1XA5A

Structure of calmodulin in complex with kar-2, a bis-indol alkaloid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
144
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title The structure of the complex of calmodulin with KAR-2: a novel mode of binding explains the unique pharmacology of the drug
pubmed doi rcsb
molecule tags Metal binding protein
total genus 49
structure length 144
sequence length 146
ec nomenclature
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xa5A00
1EG4A 4YBHB 5JJGA 3E3RA 4I5KA 1J1DA 1LA0A 2ZN8A 1Y1UA 3NSLA 4M2PA 2L0PA 1S36A 2MA2A 3BUWB 4HSZA 1TTXA 4BY4A 4WRIA 5TNCA 3TDIA 1AP4A 1XVJA 1UURA 3OP0A 1IKUA 1A75A 4PHJA 2HPSA 1UHNA 3D0YA 4NDDA 2K8MB 1F70A 3O4YA 1UWOA 5ER4X 3TUYB 1KSOA 5ER5A 1CDMA 1CFDA 4L9MA 2LVKA 4PDZA 1QX5B 1N2DA 1A2XA 4MVFA 5CSJA 2DOQA 1RROA 4AQJA 1ZFSA 1OMVA 1L2OB 1NCYA 1ZUZA 1DF0B 3EVRA 3BXKA 4D1EA 3C1VA 3NXAA 4QJ4B 1S5GZ 1XK4A 2CTNA 3AKBA 1DMOA 1V1FA 4BY5A 1DJHA 1W7IB 4JPZB 1ZOTB 2OPOA 3PALA 4N5XA 4ORBB 1QX2A 1M45A 2AUCA 2PVBA 2JRFA 1B7TZ 4GNKB 1WRZA 2TN4A 4ZCVA 1J55A 2JTTA 3SG7A 2JT0A 1PVBA 3VGOA 1CMGA 1BODA 3NSOA 5I2QA 2KAYA 1YTZC 4U8DA 1DJWA 4NDBA 1TN4A 1SBJA 1CDLA 1OSAA 4PE7A 2AMIA 4XYNA 3EK7A 1DF0A 5KU1A 1YUSA 2FOTA 1CMFA 2LE9B 3JVTB 1JWDA 1OZOA 1SL7A 3NSIA 2JULA 2K7DA 2MLEC 3SG4A 1AVSA 1DVIA 1IWQA 3TUYC 1WDCB 1N65A 2B1UA 1TNXA 1JFJA 1LVCD 2ZNDA 3FWCA 1WLMA 5F6TA 1MXEA 2L4HA 3HCMA 1CDNA 4OKHA 1AJ5A 1MR8A 2K2AA 2KYFA 1TIZA 2JWWA 4CPVA 2KNEA 1KFUL 2GGMA 3RLZA 1FBVA 3NSKA 3FWBA 4ORCB 1MHOA 1CM4A 3ZNIA 1BOCA 1EH2A 1BR4B 2LP3A 1M31A 4OR9B 1CNPA 1XO5A 3WXAA 4XJKB 3ZWHA 3CR4X 2LLSA 4FTGA 2KQYA 4CLNA 1BT6A 5K89A 2KQ6A 1B47A 1QXPA 2E30A 3GOFA 4NQGA 3SJSA 2LM5A 1WRLA 3VRPA 1VRKA 4P5OE 4A4CA 1U5IB 2M29A 3I5GC 1PVAA 4DUQA 2KAVA 3LLEA 2PASA 2BCXA 4JQ0D 1RK9A 1XYDA 3JVTC 1GGWA 3EKHA 1ALWA 1NWDA 2KI6D 3I5IB 3OB1B 2O60A 1QLKA 3WHTB 1JBAA 2I2RE 1F71A 1NX1A 1GGZA 1G8IA 1QVIY 3PLFB 1KQVA 1KFXL 5IBWA 1QIVA 1YVLA 2L51A 2KOTA 1IJ6A 2LANA 1CFCA 2KYCA 3SG5A 2BCAA 4N1GA 1E8AA 3M0WA 1MQ1A 2BE4A 3K21A 1C7WA 2KHNA 2O5GA 2LMVA 5CSIA 4YGBB 1SRAA 4MZJA 5FYXA 1SY9A 2LVIA 3EK8A 3SG6A 4MSPA 1F4OA 3TS5B 2BE6A 1IRJA 4IL1A 1SPYA 1ODBA 2M1UA 2KAXA 1SR6B 4WQ2A 2GV5A 1SYMA 2K7OA 1B4CA 2KGRA 3PN7B 5HKWA 1R2UA 3BOWA 3CWGA 3CZTX 3GK2A 1XFZO 1JUOA 2ZKMX 1DJGA 1SK6D 4WQ3A 1J7OA 4USLA 1M63B 1KK8B 4CFRA 3EK4A 1UUSA 3A4UB 5CSNA 4CIDA 1QLSA 3PATA 1JC2A 3PM8A 5AFPA 2P6BB 1XFXO 3EVVA 1K9UA 1LXFC 1NYAA 2M7NA 2PRUA 2M1KB 4YGEB 3JTDB 4QJ5B 2LHIA 4DIRA 1D1OA 1MF8B 1QV0A 1XFWO 2NLNA 4I5LB 4PHMA 1YRUB 1B8LA 1TOPA 3BUNB 1WY9A 1SCVA 3ICBA 4ORAB 5HLVA 1IGVA 2NCOA 3I5FB 3TDUA 2JPTA 2I94A 2LHLA 2OTGB 1KK7Y 2E6WA 2MLFC 4TNCA 2WCEA 4HREE 1RJVA 5I8NA 2FCDA 2ISDA 2R2IA 1XA5A 3CLNA 1SL9A 3IQQA 4OCIA 3DD4A 3IF7A 1YURA 2NCPA 2OS8B 2H2KA 4GAOA 1J7RA 2ZNEA 5AERA 1GQMA 1L7ZA 5HLOA 2F33A 3TS5C 5B8IB 2KFHA 4DRWA 1IH0A 3SIAA 1NSHA 1BF5A 2LAPA 2LCPA 2Y5IA 1SR6C 2Y4QA 1QATA 2LC5A 2NXQA 1K94A 1TNWA 1YRTB 3VRQA 3PN7C 1EXRA 3DF0B 1LKJA 2G2BA 3BUMB 1C07A 1B8RA 1MUXA 2WC8A 1H8BA 1KK8C 2CCMA 2KI4B 2JU0A 4PHNA 5AXIA 1FF1A 1AHRA 1JSAA 2MHHA 2KI6C 5I2LA 1BR1B 1BJFA 1FPWA 1QVIZ 1L2OC 3I5HB 1AUIB 1NCXA 2PALA 3OX6A 3CS1A 3H4SE 4C0LA 5PALA 4MRYA 1RWYA 3CR2A 1NX2A 1UP5A 2GGZA 3OB2B 3I5FC 4M2QA 1MXLC 2OTGC 3PFVA 2F2OA 1HT9A 2PSRA 4YGCB 1SW8A 3BYAA 2K61A 1OMDA 5AANA 1BG1A 1FW4A 4MZKA 3FIAA 3DVMA 2BKHB 5JOLA 2LMUA 2H61C 2M49B 2OS8C 3EVUA 1FI6A 1KQMB 2PMYA 1YX8A 3O6BA 3QRXA 5DKRA 3WNXB 3WHUB 2KFFA 2AAOA 1CLLA 1TNPA 5HKYA 1CLMA 1JFKA 2JTZA 2Y1MA 3SG3A 1QS7A 1S26D 4YGDB 1S6JA 2K0JA 2FJUB 4MLWA 5DKNA 2KBMA 1EL4A 1IQ3A 1ALVA 3CGAA 3KEVA 1F4QA 2LUXA 1UHJA 2JC2A 3OHMB 1TCOB 3SG2A 1F54A 1WDCC 5G08A 2JT3A 2CT9A 3KO0A 2JT8A 3F45A 4XJKA 2VRGA 2I18A 2MAZA 1CFFA 3HX4A 3I5HC 1UHHA 1M39A 3GK1A 1A29A 1BU3A 1EJ3A 3DVEA 1PRWA 2EHBA 4YI9A 1F55A 1DTLA 1YUTA 2HF5A 1S1EA 1NX3A 1U5IA 2JNFA 2L4IA 4MN0A 1KFUS 4GPLB 1HQVA 4M2OA 4MRXA 3TZ1A 1YX7A 3MSEB 3GK4X 3VROA 5CSFA 4HRHA 4ETOA 4YI8A 3KPXA 1W7JB 1K90D 1K9KA 2Q4UA 1RFJA 4MBEA 1F8HA 5AEQA 1KQMC 1A75B 2L2EA 1YR5A 3D0YB 4C0KA 1FI5A 2BECA 1DGUA 2M3WA 4PALA 2KBIA 5DKQA 1OZSA 2FCEA 3BUOB 1DJYA 1BLQA 3EKJA 1WLZA 4AQIA 2ZRSA 4PE4A 3I5IC 1K2HA 1XFYO 2K7BA 1JF2A 1YUUA 2QACA 4FQOA 1PULA 1B9AA 1AJ4A 1G33A 4C0JA 1QJTA 1K96A 1NCZA 2KDHA 1OQPA 3BUXB 1PSBA 1CLBA 2LVVA 4PE0A 3IQOA 1K8UA 2KGBC 2BL0B 2BKIB 5HKZA 4PHKA 1A4PA 3DVKA 2KFGA 1X02A 2K7CA 1KFXS 2LUCA 1CB1A 4OV2A 1YVHA 2HQWA 2HQ8A 1K95A 2M97A 1N0YA 1TCFA 1C7VA 3VRNA 2F8PA 3TDZA 2RGIA 5D69A 2EC6B 3SIBA 3RM1A 1KCYA 2ZN9A 2MRDA 1GJYA 3PSRA 4PE1A 1B8CA 1SL8A 5J3XA 4UPGA 2BBNA 1ZACA 4YRUA 1A03A 4ZCUA 1K9PA 2Y1NA 1J1EA 1NP8A 2F2PA 1CKKA 3OX5A 2COLB 1SKTA 1XFUO 1PALA 1S6IA 1EG3A 2HETA 3CTNA 2LVJA 3FS7A 1Y1XA 2MJWB 3BQ3A 3LL8B 1XK4C 1QASA 3AAKA 5I2OA 3JTDC 2I7AA 2LNKA 2H61A 4NDCA 3I5GB 2BBMA 4JWQA 4OVNF 1ZMZA 1B1GA 1CDPA 1Y6WA 1PSRA 4DCKA 2WOSA 4CFQA 1NPQA 4I5JA 4GBAA 4GFTA 1IJ5A 1SNLA 2JOJA 1SMGA 2BL0C 1S3PA 1LINA 2LMTA 1LA3A 1TNQA 2CXJA 3D10A 1WRKA 3O2PA 4GGNA 1RTP1 2G9BA 3DF0A 5HYDA 4Q04A 4E68A 1KWOB 4MEWA 2ZRTA 4HRGA 1DJZA 2WCFA 3LCPC 1QIWA 2QPTA 2BCBA 2EC6C 1AK8A 1NIWA 1S5GY 4P2YB 2CNPA 1QTXA 2JXCA 1BMOA 1SCMB 1OMRA 1H4BA 1XFVO 2Q91A 2WNDA 2NZ0A 2L98A 2L5XB 2LV7A 2M0RA 1JF0A 4DS7A 2F3ZA 4N1FA 1B7TY 1CFPA 1RECA 2LP2A 2KSPA 4A4BA 2L50A 2EGDA 1NUBA 2M8UA 2KI4C 2WORA 4ICBA 5GQQC 1J7PA 1TRFA 1QX7A 3CR5X 3DVJA 2K2FA 1K93D 4GGFA 1KSMA 5BPJA 1PK0D 4MZLA 5CPVA 1DJXA 4F0ZB 4AOMA 3A8RA 2V53A 3AAJA 3LK1A 2CBLA 1Y0VH 1KK7Z 1G4YR 5KTYA 4I5NB 1DT7B 1IQ5A 2M9GA 1NX0A 2F3YA 3LK0A 1M46A 2JXLA 2MBXA 2JZIA 1UHKA 1V1GA 1J7QA 4GUKA 4PCWA 1OOJA 4YGAA 2LLUA 1KWOC 2D8NA 4GGFC 1Y1AA 2JNXA 1QV1A 1Q80A 2M7LA 3BOWB 1UHIA 1IG5A 3VRRA 2WCBA 3O78A 3KF9A 4QJ3B 2A4JA 2SASA 1CM1A 3AKAA 3KHEA 5D7FA 2JQ6A 1R6PA 2LLTA 1SCMC 1OE9B 5KSZA 1CTRA 2ZFDA 1S6CA 1MWNA 2SCPA 4R1EA 1DJIA 1DGVA 2IS9A
