1EJ3A 1KWOB 5B8IB 4OVNF 3KPXA 1MQ1A 2KGBC 4XJKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CR2 A;  5I2Q A;  3DVJ A;  2F3Y A;  1YVH A;  4NDD A;  1PK0 D;  1JBA A;  3OP0 A;  5HKY A;  2AUC A;  2I18 A;  1ZAC A;  2ZN8 A;  1TNQ A;  2LC5 A;  5CSF A;  4PAL A;  1QIV A;  1M46 A;  3CR5 X;  4PHM A;  3VRR A;  1ZOT B;  1ZMZ A;  2M97 A;  2EC6 B;  2CCM A;  2JZI A;  2WND A;  1F55 A;  3BUO B;  1JSA A;  1BR1 B;  1BU3 A;  2L4H A;  5BPJ A;  4DS7 A;  1IJ6 A;  4ICB A;  1S6I A;  1QX5 B;  1XYD A;  1J1D A;  1A4P A;  1EXR A;  3EVR A;  4DIR A;  1DMO A;  4HRE E;  3SG5 A;  1DJZ A;  2KI4 C;  2LVJ A;  2PAS A;  3JVT B;  2FCD A;  4GAO A;  1FF1 A;  1KWO C;  3CGA A;  5KU1 A;  1Y1U A;  2E30 A;  1IGV A;  4NQG A;  2NLN A;  1IG5 A;  4HRH A;  5DKN A;  2MHH A;  4E68 A;  1SR6 B;  4AQJ A;  2FOT A;  2NZ0 A;  1TNX A;  1OMD A;  3GK1 A;  1TN4 A;  1WRL A;  1CLM A;  1FPW A;  1H8B A;  2O60 A;  2ZN9 A;  3SG6 A;  1IH0 A;  4FTG A;  2EC6 C;  2K7B A;  2MLF C;  1KK7 Y;  1SNL A;  2BBN A;  3MSE B;  4R1E A;  4C0K A;  1H4B A;  3BOW B;  1QXP A;  1IKU A;  1A75 B;  2GGM A;  2I7A A;  2K2A A;  3IQO A;  1B4C A;  1F8H A;  1EG4 A;  2JTT A;  1G4Y R;  2L98 A;  4DCK A;  2JOJ A;  1NCX A;  1B8C A;  1CDL A;  1XFW O;  2ZND A;  1RRO A;  1JFK A;  2OTG B;  1S1E A;  5I2O A;  3SG4 A;  1FBV A;  1S36 A;  2LP2 A;  1GGZ A;  2JXC A;  3JVT C;  1EG3 A;  2OPO A;  3FWB A;  1UHJ A;  1TIZ A;  1CFC A;  3FS7 A;  4CFQ A;  2LAP A;  2CBL A;  1SR6 C;  4CID A;  5JJG A;  1Q80 A;  1Y6W A;  4MSP A;  1BOC A;  4FQO A;  4MRX A;  1CTR A;  3HX4 A;  1N2D A;  3DD4 A;  1XFV O;  1DGV A;  2EGD A;  1K8U A;  4JQ0 D;  2Q91 A;  1C7W A;  1SKT A;  1KSM A;  1EH2 A;  2CTN A;  1J7O A;  2BL0 B;  1M31 A;  3BUM B;  4I5J A;  4MRY A;  1SY9 A;  1WDC C;  1BR4 B;  1M45 A;  2LE9 B;  1TOP A;  4YI9 A;  4HSZ A;  3TDZ A;  1CM1 A;  2WOS A;  1SL9 A;  4XJK A;  3SJS A;  4L9M A;  3D10 A;  2L50 A;  1MUX A;  1IRJ A;  1M39 A;  4P2Y B;  1GGW A;  2KYF A;  2OTG C;  1K9U A;  3BUX B;  1W7J B;  1XVJ A;  1WY9 A;  1UHK A;  2JNF A;  2JRF A;  4GGF C;  5CSN A;  4A4C A;  1F54 A;  1K2H A;  2BBM A;  1AJ4 A;  3SIB A;  2L2E A;  1X02 A;  1L7Z A;  3I5F B;  2GV5 A;  3SG3 A;  1OZO A;  2K0J A;  2F3Z A;  1Y0V H;  1OE9 B;  1UUS A;  5ER4 X;  2HPS A;  1SL7 A;  2G9B A;  1OMV A;  4MBE A;  2CXJ A;  3OB1 B;  1K96 A;  1N0Y A;  3VRP A;  1YRT B;  1AP4 A;  5HLO A;  1ODB A;  2KBI A;  2BL0 C;  5PAL A;  1JFJ A;  4MVF A;  1AVS A;  1SW8 A;  1AJ5 A;  5CSI A;  1F70 A;  1SBJ A;  2LCP A;  1XK4 A;  1NP8 A;  3C1V A;  2B1U A;  2LMV A;  2LMU A;  1C07 A;  1GJY A;  4GNK B;  2PSR A;  2EHB A;  4TNC A;  4I5K A;  3O2P A;  3DVK A;  2JT3 A;  2JNX A;  3KEV A;  1S5G Y;  2KAX A;  1UUR A;  3CLN A;  5ER5 A;  3BUN B;  1QIW A;  1QLS A;  3KHE A;  3BYA A;  2K8M B;  3D0Y B;  3PM8 A;  1L2O B;  2I2R E;  1G33 A;  5HKZ A;  3BOW A;  2F8P A;  1MF8 B;  3TDI A;  3ICB A;  4PDZ A;  3I5F C;  2TN4 A;  4I5L B;  4QJ5 B;  3EK7 A;  4NDC A;  2PMY A;  5G08 A;  4UPG A;  5AER A;  4F0Z B;  3PAL A;  3I5I B;  4WQ2 A;  1QV1 A;  1RTP 1;  2MJW B;  2JU0 A;  2JQ6 A;  2Y4Q A;  2KQ6 A;  3EVV A;  1B8L A;  2WCE A;  2LHL A;  4YGD B;  4CLN A;  3IQQ A;  4GGF A;  1CFP A;  1KFU L;  4N1F A;  4ETO A;  1KFX L;  3EK8 A;  2JWW A;  