1XA5A

Structure of calmodulin in complex with kar-2, a bis-indol alkaloid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
144
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the complex of calmodulin with KAR-2: a novel mode of binding explains the unique pharmacology of the drug
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Calmodulin
total genus 49
structure length 144
sequence length 146
ec nomenclature
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xa5A00
1BR4B 1U5IA 5ER4X 1JWDA 1MWNA 3DVEA 3VRQA 3SG7A 2PRUA 2LMVA 1S6JA 4ETOA 1TCOB 1K9PA 2G9BA 2JQ6A 2NZ0A 1F55A 5JOLA 5CSNA 4D1EA 1F4QA 2KI4C 1SR6C 3AAJA 3VROA 1SR6B 1WRZA 5AEQA 1R2UA 2G2BA 1OMDA 3GK1A 1NX1A 4YI8A 1YRUB 3RLZA 2Q91A 1QLSA 5I8NA 1XO5A 4N1GA 2BKHB 1QX7A 1S1EA 3BXKA 1QS7A 2O60A 5FYXA 1YX7A 2CXJA 1UP5A 1SCMB 1ZOTB 5AERA 3SG3A 1TIZA 2JWWA 3CGAA 1QV0A 3LCPC 1OMVA 1S5GY 4AQJA 1DJHA 4CLNA 4CFQA 1CTRA 1IWQA 1OMRA 1QATA 1RROA 3AAKA 4NDDA 1KK8C 2M7NA 3TDUA 2JT0A 2ZRSA 1J7PA 2LCPA 1YUTA 1B1GA 1K2HA 3O6BA 2PASA 3SG4A 1OOJA 2AMIA 3VRNA 1B9AA 1TCFA 2AAOA 2JXCA 4YGAA 1NCZA 4YGCB 4MZJA 1DJGA 3I5IB 3QRXA 4MLWA 2M7LA 2Y5IA 2I2RE 2L51A 4C0LA 4GPLB 4I5JA 4USLA 2JULA 5I2QA 3OB2B 2IS9A 1SMGA 1K8UA 1XFZO 3FWBA 1UHHA 1B4CA 1YTZC 4XJKA 1EXRA 2E30A 3DVKA 1FF1A 2WCFA 4HRHA 1TTXA 2BBNA 2LLSA 3JTDC 4Q04A 2F3YA 2KBIA 2FOTA 1SL7A 3O2PA 2LLUA 2MLEC 5HLVA 1V1GA 2M49B 2DOQA 3WHUB 2KAYA 4M2OA 3VRRA 2L5XB 1NCYA 2BBMA 1CNPA 3NSKA 4I5KA 5KU1A 1XFUO 1PVBA 3CLNA 3SG5A 4ICBA 1YVLA 3D0YB 3SG2A 1BJFA 1TN4A 1OZOA 3K21A 4PHJA 1SW8A 1DJWA 2JT3A 3IF7A 3I5HC 2KI4B 1DJIA 4A4BA 3OX6A 3OX5A 1C7VA 1H4BA 1YVHA 1FPWA 3GK2A 1SCVA 2KGRA 3MSEB 3OHMB 1TRFA 4MVFA 2E6WA 1BG1A 2OS8B 1AVSA 3GOFA 4GGFA 1WDCB 4CPVA 5KTYA 3CS1A 1S6CA 1SRAA 1TNXA 1IG5A 4HREE 2HPSA 3BUMB 2Q4UA 3E3RA 2Y4QA 4MN0A 1SYMA 1WLMA 1IH0A 1HT9A 3TDZA 2LVIA 1ALWA 4I5LB 1M46A 1Y0VH 2BKIB 5AXIA 1A4PA 3LL8B 1M45A 1Y1UA 5TNCA 3A8RA 2JU0A 2JPTA 3IQQA 2EC6B 3PSRA 1XVJA 2K7BA 1PVAA 1J1EA 2WCEA 2EC6C 3WXAA 2D8NA 3IQOA 2FCEA 5HYDA 1F4OA 3GK4X 2GGMA 2M0RA 2ISDA 1YUSA 1CKKA 2MHHA 2VRGA 1G8IA 2MA2A 4DRWA 3DVJA 1MXLC 2CT9A 2KDHA 1JF2A 4QJ5B 2OS8C 1KSOA 2KI6D 4MSPA 4GUKA 1B7TY 5I2LA 1QV1A 2JRFA 1EJ3A 4YGDB 2BCBA 4PE0A 1E8AA 1V1FA 2K7OA 2V53A 1K96A 3EVRA 4M2PA 1SBJA 3I5HB 1J1DA 1SL9A 1F70A 2QPTA 3CTNA 2LMTA 3CWGA 2ZNEA 2ZFDA 3M0WA 2Y1NA 1OSAA 3PLFB 1ZACA 1LVCD 4BY4A 3NSIA 1CMFA 1KQMB 4GFTA 1G4YR 1WRKA 1RWYA 1CDLA 3TS5B 1W7JB 1PALA 2NXQA 4QJ3B 1KK7Z 5BPJA 5AANA 4CFRA 1RECA 3I5FB 1J7OA 2M29A 3SIAA 1MR8A 2R2IA 4ZCVA 3DF0A 1VRKA 3WHTB 1XFYO 1J7QA 1MF8B 2H61C 1DVIA 4U8DA 1BR1B 2JXLA 2JNXA 4OCIA 3A4UB 3RM1A 4AOMA 4PALA 1C7WA 2PMYA 1K9KA 1FI5A 1QXPA 1SY9A 2HETA 2WOSA 1S5GZ 5K89A 2KNEA 2L98A 2KAXA 2LE9B 1C07A 2HQ8A 1K93D 1XFXO 1PSRA 1KFUS 1F71A 5CSFA 1MQ1A 2I94A 3FS7A 3PN7C 3EK8A 3SG6A 1J55A 3EKJA 4N1FA 4HSZA 3PFVA 2HQWA 2KGBC 4OV2A 4WRIA 3PM8A 1NX0A 4PHNA 2M8UA 1CM4A 3ZNIA 2BL0B 3KO0A 2JTTA 3EVUA 3DVMA 2NCOA 2COLB 1DJYA 2K7DA 4NDBA 1TNWA 4R1EA 1LA3A 3VGOA 4UPGA 3D0YA 2PSRA 1CFCA 1K95A 2L4IA 2F8PA 1U5IB 2JNFA 2L0PA 1M63B 1IQ5A 3BQ3A 1KFXS 1L2OB 1M31A 1FBVA 1B8CA 1QVIY 3O78A 5D69A 2CBLA 1LA0A 2O5GA 1WDCC 4DIRA 4A4CA 2BCAA 2F2PA 1NSHA 3WNXB 1DGUA 4C0JA 3KF9A 1N0YA 1G33A 1UURA 2F33A 2M1UA 1CLBA 3LK1A 2LMUA 3CR4X 1JUOA 1KWOB 2JOJA 3I5GC 1KWOC 4MBEA 1BODA 2L4HA 4JPZB 3TUYC 1CLLA 1S26D 1YR5A 1B8LA 2LNKA 1QTXA 5IBWA 1KFUL 2KSPA 2F2OA 1TOPA 1WY9A 3EK7A 4F0ZB 4JQ0D 1N2DA 4GAOA 1MHOA 3PALA 1L2OC 4WQ3A 5DKRA 1DF0A 5F6TA 3NSLA 1CFDA 2KQYA 1BF5A 2ZKMX 2QACA 1NX2A 1BU3A 1JF0A 1D1OA 1FI6A 1QLKA 2MAZA 1GGWA 3DD4A 1SKTA 1H8BA 3NXAA 1IKUA 2BL0C 2KI6C 2LVJA 3BYAA 5CPVA 5HKYA 1IQ3A 4YRUA 3LK0A 2LP2A 5CSJA 1LINA 1RK9A 1XFVO 4GNKB 1RFJA 1A03A 3AKBA 2B1UA 2KFGA 5ER5A 5J3XA 3KEVA 1NYAA 1AJ4A 2M97A 3OB1B 1JFJA 1NCXA 2FCDA 2JZIA 2LAPA 3I5IC 1JC2A 2PALA 1CMGA 1IJ5A 1DGVA 1IGVA 1Y1AA 2Y1MA 3BUXB 1NPQA 4N5XA 4XJKB 1W7IB 1AK8A 3HCMA 2GGZA 2MRDA 4L9MA 1AJ5A 1UWOA 3PATA 2ZNDA 1X02A 5GQQC 2JTZA 1XFWO 1KK8B 2I18A 1QIVA 2M1KB 5HKWA 2FJUB 4CIDA 2LANA 2MLFC 4PCWA 2KYFA 1DJZA 3AKAA 1SCMC 4OR9B 2F3ZA 1B8RA 1LKJA 2K61A 1DMOA 1IJ6A 2WC8A 1PSBA 1A75B 3C1VA 2M9GA 1BMOA 1KSMA 5I2OA 1YRTB 2JT8A 1CFFA 1PULA 4YI9A 3KHEA 1K9UA 3TUYB 4IL1A 5HLOA 4GGFC 5G08A 5DKQA 3TDIA 3ICBA 4I5NB 2LP3A 3F45A 1BOCA 1EG4A 3KPXA 4YGBB 1ZFSA 2A4JA 4XYNA 1K94A 1S3PA 3I5GB 1KK7Y 2SCPA 2CTNA 3FWCA 4P5OE 1OQPA 1GQMA 2K0JA 3HX4A 2P6BB 2K8MB 1ALVA 2KBMA 1EG3A 2RGIA 3LLEA 4PE4A 1NUBA 2AUCA 1KQVA 5D7FA 4M2QA 1UHIA 2KYCA 1DT7B 1CLMA 1GGZA 1YURA 4E68A 1EH2A 1F8HA 3VRPA 1QASA 4PDZA 1Y1XA 2H61A 3EK4A 1KCYA 5KSZA 4GGNA 1YX8A 1CFPA 1QVIZ 3CR5X 4AQIA 1BT6A 1UHNA 2LLTA 2OTGC 1NP8A 2LVKA 1NX3A 1QX5B 1XK4C 1Y6WA 3TZ1A 1CDNA 4PE7A 4C0KA 1RJVA 2MJWB 1PRWA 4JWQA 1EL4A 1HQVA 1S36A 1OZSA 2KFFA 4MRYA 3BUOB 4BY5A 1IRJA 2LVVA 1L7ZA 4NQGA 1R6PA 3PN7B 5B8IB 1AUIB 1SPYA 2L50A 1B47A 3BUWB 5CSIA 1XA5A 1FW4A 1GJYA 1A29A 1ODBA 4WQ2A 1UHKA 1N65A 1CM1A 5JJGA 2JC2A 3CZTX 4MEWA 2KFHA 3SJSA 2EGDA 1QJTA 3D10A 2KHNA 4PHKA 2M3WA 2LV7A 2HF5A 2LM5A 4TNCA 3ZWHA 2CCMA 4ORBB 1RTP1 1B7TZ 5HKZA 2ZRTA 2L2EA 4HRGA 5PALA 4QJ4B 1BLQA 2WORA 1XK4A 1SK6D 1WRLA 3JVTB 4P2YB 1XYDA 1DF0B 4MZKA 2ZN8A 1WLZA 1DTLA 3I5FC 1ZUZA 2EHBA 2LUCA 2K2FA 3H4SE 4FQOA 4OVNF 1TNPA 1A75A 3TS5C 2BCXA 1AHRA 1NWDA 3JVTC 3NSOA 1YUUA 2K2AA 1KQMC 1MXEA 2LC5A 2ZN9A 2WNDA 2LHLA 4MZLA 2NLNA 3JTDB 2I7AA 2H2KA 4GBAA 1UHJA 2CNPA 4NDCA 4YGEB 1CDPA 2PVBA 2LUXA 5DKNA 3FIAA 4PHMA 4MRXA 1SL8A 1CB1A 3BUNB 2KOTA 2MBXA 1TNQA 1K90D 3CR2A 4PE1A 4FTGA 2BE6A 5AFPA 1AP4A 2NCPA 3O4YA 4ORAB 3EVVA 1F54A 4DS7A 4YBHB 1SNLA 1S6IA 2WCBA 4DUQA 1LXFC 2KQ6A 4ORCB 3SIBA 1M39A 1UUSA 1OE9B 1JFKA 1DJXA 1PK0D 1MUXA 1QIWA 2LHIA 3BOWB 3EKHA 3BOWA 2KAVA 1A2XA 2OPOA 1Q80A 2OTGB 2SASA 2GV5A 4ZCUA 1JBAA 2K7CA 4DCKA 1NIWA 1ZMZA 2BE4A 2BECA 1KFXL 1CDMA 1QX2A 3DF0B 1JSAA 4OKHA 1J7RA 2TN4A 3OP0A