chains in the Genus database with same CATH superfamily
3O4XA 1EG4A 4YBHB 5JJGA 3E3RA 4I5KA 1J1DA 1LA0A 2ZN8A 1Y1UA 3NSLA 4M2PA 2L0PA 1S36A 2MA2A 3BUWB 4HSZA 1SSEB 1TTXA 4WRIA 4BY4A 5TNCA 3TDIA 1AP4A 1XVJA 1UURA 3OP0A 3V2LA 1IKUA 1A75A 4PHJA 1DC1A 2HPSA 1UHNA 3D0YA 4JKTA 4NDDA 2K8MB 1F70A 3O4YA 1UWOA 1XFRA 5ER4X 2GTEA 3TUYB 1KSOA 3R72A 5ER5A 1CDMA 1CFDA 4L9MA 2LVKA 4PDZA 1QX5B 1N2DA 1A2XA 4MVFA 5CSJA 1GM0A 2DOQA 2K60A 1RROA 4AQJA 1TUJA 1ZFSA 5EL2A 1OMVA 1L2OB 1NCYA 1ZUZA 1DF0B 3EVRA 3BXKA 4D1EA 3C1VA 3NXAA 4QJ4B 1S5GZ 1XK4A 2CTNA 3AKBA 1DMOA 1V1FA 4BY5A 1DJHA 3FE9A 1W7IB 4JPZB 1ZOTB 2OPOA 3PALA 4N5XA 4INXA 4ORBB 1QX2A 1M45A 2AUCA 2PVBA 2JRFA 3K1EA 1B7TZ 4GNKB 1WRZA 2TN4A 4ZCVA 1J55A 2JTTA 3SG7A 2JT0A 1PVBA 3VGOA 1CMGA 3IVTA 1BODA 3NSOA 5I2QA 2KAYA 1YTZC 4U8DA 1DJWA 4NDBA 3S0AA 1TN4A 1SBJA 1CDLA 1OSAA 4PE7A 2AMIA 4XYNA 3EK7A 1DF0A 5KU1A 1YUSA 3DZTA 2FOTA 2QEHA 1CMFA 2LE9B 3JVTB 1JWDA 1OZOA 1SL7A 3NSIA 2JULA 2K7DA 1DEKA 2MLEC 3SG4A 1AVSA 1DVIA 1IWQA 3TUYC 1WDCB 3R1OA 1N65A 2B1UA 1TNXA 1JFJA 1LVCD 2ZNDA 3FWCA 1WLMA 2JPOA 5F6TA 3S0DA 1MXEA 3S0EA 3RZSA 2L4HA 3HCMA 1CDNA 3CYZA 4OKHA 1AJ5A 1MR8A 1OOIX 2K2AA 2KYFA 2WCHA 1TIZA 2JWWA 4CPVA 3BFHA 2KNEA 1KFUL 2GGMA 3RLZA 1FBVA 3NSKA 3FWBA 5FI2A 4ORCB 1MHOA 1CM4A 3ZNIA 1BOCA 1EH2A 1BR4B 2LP3A 1M31A 2P70A 4OR9B 1XO5A 1CNPA 3WXAA 4XJKB 3ZWHA 3CR4X 2LLSA 4FTGA 2KQYA 2WC5A 2WCLA 1BT6A 4CLNA 2KQ6A 5K89A 1B47A 1QXPA 2E30A 3GOFA 4NQGA 3SJSA 2LM5A 1WRLA 3VRPA 1VRKA 4P5OE 4A4CA 1U5IB 2M29A 3B88A 1PVAA 3I5GC 3B87A 5FI6A 4DUQA 2KAVA 3LLEA 2PASA 2BCXA 3R1PA 4JQ0D 1RK9A 1XYDA 3JVTC 1GGWA 3D77A 3EKHA 1ALWA 1NWDA 2KI6D 3I5IB 3OB1B 2O60A 3FE6A 1QLKA 3NHIA 1DELA 3WHTB 1JBAA 2I2RE 1F71A 1NX1A 1GGZA 1G8IA 1QVIY 3PLFB 1KQVA 1KFXL 5IBWA 1QIVA 1YVLA 2L51A 2KOTA 5FI7A 3SS4A 1IJ6A 2LANA 1CFCA 2KYCA 3SG5A 2BCAA 4N1GA 1E8AA 3M0WA 1MQ1A 2BE4A 3K21A 4F7FA 1C7WA 2KHNA 2O5GA 2LMVA 5CSIA 4INWA 4YGBB 1SRAA 3PM2A 4MZJA 5FYXA 4IJ7A 1SY9A 2LVIA 3EK8A 2PYQA 3SG6A 4MSPA 1F4OA 3TS5B 3D78A 2BE6A 1IRJA 4IL1A 1SPYA 1ODBA 2M1UA 2KAXA 1SR6B 4WQ2A 2GV5A 3N7HA 1SYMA 2K7OA 1B4CA 2KGRA 3PN7B 5HKWA 1R2UA 3BOWA 3CWGA 3CZTX 3GK2A 1XFZO 1JUOA 2ZKMX 4OZDA 1DJGA 1OW4A 1SK6D 4WQ3A 1J7OA 4USLA 1M63B 1KK8B 4CFRA 3EK4A 1IIOA 1UUSA 1P28A 3A4UB 5CSNA 4CIDA 1QLSA 3PATA 1JC2A 3PM8A 5AFPA 2P6BB 4FQTA 1XFXO 3EVVA 1K9UA 1LXFC 1NYAA 2M7NA 2PRUA 2M1KB 4YGEB 3JTDB 4QJ5B 2LHIA 4DIRA 2BAPA 1D1OA 1MF8B 1QV0A 1XFWO 2NLNA 4I5LB 4PHMA 1YRUB 1B8LA 1TOPA 3BUNB 1WY9A 1SCVA 3ICBA 4ORAB 5HLVA 1IGVA 2NCOA 3I5FB 3TDUA 2JPTA 2I94A 2LHLA 2OTGB 1KK7Y 2E6WA 2MLFC 4TNCA 2WCEA 4HREE 1RJVA 5I8NA 2FCDA 2ISDA 2R2IA 1XA5A 3CLNA 1SL9A 3IQQA 3CZ1A 4OCIA 5I94A 3DD4A 3IF7A 1YURA 2NCPA 2OS8B 2H2KA 4GAOA 1J7RA 1Z2CB 2ZNEA 5AERA 1GQMA 1L7ZA 5HLOA 2F33A 3TS5C 5B8IB 3NHTA 2KFHA 4DRWA 1IH0A 3SIAA 1NSHA 1BF5A 2LAPA 2LCPA 2Y5IA 1SR6C 2Y4QA 1QATA 2LC5A 2NXQA 1K94A 1TNWA 1YRTB 3R1VA 3VRQA 3PN7C 3B7AA 1EXRA 1Z4HA 3DF0B 1LKJA 2G2BA 3BUMB 1C07A 1B8RA 1MUXA 2WCKA 2WC8A 1H8BA 1KK8C 2CCMA 2KI4B 2JU0A 4PHNA 3L4AA 5AXIA 1FF1A 1AHRA 1JSAA 2MHHA 2KI6C 5I2LA 1BR1B 1BJFA 1FPWA 1QVIZ 1L2OC 3I5HB 1AUIB 1NCXA 2PALA 3OX6A 3CS1A 3H4SE 4C0LA 5PALA 4MRYA 3EG5B 1RWYA 3CR2A 1NX2A 1UP5A 2GGZA 3OB2B 3NGVA 3I5FC 4M2QA 1MXLC 2OTGC 3PFVA 2F2OA 3D76A 1HT9A 2PSRA 4YGCB 1SW8A 2L5YA 2K61A 3BYAA 1OMDA 5AANA 1BG1A 1FW4A 4MZKA 3FIAA 3CZ0A 2BKHB 3DVMA 3DXLA 5JOLA 2LMUA 2H61C 2M49B 2OS8C 2QEVA 3EVUA 1FI6A 1KQMB 2PMYA 1YX8A 3O6BA 3QRXA 5DKRA 3WNXB 3WHUB 2KFFA 2AAOA 1CLLA 1TNPA 5HKYA 1CLMA 1JFKA 2JTZA 2Y1MA 3SG3A 1QS7A 1S26D 4YGDB 1S6JA 2K0JA 2FJUB 4MLWA 5DKNA 2KBMA 1EL4A 1IQ3A 2PQLA 1ALVA 3CGAA 3KEVA 1F4QA 2LUXA 1UHJA 2JC2A 3VB1A 3OHMB 1TCOB 3SG2A 1F54A 1WDCC 5G08A 3BFAA 1OOHA 2JT3A 2CT9A 3KO0A 2JT8A 1C3YA 3F45A 4XJKA 2VRGA 2I18A 2MAZA 2FJYA 2H8VA 2WC6A 3B86A 3HX4A 1CFFA 3I5HC 1UHHA 1M39A 1C3ZA 3GK1A 1A29A 1BU3A 1EJ3A 3DVEA 1PRWA 2EHBA 4YI9A 1F55A 3L4LA 1DTLA 1YUTA 2HF5A 1S1EA 1NX3A 1U5IA 1ORGA 2JNFA 2L4IA 4MN0A 1KFUS 1TWOA 2QDIA 3DY9A 1HQVA 4GPLB 1LS8A 4M2OA 1YX7A 4MRXA 3TZ1A 3MSEB 3GK4X 3VROA 5CSFA 4HRHA 4ETOA 4YI8A 5DICA 3KPXA 1W7JB 1K90D 1K9KA 2Q4UA 1RFJA 4MBEA 1F8HA 5AEQA 1KQMC 1A75B 2L2EA 3UNWA 1YR5A 3D0YB 4C0KA 1FI5A 2QEOA 2ERBA 2BECA 3D74A 1DGUA 2M3WA 2KLEA 4PALA 2KBIA 5DKQA 1OZSA 3D73A 1QWVA 2FCEA 3BUOB 3SS3A 1DJYA 1BLQA 3EKJA 3FE8A 1WLZA 4AQIA 2ZRSA 4PE4A 1DQEA 3I5IC 1K2HA 1XFYO 2K7BA 1JF2A 1YUUA 2QACA 4FQOA 1PULA 1B9AA 1AJ4A 1G33A 4C0JA 1QJTA 3QMEA 1K96A 1NCZA 2KDHA 1OQPA 3BUXB 1PSBA 5HL1A 3L47A 1CLBA 2LVVA 4PE0A 3IQOA 1K8UA 2KGBC 2BL0B 2BKIB 5HKZA 4PHKA 1A4PA 3DVKA 1OOGA 1OOFA 2KFGA 1X02A 2K7CA 1KFXS 2WCJA 2LUCA 1CB1A 4OV2A 1YVHA 2HQWA 2HQ8A 1K95A 2M97A 1N0YA 1TCFA 1C7VA 3VRNA 2F8PA 3TDZA 2RGIA 5D69A 2EC6B 3SIBA 3RM1A 1KCYA 2ZN9A 2MRDA 1GJYA 3PSRA 4PE1A 1B8CA 1SL8A 5J3XA 4UPGA 2BBNA 1ZACA 4YRUA 1A03A 2P71A 4ZCUA 1K9PA 2Y1NA 1J1EA 3DYEA 1NP8A 2F2PA 1CKKA 3OX5A 2COLB 1SKTA 1XFUO 1PALA 1S6IA 1EG3A 2HETA 3CTNA 2LVJA 3FS7A 1Y1XA 2MJWB 3BQ3A 3LL8B 1XK4C 1QASA 3AAKA 5I2OA 3S0FA 3JTDC 2I7AA 2LNKA 2H61A 1TUZA 4NDCA 3I5GB 2BBMA 4JWQA 4OVNF 1ZMZA 1B1GA 1CDPA 1Y6WA 1PSRA 4DCKA 2WOSA 4CFQA 1NPQA 4I5JA 4GBAA 4GFTA 2KPHA 1IJ5A 1SNLA 2JOJA 1SMGA 2BL0C 1S3PA 1LINA 2LMTA 1LA3A 1TNQA 2CXJA 3D10A 3SS5A 1WRKA 3O2PA 4GGNA 1T14A 1RTP1 2G9BA 2QEBA 3DF0A 1W9ZA 5HYDA 4Q04A 4E68A 1KWOB 3OBVA 4MEWA 2ZRTA 4HRGA 1DJZA 2WCFA 3UO9A 3LCPC 1QIWA 2QPTA 2BCBA 2EC6C 1AK8A 1NIWA 1S5GY 4P2YB 2CNPA 1QTXA 3OGNA 4PT1A 2JXCA 3PJIA 1BMOA 1SCMB 1OMRA 1H4BA 2WCMA 1XFVO 2Q91A 2KLDA 2WNDA 2NZ0A 3Q8IA 2L98A 2L5XB 2LV7A 2M0RA 1JF0A 3D75A 2F3ZA 4N1FA 4DS7A 1B7TY 3CZ2A 1CFPA 1RECA 2LP2A 2KSPA 4A4BA 2L50A 2EGDA 1NUBA 2L2CA 2M8UA 2KI4C 2WORA 4ICBA 3B6XA 5GQQC 1J7PA 1TRFA 1QX7A 3CR5X 2BNXA 3DVJA 2K2FA 1K93D 3BFBA 4GGFA 1KSMA 5BPJA 1PK0D 4MZLA 5CPVA 1DJXA 4F0ZB 4AOMA 3A8RA 5D3OA 2V53A 3AAJA 3LK1A 2CBLA 1Y0VH 1KK7Z 1G4YR 5KTYA 4I5NB 1DT7B 1IQ5A 2M9GA 1NX0A 2F3YA 3LK0A 1M46A 3CDNA 2JXLA 2MBXA 2JZIA 1UHKA 1V1GA 1J7QA 4GUKA 4PCWA 1OOJA 4YGAA 2LLUA 1KWOC 2D8NA 3CABA 1Y1AA 2JNXA 1QV1A 4GGFC 1Q80A 4JD9A 4KYNA 2M7LA 3BOWB 1UHIA 1IG5A 3VRRA 3S0GA 2WCBA 3O78A 3KF9A 4QJ3B 2A4JA 2SASA 1CM1A 3AKAA 3KHEA 5D7FA 2JQ6A 1R6PA 2LLTA 1SCMC 1OE9B 5KSZA 1CTRA 2ZFDA 1S6CA 1MWNA 2YGUA 2SCPA 4R1EA 1DJIA 3S0BA 1DGVA 2IS9A 3BJHA
chains in the Genus database with same CATH topology
1EG4A 4YBHB 5JJGA 3E3RA 4I5KA 1J1DA 1LA0A 2ZN8A 1Y1UA 3NSLA 4M2PA 2L0PA 1S36A 2MA2A 3BUWB 4HSZA 1TTXA 4BY4A 4WRIA 5TNCA 3TDIA 1AP4A 1XVJA 1UURA 3OP0A 1IKUA 1A75A 4PHJA 2HPSA 1UHNA 3D0YA 4NDDA 2K8MB 1F70A 3O4YA 1UWOA 5ER4X 3TUYB 1KSOA 5ER5A 1CDMA 1CFDA 4L9MA 2LVKA 4PDZA 1QX5B 1N2DA 1A2XA 4MVFA 5CSJA 2DOQA 1RROA 4AQJA 1ZFSA 1OMVA 1L2OB 1NCYA 1ZUZA 1DF0B 3EVRA 3BXKA 4D1EA 3C1VA 3NXAA 4QJ4B 1S5GZ 1XK4A 2CTNA 3AKBA 1DMOA 1V1FA 4BY5A 1DJHA 1W7IB 4JPZB 1ZOTB 2OPOA 3PALA 4N5XA 4ORBB 1QX2A 1M45A 2AUCA 2PVBA 2JRFA 1B7TZ 4GNKB 1WRZA 2TN4A 4ZCVA 1J55A 2JTTA 3SG7A 2JT0A 1PVBA 3VGOA 1CMGA 1BODA 3NSOA 5I2QA 2KAYA 1YTZC 4U8DA 1DJWA 4NDBA 1TN4A 1SBJA 1CDLA 1OSAA 4PE7A 2AMIA 4XYNA 3EK7A 1DF0A 5KU1A 1YUSA 2FOTA 1CMFA 2LE9B 3JVTB 1JWDA 1OZOA 1SL7A 3NSIA 2JULA 2K7DA 2MLEC 3SG4A 1AVSA 1DVIA 1IWQA 3TUYC 1WDCB 1N65A 2B1UA 1TNXA 1JFJA 1LVCD 2ZNDA 3FWCA 1WLMA 5F6TA 1MXEA 2L4HA 3HCMA 1CDNA 4OKHA 1AJ5A 1MR8A 2K2AA 2KYFA 1TIZA 2JWWA 4CPVA 2KNEA 1KFUL 2GGMA 3RLZA 1FBVA 3NSKA 3FWBA 4ORCB 1MHOA 1CM4A 3ZNIA 1BOCA 1EH2A 1BR4B 2LP3A 1M31A 4OR9B 1CNPA 1XO5A 3WXAA 4XJKB 3ZWHA 3CR4X 2LLSA 4FTGA 2KQYA 4CLNA 1BT6A 5K89A 2KQ6A 1B47A 1QXPA 2E30A 3GOFA 4NQGA 3SJSA 2LM5A 1WRLA 3VRPA 1VRKA 4P5OE 4A4CA 1U5IB 2M29A 3I5GC 1PVAA 4DUQA 2KAVA 3LLEA 2PASA 2BCXA 4JQ0D 1RK9A 1XYDA 3JVTC 1GGWA 3EKHA 1ALWA 1NWDA 2KI6D 3I5IB 3OB1B 2O60A 1QLKA 3WHTB 1JBAA 2I2RE 1F71A 1NX1A 1GGZA 1G8IA 1QVIY 3PLFB 1KQVA 1KFXL 5IBWA 1QIVA 1YVLA 2L51A 2KOTA 1IJ6A 2LANA 1CFCA 2KYCA 3SG5A 2BCAA 4N1GA 1E8AA 3M0WA 1MQ1A 2BE4A 3K21A 1C7WA 2KHNA 2O5GA 2LMVA 5CSIA 4YGBB 1SRAA 4MZJA 5FYXA 1SY9A 2LVIA 3EK8A 3SG6A 4MSPA 1F4OA 3TS5B 2BE6A 1IRJA 4IL1A 1SPYA 1ODBA 2M1UA 2KAXA 1SR6B 4WQ2A 2GV5A 1SYMA 2K7OA 1B4CA 2KGRA 3PN7B 5HKWA 1R2UA 3BOWA 3CWGA 3CZTX 3GK2A 1XFZO 1JUOA 2ZKMX 1DJGA 1SK6D 4WQ3A 1J7OA 4USLA 1M63B 1KK8B 4CFRA 3EK4A 1UUSA 3A4UB 5CSNA 4CIDA 1QLSA 3PATA 1JC2A 3PM8A 5AFPA 2P6BB 1XFXO 3EVVA 1K9UA 1LXFC 1NYAA 2M7NA 2PRUA 2M1KB 4YGEB 3JTDB 4QJ5B 2LHIA 4DIRA 1D1OA 1MF8B 1QV0A 1XFWO 2NLNA 4I5LB 4PHMA 1YRUB 1B8LA 1TOPA 3BUNB 1WY9A 1SCVA 3ICBA 4ORAB 5HLVA 1IGVA 2NCOA 3I5FB 3TDUA 2JPTA 2I94A 2LHLA 2OTGB 1KK7Y 2E6WA 2MLFC 4TNCA 2WCEA 4HREE 1RJVA 5I8NA 2FCDA 2ISDA 2R2IA 1XA5A 3CLNA 1SL9A 3IQQA 4OCIA 3DD4A 3IF7A 1YURA 2NCPA 2OS8B 2H2KA 4GAOA 1J7RA 2ZNEA 5AERA 1GQMA 1L7ZA 5HLOA 2F33A 3TS5C 5B8IB 2KFHA 4DRWA 1IH0A 3SIAA 1NSHA 1BF5A 2LAPA 2LCPA 2Y5IA 1SR6C 2Y4QA 1QATA 2LC5A 2NXQA 1K94A 1TNWA 1YRTB 3VRQA 3PN7C 1EXRA 3DF0B 1LKJA 2G2BA 3BUMB 1C07A 1B8RA 1MUXA 2WC8A 1H8BA 1KK8C 2CCMA 2KI4B 2JU0A 4PHNA 5AXIA 1FF1A 1AHRA 1JSAA 2MHHA 2KI6C 5I2LA 1BR1B 1BJFA 1FPWA 1QVIZ 1L2OC 3I5HB 1AUIB 1NCXA 2PALA 3OX6A 3CS1A 3H4SE 4C0LA 5PALA 4MRYA 1RWYA 3CR2A 1NX2A 1UP5A 2GGZA 3OB2B 3I5FC 4M2QA 1MXLC 2OTGC 3PFVA 2F2OA 1HT9A 2PSRA 4YGCB 1SW8A 3BYAA 2K61A 1OMDA 5AANA 1BG1A 1FW4A 4MZKA 3FIAA 3DVMA 2BKHB 5JOLA 2LMUA 2H61C 2M49B 2OS8C 3EVUA 1FI6A 1KQMB 2PMYA 1YX8A 3O6BA 3QRXA 5DKRA 3WNXB 3WHUB 2KFFA 2AAOA 1CLLA 1TNPA 5HKYA 1CLMA 1JFKA 2JTZA 2Y1MA 3SG3A 1QS7A 1S26D 4YGDB 1S6JA 2K0JA 2FJUB 4MLWA 5DKNA 2KBMA 1EL4A 1IQ3A 1ALVA 3CGAA 3KEVA 1F4QA 2LUXA 1UHJA 2JC2A 3OHMB 1TCOB 3SG2A 1F54A 1WDCC 5G08A 2JT3A 2CT9A 3KO0A 2JT8A 3F45A 4XJKA 2VRGA 2I18A 2MAZA 1CFFA 3HX4A 3I5HC 1UHHA 1M39A 3GK1A 1A29A 1BU3A 1EJ3A 3DVEA 1PRWA 2EHBA 4YI9A 1F55A 1DTLA 1YUTA 2HF5A 1S1EA 1NX3A 1U5IA 2JNFA 2L4IA 4MN0A 1KFUS 4GPLB 1HQVA 4M2OA 4MRXA 3TZ1A 1YX7A 3MSEB 3GK4X 3VROA 5CSFA 4HRHA 4ETOA 4YI8A 3KPXA 1W7JB 1K90D 1K9KA 2Q4UA 1RFJA 4MBEA 1F8HA 5AEQA 1KQMC 1A75B 2L2EA 1YR5A 3D0YB 4C0KA 1FI5A 2BECA 1DGUA 2M3WA 4PALA 2KBIA 5DKQA 1OZSA 2FCEA 3BUOB 1DJYA 1BLQA 3EKJA 1WLZA 4AQIA 2ZRSA 4PE4A 3I5IC 1K2HA 1XFYO 2K7BA 1JF2A 1YUUA 2QACA 4FQOA 1PULA 1B9AA 1AJ4A 1G33A 4C0JA 1QJTA 1K96A 1NCZA 2KDHA 1OQPA 3BUXB 1PSBA 1CLBA 2LVVA 4PE0A 3IQOA 1K8UA 2KGBC 2BL0B 2BKIB 5HKZA 4PHKA 1A4PA 3DVKA 2KFGA 1X02A 2K7CA 1KFXS 2LUCA 1CB1A 4OV2A 1YVHA 2HQWA 2HQ8A 1K95A 2M97A 1N0YA 1TCFA 1C7VA 3VRNA 