1BLQ A;  4YBH B;  2FCE A;  1F4O A;  1KQM B;  1SRA A;  2L4I A;  2K7D A;  3CS1 A;  4YGE B;  1DF0 B;  2WC8 A;  3O4Y A;  2Y1M A;  3NSI A;  4GGN A;  4MZK A;  2M29 A;  3BXK A;  1Y1A A;  1BJF A;  2H61 C;  2JXL A;  2M8U A;  3LLE A;  1QAT A;  3PAT A;  1TCO B;  1C7V A;  4PHK A;  4C0J A;  1B9A A;  1Y1X A;  4M2Q A;  4A4B A;  3DF0 B;  3TS5 B;  1WDC B;  3ZWH A;  4NDB A;  2KAV A;  1L2O C;  1SK6 D;  1QS7 A;  1IQ3 A;  2PVB A;  4P5O E;  1QVI Y;  2O5G A;  2COL B;  1YTZ C;  3WNX B;  4BY5 A;  5I8N A;  3CZT X;  3PSR A;  1YX7 A;  2HET A;  2LUC A;  2ISD A;  5FYX A;  1NX0 A;  1UHH A;  3I5I C;  5HKW A;  1CMG A;  5HLV A;  1K9P A;  2P6B B;  1K90 D;  4GUK A;  2M3W A;  2HQW A;  1DJW A;  3EVU A;  4GBA A;  1IQ5 A;  1NPQ A;  2MAZ A;  4Q04 A;  3LL8 B;  4CFR A;  1XA5 A;  1JUO A;  1KQM C;  3EK4 A;  1KK7 Z;  1QTX A;  1MXL C;  1NX3 A;  1MWN A;  1YUT A;  1S6C A;  2JPT A;  4BY4 A;  2A4J A;  2KFH A;  2LM5 A;  1E8A A;  1PVA A;  5D69 A;  3KF9 A;  2LP3 A;  1B7T Y;  4YGB B;  2KAY A;  1PUL A;  5J3X A;  5HYD A;  4PHN A;  1GQM A;  2BCB A;  2I94 A;  3GK4 X;  3TS5 C;  1YUS A;  2LMT A;  4MZJ A;  1YRU B;  5CSJ A;  1QAS A;  2QPT A;  4C0L A;  1CNP A;  2WCF A;  4PE7 A;  2BE4 A;  4N1G A;  4CPV A;  2GGZ A;  2F2P A;  2H61 A;  3FIA A;  1WLZ A;  1J7Q A;  1DVI A;  4WQ3 A;  4ZCU A;  1TRF A;  4MN0 A;  2M1U A;  2KI6 D;  2KQY A;  4M2P A;  2BE6 A;  1CB1 A;  2AMI A;  1BOD A;  2ZKM X;  1SL8 A;  5TNC A;  2CT9 A;  4D1E A;  2LVK A;  1CMF A;  2M0R A;  1OZS A;  1QX7 A;  1SYM A;  4PCW A;  3CTN A;  3PFV A;  1XFZ O;  1K95 A;  1JF0 A;  3BUW B;  3H4S E;  5KTY A;  1B8R A;  1TNW A;  1K9K A;  1XFX O;  3GOF A;  2KGR A;  3PN7 B;  1FI5 A;  2M49 B;  3EKJ A;  2H2K A;  2ZRS A;  4OR9 B;  4N5X A;  2KNE A;  2MA2 A;  4JPZ B;  1S3P A;  2PRU A;  4YGC B;  3NSO A;  1PSR A;  2IS9 A;  3JTD C;  2LHI A;  1ZFS A;  3AAJ A;  5D7F A;  1V1G A;  2WOR A;  5AAN A;  1F71 A;  4PE1 A;  1UHN A;  2LLU A;  2VRG A;  3RM1 A;  1SCV A;  2AAO A;  1MXE A;  2JT0 A;  4OKH A;  1KCY A;  1DJY A;  4AQI A;  4QJ3 B;  1M63 B;  1ZUZ A;  4WRI A;  1IJ5 A;  1JF2 A;  3DF0 A;  1KQV A;  4QJ4 B;  1N65 A;  2R2I A;  4PE4 A;  1PSB A;  1A75 A;  1S26 D;  1W7I B;  1WLM A;  3SG2 A;  1B47 A;  1UP5 A;  2LLT A;  3NSK A;  1XFU O;  1SPY A;  1HT9 A;  3AKB A;  2K7C A;  2BKI B;  2OS8 C;  2KFF A;  3IF7 A;  2SAS A;  2LVV A;  1RJV A;  1J7R A;  1DJI A;  1YUU A;  1QV0 A;  1ALW A;  2KSP A;  3M0W A;  1NCZ A;  1LKJ A;  1S5G Z;  1U5I B;  3PN7 C;  2M7N A;  1CLB A;  1R6P A;  2BCX A;  1LA3 A;  1YX8 A;  1D1O A;  3TDU A;  1XO5 A;  4GPL B;  1OSA A;  4M2O A;  4YGA A;  1DTL A;  2L51 A;  1YUR A;  2LVI A;  3PLF B;  2BEC A;  1PAL A;  3HCM A;  1KK8 B;  1LIN A;  1CDN A;  1JWD A;  1RFJ A;  3CWG A;  1NX1 A;  4MZL A;  3ZNI A;  1DJG A;  1FW4 A;  1QJT A;  4GFT A;  1CLL A;  2NXQ A;  3FWC A;  2JTZ A;  2FJU B;  4ORB B;  4U8D A;  4YI8 A;  1CFF A;  1J55 A;  1BF5 A;  1DJH A;  1QX2 A;  1KSO A;  3AAK A;  3F45 A;  3I5H C;  3TUY B;  1NYA A;  5AFP A;  2KI6 C;  1NWD A;  5GQQ C;  1A03 A;  2KHN A;  3O6B A;  4JWQ A;  2M9G A;  2NCP A;  2RGI A;  1BT6 A;  2MBX A;  1DJX A;  2ZNE A;  2K7O A;  3EKH A;  2DOQ A;  1REC A;  3BQ3 A;  2HF5 A;  4ZCV A;  4DRW A;  1J1E A;  1LXF C;  2JUL A;  2K2F A;  3QRX