chains in the Genus database with same CATH superfamily
1BR4B 1U5IA 5ER4X 1JWDA 3VB1A 1MWNA 3DVEA 3VRQA 3SG7A 2PRUA 2LMVA 1S6JA 4ETOA 1TCOB 3L4LA 1K9PA 2G9BA 2JQ6A 2NZ0A 1F55A 5JOLA 2KPHA 5CSNA 4D1EA 1F4QA 2KI4C 1SR6C 3AAJA 2BNXA 3VROA 1SR6B 1WRZA 5FI2A 2WCMA 1R2UA 5AEQA 2G2BA 2QEVA 1OMDA 2WCJA 3GK1A 1NX1A 4YI8A 1YRUB 3RLZA 3S0BA 3B7AA 2Q91A 1QLSA 5I8NA 1XO5A 4N1GA 2BKHB 1QX7A 1S1EA 3BXKA 1QS7A 2O60A 5FYXA 1YX7A 2CXJA 1UP5A 1SCMB 1ZOTB 5AERA 3SG3A 1TIZA 2JWWA 3CGAA 1QV0A 3LCPC 1OMVA 1S5GY 3UNWA 1DJHA 4AQJA 4CLNA 4CFQA 1BOCA 1OOFA 1CTRA 1IWQA 1OMRA 1QATA 1RROA 3AAKA 4NDDA 1KK8C 2M7NA 3TDUA 2JT0A 2ZRSA 3PJIA 2LCPA 1YUTA 1J7PA 1B1GA 1K2HA 3O6BA 2PASA 3SG4A 1OOJA 2AMIA 3VRNA 1B9AA 2L5YA 1TCFA 2AAOA 2JXCA 4YGAA 1NCZA 3OGNA 4YGCB 4MZJA 1DJGA 3I5IB 3QRXA 4MLWA 2M7LA 2Y5IA 2I2RE 2L51A 4C0LA 2H8VA 4GPLB 4I5JA 3RZSA 4USLA 2JULA 2K60A 5I2QA 3OB2B 2IS9A 1SMGA 1K8UA 1XFZO 2QEOA 3FWBA 1UHHA 1B4CA 1YTZC 4XJKA 1EXRA 2E30A 3DVKA 3R1VA 1FF1A 2WCFA 1OOHA 4HRHA 1TTXA 2BBNA 3FE8A 2LLSA 3JTDC 4Q04A 3S0GA 1TUJA 2F3YA 2KBIA 2FOTA 1SL7A 3O2PA 2LLUA 1OW4A 2MLEC 3NGVA 5HLVA 2QEHA 1V1GA 2M49B 2DOQA 3WHUB 2KAYA 3D74A 4M2OA 3NHIA 3VRRA 2L5XB 3S0FA 1NCYA 2BBMA 1CNPA 3NSKA 4I5KA 5KU1A 1XFUO 1PVBA 3B86A 3CLNA 3SG5A 4ICBA 1YVLA 3D0YB 3R1OA 3SG2A 1BJFA 1TN4A 1OZOA 3K21A 1TWOA 4PHJA 1SW8A 1DJWA 2JT3A 3O4XA 3IF7A 3I5HC 2KI4B 1DJIA 4A4BA 3OX6A 2GTEA 3L4AA 3OX5A 1C7VA 1H4BA 1YVHA 1FPWA 3GK2A 1SCVA 2KGRA 3MSEB 3OHMB 3SS3A 2BAPA 1TRFA 3V2LA 4MVFA 2E6WA 1BG1A 2OS8B 1AVSA 3GOFA 4GGFA 1WDCB 4CPVA 5KTYA 3CS1A 1S6CA 1SRAA 1TNXA 4INWA 1IG5A 4HREE 2HPSA 3BUMB 2Q4UA 3E3RA 2Y4QA 4MN0A 1SYMA 1WLMA 1IH0A 1HT9A 2QEBA 3TDZA 2LVIA 1ALWA 4I5LB 1M46A 1Y0VH 2BKIB 5AXIA 1A4PA 3LL8B 1M45A 1Y1UA 4IJ7A 3A8RA 2JU0A 2JPTA 3DYEA 3IQQA 5TNCA 2EC6B 3PSRA 1XVJA 2K7BA 3B6XA 1PVAA 1J1EA 2WCEA 2EC6C 3WXAA 2D8NA 3IQOA 2FJYA 2FCEA 5HYDA 1F4OA 4INXA 3GK4X 2GGMA 3K1EA 2M0RA 2ISDA 1YUSA 1CKKA 2MHHA 2VRGA 1G8IA 2MA2A 4DRWA 3DVJA 1MXLC 2CT9A 2KDHA 1JF2A 4QJ5B 2OS8C 1KSOA 2KI6D 4MSPA 4GUKA 1B7TY 5I2LA 1QV1A 2JRFA 1EJ3A 4YGDB 2BCBA 4PE0A 1E8AA 1V1FA 2K7OA 2V53A 1K96A 3EVRA 3DXLA 3QMEA 1SBJA 3CDNA 4JD9A 4M2PA 3I5HB 1J1DA 1SL9A 3R72A 1F70A 2QPTA 3CTNA 2LMTA 3CWGA 2ZNEA 2ZFDA 3M0WA 2Y1NA 1OSAA 3PLFB 1ZACA 1LVCD 4BY4A 1T14A 3NSIA 1KQMB 4GFTA 1CMFA 1G4YR 1WRKA 4KYNA 1RWYA 1CDLA 3TS5B 1W7JB 1PALA 2WC5A 2NXQA 4QJ3B 1KK7Z 5BPJA 5AANA 4CFRA 1RECA 3I5FB 1J7OA 2M29A 1OOIX 3CZ1A 3SIAA 1MR8A 2R2IA 4ZCVA 3DF0A 1VRKA 3SS4A 1XFYO 3WHTB 1MF8B 1J7QA 2H61C 1DVIA 4U8DA 1BR1B 2JXLA 2JNXA 4OCIA 3A4UB 3RM1A 4AOMA 4PALA 1C7WA 2PMYA 1K9KA 1FI5A 1QXPA 1SY9A 2HETA 2WOSA 3N7HA 1S5GZ 5K89A 2KNEA 2L98A 2KAXA 2LE9B 1C07A 3FE9A 2HQ8A 2WC6A 1K93D 1XFXO 1PSRA 1SSEB 3Q8IA 1KFUS 1F71A 5CSFA 1MQ1A 2I94A 3FS7A 3PN7C 3EK8A 3SG6A 1J55A 3EKJA 2KLDA 3SS5A 4N1FA 4HSZA 3PFVA 2HQWA 2WCLA 2KGBC 2PYQA 4OV2A 3PM8A 4WRIA 1NX0A 4PHNA 2M8UA 1CM4A 3ZNIA 2BL0B 3KO0A 2JTTA 3EVUA 3DVMA 2NCOA 2COLB 3B87A 1DJYA 2K7DA 4NDBA 1TNWA 4R1EA 3D78A 1LA3A 3VGOA 4UPGA 3D0YA 2PSRA 1CFCA 1K95A 2L4IA 2F8PA 1U5IB 2JNFA 2L0PA 1M63B 1Z2CB 1C3ZA 1IQ5A 3BQ3A 1KFXS 1L2OB 1M31A 1FBVA 1B8CA 1QVIY 3O78A 2JPOA 5D69A 2CBLA 1LA0A 4F7FA 2O5GA 1P28A 1WDCC 4DIRA 4A4CA 2BCAA 2F2PA 1NSHA 3WNXB 1DGUA 4C0JA 3KF9A 1N0YA 1G33A 1UURA 2F33A 2M1UA 1CLBA 3LK1A 2LMUA 3CR4X 1JUOA 1KWOB 2JOJA 3I5GC 1KWOC 4MBEA 1BODA 2L4HA 4JPZB 3TUYC 5HL1A 1CLLA 1S26D 1YR5A 1B8LA 2LNKA 1QTXA 3UO9A 5IBWA 1KFUL 2KSPA 2F2OA 1TOPA 1WY9A 3EK7A 4F0ZB 4JQ0D 1N2DA 4GAOA 1MHOA 1Z4HA 3PALA 1L2OC 4WQ3A 5DKRA 1DF0A 5F6TA 3NSLA 1CFDA 2KQYA 3R1PA 1BF5A 2ZKMX 2QACA 1NX2A 1BU3A 1JF0A 1D1OA 3S0EA 1FI6A 1QLKA 2MAZA 1GGWA 3DD4A 1SKTA 1H8BA 3NXAA 1IKUA 2BL0C 2KI6C 2LVJA 3BYAA 5CPVA 1ORGA 5HKYA 1IQ3A 3CZ0A 2QDIA 4YRUA 3LK0A 1TUZA 2LP2A 5CSJA 3S0AA 1LINA 2L2CA 1RK9A 1XFVO 4GNKB 1RFJA 1A03A 4OZDA 3AKBA 1W9ZA 5I94A 2B1UA 2KFGA 5ER5A 3BFHA 5J3XA 3KEVA 2YGUA 1NYAA 1AJ4A 2M97A 3OB1B 1JFJA 1NCXA 2FCDA 2JZIA 3NHTA 2LAPA 3I5IC 1JC2A 1OOGA 2PALA 1CMGA 1IJ5A 1DGVA 1IGVA 1Y1AA 1DEKA 2Y1MA 1NPQA 3BUXB 3D77A 4N5XA 4XJKB 1W7IB 1AK8A 3HCMA 2GGZA 2MRDA 2ERBA 4L9MA 1AJ5A 1UWOA 2WCKA 3PATA 2ZNDA 1X02A 5GQQC 2JTZA 1XFWO 1KK8B 3L47A 2I18A 1QIVA 2M1KB 5HKWA 2FJUB 4CIDA 2LANA 1C3YA 2MLFC 4PCWA 2KYFA 1DJZA 3AKAA 3OBVA 1SCMC 4OR9B 2F3ZA 1B8RA 1LKJA 2K61A 1DMOA 1IJ6A 2WC8A 1PSBA 1A75B 3C1VA 2M9GA 1BMOA 1KSMA 1GM0A 5I2OA 1YRTB 2JT8A 1CFFA 1PULA 4YI9A 3KHEA 1K9UA 3TUYB 4IL1A 3PM2A 5HLOA 4GGFC 5G08A 5DKQA 3TDIA 3ICBA 4I5NB 2LP3A 3F45A 5D3OA 1EG4A 3KPXA 4YGBB 1ZFSA 2A4JA 4XYNA 1K94A 1S3PA 3I5GB 1KK7Y 2SCPA 2CTNA 3FWCA 1QWVA 1LS8A 4P5OE 1OQPA 1GQMA 2K0JA 3HX4A 2P6BB 2K8MB 1ALVA 2KBMA 1EG3A 2RGIA 3LLEA 4PE4A 1NUBA 2AUCA 1KQVA 5D7FA 4M2QA 1UHIA 2KYCA 1DT7B 3D76A 3CABA 1CLMA 1GGZA 1YURA 4E68A 1EH2A 3BFAA 3VRPA 3DZTA 1QASA 4PDZA 1F8HA 1Y1XA 2H61A 3EK4A 1KCYA 5KSZA 1XFRA 1YX8A 4GGNA 1CFPA 1QVIZ 3CR5X 4AQIA 1BT6A 1UHNA 2LLTA 2OTGC 1NP8A 5DICA 