2F8PA 3TDZA 2RGIA 5D69A 2EC6B 3SIBA 3RM1A 1KCYA 2ZN9A 2MRDA 1GJYA 3PSRA 4PE1A 1B8CA 1SL8A 5J3XA 4UPGA 2BBNA 1ZACA 4YRUA 1A03A 4ZCUA 1K9PA 2Y1NA 1J1EA 1NP8A 2F2PA 1CKKA 3OX5A 2COLB 1SKTA 1XFUO 1PALA 1S6IA 1EG3A 2HETA 3CTNA 2LVJA 3FS7A 1Y1XA 2MJWB 3BQ3A 3LL8B 1XK4C 1QASA 3AAKA 5I2OA 3JTDC 2I7AA 2LNKA 2H61A 4NDCA 3I5GB 2BBMA 4JWQA 4OVNF 1ZMZA 1B1GA 1CDPA 1Y6WA 1PSRA 4DCKA 2WOSA 4CFQA 1NPQA 4I5JA 4GBAA 4GFTA 1IJ5A 1SNLA 2JOJA 1SMGA 2BL0C 1S3PA 1LINA 2LMTA 1LA3A 1TNQA 2CXJA 3D10A 1WRKA 3O2PA 4GGNA 1RTP1 2G9BA 3DF0A 5HYDA 4Q04A 4E68A 1KWOB 4MEWA 2ZRTA 4HRGA 1DJZA 2WCFA 3LCPC 1QIWA 2QPTA 2BCBA 2EC6C 1AK8A 1NIWA 1S5GY 4P2YB 2CNPA 1QTXA 2JXCA 1BMOA 1SCMB 1OMRA 1H4BA 1XFVO 2Q91A 2WNDA 2NZ0A 2L98A 2L5XB 2LV7A 2M0RA 1JF0A 4DS7A 2F3ZA 4N1FA 1B7TY 1CFPA 1RECA 2LP2A 2KSPA 4A4BA 2L50A 2EGDA 1NUBA 2M8UA 2KI4C 2WORA 4ICBA 5GQQC 1J7PA 1TRFA 1QX7A 3CR5X 3DVJA 2K2FA 1K93D 4GGFA 1KSMA 5BPJA 1PK0D 4MZLA 5CPVA 1DJXA 4F0ZB 4AOMA 3A8RA 2V53A 3AAJA 3LK1A 2CBLA 1Y0VH 1KK7Z 1G4YR 5KTYA 4I5NB 1DT7B 1IQ5A 2M9GA 1NX0A 2F3YA 3LK0A 1M46A 2JXLA 2MBXA 2JZIA 1UHKA 1V1GA 1J7QA 4GUKA 4PCWA 1OOJA 4YGAA 2LLUA 1KWOC 2D8NA 4GGFC 1Y1AA 2JNXA 1QV1A 1Q80A 2M7LA 3BOWB 1UHIA 1IG5A 3VRRA 2WCBA 3O78A 3KF9A 4QJ3B 2A4JA 2SASA 1CM1A 3AKAA 3KHEA 5D7FA 2JQ6A 1R6PA 2LLTA 1SCMC 1OE9B 5KSZA 1CTRA 2ZFDA 1S6CA 1MWNA 2SCPA 4R1EA 1DJIA 1DGVA 2IS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG4 A;  4YBH B;  5JJG A;  3E3R A;  4I5K A;  1J1D A;  1LA0 A;  2ZN8 A;  1Y1U A;  3NSL A;  4M2P A;  2L0P A;  1S36 A;  2MA2 A;  3BUW B;  4HSZ A;  1TTX A;  4BY4 A;  4WRI A;  5TNC A;  3TDI A;  1AP4 A;  1XVJ A;  1UUR A;  3OP0 A;  1IKU A;  1A75 A;  4PHJ A;  2HPS A;  1UHN A;  3D0Y A;  4NDD A;  2K8M B;  1F70 A;  3O4Y A;  1UWO A;  5ER4 X;  3TUY B;  1KSO A;  5ER5 A;  1CDM A;  1CFD A;  4L9M A;  2LVK A;  4PDZ A;  1QX5 B;  1N2D A;  1A2X A;  4MVF A;  5CSJ A;  2DOQ A;  1RRO A;  4AQJ A;  1ZFS A;  1OMV A;  1L2O B;  1NCY A;  1ZUZ A;  1DF0 B;  3EVR A;  3BXK A;  4D1E A;  3C1V A;  3NXA A;  4QJ4 B;  1S5G Z;  1XK4 A;  2CTN A;  3AKB A;  1DMO A;  1V1F A;  4BY5 A;  1DJH A;  1W7I B;  4JPZ B;  1ZOT B;  2OPO A;  3PAL A;  4N5X A;  4ORB B;  1QX2 A;  1M45 A;  2AUC A;  2PVB A;  2JRF A;  1B7T Z;  4GNK B;  1WRZ A;  2TN4 A;  4ZCV A;  1J55 A;  2JTT A;  3SG7 A;  2JT0 A;  1PVB A;  3VGO A;  1CMG A;  1BOD A;  3NSO A;  5I2Q A;  2KAY A;  1YTZ C;  4U8D A;  1DJW A;  4NDB A;  1TN4 A;  1SBJ A;  1CDL A;  1OSA A;  4PE7 A;  2AMI A;  4XYN A;  3EK7 A;  1DF0 A;  5KU1 A;  1YUS A;  2FOT A;  1CMF A;  2LE9 B;  3JVT B;  1JWD A;  1OZO A;  1SL7 A;  3NSI A;  2JUL A;  2K7D A;  2MLE C;  3SG4 A;  1AVS A;  1DVI A;  1IWQ A;  3TUY C;  1WDC B;  1N65 A;  2B1U A;  1TNX A;  1JFJ A;  1LVC D;  2ZND A;  3FWC A;  1WLM A;  5F6T A;  1MXE A;  2L4H A;  3HCM A;  1CDN A;  4OKH A;  1AJ5 A;  1MR8 A;  2K2A A;  2KYF A;  1TIZ A;  2JWW A;  4CPV A;  2KNE A;  1KFU L;  2GGM A;  3RLZ A;  1FBV A;  3NSK A;  3FWB A;  4ORC B;  1MHO A;  1CM4 A;  3ZNI A;  1BOC A;  1EH2 A;  1BR4 B;  2LP3 A;  1M31 A;  4OR9 B;  1CNP A;  1XO5 A;  3WXA A;  4XJK B;  3ZWH A;  3CR4 X;  2LLS A;  4FTG A;  2KQY A;  4CLN A;  1BT6 A;  5K89 A;  2KQ6 A;  1B47 A;  1QXP A;  2E30 A;  3GOF A;  4NQG A;  3SJS A;  2LM5 A;  1WRL A;  3VRP A;  1VRK A;  4P5O E;  4A4C A;  1U5I B;  2M29 A;  3I5G C;  1PVA A;  4DUQ A;  2KAV A;  3LLE A;  2PAS A;  2BCX A;  4JQ0 D;  1RK9 A;  1XYD A;  3JVT C;  1GGW A;  3EKH A;  1ALW A;  1NWD A;  2KI6 D;  3I5I B;  3OB1 B;  2O60 A;  1QLK A;  3WHT B;  1JBA A;  2I2R E;  1F71 A;  1NX1 A;  1GGZ A;  1G8I A;  1QVI Y;  3PLF B;  1KQV A;  1KFX L;  5IBW A;  1QIV A;  1YVL A;  2L51 A;  2KOT A;  1IJ6 A;  2LAN A;  1CFC A;  2KYC A;  3SG5 A;  2BCA A;  4N1G A;  1E8A A;  3M0W A;  1MQ1 A;  2BE4 A;  3K21 A;  1C7W A;  2KHN A;  2O5G A;  2LMV A;  5CSI A;  4YGB B;  1SRA A;  4MZJ A;  5FYX A;  1SY9 A;  2LVI A;  3EK8 A;  3SG6 A;  4MSP A;  1F4O A;  3TS5 B;  2BE6 A;  1IRJ A;  4IL1 A;  1SPY A;  1ODB A;  2M1U A;  2KAX A;  1SR6 B;  4WQ2 A;  2GV5 A;  1SYM A;  2K7O A;  1B4C A;  2KGR A;  3PN7 B;  5HKW A;  1R2U A;  3BOW A;  3CWG A;  3CZT X;  3GK2 A;  1XFZ O;  1JUO A;  2ZKM X;  1DJG A;  1SK6 D;  4WQ3 A;  1J7O A;  4USL A;  1M63 B;  1KK8 B;  4CFR A;  3EK4 A;  1UUS A;  3A4U B;  5CSN A;  4CID A;  1QLS A;  3PAT A;  1JC2 A;  3PM8 A;  5AFP A;  2P6B B;  1XFX O;  3EVV A;  1K9U A;  1LXF C;  1NYA A;  2M7N A;  2PRU A;  2M1K B;  4YGE B;  3JTD B;  4QJ5 B;  2LHI A;  4DIR A;  1D1O A;  1MF8 B;  1QV0 A;  1XFW O;  2NLN A;  4I5L B;  4PHM A;  1YRU B;  1B8L A;  1TOP A;  3BUN B;  1WY9 A;  1SCV A;  3ICB A;  4ORA B;  5HLV A;  1IGV A;  2NCO A;  3I5F B;  3TDU A;  2JPT A;  2I94 A;  2LHL A;  2OTG B;  1KK7 Y;  2E6W A;  2MLF C;  4TNC A;  2WCE A;  4HRE E;  1RJV A;  5I8N A;  2FCD A;  2ISD A;  2R2I A;  1XA5 A;  3CLN A;  1SL9 A;  3IQQ A;  4OCI A;  3DD4 A;  3IF7 A;  1YUR A;  2NCP A;  2OS8 B;  2H2K A;  4GAO A;  1J7R A;  2ZNE A;  5AER A;  1GQM A;  1L7Z A;  5HLO A;  2F33 A;  3TS5 C;  5B8I B;  2KFH A;  4DRW A;  1IH0 A;  3SIA A;  1NSH A;  1BF5 A;  2LAP A;  2LCP A;  2Y5I A;  1SR6 C;  2Y4Q A;  1QAT A;  2LC5 A;  2NXQ A;  1K94 A;  1TNW A;  1YRT B;  3VRQ A;  3PN7 C;  1EXR A;  3DF0 B;  1LKJ A;  2G2B A;  3BUM B;  1C07 A;  1B8R A;  1MUX A;  2WC8 A;  1H8B A;  1KK8 C;  2CCM A;  2KI4 B;  2JU0 A;  4PHN A;  5AXI A;  1FF1 A;  1AHR A;  1JSA A;  2MHH A;  2KI6 C;  5I2L A;  1BR1 B;  1BJF A;  1FPW A;  1QVI Z;  1L2O