A;  1NIW A;  1PVB A;  4MEW A;  2E6W A;  3A8R A;  2PAL A;  2NCO A;  4OV2 A;  1XFY O;  1QVI Z;  4XYN A;  1KK8 C;  1PRW A;  1KFU S;  3OB2 B;  1KFX S;  5K89 A;  1HQV A;  1K94 A;  3LCP C;  3AKA A;  2WCB A;  5JOL A;  4MLW A;  3LK0 A;  1OQP A;  1YVL A;  3OX6 A;  3RLZ A;  1TTX A;  3VRQ A;  1NCY A;  2M7L A;  1ALV A;  1NSH A;  1AUI B;  1MHO A;  1R2U A;  1SCM B;  2LNK A;  3WHT B;  3TUY C;  4HRG A;  1CDP A;  3CR4 X;  3SIA A;  3JTD B;  1LA0 A;  2LAN A;  1K93 D;  4ORA B;  1WRK A;  2JC2 A;  1CM4 A;  2SCP A;  1WRZ A;  1S6J A;  1XK4 C;  5DKR A;  3DVM A;  3I5G B;  4USL A;  3SG7 A;  3TZ1 A;  1UWO A;  1IWQ A;  2V53 A;  2MRD A;  3O78 A;  1RWY A;  1SMG A;  2CNP A;  1A2X A;  1OMR A;  3OX5 A;  1YR5 A;  1JC2 A;  4PE0 A;  1B7T Z;  1RK9 A;  3D0Y A;  2BKH B;  2HQ8 A;  3K21 A;  1TCF A;  1VRK A;  3KO0 A;  4AOM A;  2KOT A;  3E3R A;  3VGO A;  1A29 A;  2M1K B;  1EL4 A;  2KDH A;  4DUQ A;  5AEQ A;  2OS8 B;  2LV7 A;  1BG1 A;  5CPV A;  3VRN A;  2Q4U A;  1NUB A;  4IL1 A;  5F6T A;  2KYC A;  2L5X B;  1B1G A;  1FI6 A;  3NSL A;  1V1F A;  2G2B A;  3OHM B;  2D8N A;  5DKQ A;  1F4Q A;  1G8I A;  1U5I A;  3GK2 A;  3WHU B;  2K61 A;  2Y5I A;  2L0P A;  1TNP A;  2LUX A;  3VRO A;  5KSZ A;  1AHR A;  1SCM C;  4ORC B;  1DF0 A;  1QLK A;  1UHI A;  1CFD A;  5IBW A;  3DVE A;  1BMO A;  1CDM A;  1J7P A;  2QAC A;  1LVC D;  5AXI A;  2F33 A;  3I5G C;  3LK1 A;  3WXA A;  5I2L A;  4PHJ A;  2JT8 A;  2MLE C;  2ZFD A;  1DGU A;  2KI4 B;  4YRU A;  3A4U B;  1NX2 A;  4OCI A;  1AK8 A;  2Y1N A;  1CKK A;  2BCA A;  4I5N B;  2F2O A;  2KBM A;  2KFG A;  1DT7 B;  1MR8 A;  1OOJ A;  3I5H B;  2LLS A;  3NXA A;  2ZRT A;  1EJ3 A;  1KWO B;  5B8I B;  4OVN F;  3KPX A;  1MQ1 A;  2KGB C;  4XJK B; 
#chains in the Genus database with same CATH topology
 3CR2 A;  5I2Q A;  3DVJ A;  2F3Y A;  1YVH A;  1OW4 A;  4NDD A;  1PK0 D;  1JBA A;  3OP0 A;  2H8V A;  5HKY A;  2AUC A;  2I18 A;  1ZAC A;  2ZN8 A;  1TNQ A;  2LC5 A;  5CSF A;  4PAL A;  1QIV A;  1M46 A;  3CR5 X;  4PHM A;  1W9Z A;  1ZOT B;  3VRR A;  1ZMZ A;  2M97 A;  2EC6 B;  2CCM A;  2JZI A;  2WND A;  1F55 A;  3BUO B;  1JSA A;  3D74 A;  1BR1 B;  1BU3 A;  2L4H A;  5BPJ A;  4DS7 A;  1IJ6 A;  4ICB A;  1S6I A;  1QX5 B;  1XYD A;  1T14 A;  2KPH A;  2WCH A;  1J1D A;  1A4P A;  1EXR A;  3EVR A;  4DIR A;  1DMO A;  4HRE E;  3SG5 A;  1DJZ A;  2KI4 C;  2LVJ A;  3S0B A;  2PAS A;  2L5Y A;  3JVT B;  2FCD A;  4GAO A;  1FF1 A;  2BAP A;  1KWO C;  3CGA A;  5KU1 A;  1Y1U A;  2E30 A;  1IGV A;  4NQG A;  2NLN A;  1LS8 A;  1IG5 A;  3NHI A;  4HRH A;  3OBV A;  2MHH A;  5DKN A;  1SR6 B;  4AQJ A;  4E68 A;  2FOT A;  2NZ0 A;  1TNX A;  1OMD A;  3D73 A;  3GK1 A;  3K1E A;  1TN4 A;  1WRL A;  1CLM A;  1FPW A;  1H8B A;  2O60 A;  3FE8 A;  2ZN9 A;  3SG6 A;  1IH0 A;  1Z4H A;  4FTG A;  2WC5 A;  2EC6 C;  2K7B A;  2MLF C;  1KK7 Y;  1SNL A;  2BBN A;  3MSE B;  3R1O A;  4R1E A;  3S0D A;  4C0K A;  1H4B A;  3BOW B;  1QXP A;  1IKU A;  1A75 B;  2GGM A;  2I7A A;  2K2A A;  3IQO A;  1B4C A;  1F8H A;  3V2L A;  1EG4 A;  2JTT A;  1G4Y R;  2L98 A;  4DCK A;  2JOJ A;  1NCX A;  1B8C A;  1CDL A;  1XFW O;  2ZND A;  1RRO A;  1JFK A;  2OTG B;  1S1E A;  5I2O A;  3R1V A;  3SG4 A;  1FBV A;  1S36 A;  2LP2 A;  1GGZ A;  2JXC A;  3JVT C;  1EG3 A;  2OPO A;  3FWB A;  1UHJ A;  1TIZ A;  1CFC A;  3FS7 A;  4CFQ A;  2LAP A;  2CBL A;  1SR6 C;  4CID A;  5JJG A;  1Q80 A;  1Y6W A;  4MSP A;  1BOC A;  3PJI A;  4FQO A;  4MRX A;  1CTR A;  3HX4 A;  1N2D A;  3DD4 A;  1XFV O;  1DGV A;  2EGD A;  1K8U A;  4JQ0 D;  1P28 A;  2Q91 A;  1C7W A;  1SKT A;  2P70 A;  5FI2 A;  1KSM A;  1EH2 A;  2CTN A;  1J7O A;  2BL0 B;  1M31 A;  3BUM B;  4I5J A;  4MRY A;  1SY9 A;  1WDC C;  1BR4 B;  1M45 A;  2LE9 B;  1TOP A;  4YI9 A;  4HSZ A;  3TDZ A;  1CM1 A;  2WOS A;  3NGV A;  1SL9 A;  4XJK A;  3SJS A;  2PQL A;  4L9M A;  3D10 A;  2L50 A;  1MUX A;  1IRJ A;  1M39 A;  4P2Y B;  1GGW A;  2KYF A;  2OTG C;  1K9U A;  3BUX B;  2YGU A;  1W7J B;  1XVJ A;  1WY9 A;  1UHK A;  2JNF A;  2JRF A;  4GGF C;  5CSN A;  4A4C A;  3CDN A;  1F54 A;  1K2H A;  3FE9 A;  4INW A;  2BBM A;  1AJ4 A;  3CYZ A;  3SIB A;  2L2E A;  1X02 A;  1L7Z A;  3I5F B;  2GV5 A;  4OZD A;  3SG3 A;  1OZO A;  1OOI X;  2K0J A;  2F3Z A;  3CAB A;  1Y0V H;  2QEO A;  5DIC A;  1OE9 B;  1UUS A;  5ER4 X;  2HPS A;  1SL7 A;  3R1P A;  2G9B A;  1OMV A;  4MBE A;  2CXJ A;  3OB1 B;  1K96 A;  1N0Y A;  3SS4 A;  3VRP A;  1YRT B;  1AP4 A;  5HLO A;  1C3Y A;  3FE6 A;  1ODB A;  2KBI A;  2QEV A;  2BL0 C;  5PAL A;  1JFJ A;  1GM0 A;  4MVF A;  1AVS A;  1SW8 A;  1AJ5 A;  5CSI A;  1F70 A;  1SBJ A;  2KLD A;  2LCP A;  1XK4 A;  1NP8 A;  3C1V A;  2B1U A;  2LMV A;  2LMU A;  1C07 A;  1GJY A;  4GNK B;  2PSR A;  2WCK A;  2EHB A;  4TNC A;  4I5K A;  3O2P A;  3DVK A;  2JT3 A;  2JNX A;  3KEV A;  1S5G Y;  2KAX A;  1UUR A;  3CLN A;  5ER5 A;  3BUN B;  1QIW A;  1QLS A;  3KHE A;  3BYA A;  2K8M B;  3D0Y B;  3PM8 A;  1L2O B;  2I2R E;  1G33 A;  5HKZ A;  3BOW A;  2F8P A;  1MF8 B;  1OOH A;  3TDI A;  3ICB A;  3R72 A;  4PDZ A;  3I5F C;  2TN4 A;  4I5L B;  4QJ5 B;  2QEB A;  3EK7 A;  4NDC A;  2PMY A;  5G08 A;  4UPG A;  5AER A;  4F0Z B;  3PAL A;  3I5I B;  3IVT A;  4WQ2 A;  1QV1 A;  1RTP 1;  2MJW B;  2JU0 A;  2JQ6 A;  2Y4Q A;  2KQ6 A;  3EVV A;  1B8L A;  2WCE A;  2LHL A;  4YGD B;  4CLN A;  3IQQ A;  3DYE A;  4GGF A;  2BNX A;  1CFP A;  1KFU L;  4N1F A;  3OGN A;  4ETO A;  1KFX L;  3EK8 A;  3N7H A;  2JWW A;  1BLQ A;  4YBH B;  2FCE A;  1F4O A;  1KQM B;  1SRA A;  2L4I A;  2K7D A;  3CS1 A;  4YGE B;  1DF0 B;  2WC8 A;  2ERB A;  1CKK A;  3O4Y A;  3D75 A;  2Y1M A;  3NSI A;  4GGN A;  4MZK A;  2M29 A;  3BXK A;  1Y1A A;  1BJF A;  2H61 C;  2JXL A;  2M8U A;  3LLE A;  1QAT A;  3PAT A;  1TCO B;  3SS3 A;  1C7V A;  1IIO A;  4PHK A;  4C0J A;  1B9A A;  1Y1X A;  4M2Q A;  4A4B A;  3DF0 B;  3TS5 B;  1WDC B;  3ZWH A;  4NDB A;  2KAV A;  3CZ1 A;  1L2O C;  1SK6 D;  1QS7 A;  1IQ3 A;  2PVB A;  3PM2 A;  4P5O E;  1QVI Y;  2O5G A;  2COL B;  1YTZ C;  3WNX B;  4BY5 A;  5I8N A;  3CZT X;  3PSR A;  1YX7 A;  2HET A;  2LUC A;  2ISD A;  5FYX A;  1NX0 A;  3S0G A;  1UHH A;  3I5I C;  5HKW A;  5I94 A;  3L47 A;  1DC1 A;  1CMG A;  5HLV A;  1K9P A;  2P6B B;  1K90 D;  1DEK A;  2M3W A;  4GUK A;  2HQW A;  1DJW A;  3EVU A;  4GBA A;  1IQ5 A;  1NPQ A;  2MAZ A;  4Q04 A;  3LL8 B;  4CFR A;  1XA5 A;  1JUO A;  1KQM C;  2QDI A;  1KK7 Z;  3EK4 A;  1QTX A;  3RZS A;  1MXL C;  1NX3 A;  1MWN A;  1YUT A;  1S6C A;  2JPT A;  4BY4 A;  2A4J A;  2KFH A;  2LM5 A;  1E8A A;  1PVA A;  5D69 A;  3KF9 A;  2LP3 A;  1B7T Y;  3B86 A;  4YGB B;  2KAY A;  1PUL A;  5J3X A;  5HYD A;  4PHN A;  3B6X A;  1GQM A;  2BCB A;  3BFA A;  3QME A;  2I94 A;  3GK4 X;  3TS5 C;  1YUS A;  2LMT A;  4MZJ A;  1YRU B;  5CSJ A;  1QAS A;  2QPT A;  4C0L A;  1CNP A;  2WCF A;  4PE7 A;  2BE4 A;  1C3Z A;  4N1G A;  4CPV A;  2GGZ A;  2F2P A;  2H61 A;  3FIA A;  1WLZ A;  1J7Q A;  1DVI A;  4WQ3 A;  4ZCU A;  1TRF A;  4MN0 A;  2M1U A;  1DEL A;  2KI6 D;  2KQY A;  4M2P A;  2BE6 A;  1CB1 A;  2AMI A;  1BOD A;  2ZKM X;  1SL8 A;  5TNC A;  2CT9 A;  4D1E A;  2LVK A;  1CMF A;  2M0R A;  1OZS A;  1QX7 A;  1SYM A;  4PCW A;  3B87 A;  3CTN A;  3PFV A;  3BJH A;  1XFZ O;  4INX A;  1K95 A;  1JF0 A;  3BUW B;  3H4S E;  5EL2 A;  5KTY A;  1B8R A;  1TNW A;  1K9K A;  1XFX O;  3GOF A;  2KGR A;  3PN7 B;  1FI5 A;  2M49 B;  3EKJ A;  1ORG A;  3D76 A;  2H2K A;  2ZRS A;  4OR9 B;  2GTE A;  4N5X A;  2KNE A;  1TWO A;  2MA2 A;  4JPZ B;  1S3P A;  2PRU A;  4YGC B;  3NSO A;  1SSE B;  3CZ2 A;  1PSR A;  2IS9 A;  3JTD C;  2LHI A;  1ZFS A;  3AAJ A;  3Q8I A;  5D7F A;  1V1G A;  2PYQ A;  2WOR A;  5AAN A;  1F71 A;  4PE1 A;  1UHN A;  2LLU A;  2VRG A;  3RM1 A;  1SCV A;  2AAO A;  1MXE A;  2JT0 A;  4OKH A;  1KCY A;  1DJY A;  4AQI A;  4QJ3 B;  1M63 B;  1ZUZ A;  4WRI A;  1IJ5 A;  1JF2 A;  3DF0 A;  1KQV A;  4QJ4 B;  1N65 A;  2R2I A;  4PE4 A;  1PSB A;  1A75 A;  1S26 D;  1W7I B;  1WLM A;  3SG2 A;  1B47 A;  1UP5 A;  2LLT A;  3NSK A;  1XFU O;  1SPY A;  1DQE A;  1HT9 A;  3AKB A;  2WCL A;  2K7C A;  2BKI B;  2JPO A;  2OS8 C;  2KFF A;  3IF7 A;  2SAS A;  2LVV A;  1RJV A;  1J7R A;  1DJI A;  1YUU A;  1QV0 A;  1ALW A;  2KSP A;  3M0W A;  1NCZ A;  4KYN A;  1LKJ A;  1S5G Z;  1U5I B;  3PN7 C;  2M7N A;  1CLB A;  1R6P A;  5FI7 A;  5FI6 A;  2BCX A;  1LA3 A;  3BFH A;  1YX8 A;  2WCJ A;  3TDU A;  1D1O A;  1XO5 A;  2L2C A;  4GPL B;  1XFR A;  1OSA A;  4M2O A;  4YGA A;  1DTL A;  2L51 A;  1YUR A;  2LVI A;  3PLF B;  4PT1 A;  2BEC A;  1PAL A;  3HCM A;  1KK8 B;  1LIN A;  1CDN A;  1JWD A;  1RFJ A;  3CWG A;  1NX1 A;  4MZL A;  3ZNI A;  1DJG A;  1FW4 A;  1QJT A;  4GFT A;  1CLL A;  2NXQ A;  3FWC A;  2JTZ A;  2FJU B;  4ORB B;  2QEH A;  4U8D A;  4YI8 A;  1J55 A;  1CFF A;  1BF5 A;  1DJH A;  1QX2 A;  1KSO A;  3AAK A;  3F45 A;  3I5H C;  3TUY B;  1NYA A;  2FJY A;  5AFP A;  3D78 A;  3D77 A;  3S0F A;  2KI6 C;  1NWD A;  5GQQ C;  1A03 A;  1Z2C B;  2KHN A;  3O6B A;  4JWQ A;  2M9G A;  2NCP A;  2RGI A;  1BT6 A;  2MBX A;  1DJX A;  2ZNE A;  2K7O A;  3EKH A;  2DOQ A;  1REC A;  3BQ3 A;  2HF5 A;  4ZCV A;  4DRW A;  1J1E A;  1LXF C;  2JUL A;  2K2F A;  3QRX A;  1NIW A;  1PVB A;  4MEW A;  2E6W A;  3A8R A;  3O4X A;  2PAL A;  3SS5 A;  2NCO A;  1OOG A;  4OV2 A;  4JD9 A;  1XFY O;  1OOF A;  1QVI Z;  4XYN A;  1KK8 C;  1PRW A;  1KFU S;  3OB2 B;  1KFX S;  1QWV A;  5K89 A;  1HQV A;  1K94 A;  3LCP C;  3AKA A;  4IJ7 A;  2WCB A;  5JOL A;  5D3O A;  4MLW A;  3LK0 A;  1OQP A;  1YVL A;  3OX6 A;  3RLZ A;  1TTX A;  5HL1 A;  3B88 A;  3VRQ A;  1NCY A;  2M7L A;  1ALV A;  1NSH A;  1AUI B;  1MHO A;  1R2U A;  1SCM B;  2LNK A;  3WHT B;  3TUY C;  4HRG A;  1TUJ A;  1CDP A;  3CR4 X;  3SIA A;  3JTD B;  1LA0 