2LVKA 1DC1A 1DQEA 1NX3A 1IIOA 1QX5B 1XK4C 4JKTA 1Y6WA 3BJHA 3TZ1A 1CDNA 4PE7A 4C0KA 1RJVA 2MJWB 1PRWA 4JWQA 1EL4A 1HQVA 1S36A 1OZSA 2KFFA 4MRYA 3BUOB 4BY5A 1IRJA 2LVVA 1L7ZA 4NQGA 1R6PA 3D73A 3PN7B 1AUIB 5B8IB 1SPYA 2L50A 1B47A 3BUWB 5CSIA 1XA5A 1FW4A 5FI7A 2KLEA 1GJYA 2P71A 1A29A 1ODBA 4WQ2A 1UHKA 1N65A 1CM1A 5JJGA 2JC2A 3CZ2A 3CZTX 4MEWA 3S0DA 4PT1A 2KFHA 3SJSA 2EGDA 1QJTA 3D10A 2KHNA 2WCHA 4PHKA 2M3WA 2LV7A 2HF5A 2LM5A 4TNCA 3ZWHA 2CCMA 4ORBB 1RTP1 1B7TZ 5HKZA 2ZRTA 2L2EA 3EG5B 4HRGA 5PALA 4QJ4B 1BLQA 2WORA 1XK4A 1SK6D 1WRLA 3JVTB 4P2YB 1XYDA 1DF0B 4MZKA 2ZN8A 1WLZA 1DTLA 3I5FC 1ZUZA 2EHBA 2LUCA 2K2FA 2P70A 3H4SE 2PQLA 4FQOA 4OVNF 1TNPA 1A75A 3B88A 1DELA 2BCXA 3TS5C 1AHRA 1NWDA 3JVTC 3NSOA 1YUUA 2K2AA 1KQMC 1MXEA 2LC5A 2ZN9A 2WNDA 2LHLA 3D75A 5EL2A 4MZLA 2NLNA 3CYZA 2I7AA 3JTDB 2H2KA 4GBAA 1UHJA 2CNPA 3FE6A 4NDCA 1CDPA 4YGEB 2PVBA 2LUXA 5DKNA 3FIAA 4PHMA 4MRXA 1SL8A 1CB1A 3BUNB 2KOTA 2MBXA 1TNQA 1K90D 3CR2A 4PE1A 4FTGA 2BE6A 5AFPA 1AP4A 5FI6A 2NCPA 3O4YA 4ORAB 3EVVA 1F54A 4DS7A 4YBHB 1SNLA 1S6IA 2WCBA 4DUQA 1LXFC 2KQ6A 4FQTA 4ORCB 3SIBA 1M39A 1UUSA 1OE9B 1JFKA 1DJXA 1PK0D 1MUXA 1QIWA 2LHIA 3BOWB 3EKHA 3BOWA 2KAVA 1A2XA 2OPOA 1Q80A 2OTGB 3BFBA 3IVTA 2SASA 2GV5A 4ZCUA 1JBAA 2K7CA 4DCKA 1NIWA 1ZMZA 2BE4A 3DY9A 2BECA 1KFXL 1CDMA 1QX2A 3DF0B 1JSAA 4OKHA 1J7RA 2TN4A 3OP0A
chains in the Genus database with same CATH topology
1BR4B 1U5IA 5ER4X 1JWDA 1MWNA 3DVEA 3VRQA 3SG7A 2PRUA 2LMVA 1S6JA 4ETOA 1TCOB 1K9PA 2G9BA 2JQ6A 2NZ0A 1F55A 5JOLA 5CSNA 4D1EA 1F4QA 2KI4C 1SR6C 3AAJA 3VROA 1SR6B 1WRZA 5AEQA 1R2UA 2G2BA 1OMDA 3GK1A 1NX1A 4YI8A 1YRUB 3RLZA 2Q91A 1QLSA 5I8NA 1XO5A 4N1GA 2BKHB 1QX7A 1S1EA 3BXKA 1QS7A 2O60A 5FYXA 1YX7A 2CXJA 1UP5A 1SCMB 1ZOTB 5AERA 3SG3A 1TIZA 2JWWA 3CGAA 1QV0A 3LCPC 1OMVA 1S5GY 4AQJA 1DJHA 4CLNA 4CFQA 1CTRA 1IWQA 1OMRA 1QATA 1RROA 3AAKA 4NDDA 1KK8C 2M7NA 3TDUA 2JT0A 2ZRSA 1J7PA 2LCPA 1YUTA 1B1GA 1K2HA 3O6BA 2PASA 3SG4A 1OOJA 2AMIA 3VRNA 1B9AA 1TCFA 2AAOA 2JXCA 4YGAA 1NCZA 4YGCB 4MZJA 1DJGA 3I5IB 3QRXA 4MLWA 2M7LA 2Y5IA 2I2RE 2L51A 4C0LA 4GPLB 4I5JA 4USLA 2JULA 5I2QA 3OB2B 2IS9A 1SMGA 1K8UA 1XFZO 3FWBA 1UHHA 1B4CA 1YTZC 4XJKA 1EXRA 2E30A 3DVKA 1FF1A 2WCFA 4HRHA 1TTXA 2BBNA 2LLSA 3JTDC 4Q04A 2F3YA 2KBIA 2FOTA 1SL7A 3O2PA 2LLUA 2MLEC 5HLVA 1V1GA 2M49B 2DOQA 3WHUB 2KAYA 4M2OA 3VRRA 2L5XB 1NCYA 2BBMA 1CNPA 3NSKA 4I5KA 5KU1A 1XFUO 1PVBA 3CLNA 3SG5A 4ICBA 1YVLA 3D0YB 3SG2A 1BJFA 1TN4A 1OZOA 3K21A 4PHJA 1SW8A 1DJWA 2JT3A 3IF7A 3I5HC 2KI4B 1DJIA 4A4BA 3OX6A 3OX5A 1C7VA 1H4BA 1YVHA 1FPWA 3GK2A 1SCVA 2KGRA 3MSEB 3OHMB 1TRFA 4MVFA 2E6WA 1BG1A 2OS8B 1AVSA 3GOFA 4GGFA 1WDCB 4CPVA 5KTYA 3CS1A 1S6CA 1SRAA 1TNXA 1IG5A 4HREE 2HPSA 3BUMB 2Q4UA 3E3RA 2Y4QA 4MN0A 1SYMA 1WLMA 1IH0A 1HT9A 3TDZA 2LVIA 1ALWA 4I5LB 1M46A 1Y0VH 2BKIB 5AXIA 1A4PA 3LL8B 1M45A 1Y1UA 5TNCA 3A8RA 2JU0A 2JPTA 3IQQA 2EC6B 3PSRA 1XVJA 2K7BA 1PVAA 1J1EA 2WCEA 2EC6C 3WXAA 2D8NA 3IQOA 2FCEA 5HYDA 1F4OA 3GK4X 2GGMA 2M0RA 2ISDA 1YUSA 1CKKA 2MHHA 2VRGA 1G8IA 2MA2A 4DRWA 3DVJA 1MXLC 2CT9A 2KDHA 1JF2A 4QJ5B 2OS8C 1KSOA 2KI6D 4MSPA 4GUKA 1B7TY 5I2LA 1QV1A 2JRFA 1EJ3A 4YGDB 2BCBA 4PE0A 1E8AA 1V1FA 2K7OA 2V53A 1K96A 3EVRA 4M2PA 1SBJA 3I5HB 1J1DA 1SL9A 1F70A 2QPTA 3CTNA 2LMTA 3CWGA 2ZNEA 2ZFDA 3M0WA 2Y1NA 1OSAA 3PLFB 1ZACA 1LVCD 4BY4A 3NSIA 1CMFA 1KQMB 4GFTA 1G4YR 1WRKA 1RWYA 1CDLA 3TS5B 1W7JB 1PALA 2NXQA 4QJ3B 1KK7Z 5BPJA 5AANA 4CFRA 1RECA 3I5FB 1J7OA 2M29A 3SIAA 1MR8A 2R2IA 4ZCVA 3DF0A 1VRKA 3WHTB 1XFYO 1J7QA 1MF8B 2H61C 1DVIA 4U8DA 1BR1B 2JXLA 2JNXA 4OCIA 3A4UB 3RM1A 4AOMA 4PALA 1C7WA 2PMYA 1K9KA 1FI5A 1QXPA 1SY9A 2HETA 2WOSA 1S5GZ 5K89A 2KNEA 2L98A 2KAXA 2LE9B 1C07A 2HQ8A 1K93D 1XFXO 1PSRA 1KFUS 1F71A 5CSFA 1MQ1A 2I94A 3FS7A 3PN7C 3EK8A 3SG6A 1J55A 3EKJA 4N1FA 4HSZA 3PFVA 2HQWA 2KGBC 4OV2A 4WRIA 3PM8A 1NX0A 4PHNA 2M8UA 1CM4A 3ZNIA 2BL0B 3KO0A 2JTTA 3EVUA 3DVMA 2NCOA 2COLB 1DJYA 2K7DA 4NDBA 1TNWA 4R1EA 1LA3A 3VGOA 4UPGA 3D0YA 2PSRA 1CFCA 1K95A 2L4IA 2F8PA 1U5IB 2JNFA 2L0PA 1M63B 1IQ5A 3BQ3A 1KFXS 1L2OB 1M31A 1FBVA 1B8CA 1QVIY 3O78A 5D69A 2CBLA 1LA0A 2O5GA 1WDCC 4DIRA 4A4CA 2BCAA 2F2PA 1NSHA 3WNXB 1DGUA 4C0JA 3KF9A 1N0YA 1G33A 1UURA 2F33A 2M1UA 1CLBA 3LK1A 2LMUA 3CR4X 1JUOA 1KWOB 2JOJA 3I5GC 1KWOC 4MBEA 1BODA 2L4HA 4JPZB 3TUYC 1CLLA 1S26D 1YR5A 1B8LA 2LNKA 1QTXA 5IBWA 1KFUL 2KSPA 2F2OA 1TOPA 1WY9A 3EK7A 4F0ZB 4JQ0D 1N2DA 4GAOA 1MHOA 3PALA 1L2OC 4WQ3A 5DKRA 1DF0A 5F6TA 3NSLA 1CFDA 2KQYA 1BF5A 2ZKMX 2QACA 1NX2A 1BU3A 1JF0A 1D1OA 1FI6A 1QLKA 2MAZA 1GGWA 3DD4A 1SKTA 1H8BA 3NXAA 1IKUA 2BL0C 2KI6C 2LVJA 3BYAA 5CPVA 5HKYA 1IQ3A 4YRUA 3LK0A 2LP2A 5CSJA 1LINA 1RK9A 1XFVO 4GNKB 1RFJA 1A03A 3AKBA 2B1UA 2KFGA 5ER5A 5J3XA 3KEVA 1NYAA 1AJ4A 2M97A 3OB1B 1JFJA 1NCXA 2FCDA 2JZIA 2LAPA 3I5IC 1JC2A 2PALA 1CMGA 1IJ5A 1DGVA 1IGVA 1Y1AA 2Y1MA 3BUXB 1NPQA 4N5XA 4XJKB 1W7IB 1AK8A 3HCMA 2GGZA 2MRDA 4L9MA 1AJ5A 1UWOA 3PATA 2ZNDA 1X02A 5GQQC 2JTZA 1XFWO 1KK8B 2I18A 1QIVA 2M1KB 5HKWA 2FJUB 4CIDA 2LANA 2MLFC 4PCWA 2KYFA 1DJZA 3AKAA 1SCMC 4OR9B 2F3ZA 1B8RA 1LKJA 2K61A 1DMOA 1IJ6A 2WC8A 1PSBA 1A75B 3C1VA 2M9GA 1BMOA 1KSMA 5I2OA 1YRTB 2JT8A 1CFFA 1PULA 4YI9A 3KHEA 1K9UA 3TUYB 4IL1A 5HLOA 4GGFC 5G08A 5DKQA 3TDIA 3ICBA 4I5NB 2LP3A 3F45A 1BOCA 1EG4A 3KPXA 4YGBB 1ZFSA 2A4JA 4XYNA 1K94A 1S3PA 3I5GB 1KK7Y 2SCPA 2CTNA 3FWCA 4P5OE 1OQPA 1GQMA 2K0JA 3HX4A 2P6BB 2K8MB 1ALVA 2KBMA 1EG3A 2RGIA 3LLEA 4PE4A 1NUBA 2AUCA 1KQVA 5D7FA 