C;  3I5H B;  1AUI B;  1NCX A;  2PAL A;  3OX6 A;  3CS1 A;  3H4S E;  4C0L A;  5PAL A;  4MRY A;  1RWY A;  3CR2 A;  1NX2 A;  1UP5 A;  2GGZ A;  3OB2 B;  3I5F C;  4M2Q A;  1MXL C;  2OTG C;  3PFV A;  2F2O A;  1HT9 A;  2PSR A;  4YGC B;  1SW8 A;  3BYA A;  2K61 A;  1OMD A;  5AAN A;  1BG1 A;  1FW4 A;  4MZK A;  3FIA A;  3DVM A;  2BKH B;  5JOL A;  2LMU A;  2H61 C;  2M49 B;  2OS8 C;  3EVU A;  1FI6 A;  1KQM B;  2PMY A;  1YX8 A;  3O6B A;  3QRX A;  5DKR A;  3WNX B;  3WHU B;  2KFF A;  2AAO A;  1CLL A;  1TNP A;  5HKY A;  1CLM A;  1JFK A;  2JTZ A;  2Y1M A;  3SG3 A;  1QS7 A;  1S26 D;  4YGD B;  1S6J A;  2K0J A;  2FJU B;  4MLW A;  5DKN A;  2KBM A;  1EL4 A;  1IQ3 A;  1ALV A;  3CGA A;  3KEV A;  1F4Q A;  2LUX A;  1UHJ A;  2JC2 A;  3OHM B;  1TCO B;  3SG2 A;  1F54 A;  1WDC C;  5G08 A;  2JT3 A;  2CT9 A;  3KO0 A;  2JT8 A;  3F45 A;  4XJK A;  2VRG A;  2I18 A;  2MAZ A;  1CFF A;  3HX4 A;  3I5H C;  1UHH A;  1M39 A;  3GK1 A;  1A29 A;  1BU3 A;  1EJ3 A;  3DVE A;  1PRW A;  2EHB A;  4YI9 A;  1F55 A;  1DTL A;  1YUT A;  2HF5 A;  1S1E A;  1NX3 A;  1U5I A;  2JNF A;  2L4I A;  4MN0 A;  1KFU S;  4GPL B;  1HQV A;  4M2O A;  4MRX A;  3TZ1 A;  1YX7 A;  3MSE B;  3GK4 X;  3VRO A;  5CSF A;  4HRH A;  4ETO A;  4YI8 A;  3KPX A;  1W7J B;  1K90 D;  1K9K A;  2Q4U A;  1RFJ A;  4MBE A;  1F8H A;  5AEQ A;  1KQM C;  1A75 B;  2L2E A;  1YR5 A;  3D0Y B;  4C0K A;  1FI5 A;  2BEC A;  1DGU A;  2M3W A;  4PAL A;  2KBI A;  5DKQ A;  1OZS A;  2FCE A;  3BUO B;  1DJY A;  1BLQ A;  3EKJ A;  1WLZ A;  4AQI A;  2ZRS A;  4PE4 A;  3I5I C;  1K2H A;  1XFY O;  2K7B A;  1JF2 A;  1YUU A;  2QAC A;  4FQO A;  1PUL A;  1B9A A;  1AJ4 A;  1G33 A;  4C0J A;  1QJT A;  1K96 A;  1NCZ A;  2KDH A;  1OQP A;  3BUX B;  1PSB A;  1CLB A;  2LVV A;  4PE0 A;  3IQO A;  1K8U A;  2KGB C;  2BL0 B;  2BKI B;  5HKZ A;  4PHK A;  1A4P A;  3DVK A;  2KFG A;  1X02 A;  2K7C A;  1KFX S;  2LUC A;  1CB1 A;  4OV2 A;  1YVH A;  2HQW A;  2HQ8 A;  1K95 A;  2M97 A;  1N0Y A;  1TCF A;  1C7V A;  3VRN A;  2F8P A;  3TDZ A;  2RGI A;  5D69 A;  2EC6 B;  3SIB A;  3RM1 A;  1KCY A;  2ZN9 A;  2MRD A;  1GJY A;  3PSR A;  4PE1 A;  1B8C A;  1SL8 A;  5J3X A;  4UPG A;  2BBN A;  1ZAC A;  4YRU A;  1A03 A;  4ZCU A;  1K9P A;  2Y1N A;  1J1E A;  1NP8 A;  2F2P A;  1CKK A;  3OX5 A;  2COL B;  1SKT A;  1XFU O;  1PAL A;  1S6I A;  1EG3 A;  2HET A;  3CTN A;  2LVJ A;  3FS7 A;  1Y1X A;  2MJW B;  3BQ3 A;  3LL8 B;  1XK4 C;  1QAS A;  3AAK A;  5I2O A;  3JTD C;  2I7A A;  2LNK A;  2H61 A;  4NDC A;  3I5G B;  2BBM A;  4JWQ A;  4OVN F;  1ZMZ A;  1B1G A;  1CDP A;  1Y6W A;  1PSR A;  4DCK A;  2WOS A;  4CFQ A;  1NPQ A;  4I5J A;  4GBA A;  4GFT A;  1IJ5 A;  1SNL A;  2JOJ A;  1SMG A;  2BL0 C;  1S3P A;  1LIN A;  2LMT A;  1LA3 A;  1TNQ A;  2CXJ A;  3D10 A;  1WRK A;  3O2P A;  4GGN A;  1RTP 1;  2G9B A;  3DF0 A;  5HYD A;  4Q04 A;  4E68 A;  1KWO B;  4MEW A;  2ZRT A;  4HRG A;  1DJZ A;  2WCF A;  3LCP C;  1QIW A;  2QPT A;  2BCB A;  2EC6 C;  1AK8 A;  1NIW A;  1S5G Y;  4P2Y B;  2CNP A;  1QTX A;  2JXC A;  1BMO A;  1SCM B;  1OMR A;  1H4B A;  1XFV O;  2Q91 A;  2WND A;  2NZ0 A;  2L98 A;  2L5X B;  2LV7 A;  2M0R A;  1JF0 A;  4DS7 A;  2F3Z A;  4N1F A;  1B7T Y;  1CFP A;  1REC A;  2LP2 A;  2KSP A;  4A4B A;  2L50 A;  2EGD A;  1NUB A;  2M8U A;  2KI4 C;  2WOR A;  4ICB A;  5GQQ C;  1J7P A;  1TRF A;  1QX7 A;  3CR5 X;  3DVJ A;  2K2F A;  1K93 D;  4GGF A;  1KSM A;  5BPJ A;  1PK0 D;  4MZL A;  5CPV A;  1DJX A;  4F0Z B;  4AOM A;  3A8R A;  2V53 A;  3AAJ A;  3LK1 A;  2CBL A;  1Y0V H;  1KK7 Z;  1G4Y R;  5KTY A;  4I5N B;  1DT7 B;  1IQ5 A;  2M9G A;  1NX0 A;  2F3Y A;  3LK0 A;  1M46 A;  2JXL A;  2MBX A;  2JZI A;  1UHK A;  1V1G A;  1J7Q A;  4GUK A;  4PCW A;  1OOJ A;  4YGA A;  2LLU A;  1KWO C;  2D8N A;  4GGF C;  1Y1A A;  2JNX A;  1QV1 A;  1Q80 A;  2M7L A;  3BOW B;  1UHI A;  1IG5 A;  3VRR A;  2WCB A;  3O78 A;  3KF9 A;  4QJ3 B;  2A4J A;  2SAS A;  1CM1 A;  3AKA A;  3KHE A;  5D7F A;  2JQ6 A;  1R6P A;  2LLT A;  1SCM C;  1OE9 B;  5KSZ A;  1CTR A;  2ZFD A;  1S6C A;  1MWN A;  2SCP A;  4R1E A;  1DJI A;  1DGV A;  2IS9 A; 
#chains in the Genus database with same CATH topology
 3O4X A;  1EG4 A;  4YBH B;  5JJG A;  3E3R A;  4I5K A;  1J1D A;  1LA0 A;  2ZN8 A;  1Y1U A;  3NSL A;  4M2P A;  2L0P A;  1S36 A;  2MA2 A;  3BUW B;  4HSZ A;  1SSE B;  1TTX A;  4WRI A;  4BY4 A;  5TNC A;  3TDI A;  1AP4 A;  1XVJ A;  1UUR A;  3OP0 A;  3V2L A;  1IKU A;  1A75 A;  4PHJ A;  1DC1 A;  2HPS A;  1UHN A;  3D0Y A;  4JKT A;  4NDD A;  2K8M B;  1F70 A;  3O4Y A;  1UWO A;  1XFR A;  5ER4 X;  2GTE A;  3TUY B;  1KSO A;  3R72 A;  5ER5 A;  1CDM A;  1CFD A;  4L9M A;  2LVK A;  4PDZ A;  1QX5 B;  1N2D A;  1A2X A;  4MVF A;  5CSJ A;  1GM0 A;  2DOQ A;  2K60 A;  1RRO A;  4AQJ A;  1TUJ A;  1ZFS A;  5EL2 A;  1OMV A;  1L2O B;  1NCY A;  1ZUZ A;  1DF0 B;  3EVR A;  3BXK A;  4D1E A;  3C1V A;  3NXA A;  4QJ4 B;  1S5G Z;  1XK4 A;  2CTN A;  3AKB A;  1DMO A;  1V1F A;  4BY5 A;  1DJH A;  3FE9 A;  1W7I B;  4JPZ B;  1ZOT B;  2OPO A;  3PAL A;  4N5X A;  4INX A;  4ORB B;  1QX2 A;  1M45 A;  2AUC A;  2PVB A;  2JRF A;  3K1E A;  1B7T Z;  4GNK B;  1WRZ A;  2TN4 A;  4ZCV A;  1J55 A;  2JTT A;  3SG7 A;  2JT0 A;  1PVB A;  3VGO A;  1CMG A;  3IVT A;  1BOD A;  3NSO A;  5I2Q A;  2KAY A;  1YTZ C;  4U8D A;  1DJW A;  4NDB A;  3S0A A;  1TN4 A;  1SBJ A;  1CDL A;  1OSA A;  4PE7 A;  2AMI A;  4XYN A;  3EK7 A;  1DF0 A;  5KU1 A;  1YUS A;  3DZT A;  2FOT A;  