A;  2LAN A;  3CZ0 A;  1K93 D;  4ORA B;  3S0A A;  1WRK A;  2JC2 A;  1CM4 A;  2SCP A;  1WRZ A;  1S6J A;  1XK4 C;  5DKR A;  3DVM A;  3DY9 A;  3I5G B;  4USL A;  3SG7 A;  3BFB A;  1UWO A;  1IWQ A;  2V53 A;  3TZ1 A;  2MRD A;  3O78 A;  1RWY A;  1SMG A;  3UO9 A;  4F7F A;  2CNP A;  1A2X A;  1OMR A;  3OX5 A;  1YR5 A;  1JC2 A;  4PE0 A;  1B7T Z;  1RK9 A;  3VB1 A;  2WCM A;  3D0Y A;  2BKH B;  2HQ8 A;  3K21 A;  1TCF A;  1VRK A;  3KO0 A;  4AOM A;  2KOT A;  3E3R A;  3VGO A;  1A29 A;  3DZT A;  2KLE A;  2M1K B;  1EL4 A;  2KDH A;  4DUQ A;  4JKT A;  5AEQ A;  2OS8 B;  2LV7 A;  1BG1 A;  5CPV A;  3VRN A;  2Q4U A;  2K60 A;  1NUB A;  4IL1 A;  5F6T A;  1TUZ A;  3L4L A;  2KYC A;  2L5X B;  1B1G A;  1FI6 A;  3NSL A;  1V1F A;  2G2B A;  3OHM B;  2D8N A;  5DKQ A;  1F4Q A;  1G8I A;  1U5I A;  3B7A A;  3GK2 A;  2K61 A;  2Y5I A;  3WHU B;  2L0P A;  1TNP A;  2LUX A;  3VRO A;  5KSZ A;  1AHR A;  1SCM C;  4ORC B;  1DF0 A;  1QLK A;  1UHI A;  1CFD A;  5IBW A;  3DVE A;  1BMO A;  1CDM A;  1J7P A;  2QAC A;  1LVC D;  3UNW A;  5AXI A;  2F33 A;  3I5G C;  3LK1 A;  3DXL A;  3WXA A;  5I2L A;  4PHJ A;  2JT8 A;  2MLE C;  2ZFD A;  1DGU A;  2KI4 B;  4YRU A;  3A4U B;  1NX2 A;  4OCI A;  1AK8 A;  2WC6 A;  2Y1N A;  2BCA A;  4I5N B;  2F2O A;  2KBM A;  2KFG A;  1DT7 B;  1MR8 A;  1OOJ A;  2P71 A;  3EG5 B;  3I5H B;  2LLS A;  3NXA A;  2ZRT A;  1EJ3 A;  1KWO B;  5B8I B;  3L4A A;  4OVN F;  3S0E A;  3KPX A;  1MQ1 A;  2KGB C;  4FQT A;  4XJK B;  3NHT A; 
#chains in the Genus database with same CATH homology
 3CR2 A;  5I2Q A;  3DVJ A;  2F3Y A;  1YVH A;  4NDD A;  1PK0 D;  1JBA A;  3OP0 A;  5HKY A;  2AUC A;  2I18 A;  1ZAC A;  2ZN8 A;  1TNQ A;  2LC5 A;  5CSF A;  4PAL A;  1QIV A;  1M46 A;  3CR5 X;  4PHM A;  3VRR A;  1ZOT B;  1ZMZ A;  2M97 A;  2EC6 B;  2CCM A;  2JZI A;  2WND A;  1F55 A;  3BUO B;  1JSA A;  1BR1 B;  1BU3 A;  2L4H A;  5BPJ A;  4DS7 A;  1IJ6 A;  4ICB A;  1S6I A;  1QX5 B;  1XYD A;  1J1D A;  1A4P A;  1EXR A;  3EVR A;  4DIR A;  1DMO A;  4HRE E;  3SG5 A;  1DJZ A;  2KI4 C;  2LVJ A;  2PAS A;  3JVT B;  2FCD A;  4GAO A;  1FF1 A;  1KWO C;  3CGA A;  5KU1 A;  1Y1U A;  2E30 A;  1IGV A;  4NQG A;  2NLN A;  1IG5 A;  4HRH A;  5DKN A;  2MHH A;  4E68 A;  1SR6 B;  4AQJ A;  2FOT A;  2NZ0 A;  1TNX A;  1OMD A;  3GK1 A;  1TN4 A;  1WRL A;  1CLM A;  1FPW A;  1H8B A;  2O60 A;  2ZN9 A;  3SG6 A;  1IH0 A;  4FTG A;  2EC6 C;  2K7B A;  2MLF C;  1KK7 Y;  1SNL A;  2BBN A;  3MSE B;  4R1E A;  4C0K A;  1H4B A;  3BOW B;  1QXP A;  1IKU A;  1A75 B;  2GGM A;  2I7A A;  2K2A A;  3IQO A;  1B4C A;  1F8H A;  1EG4 A;  2JTT A;  1G4Y R;  2L98 A;  4DCK A;  2JOJ A;  1NCX A;  1B8C A;  1CDL A;  1XFW O;  2ZND A;  1RRO A;  1JFK A;  2OTG B;  1S1E A;  5I2O A;  3SG4 A;  1FBV A;  1S36 A;  2LP2 A;  1GGZ A;  2JXC A;  3JVT C;  1EG3 A;  2OPO A;  3FWB A;  1UHJ A;  1TIZ A;  1CFC A;  3FS7 A;  4CFQ A;  2LAP A;  2CBL A;  1SR6 C;  4CID A;  5JJG A;  1Q80 A;  1Y6W A;  4MSP A;  1BOC A;  4FQO A;  4MRX A;  1CTR A;  3HX4 A;  1N2D A;  3DD4 A;  1XFV O;  1DGV A;  2EGD A;  1K8U A;  4JQ0 D;  2Q91 A;  1C7W A;  1SKT A;  1KSM A;  1EH2 A;  2CTN A;  1J7O A;  2BL0 B;  1M31 A;  3BUM B;  4I5J A;  4MRY A;  1SY9 A;  1WDC C;  1BR4 B;  1M45 A;  2LE9 