4M2QA 1UHIA 2KYCA 1DT7B 1CLMA 1GGZA 1YURA 4E68A 1EH2A 1F8HA 3VRPA 1QASA 4PDZA 1Y1XA 2H61A 3EK4A 1KCYA 5KSZA 4GGNA 1YX8A 1CFPA 1QVIZ 3CR5X 4AQIA 1BT6A 1UHNA 2LLTA 2OTGC 1NP8A 2LVKA 1NX3A 1QX5B 1XK4C 1Y6WA 3TZ1A 1CDNA 4PE7A 4C0KA 1RJVA 2MJWB 1PRWA 4JWQA 1EL4A 1HQVA 1S36A 1OZSA 2KFFA 4MRYA 3BUOB 4BY5A 1IRJA 2LVVA 1L7ZA 4NQGA 1R6PA 3PN7B 5B8IB 1AUIB 1SPYA 2L50A 1B47A 3BUWB 5CSIA 1XA5A 1FW4A 1GJYA 1A29A 1ODBA 4WQ2A 1UHKA 1N65A 1CM1A 5JJGA 2JC2A 3CZTX 4MEWA 2KFHA 3SJSA 2EGDA 1QJTA 3D10A 2KHNA 4PHKA 2M3WA 2LV7A 2HF5A 2LM5A 4TNCA 3ZWHA 2CCMA 4ORBB 1RTP1 1B7TZ 5HKZA 2ZRTA 2L2EA 4HRGA 5PALA 4QJ4B 1BLQA 2WORA 1XK4A 1SK6D 1WRLA 3JVTB 4P2YB 1XYDA 1DF0B 4MZKA 2ZN8A 1WLZA 1DTLA 3I5FC 1ZUZA 2EHBA 2LUCA 2K2FA 3H4SE 4FQOA 4OVNF 1TNPA 1A75A 3TS5C 2BCXA 1AHRA 1NWDA 3JVTC 3NSOA 1YUUA 2K2AA 1KQMC 1MXEA 2LC5A 2ZN9A 2WNDA 2LHLA 4MZLA 2NLNA 3JTDB 2I7AA 2H2KA 4GBAA 1UHJA 2CNPA 4NDCA 4YGEB 1CDPA 2PVBA 2LUXA 5DKNA 3FIAA 4PHMA 4MRXA 1SL8A 1CB1A 3BUNB 2KOTA 2MBXA 1TNQA 1K90D 3CR2A 4PE1A 4FTGA 2BE6A 5AFPA 1AP4A 2NCPA 3O4YA 4ORAB 3EVVA 1F54A 4DS7A 4YBHB 1SNLA 1S6IA 2WCBA 4DUQA 1LXFC 2KQ6A 4ORCB 3SIBA 1M39A 1UUSA 1OE9B 1JFKA 1DJXA 1PK0D 1MUXA 1QIWA 2LHIA 3BOWB 3EKHA 3BOWA 2KAVA 1A2XA 2OPOA 1Q80A 2OTGB 2SASA 2GV5A 4ZCUA 1JBAA 2K7CA 4DCKA 1NIWA 1ZMZA 2BE4A 2BECA 1KFXL 1CDMA 1QX2A 3DF0B 1JSAA 4OKHA 1J7RA 2TN4A 3OP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR4 B;  1U5I A;  5ER4 X;  1JWD A;  1MWN A;  3DVE A;  3VRQ A;  3SG7 A;  2PRU A;  2LMV A;  1S6J A;  4ETO A;  1TCO B;  1K9P A;  2G9B A;  2JQ6 A;  2NZ0 A;  1F55 A;  5JOL A;  5CSN A;  4D1E A;  1F4Q A;  2KI4 C;  1SR6 C;  3AAJ A;  3VRO A;  1SR6 B;  1WRZ A;  5AEQ A;  1R2U A;  2G2B A;  1OMD A;  3GK1 A;  1NX1 A;  4YI8 A;  1YRU B;  3RLZ A;  2Q91 A;  1QLS A;  5I8N A;  1XO5 A;  4N1G A;  2BKH B;  1QX7 A;  1S1E A;  3BXK A;  1QS7 A;  2O60 A;  5FYX A;  1YX7 A;  2CXJ A;  1UP5 A;  1SCM B;  1ZOT B;  5AER A;  3SG3 A;  1TIZ A;  2JWW A;  3CGA A;  1QV0 A;  3LCP C;  1OMV A;  1S5G Y;  4AQJ A;  1DJH A;  4CLN A;  4CFQ A;  1CTR A;  1IWQ A;  1OMR A;  1QAT A;  1RRO A;  3AAK A;  4NDD A;  1KK8 C;  2M7N A;  3TDU A;  2JT0 A;  2ZRS A;  1J7P A;  2LCP A;  1YUT A;  1B1G A;  1K2H A;  3O6B A;  2PAS A;  3SG4 A;  1OOJ A;  2AMI A;  3VRN A;  1B9A A;  1TCF A;  2AAO A;  2JXC A;  4YGA A;  1NCZ A;  4YGC B;  4MZJ A;  1DJG A;  3I5I B;  3QRX A;  4MLW A;  2M7L A;  2Y5I A;  2I2R E;  2L51 A;  4C0L A;  4GPL B;  4I5J A;  4USL A;  2JUL A;  5I2Q A;  3OB2 B;  2IS9 A;  1SMG A;  1K8U A;  1XFZ O;  3FWB A;  1UHH A;  1B4C A;  1YTZ C;  4XJK A;  1EXR A;  2E30 A;  3DVK A;  1FF1 A;  2WCF A;  4HRH A;  1TTX A;  2BBN A;  2LLS A;  3JTD C;  4Q04 A;  2F3Y A;  2KBI A;  2FOT A;  1SL7 A;  3O2P A;  2LLU A;  2MLE C;  5HLV A;  1V1G A;  2M49 B;  2DOQ A;  3WHU B;  2KAY A;  4M2O A;  3VRR A;  2L5X B;  1NCY A;  2BBM A;  1CNP A;  3NSK A;  4I5K A;  5KU1 A;  1XFU O;  1PVB A;  3CLN A;  3SG5 A;  4ICB A;  1YVL A;  3D0Y B;  3SG2 A;  1BJF A;  1TN4 A;  1OZO A;  3K21 A;  4PHJ A;  1SW8 A;  1DJW A;  2JT3 A;  3IF7 A;  3I5H C;  2KI4 B;  1DJI A;  4A4B A;  3OX6 A;  3OX5 A;  1C7V A;  1H4B A;  1YVH A;  1FPW A;  3GK2 A;  1SCV A;  2KGR A;  3MSE B;  3OHM B;  1TRF A;  4MVF A;  2E6W A;  1BG1 A;  2OS8 B;  1AVS A;  3GOF A;  4GGF A;  1WDC B;  4CPV A;  5KTY A;  3CS1 A;  1S6C A;  1SRA A;  1TNX A;  1IG5 A;  4HRE E;  2HPS A;  3BUM B;  2Q4U A;  3E3R A;  2Y4Q A;  4MN0 A;  1SYM A;  1WLM A;  1IH0 A;  1HT9 A;  3TDZ A;  2LVI A;  1ALW A;  4I5L B;  1M46 A;  1Y0V H;  2BKI B;  5AXI A;  1A4P A;  3LL8 B;  1M45 A;  1Y1U A;  5TNC A;  3A8R A;  2JU0 A;  2JPT A;  3IQQ A;  2EC6 B;  3PSR A;  1XVJ A;  2K7B A;  1PVA A;  1J1E A;  2WCE A;  2EC6 C;  3WXA A;  2D8N A;  3IQO A;  2FCE A;  5HYD A;  1F4O A;  3GK4 X;  2GGM A;  2M0R A;  2ISD A;  1YUS A;  1CKK A;  2MHH A;  2VRG A;  1G8I A;  2MA2 A;  4DRW A;  3DVJ A;  1MXL C;  2CT9 A;  2KDH A;  1JF2 A;  4QJ5 B;  2OS8 C;  1KSO A;  2KI6 D;  4MSP A;  4GUK A;  1B7T Y;  5I2L A;  1QV1 A;  2JRF A;  1EJ3 A;  4YGD B;  2BCB A;  4PE0 A;  1E8A A;  1V1F A;  2K7O A;  2V53 A;  1K96 A;  3EVR A;  4M2P A;  1SBJ A;  3I5H B;  1J1D A;  1SL9 A;  1F70 A;  2QPT A;  3CTN A;  2LMT A;  3CWG A;  2ZNE A;  2ZFD A;  3M0W A;  2Y1N A;  1OSA A;  3PLF B;  1ZAC A;  1LVC D;  4BY4 A;  3NSI A;  1CMF A;  1KQM B;  4GFT A;  1G4Y R;  1WRK A;  1RWY A;  1CDL A;  3TS5 B;  1W7J B;  1PAL A;  2NXQ A;  4QJ3 B;  1KK7 Z;  5BPJ A;  5AAN A;  4CFR A;  1REC A;  3I5F B;  1J7O A;  2M29 A;  3SIA A;  1MR8 A;  2R2I A;  4ZCV A;  3DF0 A;  1VRK A;  3WHT B;  1XFY O;  1J7Q A;  1MF8 B;  2H61 C;  1DVI A;  4U8D A;  1BR1 B;  2JXL A;  2JNX A;  4OCI A;  3A4U B;  3RM1 A;  4AOM A;  4PAL A;  1C7W A;  2PMY A;  1K9K A;  1FI5 A;  1QXP A;  1SY9 A;  2HET A;  2WOS A;  1S5G Z;  5K89 A;  2KNE A;  2L98 A;  2KAX A;  2LE9 B;  1C07 A;  2HQ8 A;  1K93 D;  1XFX O;  1PSR A;  1KFU S;  1F71 A;  5CSF A;  1MQ1 A;  2I94 A;  3FS7 A;  3PN7 C;  3EK8 A;  3SG6 A;  1J55 A;  3EKJ A;  4N1F A;  4HSZ A;  3PFV A;  2HQW A;  2KGB C;  4OV2 A;  4WRI A;  3PM8 A;  1NX0 A;  4PHN A;  2M8U A;  1CM4 A;  3ZNI A;  2BL0 B;  3KO0 A;  2JTT A;  3EVU A;  3DVM A;  2NCO A;  2COL B;  1DJY A;  2K7D A;  4NDB A;  1TNW A;  4R1E A;  1LA3 A;  3VGO A;  4UPG A;  3D0Y A;  2PSR A;  1CFC A;  1K95 A;  2L4I A;  2F8P A;  1U5I B;  2JNF A;  2L0P A;  1M63 B;  1IQ5 A;  3BQ3 A;  1KFX S;  1L2O B;  1M31 A;  1FBV A;  1B8C A;  1QVI Y;  3O78 A;  5D69 A;  2CBL