2QEH A;  1CMF A;  2LE9 B;  3JVT B;  1JWD A;  1OZO A;  1SL7 A;  3NSI A;  2JUL A;  2K7D A;  1DEK A;  2MLE C;  3SG4 A;  1AVS A;  1DVI A;  1IWQ A;  3TUY C;  1WDC B;  3R1O A;  1N65 A;  2B1U A;  1TNX A;  1JFJ A;  1LVC D;  2ZND A;  3FWC A;  1WLM A;  2JPO A;  5F6T A;  3S0D A;  1MXE A;  3S0E A;  3RZS A;  2L4H A;  3HCM A;  1CDN A;  3CYZ A;  4OKH A;  1AJ5 A;  1MR8 A;  1OOI X;  2K2A A;  2KYF A;  2WCH A;  1TIZ A;  2JWW A;  4CPV A;  3BFH A;  2KNE A;  1KFU L;  2GGM A;  3RLZ A;  1FBV A;  3NSK A;  3FWB A;  5FI2 A;  4ORC B;  1MHO A;  1CM4 A;  3ZNI A;  1BOC A;  1EH2 A;  1BR4 B;  2LP3 A;  1M31 A;  2P70 A;  4OR9 B;  1XO5 A;  1CNP A;  3WXA A;  4XJK B;  3ZWH A;  3CR4 X;  2LLS A;  4FTG A;  2KQY A;  2WC5 A;  2WCL A;  1BT6 A;  4CLN A;  2KQ6 A;  5K89 A;  1B47 A;  1QXP A;  2E30 A;  3GOF A;  4NQG A;  3SJS A;  2LM5 A;  1WRL A;  3VRP A;  1VRK A;  4P5O E;  4A4C A;  1U5I B;  2M29 A;  3B88 A;  1PVA A;  3I5G C;  3B87 A;  5FI6 A;  4DUQ A;  2KAV A;  3LLE A;  2PAS A;  2BCX A;  3R1P A;  4JQ0 D;  1RK9 A;  1XYD A;  3JVT C;  1GGW A;  3D77 A;  3EKH A;  1ALW A;  1NWD A;  2KI6 D;  3I5I B;  3OB1 B;  2O60 A;  3FE6 A;  1QLK A;  3NHI A;  1DEL A;  3WHT B;  1JBA A;  2I2R E;  1F71 A;  1NX1 A;  1GGZ A;  1G8I A;  1QVI Y;  3PLF B;  1KQV A;  1KFX L;  5IBW A;  1QIV A;  1YVL A;  2L51 A;  2KOT A;  5FI7 A;  3SS4 A;  1IJ6 A;  2LAN A;  1CFC A;  2KYC A;  3SG5 A;  2BCA A;  4N1G A;  1E8A A;  3M0W A;  1MQ1 A;  2BE4 A;  3K21 A;  4F7F A;  1C7W A;  2KHN A;  2O5G A;  2LMV A;  5CSI A;  4INW A;  4YGB B;  1SRA A;  3PM2 A;  4MZJ A;  5FYX A;  4IJ7 A;  1SY9 A;  2LVI A;  3EK8 A;  2PYQ A;  3SG6 A;  4MSP A;  1F4O A;  3TS5 B;  3D78 A;  2BE6 A;  1IRJ A;  4IL1 A;  1SPY A;  1ODB A;  2M1U A;  2KAX A;  1SR6 B;  4WQ2 A;  2GV5 A;  3N7H A;  1SYM A;  2K7O A;  1B4C A;  2KGR A;  3PN7 B;  5HKW A;  1R2U A;  3BOW A;  3CWG A;  3CZT X;  3GK2 A;  1XFZ O;  1JUO A;  2ZKM X;  4OZD A;  1DJG A;  1OW4 A;  1SK6 D;  4WQ3 A;  1J7O A;  4USL A;  1M63 B;  1KK8 B;  4CFR A;  3EK4 A;  1IIO A;  1UUS A;  1P28 A;  3A4U B;  5CSN A;  4CID A;  1QLS A;  3PAT A;  1JC2 A;  3PM8 A;  5AFP A;  2P6B B;  4FQT A;  1XFX O;  3EVV A;  1K9U A;  1LXF C;  1NYA A;  2M7N A;  2PRU A;  2M1K B;  4YGE B;  3JTD B;  4QJ5 B;  2LHI A;  4DIR A;  2BAP A;  1D1O A;  1MF8 B;  1QV0 A;  1XFW O;  2NLN A;  4I5L B;  4PHM A;  1YRU B;  1B8L A;  1TOP A;  3BUN B;  1WY9 A;  1SCV A;  3ICB A;  4ORA B;  5HLV A;  1IGV A;  2NCO A;  3I5F B;  3TDU A;  2JPT A;  2I94 A;  2LHL A;  2OTG B;  1KK7 Y;  2E6W A;  2MLF C;  4TNC A;  2WCE A;  4HRE E;  1RJV A;  5I8N A;  2FCD A;  2ISD A;  2R2I A;  1XA5 A;  3CLN A;  1SL9 A;  3IQQ A;  3CZ1 A;  4OCI A;  5I94 A;  3DD4 A;  3IF7 A;  1YUR A;  2NCP A;  2OS8 B;  2H2K A;  4GAO A;  1J7R A;  1Z2C B;  2ZNE A;  5AER A;  1GQM A;  1L7Z A;  5HLO A;  2F33 A;  3TS5 C;  5B8I B;  3NHT A;  2KFH A;  4DRW A;  1IH0 A;  3SIA A;  1NSH A;  1BF5 A;  2LAP A;  2LCP A;  2Y5I A;  1SR6 C;  2Y4Q A;  1QAT A;  2LC5 A;  2NXQ A;  1K94 A;  1TNW A;  1YRT B;  3R1V A;  3VRQ A;  3PN7 C;  3B7A A;  1EXR A;  1Z4H A;  3DF0 B;  1LKJ A;  2G2B A;  3BUM B;  1C07 A;  1B8R A;  1MUX A;  2WCK A;  2WC8 A;  1H8B A;  1KK8 C;  2CCM A;  2KI4 B;  2JU0 A;  4PHN A;  3L4A A;  5AXI A;  1FF1 A;  1AHR A;  1JSA A;  2MHH A;  2KI6 C;  5I2L A;  1BR1 B;  1BJF A;  1FPW A;  1QVI Z;  1L2O C;  3I5H B;  1AUI B;  1NCX A;  2PAL A;  3OX6 A;  3CS1 A;  3H4S E;  4C0L A;  5PAL A;  4MRY A;  3EG5 B;  1RWY A;  3CR2 A;  1NX2 A;  1UP5 A;  2GGZ A;  3OB2 B;  3NGV A;  3I5F C;  4M2Q A;  1MXL C;  2OTG C;  3PFV A;  2F2O A;  3D76 A;  1HT9 A;  2PSR A;  4YGC B;  1SW8 A;  2L5Y A;  2K61 A;  3BYA A;  1OMD A;  5AAN A;  1BG1 A;  1FW4 A;  4MZK A;  3FIA A;  3CZ0 A;  2BKH B;  3DVM A;  3DXL A;  5JOL A;  2LMU A;  2H61 C;  2M49 B;  2OS8 C;  2QEV A;  3EVU A;  1FI6 A;  1KQM B;  2PMY A;  1YX8 A;  3O6B A;  3QRX A;  5DKR A;  3WNX B;  3WHU B;  2KFF A;  2AAO A;  1CLL A;  1TNP A;  5HKY A;  1CLM A;  1JFK A;  2JTZ A;  2Y1M A;  3SG3 A;  1QS7 A;  1S26 D;  4YGD B;  1S6J A;  2K0J A;  2FJU B;  4MLW A;  5DKN A;  2KBM A;  1EL4 A;  1IQ3 A;  2PQL A;  1ALV A;  3CGA A;  3KEV A;  1F4Q A;  2LUX A;  1UHJ A;  2JC2 A;  3VB1 A;  3OHM B;  1TCO B;  3SG2 A;  1F54 A;  1WDC C;  5G08 A;  3BFA A;  1OOH A;  2JT3 A;  2CT9 A;  3KO0 A;  2JT8 A;  1C3Y A;  3F45 A;  4XJK A;  2VRG A;  2I18 A;  2MAZ A;  2FJY A;  2H8V A;  2WC6 A;  3B86 A;  3HX4 A;  1CFF A;  3I5H C;  1UHH A;  1M39 A;  1C3Z A;  3GK1 A;  1A29 A;  1BU3 A;  1EJ3 A;  3DVE A;  1PRW A;  2EHB A;  4YI9 A;  1F55 A;  3L4L A;  1DTL A;  1YUT A;  2HF5 A;  1S1E A;  1NX3 A;  1U5I A;  1ORG A;  2JNF A;  2L4I A;  4MN0 A;  1KFU S;  1TWO A;  2QDI A;  3DY9 A;  1HQV A;  4GPL B;  1LS8 A;  4M2O A;  1YX7 A;  4MRX A;  3TZ1 A;  3MSE B;  3GK4 X;  3VRO A;  5CSF A;  4HRH A;  4ETO A;  4YI8 A;  5DIC A;  3KPX A;  1W7J B;  1K90 D;  1K9K A;  2Q4U A;  1RFJ A;  4MBE A;  1F8H A;  5AEQ A;  1KQM C;  1A75 B;  2L2E A;  3UNW A;  1YR5 A;  3D0Y B;  4C0K A;  1FI5 A;  2QEO A;  2ERB A;  2BEC A;  3D74 A;  1DGU A;  2M3W A;  2KLE A;  4PAL A;  2KBI A;  5DKQ A;  1OZS A;  3D73 A;  1QWV A;  2FCE A;  3BUO B;  3SS3 A;  1DJY A;  1BLQ A;  3EKJ A;  3FE8 A;  1WLZ A;  4AQI A;  2ZRS A;  4PE4 A;  1DQE A;  3I5I C;  1K2H A;  1XFY O;  2K7B A;  1JF2 A;  1YUU A;  2QAC A;  4FQO A;  1PUL A;  1B9A A;  1AJ4 A;  1G33 A;  4C0J A;  1QJT A;  3QME A;  1K96 A;  1NCZ A;  2KDH A;  1OQP A;  3BUX B;  1PSB A;  5HL1 A;  3L47 A;  1CLB