1XA5A

Structure of calmodulin in complex with kar-2, a bis-indol alkaloid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
144
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin
publication title The structure of the complex of calmodulin with KAR-2: a novel mode of binding explains the unique pharmacology of the drug
pubmed doi rcsb
total genus 49
structure length 144
sequence length 146
ec nomenclature
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xa5A00
1DJWA 1WLMA 4ORAB 1BR1B 1NSHA 2VRGA 1CFCA 1JWDA 1AHRA 3GK2A 1SKTA 1J7RA 4I5LB 1EG3A 1MWNA 2JPTA 1EH2A 1SCVA 1Y6WA 1NX2A 1DF0B 4BY4A 1IGVA 2F3ZA 1DMOA 5PALA 5AFPA 1F55A 1QV0A 1CFDA 1FBVA 4HRGA 1KQMB 1XK4A 5K89A 1WDCC 4YRUA 4XYNA 2F8PA 1JUOA 1K8UA 2KGRA 4OCIA 3ZWHA 2EC6B 1CNPA 2BKHB 2BKIB 3VRRA 4A4CA 1J1EA 2L0PA 3BQ3A 5FYXA 3TS5C 4PDZA 2KI6C 2K2FA 2JXLA 2KI4C 3FWBA 1VRKA 1FW4A 2LUCA 2ZFDA 3VGOA 1CMGA 1CLLA 1YTZC 2NCOA 1B8RA 4FTGA 2P6BB 1XO5A 2PVBA 2FCEA 3SG6A 2SASA 4N5XA 2LV7A 4YI9A 3EK7A 3DVJA 2DOQA 1SCMC 1UHNA 3I5HB 1A2XA 4N1FA 1DJHA 3TZ1A 3BOWB 1SW8A 3HCMA 1NYAA 2OTGC 3NSIA 2KOTA 3BUMB 1NIWA 2GGZA 4MZLA 2BECA 2KNEA 1SMGA 2A4JA 4JPZB 2AMIA 1C7VA 1RFJA 2ZN8A 2EGDA 1BODA 1ZACA 1F54A 2KSPA 4ETOA 5JOLA 1B9AA 2LLUA 1XFXO 3H4SE 5F6TA 1YUUA 5I2OA 4GNKB 1K9KA 1F70A 1YR5A 1EJ3A 2JNFA 2FCDA 3CTNA 1F71A 1TNQA 1EG4A 5HKZA 4CIDA 1OZOA 4NDDA 2GV5A 1A4PA 3CZTX 1E8AA 1KK7Z 1YRTB 2TN4A 1BU3A 4FQOA 1FI6A 2JQ6A 1J7OA 2WC8A 1OSAA 4GAOA 2LANA 3JTDC 1IJ6A 1BOCA 2KHNA 1XYDA 1Y1XA 3PN7C 3BOWA 2KYCA 1XFUO 2K7CA 1NPQA 1N0YA 2PSRA 4OV2A 4PE1A 2OS8C 1OMRA 3OX5A 3JVTC 1JF0A 1KWOC 2OPOA 3D10A 1J55A 3FIAA 1QX5B 1L2OB 1A75A 1XFYO 2LE9B 2BL0C 4BY5A 2PASA 2KGBC 1YUSA 1KSMA 1IKUA 1Y0VH 4NQGA 4YGDB 3WXAA 1B7TZ 2KAVA 1S26D 1SR6B 3SG4A 1RWYA 4CLNA 4QJ3B 3I5FC 1S6CA 1CMFA 2L98A 2LUXA 1SK6D 3KPXA 1R6PA 1CDMA 1YUTA 1UHHA 2KDHA 1XFWO 2KBMA 2M29A 4IL1A 4PE0A 4F0ZB 5ER4X 3SIAA 1JC2A 2KAYA 2JTTA 3I5IB 5KSZA 2LHIA 1UP5A 2BE6A 1CB1A 2PALA 3LK0A 1DJXA 2MAZA 2LLTA 2G9BA 3SIBA 4PHMA 4GPLB 2M8UA 4D1EA 4ICBA 3VROA 5I8NA 1YURA 3AKAA 2NZ0A 2GGMA 1S36A 1FPWA 1W7JB 4MN0A 2JWWA 2MA2A 2ZRTA 5KTYA 4CPVA 1S3PA 1S5GZ 3BUXB 5I2QA 4OKHA 2MHHA 2KYFA 2LP2A 1WDCB 1QJTA 1ALVA 2K61A 4M2OA 4R1EA 5HLVA 4MBEA 4GGFC 1AP4A 1KQVA 4M2PA 1B4CA 1QXPA 1QX2A 2BBNA 4I5KA 3TS5B 1CM1A 1QASA 2KI4B 1LA3A 2Y1NA 2WCFA 3TUYC 4GBAA 2FJUB 1PSRA 4DRWA 2ZN9A 2JC2A 3OP0A 3TDIA 1K90D 3WNXB 2L5XB 3KF9A 3A8RA 3TDUA 1M39A 2WORA 4HSZA 1FF1A 2M1KB 3RM1A 