A;  1LA0 A;  2O5G A;  1WDC C;  4DIR A;  4A4C A;  2BCA A;  2F2P A;  1NSH A;  3WNX B;  1DGU A;  4C0J A;  3KF9 A;  1N0Y A;  1G33 A;  1UUR A;  2F33 A;  2M1U A;  1CLB A;  3LK1 A;  2LMU A;  3CR4 X;  1JUO A;  1KWO B;  2JOJ A;  3I5G C;  1KWO C;  4MBE A;  1BOD A;  2L4H A;  4JPZ B;  3TUY C;  1CLL A;  1S26 D;  1YR5 A;  1B8L A;  2LNK A;  1QTX A;  5IBW A;  1KFU L;  2KSP A;  2F2O A;  1TOP A;  1WY9 A;  3EK7 A;  4F0Z B;  4JQ0 D;  1N2D A;  4GAO A;  1MHO A;  3PAL A;  1L2O C;  4WQ3 A;  5DKR A;  1DF0 A;  5F6T A;  3NSL A;  1CFD A;  2KQY A;  1BF5 A;  2ZKM X;  2QAC A;  1NX2 A;  1BU3 A;  1JF0 A;  1D1O A;  1FI6 A;  1QLK A;  2MAZ A;  1GGW A;  3DD4 A;  1SKT A;  1H8B A;  3NXA A;  1IKU A;  2BL0 C;  2KI6 C;  2LVJ A;  3BYA A;  5CPV A;  5HKY A;  1IQ3 A;  4YRU A;  3LK0 A;  2LP2 A;  5CSJ A;  1LIN A;  1RK9 A;  1XFV O;  4GNK B;  1RFJ A;  1A03 A;  3AKB A;  2B1U A;  2KFG A;  5ER5 A;  5J3X A;  3KEV A;  1NYA A;  1AJ4 A;  2M97 A;  3OB1 B;  1JFJ A;  1NCX A;  2FCD A;  2JZI A;  2LAP A;  3I5I C;  1JC2 A;  2PAL A;  1CMG A;  1IJ5 A;  1DGV A;  1IGV A;  1Y1A A;  2Y1M A;  3BUX B;  1NPQ A;  4N5X A;  4XJK B;  1W7I B;  1AK8 A;  3HCM A;  2GGZ A;  2MRD A;  4L9M A;  1AJ5 A;  1UWO A;  3PAT A;  2ZND A;  1X02 A;  5GQQ C;  2JTZ A;  1XFW O;  1KK8 B;  2I18 A;  1QIV A;  2M1K B;  5HKW A;  2FJU B;  4CID A;  2LAN A;  2MLF C;  4PCW A;  2KYF A;  1DJZ A;  3AKA A;  1SCM C;  4OR9 B;  2F3Z A;  1B8R A;  1LKJ A;  2K61 A;  1DMO A;  1IJ6 A;  2WC8 A;  1PSB A;  1A75 B;  3C1V A;  2M9G A;  1BMO A;  1KSM A;  5I2O A;  1YRT B;  2JT8 A;  1CFF A;  1PUL A;  4YI9 A;  3KHE A;  1K9U A;  3TUY B;  4IL1 A;  5HLO A;  4GGF C;  5G08 A;  5DKQ A;  3TDI A;  3ICB A;  4I5N B;  2LP3 A;  3F45 A;  1BOC A;  1EG4 A;  3KPX A;  4YGB B;  1ZFS A;  2A4J A;  4XYN A;  1K94 A;  1S3P A;  3I5G B;  1KK7 Y;  2SCP A;  2CTN A;  3FWC A;  4P5O E;  1OQP A;  1GQM A;  2K0J A;  3HX4 A;  2P6B B;  2K8M B;  1ALV A;  2KBM A;  1EG3 A;  2RGI A;  3LLE A;  4PE4 A;  1NUB A;  2AUC A;  1KQV A;  5D7F A;  4M2Q A;  1UHI A;  2KYC A;  1DT7 B;  1CLM A;  1GGZ A;  1YUR A;  4E68 A;  1EH2 A;  1F8H A;  3VRP A;  1QAS A;  4PDZ A;  1Y1X A;  2H61 A;  3EK4 A;  1KCY A;  5KSZ A;  4GGN A;  1YX8 A;  1CFP A;  1QVI Z;  3CR5 X;  4AQI A;  1BT6 A;  1UHN A;  2LLT A;  2OTG C;  1NP8 A;  2LVK A;  1NX3 A;  1QX5 B;  1XK4 C;  1Y6W A;  3TZ1 A;  1CDN A;  4PE7 A;  4C0K A;  1RJV A;  2MJW B;  1PRW A;  4JWQ A;  1EL4 A;  1HQV A;  1S36 A;  1OZS A;  2KFF A;  4MRY A;  3BUO B;  4BY5 A;  1IRJ A;  2LVV A;  1L7Z A;  4NQG A;  1R6P A;  3PN7 B;  5B8I B;  1AUI B;  1SPY A;  2L50 A;  1B47 A;  3BUW B;  5CSI A;  1XA5 A;  1FW4 A;  1GJY A;  1A29 A;  1ODB A;  4WQ2 A;  1UHK A;  1N65 A;  1CM1 A;  5JJG A;  2JC2 A;  3CZT X;  4MEW A;  2KFH A;  3SJS A;  2EGD A;  1QJT A;  3D10 A;  2KHN A;  4PHK A;  2M3W A;  2LV7 A;  2HF5 A;  2LM5 A;  4TNC A;  3ZWH A;  2CCM A;  4ORB B;  1RTP 1;  1B7T Z;  5HKZ A;  2ZRT A;  2L2E A;  4HRG A;  5PAL A;  4QJ4 B;  1BLQ A;  2WOR A;  1XK4 A;  1SK6 D;  1WRL A;  3JVT B;  4P2Y B;  1XYD A;  1DF0 B;  4MZK A;  2ZN8 A;  1WLZ A;  1DTL A;  3I5F C;  1ZUZ A;  2EHB A;  2LUC A;  2K2F A;  3H4S E;  4FQO A;  4OVN F;  1TNP A;  1A75 A;  3TS5 C;  2BCX A;  1AHR A;  1NWD A;  3JVT C;  3NSO A;  1YUU A;  2K2A A;  1KQM C;  1MXE A;  2LC5 A;  2ZN9 A;  2WND A;  2LHL A;  4MZL A;  2NLN A;  3JTD B;  2I7A A;  2H2K A;  4GBA A;  1UHJ A;  2CNP A;  4NDC A;  4YGE B;  1CDP A;  2PVB A;  2LUX A;  5DKN A;  3FIA A;  4PHM A;  4MRX A;  1SL8 A;  1CB1 A;  3BUN B;  2KOT A;  2MBX A;  1TNQ A;  1K90 D;  3CR2 A;  4PE1 A;  4FTG A;  2BE6 A;  5AFP A;  1AP4 A;  2NCP A;  3O4Y A;  4ORA B;  3EVV A;  1F54 A;  4DS7 A;  4YBH B;  1SNL A;  1S6I A;  2WCB A;  4DUQ A;  1LXF C;  2KQ6 A;  4ORC B;  3SIB A;  1M39 A;  1UUS A;  1OE9 B;  1JFK A;  1DJX A;  1PK0 D;  1MUX A;  1QIW A;  2LHI A;  3BOW B;  3EKH A;  3BOW A;  2KAV A;  1A2X A;  2OPO A;  1Q80 A;  2OTG B;  2SAS A;  2GV5 A;  4ZCU A;  1JBA A;  2K7C A;  4DCK A;  1NIW A;  1ZMZ A;  2BE4 A;  2BEC A;  1KFX L;  1CDM A;  1QX2 A;  3DF0 B;  1JSA A;  4OKH A;  1J7R A;  2TN4 A;  3OP0 A; 
#chains in the Genus database with same CATH topology
 1BR4 B;  1U5I A;  5ER4 X;  1JWD A;  3VB1 A;  1MWN A;  3DVE A;  3VRQ A;  3SG7 A;  2PRU A;  2LMV A;  1S6J A;  4ETO A;  1TCO B;  3L4L A;  1K9P A;  2G9B A;  2JQ6 A;  2NZ0 A;  1F55 A;  5JOL A;  2KPH A;  5CSN A;  4D1E A;  1F4Q A;  2KI4 C;  1SR6 C;  3AAJ A;  2BNX A;  3VRO A;  1SR6 B;  1WRZ A;  5FI2 A;  2WCM A;  1R2U A;  5AEQ A;  2G2B A;  2QEV A;  1OMD A;  2WCJ A;  3GK1 A;  1NX1 A;  4YI8 A;  1YRU B;  3RLZ A;  3S0B A;  3B7A A;  2Q91 A;  1QLS A;  5I8N A;  1XO5 A;  4N1G A;  2BKH B;  1QX7 A;  1S1E A;  3BXK A;  1QS7 A;  2O60 A;  5FYX A;  1YX7 A;  2CXJ A;  1UP5 A;  1SCM B;  1ZOT B;  5AER A;  3SG3 A;  1TIZ A;  2JWW A;  3CGA A;  1QV0 A;  3LCP C;  1OMV A;  1S5G Y;  3UNW A;  1DJH A;  4AQJ A;  4CLN A;  4CFQ A;  1BOC A;  1OOF A;  1CTR A;  1IWQ A;  1OMR A;  1QAT A;  1RRO A;  3AAK A;  4NDD A;  1KK8 C;  2M7N A;  3TDU A;  2JT0 A;  2ZRS A;  3PJI A;  2LCP A;  1YUT A;  1J7P A;  1B1G A;  1K2H A;  3O6B A;  2PAS A;  3SG4 A;  1OOJ A;  2AMI A;  3VRN A;  1B9A A;  2L5Y A;  1TCF A;  2AAO A;  2JXC A;  4YGA A;  1NCZ A;  3OGN A;  4YGC B;  4MZJ A;  1DJG A;  3I5I B;  3QRX A;  4MLW A;  2M7L A;  2Y5I A;  2I2R E;  2L51 A;  4C0L A;  2H8V A;  4GPL B;  4I5J A;  3RZS A;  4USL A;  2JUL A;  2K60 A;  5I2Q A;  3OB2 B;  2IS9 A;  1SMG A;  1K8U A;  1XFZ O;  2QEO A;  3FWB A;  1UHH A;  1B4C A;  1YTZ C;  4XJK A;  1EXR A;  2E30 A;  3DVK A;  3R1V A;  1FF1 A;  2WCF A;  1OOH A;  4HRH A;  1TTX A;  2BBN A;  3FE8 A;  2LLS A;  3JTD C;  4Q04 A;  3S0G A;  1TUJ A;  2F3Y A;  2KBI A;  2FOT A;  1SL7 A;  3O2P A;  2LLU A;  1OW4 A;  2MLE C;  3NGV A;  5HLV A;  2QEH A;  1V1G A;  2M49 B;  2DOQ A;  3WHU B;  2KAY A;  3D74 A;  4M2O A;  3NHI A;  3VRR A;  2L5X B;  3S0F A;  1NCY A;  2BBM A;  1CNP A;  3NSK A;  4I5K A;  5KU1 A;  1XFU O;  1PVB A;  3B86 A;  3CLN A;  3SG5 A;  4ICB A;  1YVL A;  3D0Y B;  3R1O A;  3SG2 A;  1BJF A;  1TN4 A;  1OZO A;  3K21 A;  1TWO A;  4PHJ A;  1SW8 A;  1DJW A;  2JT3 A;  3O4X A;  3IF7 A;  3I5H C;  2KI4 B;  1DJI A;  4A4B A;  3OX6 A;  2GTE A;  3L4A A;  3OX5 A;  1C7V A;  1H4B A;  1YVH A;  1FPW A;  3GK2 A;  1SCV A;  2KGR A;  3MSE B;  3OHM B;  3SS3 A;  2BAP A;  1TRF A;  3V2L A;  4MVF A;  2E6W A;  1BG1 A;  2OS8 B;  1AVS A;  3GOF A;  4GGF A;  1WDC B;  4CPV A;  5KTY A;  3CS1 A;  1S6C A;  1SRA A;  1TNX A;  4INW A;  1IG5 A;  4HRE E;  2HPS A;  3BUM B;  2Q4U A;  3E3R A;  2Y4Q A;  4MN0 A;  1SYM A;  1WLM A;  1IH0 A;  1HT9 A;  2QEB A;  3TDZ A;  2LVI A;  1ALW A;  4I5L B;  1M46 A;  1Y0V H;  2BKI B;  5AXI A;  1A4P A;  3LL8 B;  1M45 A;  1Y1U A;  4IJ7 A;  3A8R A;  2JU0 A;  2JPT A;  3DYE A;  3IQQ A;  5TNC A;  2EC6 B;  3PSR A;  1XVJ A;  2K7B A;  3B6X A;  1PVA A;  1J1E A;  2WCE A;  2EC6 C;  3WXA A;  2D8N A;  3IQO A;  2FJY A;  2FCE A;  5HYD A;  1F4O A;  4INX A;  3GK4 X;  2GGM A;  3K1E A;  2M0R A;  2ISD A;  1YUS A;  1CKK A;  2MHH A;  2VRG A;  1G8I A;  2MA2 A;  4DRW A;  3DVJ A;  1MXL C;  2CT9 A;  2KDH A;  1JF2 A;  4QJ5 B;  2OS8 C;  1KSO A;  2KI6 D;  4MSP A;  4GUK A;  1B7T Y;  5I2L A;  1QV1 A;  2JRF A;  1EJ3 A;  4YGD B;  2BCB A;  4PE0 A;  1E8A A;  1V1F A;  2K7O A;  2V53 A;  1K96 A;  3EVR A;  3DXL A;  3QME A;  1SBJ A;  3CDN A;  4JD9 A;  4M2P A;  3I5H B;  1J1D A;  1SL9 A;  3R72 A;  1F70 A;  2QPT A;  3CTN A;  2LMT A;  3CWG A;  2ZNE A;  2ZFD A;  3M0W A;  2Y1N A;  1OSA A;  3PLF B;  1ZAC A;  1LVC D;  4BY4 A;  1T14 A;  3NSI A;  1KQM B;  4GFT A;  1CMF A;  1G4Y R;  1WRK A;  4KYN A;  1RWY A;  1CDL A;  3TS5 B;  1W7J B;  1PAL A;  2WC5 A;  2NXQ A;  4QJ3 B;  1KK7 Z;  5BPJ A;  5AAN A;  4CFR A;  1REC A;  3I5F B;  1J7O A;  2M29 A;  1OOI X;  3CZ1 A;  3SIA A;  1MR8 A;  2R2I A;  4ZCV A;  3DF0 A;  1VRK A;  3SS4 A;  1XFY O;  3WHT B;  1MF8 B;  1J7Q A;  2H61 C;  1DVI A;  4U8D A;  1BR1 B;  2JXL A;  2JNX A;  4OCI A;  3A4U B;  3RM1 A;  4AOM A;  4PAL A;  1C7W A;  2PMY A;  1K9K A;  1FI5 A;  1QXP A;  1SY9 A;  2HET A;  2WOS A;  3N7H A;  1S5G Z;  5K89 A;  2KNE A;  2L98 A;  2KAX A;  2LE9 B;  1C07 A;  3FE9 A;  2HQ8 A;  2WC6 A;  1K93 D;  1XFX O;  1PSR A;  1SSE B;  3Q8I A;  1KFU S;  1F71 A;  5CSF A;  1MQ1 A;  2I94 A;  3FS7 A;  3PN7 C;  3EK8 A;  3SG6 A;  1J55 A;  3EKJ A;  2KLD A;  3SS5 A;  4N1F A;  4HSZ A;  3PFV A;  2HQW A;  2WCL A;  2KGB C;  2PYQ A;  4OV2 A;  3PM8 A;  4WRI A;  1NX0 A;  4PHN A;  2M8U A;  1CM4 A;  3ZNI A;  2BL0 B;  3KO0 A;  2JTT A;  3EVU A;  3DVM A;  2NCO A;  2COL B;  3B87 A;  1DJY A;  2K7D A;  4NDB A;  1TNW A;  4R1E A;  3D78 A;  1LA3 A;  3VGO A;  4UPG A;  3D0Y A;  2PSR A;  1CFC A;  1K95 A;  2L4I A;  2F8P A;  1U5I B;  2JNF A;  2L0P A;  1M63 B;  1Z2C B;  1C3Z A;  1IQ5 A;  3BQ3 A;  1KFX S;  1L2O B;  1M31 A;  1FBV A;  1B8C A;  1QVI Y;  3O78 A;  2JPO A;  5D69 A;  2CBL A;  1LA0 A;  4F7F A;  2O5G A;  1P28 A;  1WDC C;  4DIR A;  4A4C A;  2BCA A;  2F2P A;  1NSH A;  3WNX B;  1DGU A;  4C0J A;  3KF9 A;  1N0Y A;  1G33 A;  1UUR A;  2F33 A;  2M1U A;  1CLB A;  3LK1 A;  2LMU A;  3CR4 X;  1JUO A;  1KWO B;  2JOJ A;  3I5G C;  1KWO C;  4MBE A;  1BOD A;  2L4H A;  4JPZ B;  3TUY C;  5HL1 A;  1CLL A;  1S26 D;  1YR5 A;  1B8L A;  2LNK A;  1QTX A;  3UO9 A;  5IBW A;  1KFU L;  2KSP A;  2F2O A;  1TOP A;  1WY9 A;  3EK7 A;  4F0Z B;  4JQ0 D;  1N2D A;  4GAO A;  1MHO A;  1Z4H A;  3PAL A;  1L2O C;  4WQ3 A;  5DKR A;  1DF0 A;  5F6T A;  3NSL A;  1CFD A;  2KQY A;  3R1P A;  1BF5 A;  2ZKM X;  2QAC A;  1NX2 A;  1BU3 A;  1JF0 A;  1D1O A;  3S0E A;  1FI6 A;  1QLK A;  2MAZ A;  1GGW A;  3DD4 A;  1SKT A;  1H8B A;  3NXA A;  1IKU A;  2BL0 C;  2KI6 C;  2LVJ A;  3BYA A;  5CPV A;  1ORG A;  5HKY A;  1IQ3 A;  3CZ0 A;  2QDI A;  4YRU A;  3LK0 A;  1TUZ A;  2LP2 A;  5CSJ A;  3S0A A;  1LIN A;  2L2C A;  1RK9 A;  1XFV O;  4GNK B;  1RFJ A;  1A03 A;  4OZD A;  3AKB A;  1W9Z A;  5I94 A;  2B1U A;  2KFG A;  5ER5 A;  3BFH A;  5J3X A;  3KEV A;  2YGU A;  1NYA A;  1AJ4 A;  2M97 A;  3OB1 B;  1JFJ A;  1NCX A;  2FCD A;  2JZI A;  3NHT A;  2LAP A;  3I5I C;  1JC2 A;  1OOG A;  2PAL A;  1CMG A;  1IJ5 A;  1DGV A;  1IGV A;  1Y1A A;  1DEK A;  2Y1M A;  1NPQ A;  3BUX B;  3D77 A;  4N5X A;  4XJK B;  1W7I B;  1AK8 A;  3HCM A;  2GGZ A;  2MRD A;  2ERB A;  4L9M A;  1AJ5 A;  1UWO A;  2WCK A;  3PAT A;  2ZND A;  1X02 A;  5GQQ C;  2JTZ A;  1XFW O;  1KK8 B;  3L47 A;  2I18 A;  1QIV A;  2M1K B;  5HKW A;  2FJU B;  4CID A;  2LAN A;  1C3Y A;  2MLF C;  4PCW A;  2KYF A;  1DJZ A;  3AKA A;  3OBV A;  1SCM C;  4OR9 B;  2F3Z A;  1B8R A;  1LKJ A;  2K61 A;  1DMO A;  1IJ6 A;  2WC8 A;  1PSB A;  1A75 B;  3C1V A;  2M9G A;  1BMO A;  1KSM A;  1GM0 A;  5I2O A;  1YRT B;  2JT8 A;  1CFF A;  1PUL A;  4YI9 A;  3KHE A;  1K9U A;  3TUY B;  4IL1 A;  3PM2 A;  5HLO A;  4GGF C;  5G08 A;  5DKQ A;  3TDI A;  3ICB A;  4I5N B;  2LP3 A;  3F45 A;  5D3O A;  1EG4 A;  3KPX A;  