A;  2LVV A;  4PE0 A;  3IQO A;  1K8U A;  2KGB C;  2BL0 B;  2BKI B;  5HKZ A;  4PHK A;  1A4P A;  3DVK A;  1OOG A;  1OOF A;  2KFG A;  1X02 A;  2K7C A;  1KFX S;  2WCJ A;  2LUC A;  1CB1 A;  4OV2 A;  1YVH A;  2HQW A;  2HQ8 A;  1K95 A;  2M97 A;  1N0Y A;  1TCF A;  1C7V A;  3VRN A;  2F8P A;  3TDZ A;  2RGI A;  5D69 A;  2EC6 B;  3SIB A;  3RM1 A;  1KCY A;  2ZN9 A;  2MRD A;  1GJY A;  3PSR A;  4PE1 A;  1B8C A;  1SL8 A;  5J3X A;  4UPG A;  2BBN A;  1ZAC A;  4YRU A;  1A03 A;  2P71 A;  4ZCU A;  1K9P A;  2Y1N A;  1J1E A;  3DYE A;  1NP8 A;  2F2P A;  1CKK A;  3OX5 A;  2COL B;  1SKT A;  1XFU O;  1PAL A;  1S6I A;  1EG3 A;  2HET A;  3CTN A;  2LVJ A;  3FS7 A;  1Y1X A;  2MJW B;  3BQ3 A;  3LL8 B;  1XK4 C;  1QAS A;  3AAK A;  5I2O A;  3S0F A;  3JTD C;  2I7A A;  2LNK A;  2H61 A;  1TUZ A;  4NDC A;  3I5G B;  2BBM A;  4JWQ A;  4OVN F;  1ZMZ A;  1B1G A;  1CDP A;  1Y6W A;  1PSR A;  4DCK A;  2WOS A;  4CFQ A;  1NPQ A;  4I5J A;  4GBA A;  4GFT A;  2KPH A;  1IJ5 A;  1SNL A;  2JOJ A;  1SMG A;  2BL0 C;  1S3P A;  1LIN A;  2LMT A;  1LA3 A;  1TNQ A;  2CXJ A;  3D10 A;  3SS5 A;  1WRK A;  3O2P A;  4GGN A;  1T14 A;  1RTP 1;  2G9B A;  2QEB A;  3DF0 A;  1W9Z A;  5HYD A;  4Q04 A;  4E68 A;  1KWO B;  3OBV A;  4MEW A;  2ZRT A;  4HRG A;  1DJZ A;  2WCF A;  3UO9 A;  3LCP C;  1QIW A;  2QPT A;  2BCB A;  2EC6 C;  1AK8 A;  1NIW A;  1S5G Y;  4P2Y B;  2CNP A;  1QTX A;  3OGN A;  4PT1 A;  2JXC A;  3PJI A;  1BMO A;  1SCM B;  1OMR A;  1H4B A;  2WCM A;  1XFV O;  2Q91 A;  2KLD A;  2WND A;  2NZ0 A;  3Q8I A;  2L98 A;  2L5X B;  2LV7 A;  2M0R A;  1JF0 A;  3D75 A;  2F3Z A;  4N1F A;  4DS7 A;  1B7T Y;  3CZ2 A;  1CFP A;  1REC A;  2LP2 A;  2KSP A;  4A4B A;  2L50 A;  2EGD A;  1NUB A;  2L2C A;  2M8U A;  2KI4 C;  2WOR A;  4ICB A;  3B6X A;  5GQQ C;  1J7P A;  1TRF A;  1QX7 A;  3CR5 X;  2BNX A;  3DVJ A;  2K2F A;  1K93 D;  3BFB A;  4GGF A;  1KSM A;  5BPJ A;  1PK0 D;  4MZL A;  5CPV A;  1DJX A;  4F0Z B;  4AOM A;  3A8R A;  5D3O A;  2V53 A;  3AAJ A;  3LK1 A;  2CBL A;  1Y0V H;  1KK7 Z;  1G4Y R;  5KTY A;  4I5N B;  1DT7 B;  1IQ5 A;  2M9G A;  1NX0 A;  2F3Y A;  3LK0 A;  1M46 A;  3CDN A;  2JXL A;  2MBX A;  2JZI A;  1UHK A;  1V1G A;  1J7Q A;  4GUK A;  4PCW A;  1OOJ A;  4YGA A;  2LLU A;  1KWO C;  2D8N A;  3CAB A;  1Y1A A;  2JNX A;  1QV1 A;  4GGF C;  1Q80 A;  4JD9 A;  4KYN A;  2M7L A;  3BOW B;  1UHI A;  1IG5 A;  3VRR A;  3S0G A;  2WCB A;  3O78 A;  3KF9 A;  4QJ3 B;  2A4J A;  2SAS A;  1CM1 A;  3AKA A;  3KHE A;  5D7F A;  2JQ6 A;  1R6P A;  2LLT A;  1SCM C;  1OE9 B;  5KSZ A;  1CTR A;  2ZFD A;  1S6C A;  1MWN A;  2YGU A;  2SCP A;  4R1E A;  1DJI A;  3S0B A;  1DGV A;  2IS9 A;  3BJH A; 
#chains in the Genus database with same CATH homology
 1EG4 A;  4YBH B;  5JJG A;  3E3R A;  4I5K A;  1J1D A;  1LA0 A;  2ZN8 A;  1Y1U A;  3NSL A;  4M2P A;  2L0P A;  1S36 A;  2MA2 A;  3BUW B;  4HSZ A;  1TTX A;  4BY4 A;  4WRI A;  5TNC A;  3TDI A;  1AP4 A;  1XVJ A;  1UUR A;  3OP0 A;  1IKU A;  1A75 A;  4PHJ A;  2HPS A;  1UHN A;  3D0Y A;  4NDD A;  2K8M B;  1F70 A;  3O4Y A;  1UWO A;  5ER4 X;  3TUY B;  1KSO A;  5ER5 A;  1CDM A;  1CFD A;  4L9M A;  2LVK A;  4PDZ A;  1QX5 B;  1N2D A;  1A2X A;  4MVF A;  5CSJ A;  2DOQ A;  1RRO A;  4AQJ A;  1ZFS A;  1OMV A;  1L2O B;  1NCY A;  1ZUZ A;  1DF0 B;  3EVR A;  3BXK A;  4D1E A;  3C1V A;  3NXA A;  4QJ4 B;  1S5G Z;  1XK4 A;  2CTN A;  3AKB A;  1DMO A;  1V1F A;  4BY5 A;  1DJH A;  1W7I B;  4JPZ B;  1ZOT B;  2OPO A;  3PAL A;  4N5X A;  4ORB B;  1QX2 A;  1M45 A;  2AUC A;  2PVB A;  2JRF A;  1B7T Z;  4GNK B;  1WRZ A;  2TN4 A;  4ZCV A;  1J55 A;  2JTT A;  3SG7 A;  2JT0 A;  1PVB A;  3VGO A;  1CMG A;  1BOD A;  3NSO A;  5I2Q A;  2KAY A;  1YTZ C;  4U8D A;  1DJW A;  4NDB A;  1TN4 A;  1SBJ A;  1CDL A;  1OSA A;  4PE7 A;  2AMI A;  4XYN A;  3EK7 A;  1DF0 A;  5KU1 A;  1YUS A;  2FOT A;  1CMF A;  2LE9 B;  3JVT B;  1JWD A;  1OZO A;  1SL7 A;  3NSI A;  2JUL A;  2K7D A;  2MLE C;  3SG4 A;  1AVS A;  1DVI A;  1IWQ A;  3TUY C;  1WDC B;  1N65 A;  2B1U A;  1TNX A;  1JFJ A;  1LVC D;  2ZND A;  3FWC A;  1WLM A;  5F6T A;  1MXE A;  2L4H A;  3HCM A;  1CDN A;  4OKH A;  1AJ5 A;  1MR8 A;  2K2A A;  2KYF A;  1TIZ A;  2JWW A;  4CPV A;  2KNE A;  1KFU L;  2GGM A;  3RLZ A;  1FBV A;  3NSK A;  3FWB A;  4ORC B;  1MHO A;  1CM4 A;  3ZNI A;  1BOC A;  1EH2 A;  1BR4 B;  2LP3 A;  1M31 A;  4OR9 B;  1CNP A;  1XO5 A;  3WXA A;  4XJK B;  3ZWH A;  3CR4 X;  2LLS A;  4FTG A;  2KQY A;  4CLN A;  1BT6 A;  5K89 A;  2KQ6 A;  1B47 A;  1QXP A;  2E30 A;  3GOF A;  4NQG A;  3SJS A;  2LM5 A;  1WRL A;  3VRP A;  1VRK A;  4P5O E;  4A4C A;  1U5I B;  2M29 A;  3I5G C;  1PVA A;  4DUQ A;  2KAV A;  3LLE A;  2PAS A;  2BCX A;  4JQ0 D;  1RK9 A;  1XYD A;  3JVT C;  1GGW A;  3EKH A;  1ALW A;  1NWD A;  2KI6 D;  3I5I B;  3OB1 B;  2O60 A;  1QLK A;  3WHT B;  1JBA A;  2I2R E;  1F71 A;  1NX1 A;  1GGZ A;  1G8I A;  1QVI Y;  3PLF B;  1KQV A;  1KFX L;  5IBW A;  1QIV A;  1YVL A;  2L51 A;  2KOT A;  1IJ6 A;  2LAN A;  1CFC A;  2KYC A;  3SG5 A;  2BCA A;  4N1G A;  1E8A A;  3M0W A;  1MQ1 A;  2BE4 A;  3K21 A;  1C7W A;  2KHN A;  2O5G A;  2LMV A;  5CSI A;  4YGB B;  1SRA A;  4MZJ A;  5FYX A;  1SY9 A;  2LVI A;  3EK8 A;  3SG6 A;  4MSP A;  1F4O A;  3TS5 B;  2BE6 A;  1IRJ A;  4IL1 A;  1SPY A;  1ODB A;  2M1U A;  2KAX A;  1SR6 B;  4WQ2 A;  2GV5 A;  1SYM A;  2K7O A;  1B4C A;  2KGR A;  3PN7 B;  5HKW A;  1R2U A;  3BOW A;  3CWG A;  3CZT X;  3GK2 A;  1XFZ O;  