B;  1TOP A;  4YI9 A;  4HSZ A;  3TDZ A;  1CM1 A;  2WOS A;  1SL9 A;  4XJK A;  3SJS A;  4L9M A;  3D10 A;  2L50 A;  1MUX A;  1IRJ A;  1M39 A;  4P2Y B;  1GGW A;  2KYF A;  2OTG C;  1K9U A;  3BUX B;  1W7J B;  1XVJ A;  1WY9 A;  1UHK A;  2JNF A;  2JRF A;  4GGF C;  5CSN A;  4A4C A;  1F54 A;  1K2H A;  2BBM A;  1AJ4 A;  3SIB A;  2L2E A;  1X02 A;  1L7Z A;  3I5F B;  2GV5 A;  3SG3 A;  1OZO A;  2K0J A;  2F3Z A;  1Y0V H;  1OE9 B;  1UUS A;  5ER4 X;  2HPS A;  1SL7 A;  2G9B A;  1OMV A;  4MBE A;  2CXJ A;  3OB1 B;  1K96 A;  1N0Y A;  3VRP A;  1YRT B;  1AP4 A;  5HLO A;  1ODB A;  2KBI A;  2BL0 C;  5PAL A;  1JFJ A;  4MVF A;  1AVS A;  1SW8 A;  1AJ5 A;  5CSI A;  1F70 A;  1SBJ A;  2LCP A;  1XK4 A;  1NP8 A;  3C1V A;  2B1U A;  2LMV A;  2LMU A;  1C07 A;  1GJY A;  4GNK B;  2PSR A;  2EHB A;  4TNC A;  4I5K A;  3O2P A;  3DVK A;  2JT3 A;  2JNX A;  3KEV A;  1S5G Y;  2KAX A;  1UUR A;  3CLN A;  5ER5 A;  3BUN B;  1QIW A;  1QLS A;  3KHE A;  3BYA A;  2K8M B;  3D0Y B;  3PM8 A;  1L2O B;  2I2R E;  1G33 A;  5HKZ A;  3BOW A;  2F8P A;  1MF8 B;  3TDI A;  3ICB A;  4PDZ A;  3I5F C;  2TN4 A;  4I5L B;  4QJ5 B;  3EK7 A;  4NDC A;  2PMY A;  5G08 A;  4UPG A;  5AER A;  4F0Z B;  3PAL A;  3I5I B;  4WQ2 A;  1QV1 A;  1RTP 1;  2MJW B;  2JU0 A;  2JQ6 A;  2Y4Q A;  2KQ6 A;  3EVV A;  1B8L A;  2WCE A;  2LHL A;  4YGD B;  4CLN A;  3IQQ A;  4GGF A;  1CFP A;  1KFU L;  4N1F A;  4ETO A;  1KFX L;  3EK8 A;  2JWW A;  1BLQ A;  4YBH B;  2FCE A;  1F4O A;  1KQM B;  1SRA A;  2L4I A;  2K7D A;  3CS1 A;  4YGE B;  1DF0 B;  2WC8 A;  3O4Y A;  2Y1M A;  3NSI A;  4GGN A;  4MZK A;  2M29 A;  3BXK A;  1Y1A A;  1BJF A;  2H61 C;  2JXL A;  2M8U A;  3LLE A;  1QAT A;  3PAT A;  1TCO B;  1C7V A;  4PHK A;  4C0J A;  1B9A A;  1Y1X A;  4M2Q A;  4A4B A;  3DF0 B;  3TS5 B;  1WDC B;  3ZWH A;  4NDB A;  2KAV A;  1L2O C;  1SK6 D;  1QS7 A;  1IQ3 A;  2PVB A;  4P5O E;  1QVI Y;  2O5G A;  2COL B;  1YTZ C;  3WNX B;  4BY5 A;  5I8N A;  3CZT X;  3PSR A;  1YX7 A;  2HET A;  2LUC A;  2ISD A;  5FYX A;  1NX0 A;  1UHH A;  3I5I C;  5HKW A;  1CMG A;  5HLV A;  1K9P A;  2P6B B;  1K90 D;  4GUK A;  2M3W A;  2HQW A;  1DJW A;  3EVU A;  4GBA A;  1IQ5 A;  1NPQ A;  2MAZ A;  4Q04 A;  3LL8 B;  4CFR A;  1XA5 A;  1JUO A;  1KQM C;  3EK4 A;  1KK7 Z;  1QTX A;  1MXL C;  1NX3 A;  1MWN A;  1YUT A;  1S6C A;  2JPT A;  4BY4 A;  2A4J A;  2KFH A;  2LM5 A;  1E8A A;  1PVA A;  5D69 A;  3KF9 A;  2LP3 A;  1B7T Y;  4YGB B;  2KAY A;  1PUL A;  5J3X A;  5HYD A;  4PHN A;  1GQM A;  2BCB A;  2I94 A;  3GK4 X;  3TS5 C;  1YUS A;  2LMT A;  4MZJ A;  1YRU B;  5CSJ A;  1QAS A;  2QPT A;  4C0L A;  1CNP A;  2WCF A;  4PE7 A;  2BE4 A;  4N1G A;  4CPV A;  2GGZ A;  2F2P A;  2H61 A;  3FIA A;  1WLZ A;  1J7Q A;  1DVI A;  4WQ3 A;  4ZCU A;  1TRF A;  4MN0 A;  2M1U A;  2KI6 D;  2KQY A;  4M2P A;  2BE6 A;  1CB1 A;  2AMI A;  1BOD A;  2ZKM X;  1SL8 A;  5TNC A;  2CT9 A;  4D1E A;  2LVK A;  1CMF A;  2M0R A;  1OZS A;  1QX7 A;  1SYM A;  4PCW A;  3CTN A;  3PFV A;  1XFZ O;  1K95 A;  1JF0 A;  3BUW B;  3H4S E;  5KTY A;  1B8R A;  1TNW A;  1K9K A;  1XFX O;  3GOF A;  2KGR A;  3PN7 B;  1FI5 A;  2M49 B;  3EKJ A;  2H2K A;  2ZRS A;  4OR9 B;  4N5X A;  2KNE A;  2MA2 A;  4JPZ B;  1S3P A;  2PRU A;  4YGC