4YGB B;  1ZFS A;  2A4J A;  4XYN A;  1K94 A;  1S3P A;  3I5G B;  1KK7 Y;  2SCP A;  2CTN A;  3FWC A;  1QWV A;  1LS8 A;  4P5O E;  1OQP A;  1GQM A;  2K0J A;  3HX4 A;  2P6B B;  2K8M B;  1ALV A;  2KBM A;  1EG3 A;  2RGI A;  3LLE A;  4PE4 A;  1NUB A;  2AUC A;  1KQV A;  5D7F A;  4M2Q A;  1UHI A;  2KYC A;  1DT7 B;  3D76 A;  3CAB A;  1CLM A;  1GGZ A;  1YUR A;  4E68 A;  1EH2 A;  3BFA A;  3VRP A;  3DZT A;  1QAS A;  4PDZ A;  1F8H A;  1Y1X A;  2H61 A;  3EK4 A;  1KCY A;  5KSZ A;  1XFR A;  1YX8 A;  4GGN A;  1CFP A;  1QVI Z;  3CR5 X;  4AQI A;  1BT6 A;  1UHN A;  2LLT A;  2OTG C;  1NP8 A;  5DIC A;  2LVK A;  1DC1 A;  1DQE A;  1NX3 A;  1IIO A;  1QX5 B;  1XK4 C;  4JKT A;  1Y6W A;  3BJH A;  3TZ1 A;  1CDN A;  4PE7 A;  4C0K A;  1RJV A;  2MJW B;  1PRW A;  4JWQ A;  1EL4 A;  1HQV A;  1S36 A;  1OZS A;  2KFF A;  4MRY A;  3BUO B;  4BY5 A;  1IRJ A;  2LVV A;  1L7Z A;  4NQG A;  1R6P A;  3D73 A;  3PN7 B;  1AUI B;  5B8I B;  1SPY A;  2L50 A;  1B47 A;  3BUW B;  5CSI A;  1XA5 A;  1FW4 A;  5FI7 A;  2KLE A;  1GJY A;  2P71 A;  1A29 A;  1ODB A;  4WQ2 A;  1UHK A;  1N65 A;  1CM1 A;  5JJG A;  2JC2 A;  3CZ2 A;  3CZT X;  4MEW A;  3S0D A;  4PT1 A;  2KFH A;  3SJS A;  2EGD A;  1QJT A;  3D10 A;  2KHN A;  2WCH A;  4PHK A;  2M3W A;  2LV7 A;  2HF5 A;  2LM5 A;  4TNC A;  3ZWH A;  2CCM A;  4ORB B;  1RTP 1;  1B7T Z;  5HKZ A;  2ZRT A;  2L2E A;  3EG5 B;  4HRG A;  5PAL A;  4QJ4 B;  1BLQ A;  2WOR A;  1XK4 A;  1SK6 D;  1WRL A;  3JVT B;  4P2Y B;  1XYD A;  1DF0 B;  4MZK A;  2ZN8 A;  1WLZ A;  1DTL A;  3I5F C;  1ZUZ A;  2EHB A;  2LUC A;  2K2F A;  2P70 A;  3H4S E;  2PQL A;  4FQO A;  4OVN F;  1TNP A;  1A75 A;  3B88 A;  1DEL A;  2BCX A;  3TS5 C;  1AHR A;  1NWD A;  3JVT C;  3NSO A;  1YUU A;  2K2A A;  1KQM C;  1MXE A;  2LC5 A;  2ZN9 A;  2WND A;  2LHL A;  3D75 A;  5EL2 A;  4MZL A;  2NLN A;  3CYZ A;  2I7A A;  3JTD B;  2H2K A;  4GBA A;  1UHJ A;  2CNP A;  3FE6 A;  4NDC A;  1CDP A;  4YGE B;  2PVB A;  2LUX A;  5DKN A;  3FIA A;  4PHM A;  4MRX A;  1SL8 A;  1CB1 A;  3BUN B;  2KOT A;  2MBX A;  1TNQ A;  1K90 D;  3CR2 A;  4PE1 A;  4FTG A;  2BE6 A;  5AFP A;  1AP4 A;  5FI6 A;  2NCP A;  3O4Y A;  4ORA B;  3EVV A;  1F54 A;  4DS7 A;  4YBH B;  1SNL A;  1S6I A;  2WCB A;  4DUQ A;  1LXF C;  2KQ6 A;  4FQT A;  4ORC B;  3SIB A;  1M39 A;  1UUS A;  1OE9 B;  1JFK A;  1DJX A;  1PK0 D;  1MUX A;  1QIW A;  2LHI A;  3BOW B;  3EKH A;  3BOW A;  2KAV A;  1A2X A;  2OPO A;  1Q80 A;  2OTG B;  3BFB A;  3IVT A;  2SAS A;  2GV5 A;  4ZCU A;  1JBA A;  2K7C A;  4DCK A;  1NIW A;  1ZMZ A;  2BE4 A;  3DY9 A;  2BEC A;  1KFX L;  1CDM A;  1QX2 A;  3DF0 B;  1JSA A;  4OKH A;  1J7R A;  2TN4 A;  3OP0 A; 
#chains in the Genus database with same CATH homology
 1BR4 B;  1U5I A;  5ER4 X;  1JWD A;  1MWN A;  3DVE A;  3VRQ A;  3SG7 A;  2PRU A;  2LMV A;  1S6J A;  4ETO A;  1TCO B;  1K9P A;  2G9B A;  2JQ6 A;  2NZ0 A;  1F55 A;  5JOL A;  5CSN A;  4D1E A;  1F4Q A;  2KI4 C;  1SR6 C;  3AAJ A;  3VRO A;  1SR6 B;  1WRZ A;  5AEQ A;  1R2U A;  2G2B A;  1OMD A;  3GK1 A;  1NX1 A;  4YI8 A;  1YRU B;  3RLZ A;  2Q91 A;  1QLS A;  5I8N A;  1XO5 A;  4N1G A;  2BKH B;  1QX7 A;  1S1E A;  3BXK A;  1QS7 A;  2O60 A;  5FYX A;  1YX7 A;  2CXJ A;  1UP5 A;  1SCM B;  1ZOT B;  5AER A;  3SG3 A;  1TIZ A;  2JWW A;  3CGA A;  1QV0 A;  3LCP C;  1OMV A;  1S5G Y;  4AQJ A;  1DJH A;  4CLN A;  4CFQ A;  1CTR A;  1IWQ A;  1OMR A;  1QAT A;  1RRO A;  3AAK A;  4NDD A;  1KK8 C;  2M7N A;  3TDU A;  2JT0 A;  2ZRS A;  1J7P A;  2LCP A;  1YUT A;  1B1G A;  1K2H A;  3O6B A;  2PAS A;  3SG4 A;  1OOJ A;  2AMI A;  3VRN A;  1B9A A;  1TCF A;  2AAO A;  2JXC A;  4YGA A;  1NCZ A;  4YGC B;  4MZJ A;  1DJG A;  3I5I B;  3QRX A;  4MLW A;  2M7L A;  2Y5I A;  2I2R E;  2L51 A;  4C0L A;  4GPL B;  4I5J A;  4USL A;  2JUL A;  5I2Q A;  3OB2 B;  2IS9 A;  1SMG A;  1K8U A;  1XFZ O;  3FWB A;  1UHH A;  1B4C A;  1YTZ C;  4XJK A;  1EXR A;  2E30 A;  3DVK A;  1FF1 A;  2WCF A;  4HRH A;  1TTX A;  2BBN A;  2LLS A;  3JTD C;  4Q04 A;  2F3Y A;  2KBI A;  2FOT A;  1SL7 A;  3O2P A;  2LLU A;  2MLE C;  5HLV A;  1V1G A;  2M49 B;  2DOQ A;  3WHU B;  2KAY A;  4M2O A;  3VRR A;  2L5X B;  1NCY A;  2BBM A;  1CNP A;  3NSK A;  4I5K A;  5KU1 A;  1XFU O;  1PVB A;  3CLN A;  3SG5 A;  4ICB A;  1YVL A;  3D0Y B;  3SG2 A;  1BJF A;  1TN4 A;  1OZO A;  3K21 A;  4PHJ A;  1SW8 A;  1DJW A;  2JT3 A;  3IF7 A;  3I5H C;  2KI4 B;  1DJI A;  4A4B A;  3OX6 A;  3OX5 A;  1C7V A;  1H4B A;  1YVH A;  1FPW A;  3GK2 A;  1SCV A;  2KGR A;  3MSE B;  3OHM B;  1TRF A;  4MVF A;  2E6W A;  1BG1 A;  2OS8 B;  1AVS A;  3GOF A;  4GGF A;  1WDC B;  4CPV A;  5KTY A;  3CS1 A;  1S6C A;  1SRA A;  1TNX A;  1IG5 A;  4HRE E;  2HPS A;  3BUM B;  2Q4U A;  3E3R A;  2Y4Q A;  4MN0 A;  1SYM A;  1WLM A;  1IH0 A;  1HT9 A;  3TDZ A;  2LVI A;  1ALW A;  4I5L B;  1M46 A;  1Y0V H;  2BKI B;  5AXI A;  1A4P A;  3LL8 B;  1M45 A;  1Y1U A;  5TNC A;  3A8R A;  2JU0 A;  2JPT A;  3IQQ A;  2EC6 B;  3PSR A;  1XVJ A;  2K7B A;  1PVA A;  1J1E A;  2WCE A;  2EC6 C;  3WXA A;  2D8N A;  3IQO A;  2FCE A;  5HYD A;  1F4O A;  3GK4 X;  2GGM A;  2M0R A;  2ISD A;  1YUS A;  1CKK A;  2MHH A;  2VRG A;  1G8I A;  2MA2 A;  4DRW A;  3DVJ A;  1MXL C;  2CT9 A;  2KDH A;  1JF2 A;  4QJ5 B;  2OS8 C;  1KSO A;  2KI6 D;  4MSP A;  4GUK A;  1B7T Y;  5I2L A;  1QV1 A;  2JRF A;  1EJ3 A;  4YGD B;  2BCB A;  4PE0 A;  1E8A A;  1V1F A;  2K7O A;  2V53 A;  1K96 A;  3EVR A;  4M2P A;  1SBJ A;  3I5H B;  