1JUO A;  2ZKM X;  1DJG A;  1SK6 D;  4WQ3 A;  1J7O A;  4USL A;  1M63 B;  1KK8 B;  4CFR A;  3EK4 A;  1UUS A;  3A4U B;  5CSN A;  4CID A;  1QLS A;  3PAT A;  1JC2 A;  3PM8 A;  5AFP A;  2P6B B;  1XFX O;  3EVV A;  1K9U A;  1LXF C;  1NYA A;  2M7N A;  2PRU A;  2M1K B;  4YGE B;  3JTD B;  4QJ5 B;  2LHI A;  4DIR A;  1D1O A;  1MF8 B;  1QV0 A;  1XFW O;  2NLN A;  4I5L B;  4PHM A;  1YRU B;  1B8L A;  1TOP A;  3BUN B;  1WY9 A;  1SCV A;  3ICB A;  4ORA B;  5HLV A;  1IGV A;  2NCO A;  3I5F B;  3TDU A;  2JPT A;  2I94 A;  2LHL A;  2OTG B;  1KK7 Y;  2E6W A;  2MLF C;  4TNC A;  2WCE A;  4HRE E;  1RJV A;  5I8N A;  2FCD A;  2ISD A;  2R2I A;  1XA5 A;  3CLN A;  1SL9 A;  3IQQ A;  4OCI A;  3DD4 A;  3IF7 A;  1YUR A;  2NCP A;  2OS8 B;  2H2K A;  4GAO A;  1J7R A;  2ZNE A;  5AER A;  1GQM A;  1L7Z A;  5HLO A;  2F33 A;  3TS5 C;  5B8I B;  2KFH A;  4DRW A;  1IH0 A;  3SIA A;  1NSH A;  1BF5 A;  2LAP A;  2LCP A;  2Y5I A;  1SR6 C;  2Y4Q A;  1QAT A;  2LC5 A;  2NXQ A;  1K94 A;  1TNW A;  1YRT B;  3VRQ A;  3PN7 C;  1EXR A;  3DF0 B;  1LKJ A;  2G2B A;  3BUM B;  1C07 A;  1B8R A;  1MUX A;  2WC8 A;  1H8B A;  1KK8 C;  2CCM A;  2KI4 B;  2JU0 A;  4PHN A;  5AXI A;  1FF1 A;  1AHR A;  1JSA A;  2MHH A;  2KI6 C;  5I2L A;  1BR1 B;  1BJF A;  1FPW A;  1QVI Z;  1L2O C;  3I5H B;  1AUI B;  1NCX A;  2PAL A;  3OX6 A;  3CS1 A;  3H4S E;  4C0L A;  5PAL A;  4MRY A;  1RWY A;  3CR2 A;  1NX2 A;  1UP5 A;  2GGZ A;  3OB2 B;  3I5F C;  4M2Q A;  1MXL C;  2OTG C;  3PFV A;  2F2O A;  1HT9 A;  2PSR A;  4YGC B;  1SW8 A;  3BYA A;  2K61 A;  1OMD A;  5AAN A;  1BG1 A;  1FW4 A;  4MZK A;  3FIA A;  3DVM A;  2BKH B;  5JOL A;  2LMU A;  2H61 C;  2M49 B;  2OS8 C;  3EVU A;  1FI6 A;  1KQM B;  2PMY A;  1YX8 A;  3O6B A;  3QRX A;  5DKR A;  3WNX B;  3WHU B;  2KFF A;  2AAO A;  1CLL A;  1TNP A;  5HKY A;  1CLM A;  1JFK A;  2JTZ A;  2Y1M A;  3SG3 A;  1QS7 A;  1S26 D;  4YGD B;  1S6J A;  2K0J A;  2FJU B;  4MLW A;  5DKN A;  2KBM A;  1EL4 A;  1IQ3 A;  1ALV A;  3CGA A;  3KEV A;  1F4Q A;  2LUX A;  1UHJ A;  2JC2 A;  3OHM B;  1TCO B;  3SG2 A;  1F54 A;  1WDC C;  5G08 A;  2JT3 A;  2CT9 A;  3KO0 A;  2JT8 A;  3F45 A;  4XJK A;  2VRG A;  2I18 A;  2MAZ A;  1CFF A;  3HX4 A;  3I5H C;  1UHH A;  1M39 A;  3GK1 A;  1A29 A;  1BU3 A;  1EJ3 A;  3DVE A;  1PRW A;  2EHB A;  4YI9 A;  1F55 A;  1DTL A;  1YUT A;  2HF5 A;  1S1E A;  1NX3 A;  1U5I A;  2JNF A;  2L4I A;  4MN0 A;  1KFU S;  4GPL B;  1HQV A;  4M2O A;  4MRX A;  3TZ1 A;  1YX7 A;  3MSE B;  3GK4 X;  3VRO A;  5CSF A;  4HRH A;  4ETO A;  4YI8 A;  3KPX A;  1W7J B;  1K90 D;  1K9K A;  2Q4U A;  1RFJ A;  4MBE A;  1F8H A;  5AEQ A;  1KQM C;  1A75 B;  2L2E A;  1YR5 A;  3D0Y B;  4C0K A;  1FI5 A;  2BEC A;  1DGU A;  2M3W A;  4PAL A;  2KBI A;  5DKQ A;  1OZS A;  2FCE A;  3BUO B;  1DJY A;  1BLQ A;  3EKJ A;  1WLZ A;  4AQI A;  2ZRS A;  4PE4 A;  3I5I C;  1K2H A;  1XFY O;  2K7B A;  1JF2 A;  1YUU A;  2QAC A;  4FQO A;  1PUL A;  1B9A A;  1AJ4 A;  1G33 A;  4C0J A;  1QJT A;  1K96 A;  1NCZ A;  2KDH A;  1OQP A;  3BUX B;  1PSB A;  1CLB A;  2LVV A;  4PE0 A;  3IQO A;  1K8U A;  2KGB C;  2BL0 B;  2BKI B;  5HKZ A;  4PHK A;  1A4P A;  3DVK A;  2KFG A;  1X02 A;  2K7C A;  1KFX S;  2LUC A;  1CB1 A;  4OV2 A;  1YVH A;  2HQW A;  2HQ8 A;  1K95 A;  2M97 A;  1N0Y A;  1TCF A;  1C7V A;  3VRN A;  2F8P A;  3TDZ A;  2RGI A;  5D69 A;  2EC6 B;  3SIB A;  3RM1 A;  1KCY A;  2ZN9 A;  2MRD A;  1GJY A;  3PSR A;  4PE1 A;  1B8C A;  1SL8 A;  5J3X A;  4UPG A;  2BBN A;  1ZAC A;  4YRU A;  1A03 A;  4ZCU A;  1K9P A;  2Y1N A;  1J1E A;  1NP8 A;  2F2P A;  1CKK A;  3OX5 A;  2COL B;  1SKT A;  1XFU O;  1PAL A;  1S6I A;  1EG3 A;  2HET A;  3CTN A;  2LVJ A;  3FS7 A;  1Y1X A;  2MJW B;  3BQ3 A;  3LL8 B;  1XK4 C;  1QAS A;  3AAK A;  5I2O A;  3JTD C;  2I7A A;  2LNK A;  2H61 A;  4NDC A;  3I5G B;  2BBM A;  4JWQ A;  4OVN F;  1ZMZ A;  1B1G A;  1CDP A;  1Y6W A;  1PSR A;  4DCK A;  2WOS A;  4CFQ A;  1NPQ A;  4I5J A;  4GBA A;  4GFT A;  1IJ5 A;  1SNL A;  2JOJ A;  1SMG A;  2BL0 C;  1S3P A;  1LIN A;  2LMT A;  1LA3 A;  1TNQ A;  2CXJ A;  3D10 A;  1WRK A;  3O2P A;  4GGN A;  1RTP 1;  2G9B A;  3DF0 A;  5HYD A;  4Q04 A;  4E68 A;  1KWO B;  4MEW A;  2ZRT A;  4HRG A;  1DJZ A;  2WCF A;  3LCP C;  1QIW A;  2QPT A;  2BCB A;  2EC6 C;  1AK8 A;  1NIW A;  1S5G Y;  4P2Y B;  2CNP A;  1QTX A;  2JXC A;  1BMO A;  1SCM B;  1OMR A;  1H4B A;  1XFV O;  2Q91 A;  2WND A;  2NZ0 A;  2L98 A;  2L5X B;  2LV7 A;  2M0R A;  1JF0 A;  4DS7 A;  2F3Z A;  4N1F A;  1B7T Y;  1CFP A;  1REC A;  2LP2 A;  2KSP A;  4A4B A;  2L50 A;  2EGD A;  1NUB A;  2M8U A;  2KI4 C;  2WOR A;  4ICB A;  5GQQ C;  1J7P A;  1TRF A;  1QX7 A;  3CR5 X;  3DVJ A;  2K2F A;  1K93 D;  4GGF A;  1KSM A;  5BPJ A;  1PK0 D;  4MZL A;  5CPV A;  1DJX A;  4F0Z B;  4AOM A;  3A8R A;  2V53 A;  3AAJ A;  3LK1 A;  2CBL A;  1Y0V H;  1KK7 Z;  1G4Y R;  5KTY A;  4I5N B;  1DT7 B;  1IQ5 A;  2M9G A;  1NX0 A;  2F3Y A;  3LK0 A;  1M46 A;  2JXL A;  2MBX A;  2JZI A;  1UHK A;  1V1G A;  1J7Q A;  4GUK A;  4PCW A;  1OOJ A;  4YGA A;  2LLU A;  1KWO C;  2D8N A;  4GGF C;  1Y1A A;  2JNX A;  1QV1 A;  1Q80 A;  2M7L A;  3BOW B;  1UHI A;  1IG5 A;  3VRR A;  2WCB A;  3O78 A;  3KF9 A;  4QJ3 B;  2A4J A;  2SAS A;  1CM1 A;  3AKA A;  3KHE A;  5D7F A;  2JQ6 A;  1R6P A;  2LLT A;  1SCM C;  1OE9 B;  5KSZ A;  1CTR A;  2ZFD A;  1S6C A;  1MWN A;  2SCP A;  4R1E A;  1DJI A;  1DGV A;  2IS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...