B;  3NSO A;  1PSR A;  2IS9 A;  3JTD C;  2LHI A;  1ZFS A;  3AAJ A;  5D7F A;  1V1G A;  2WOR A;  5AAN A;  1F71 A;  4PE1 A;  1UHN A;  2LLU A;  2VRG A;  3RM1 A;  1SCV A;  2AAO A;  1MXE A;  2JT0 A;  4OKH A;  1KCY A;  1DJY A;  4AQI A;  4QJ3 B;  1M63 B;  1ZUZ A;  4WRI A;  1IJ5 A;  1JF2 A;  3DF0 A;  1KQV A;  4QJ4 B;  1N65 A;  2R2I A;  4PE4 A;  1PSB A;  1A75 A;  1S26 D;  1W7I B;  1WLM A;  3SG2 A;  1B47 A;  1UP5 A;  2LLT A;  3NSK A;  1XFU O;  1SPY A;  1HT9 A;  3AKB A;  2K7C A;  2BKI B;  2OS8 C;  2KFF A;  3IF7 A;  2SAS A;  2LVV A;  1RJV A;  1J7R A;  1DJI A;  1YUU A;  1QV0 A;  1ALW A;  2KSP A;  3M0W A;  1NCZ A;  1LKJ A;  1S5G Z;  1U5I B;  3PN7 C;  2M7N A;  1CLB A;  1R6P A;  2BCX A;  1LA3 A;  1YX8 A;  1D1O A;  3TDU A;  1XO5 A;  4GPL B;  1OSA A;  4M2O A;  4YGA A;  1DTL A;  2L51 A;  1YUR A;  2LVI A;  3PLF B;  2BEC A;  1PAL A;  3HCM A;  1KK8 B;  1LIN A;  1CDN A;  1JWD A;  1RFJ A;  3CWG A;  1NX1 A;  4MZL A;  3ZNI A;  1DJG A;  1FW4 A;  1QJT A;  4GFT A;  1CLL A;  2NXQ A;  3FWC A;  2JTZ A;  2FJU B;  4ORB B;  4U8D A;  4YI8 A;  1CFF A;  1J55 A;  1BF5 A;  1DJH A;  1QX2 A;  1KSO A;  3AAK A;  3F45 A;  3I5H C;  3TUY B;  1NYA A;  5AFP A;  2KI6 C;  1NWD A;  5GQQ C;  1A03 A;  2KHN A;  3O6B A;  4JWQ A;  2M9G A;  2NCP A;  2RGI A;  1BT6 A;  2MBX A;  1DJX A;  2ZNE A;  2K7O A;  3EKH A;  2DOQ A;  1REC A;  3BQ3 A;  2HF5 A;  4ZCV A;  4DRW A;  1J1E A;  1LXF C;  2JUL A;  2K2F A;  3QRX A;  1NIW A;  1PVB A;  4MEW A;  2E6W A;  3A8R A;  2PAL A;  2NCO A;  4OV2 A;  1XFY O;  1QVI Z;  4XYN A;  1KK8 C;  1PRW A;  1KFU S;  3OB2 B;  1KFX S;  5K89 A;  1HQV A;  1K94 A;  3LCP C;  3AKA A;  2WCB A;  5JOL A;  4MLW A;  3LK0 A;  1OQP A;  1YVL A;  3OX6 A;  3RLZ A;  1TTX A;  3VRQ A;  1NCY A;  2M7L A;  1ALV A;  1NSH A;  1AUI B;  1MHO A;  1R2U A;  1SCM B;  2LNK A;  3WHT B;  3TUY C;  4HRG A;  1CDP A;  3CR4 X;  3SIA A;  3JTD B;  1LA0 A;  2LAN A;  1K93 D;  4ORA B;  1WRK A;  2JC2 A;  1CM4 A;  2SCP A;  1WRZ A;  1S6J A;  1XK4 C;  5DKR A;  3DVM A;  3I5G B;  4USL A;  3SG7 A;  3TZ1 A;  1UWO A;  1IWQ A;  2V53 A;  2MRD A;  3O78 A;  1RWY A;  1SMG A;  2CNP A;  1A2X A;  1OMR A;  3OX5 A;  1YR5 A;  1JC2 A;  4PE0 A;  1B7T Z;  1RK9 A;  3D0Y A;  2BKH B;  2HQ8 A;  3K21 A;  1TCF A;  1VRK A;  3KO0 A;  4AOM A;  2KOT A;  3E3R A;  3VGO A;  1A29 A;  2M1K B;  1EL4 A;  2KDH A;  4DUQ A;  5AEQ A;  2OS8 B;  2LV7 A;  1BG1 A;  5CPV A;  3VRN A;  2Q4U A;  1NUB A;  4IL1 A;  5F6T A;  2KYC A;  2L5X B;  1B1G A;  1FI6 A;  3NSL A;  1V1F A;  2G2B A;  3OHM B;  2D8N A;  5DKQ A;  1F4Q A;  1G8I A;  1U5I A;  3GK2 A;  3WHU B;  2K61 A;  2Y5I A;  2L0P A;  1TNP A;  2LUX A;  3VRO A;  5KSZ A;  1AHR A;  1SCM C;  4ORC B;  1DF0 A;  1QLK A;  1UHI A;  1CFD A;  5IBW A;  3DVE A;  1BMO A;  1CDM A;  1J7P A;  2QAC A;  1LVC D;  5AXI A;  2F33 A;  3I5G C;  3LK1 A;  3WXA A;  5I2L A;  4PHJ A;  2JT8 A;  2MLE C;  2ZFD A;  1DGU A;  2KI4 B;  4YRU A;  3A4U B;  1NX2 A;  4OCI A;  1AK8 A;  2Y1N A;  1CKK A;  2BCA A;  4I5N B;  2F2O A;  2KBM A;  2KFG A;  1DT7 B;  1MR8 A;  1OOJ A;  3I5H B;  2LLS A;  3NXA A;  2ZRT A;  1EJ3 A;  1KWO B;  5B8I B;  4OVN F;  3KPX A;  1MQ1 A;  2KGB C;  4XJK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...