1J1D A;  1SL9 A;  1F70 A;  2QPT A;  3CTN A;  2LMT A;  3CWG A;  2ZNE A;  2ZFD A;  3M0W A;  2Y1N A;  1OSA A;  3PLF B;  1ZAC A;  1LVC D;  4BY4 A;  3NSI A;  1CMF A;  1KQM B;  4GFT A;  1G4Y R;  1WRK A;  1RWY A;  1CDL A;  3TS5 B;  1W7J B;  1PAL A;  2NXQ A;  4QJ3 B;  1KK7 Z;  5BPJ A;  5AAN A;  4CFR A;  1REC A;  3I5F B;  1J7O A;  2M29 A;  3SIA A;  1MR8 A;  2R2I A;  4ZCV A;  3DF0 A;  1VRK A;  3WHT B;  1XFY O;  1J7Q A;  1MF8 B;  2H61 C;  1DVI A;  4U8D A;  1BR1 B;  2JXL A;  2JNX A;  4OCI A;  3A4U B;  3RM1 A;  4AOM A;  4PAL A;  1C7W A;  2PMY A;  1K9K A;  1FI5 A;  1QXP A;  1SY9 A;  2HET A;  2WOS A;  1S5G Z;  5K89 A;  2KNE A;  2L98 A;  2KAX A;  2LE9 B;  1C07 A;  2HQ8 A;  1K93 D;  1XFX O;  1PSR A;  1KFU S;  1F71 A;  5CSF A;  1MQ1 A;  2I94 A;  3FS7 A;  3PN7 C;  3EK8 A;  3SG6 A;  1J55 A;  3EKJ A;  4N1F A;  4HSZ A;  3PFV A;  2HQW A;  2KGB C;  4OV2 A;  4WRI A;  3PM8 A;  1NX0 A;  4PHN A;  2M8U A;  1CM4 A;  3ZNI A;  2BL0 B;  3KO0 A;  2JTT A;  3EVU A;  3DVM A;  2NCO A;  2COL B;  1DJY A;  2K7D A;  4NDB A;  1TNW A;  4R1E A;  1LA3 A;  3VGO A;  4UPG A;  3D0Y A;  2PSR A;  1CFC A;  1K95 A;  2L4I A;  2F8P A;  1U5I B;  2JNF A;  2L0P A;  1M63 B;  1IQ5 A;  3BQ3 A;  1KFX S;  1L2O B;  1M31 A;  1FBV A;  1B8C A;  1QVI Y;  3O78 A;  5D69 A;  2CBL A;  1LA0 A;  2O5G A;  1WDC C;  4DIR A;  4A4C A;  2BCA A;  2F2P A;  1NSH A;  3WNX B;  1DGU A;  4C0J A;  3KF9 A;  1N0Y A;  1G33 A;  1UUR A;  2F33 A;  2M1U A;  1CLB A;  3LK1 A;  2LMU A;  3CR4 X;  1JUO A;  1KWO B;  2JOJ A;  3I5G C;  1KWO C;  4MBE A;  1BOD A;  2L4H A;  4JPZ B;  3TUY C;  1CLL A;  1S26 D;  1YR5 A;  1B8L A;  2LNK A;  1QTX A;  5IBW A;  1KFU L;  2KSP A;  2F2O A;  1TOP A;  1WY9 A;  3EK7 A;  4F0Z B;  4JQ0 D;  1N2D A;  4GAO A;  1MHO A;  3PAL A;  1L2O C;  4WQ3 A;  5DKR A;  1DF0 A;  5F6T A;  3NSL A;  1CFD A;  2KQY A;  1BF5 A;  2ZKM X;  2QAC A;  1NX2 A;  1BU3 A;  1JF0 A;  1D1O A;  1FI6 A;  1QLK A;  2MAZ A;  1GGW A;  3DD4 A;  1SKT A;  1H8B A;  3NXA A;  1IKU A;  2BL0 C;  2KI6 C;  2LVJ A;  3BYA A;  5CPV A;  5HKY A;  1IQ3 A;  4YRU A;  3LK0 A;  2LP2 A;  5CSJ A;  1LIN A;  1RK9 A;  1XFV O;  4GNK B;  1RFJ A;  1A03 A;  3AKB A;  2B1U A;  2KFG A;  5ER5 A;  5J3X A;  3KEV A;  1NYA A;  1AJ4 A;  2M97 A;  3OB1 B;  1JFJ A;  1NCX A;  2FCD A;  2JZI A;  2LAP A;  3I5I C;  1JC2 A;  2PAL A;  1CMG A;  1IJ5 A;  1DGV A;  1IGV A;  1Y1A A;  2Y1M A;  3BUX B;  1NPQ A;  4N5X A;  4XJK B;  1W7I B;  1AK8 A;  3HCM A;  2GGZ A;  2MRD A;  4L9M A;  1AJ5 A;  1UWO A;  3PAT A;  2ZND A;  1X02 A;  5GQQ C;  2JTZ A;  1XFW O;  1KK8 B;  2I18 A;  1QIV A;  2M1K B;  5HKW A;  2FJU B;  4CID A;  2LAN A;  2MLF C;  4PCW A;  2KYF A;  1DJZ A;  3AKA A;  1SCM C;  4OR9 B;  2F3Z A;  1B8R A;  1LKJ A;  2K61 A;  1DMO A;  1IJ6 A;  2WC8 A;  1PSB A;  1A75 B;  3C1V A;  2M9G A;  1BMO A;  1KSM A;  5I2O A;  1YRT B;  2JT8 A;  1CFF A;  1PUL A;  4YI9 A;  3KHE A;  1K9U A;  3TUY B;  4IL1 A;  5HLO A;  4GGF C;  5G08 A;  5DKQ A;  3TDI A;  3ICB A;  4I5N B;  2LP3 A;  3F45 A;  1BOC A;  1EG4 A;  3KPX A;  4YGB B;  1ZFS A;  2A4J A;  4XYN A;  1K94 A;  1S3P A;  3I5G B;  1KK7 Y;  2SCP A;  2CTN A;  3FWC A;  4P5O E;  1OQP A;  1GQM A;  2K0J A;  3HX4 A;  2P6B B;  2K8M B;  1ALV A;  2KBM A;  1EG3 A;  2RGI A;  3LLE A;  4PE4 A;  1NUB A;  2AUC A;  1KQV A;  5D7F A;  4M2Q A;  1UHI A;  2KYC A;  1DT7 B;  1CLM A;  1GGZ A;  1YUR A;  4E68 A;  1EH2 A;  1F8H A;  3VRP A;  1QAS A;  4PDZ A;  1Y1X A;  2H61 A;  3EK4 A;  1KCY A;  5KSZ A;  4GGN A;  1YX8 A;  1CFP A;  1QVI Z;  3CR5 X;  4AQI A;  1BT6 A;  1UHN A;  2LLT A;  2OTG C;  1NP8 A;  2LVK A;  1NX3 A;  1QX5 B;  1XK4 C;  1Y6W A;  3TZ1 A;  1CDN A;  4PE7 A;  4C0K A;  1RJV A;  2MJW B;  1PRW A;  4JWQ A;  1EL4 A;  1HQV A;  1S36 A;  1OZS A;  2KFF A;  4MRY A;  3BUO B;  4BY5 A;  1IRJ A;  2LVV A;  1L7Z A;  4NQG A;  1R6P A;  3PN7 B;  5B8I B;  1AUI B;  1SPY A;  2L50 A;  1B47 A;  3BUW B;  5CSI A;  1XA5 A;  1FW4 A;  1GJY A;  1A29 A;  1ODB A;  4WQ2 A;  1UHK A;  1N65 A;  1CM1 A;  5JJG A;  2JC2 A;  3CZT X;  4MEW A;  2KFH A;  3SJS A;  2EGD A;  1QJT A;  3D10 A;  2KHN A;  4PHK A;  2M3W A;  2LV7 A;  2HF5 A;  2LM5 A;  4TNC A;  3ZWH A;  2CCM A;  4ORB B;  1RTP 1;  1B7T Z;  5HKZ A;  2ZRT A;  2L2E A;  4HRG A;  5PAL A;  4QJ4 B;  1BLQ A;  2WOR A;  1XK4 A;  1SK6 D;  1WRL A;  3JVT B;  4P2Y B;  1XYD A;  1DF0 B;  4MZK A;  2ZN8 A;  1WLZ A;  1DTL A;  3I5F C;  1ZUZ A;  2EHB A;  2LUC A;  2K2F A;  3H4S E;  4FQO A;  4OVN F;  1TNP A;  1A75 A;  3TS5 C;  2BCX A;  1AHR A;  1NWD A;  3JVT C;  3NSO A;  1YUU A;  2K2A A;  1KQM C;  1MXE A;  2LC5 A;  2ZN9 A;  2WND A;  2LHL A;  4MZL A;  2NLN A;  3JTD B;  2I7A A;  2H2K A;  4GBA A;  1UHJ A;  2CNP A;  4NDC A;  4YGE B;  1CDP A;  2PVB A;  2LUX A;  5DKN A;  3FIA A;  4PHM A;  4MRX A;  1SL8 A;  1CB1 A;  3BUN B;  2KOT A;  2MBX A;  1TNQ A;  1K90 D;  3CR2 A;  4PE1 A;  4FTG A;  2BE6 A;  5AFP A;  1AP4 A;  2NCP A;  3O4Y A;  4ORA B;  3EVV A;  1F54 A;  4DS7 A;  4YBH B;  1SNL A;  1S6I A;  2WCB A;  4DUQ A;  1LXF C;  2KQ6 A;  4ORC B;  3SIB A;  1M39 A;  1UUS A;  1OE9 B;  1JFK A;  1DJX A;  1PK0 D;  1MUX A;  1QIW A;  2LHI A;  3BOW B;  3EKH A;  3BOW A;  2KAV A;  1A2X A;  2OPO A;  1Q80 A;  2OTG B;  2SAS A;  2GV5 A;  4ZCU A;  1JBA A;  2K7C A;  4DCK A;  1NIW A;  1ZMZ A;  2BE4 A;  2BEC A;  1KFX L;  1CDM A;  1QX2 A;  3DF0 B;  1JSA A;  4OKH A;  1J7R A;  2TN4 A;  3OP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...