4XJKB 3FWCA 4P2YB 2M3WA 3BYAA 3VRNA 1KK7Y 5B8IB 1C7WA 1SCMB 2CTNA 2M97A 1K93D 1ALWA 1AK8A 1OMVA 3SG7A 1GGWA 2I7AA 1IWQA 1X02A 1HQVA 3C1VA 4ZCUA 1KFUL 4DCKA 4A4BA 1HT9A 2OTGB 1QIWA 4GGFA 2IS9A 3WHTB 2HF5A 1UUSA 1Q80A 1QS7A 3OX6A 1PALA 1M63B 5HKYA 1TNWA 1KFUS 4UPGA 4U8DA 5KU1A 1BR4B 2D8NA 4I5NB 3CS1A 4PHJA 2KI6D 2LLSA 1DT7B 5IBWA 1EXRA 1AUIB 3GK1A 1JFJA 5HKWA 2LC5A 1B8LA 1B7TY 3BXKA 3NSOA 1A75B 2JT8A 2F2OA 3I5GB 1BF5A 3ZNIA 3FS7A 1EL4A 3PLFB 1NP8A 1TRFA 4GUKA 4PE4A 2HETA 1LVCD 2LHLA 2MJWB 1K9PA 1Y1AA 1PSBA 1OOJA 2JRFA 3DVEA 4QJ4B 2MBXA 1PVBA 1BG1A 1NX1A 2JNXA 3SJSA 2F3YA 4XJKA 4C0LA 4YBHB 3O6BA 1S6JA 2LMTA 1QVIZ 3JTDB 1D1OA 2LP3A 1NX3A 2KFFA 4E68A 1M31A 2MRDA 3HX4A 3PN7B 1SNLA 5CPVA 2H61C 3GK4X 5AXIA 4DIRA 4QJ5B 2OS8B 1BLQA 2BBMA 3JVTB 2HQ8A 2SCPA 1K95A 1KWOB 1WRKA 2LM5A 1MXEA 1SRAA 4ORCB 2K7OA 1S5GY 1OE9B 3KO0A 5CSFA 1TTXA 5DKQA 1QLKA 2KAXA 2M49B 3AAJA 4AQJA 1RK9A 3GOFA 2HPSA 2KFGA 2KQ6A 3BUOB 1J1DA 1MHOA 1PRWA 2NLNA 1N2DA 1NCZA 1ZMZA 2CXJA 1DGUA 2L51A 3LL8B 1CM4A 2JT0A 4YGBB 1G8IA 1LKJA 1XFVO 2H2KA 2O60A 3PALA 3I5FB 4WQ2A 1CLBA 1FI5A 2ZRSA 1CFFA 1A29A 1UWOA 1TOPA 1IH0A 3TDZA 1G4YR 1W7IB 2I18A 2M7LA 3ICBA 5G08A 5CSJA 3VRQA 1RTP1 3DD4A 1WRZA 2K7BA 3VRPA 1XVJA 2MLEC 1IJ5A 3CR2A 1KSOA 3IQQA 2E30A 1K2HA 5TNCA 2B1UA 5DKNA 1XA5A 2L4IA 4TNCA 1S6IA 2V53A 4WQ3A 1UHIA 2EHBA 3IF7A 2NXQA 2JT3A 2Q91A 1JSAA 2LVJA 1CKKA 1KFXL 2CNPA 2K2AA 1C07A 4MLWA 1WY9A 2RGIA 5AANA 3BUNB 1RECA 1SL7A 1ZUZA 5BPJA 2L4HA 1NCXA 2F2PA 2HQWA 4MSPA 1J7QA 4HREE 2KBIA 2PMYA 1M45A 4AOMA 1KFXS 2I2RE 2I94A 3EVVA 4I5JA 1WLZA 4MRXA 4PHKA 3DVKA 4MZKA 2JXCA 5GQQC 1CLMA 2JOJA 5JJGA 2WNDA 3DVMA 4NDBA 3TUYB 1SR6C 1F8HA 1DJGA 5I2LA 1SYMA 1KK8C 3IQOA 3O78A 4ZCVA 2KQYA 2COLB 4YGAA 1SL8A 1MXLC 2ZNEA 1UHKA 2JU0A 2WCBA 3AAKA 1GGZA 4YGEB 1BT6A 2L2EA 4JWQA 1UHJA 1IRJA 2O5GA 1R2UA 2CCMA 3NXAA 1Y1UA 1QVIY 1QIVA 1QTXA 2F33A 2LVKA 1M46A 3F45A 2Q4UA 1MQ1A 1YVHA 3EVUA 2QACA 3KEVA 2CBLA 3CR4X 1ODBA 3D0YA 3SG2A 4C0JA 4MVFA 1H8BA 5AERA 1RJVA 1U5IA 2Y4QA 2BCXA 1TIZA 1GQMA 1QV1A 1QX7A 4MEWA 2BE4A 5D69A 2K0JA 3AKBA 1CTRA 2AAOA 4DS7A 1ZOTB 4CFQA 1V1GA 1BJFA 1K96A 4M2QA 5CSIA 1G33A 4YGCB 4CFRA 5HYDA 1H4BA 1SBJA 5J3XA 1AJ5A 1V1FA 1KQMC 3A4UB 2AUCA 1S1EA 2LMUA 4OVNF 1LINA 3EK4A 1DTLA 2E6WA 2EC6C 1DJIA 1NCYA 3CLNA 4Q04A 1MR8A 3EKJA 2WCEA 3LLEA 4ORBB 3DF0A 1CDLA 1NWDA 2CT9A 2JTZA 3BUWB 1OQPA 1SY9A 1JFKA 2Y5IA 3KHEA 1OZSA 2FOTA 3LK1A 1DJYA 2M0RA 1BMOA 3OB1B 1J7PA 1CFPA 2M9GA 1AVSA 4C0KA 4YI8A 3SG5A 2Y1MA 4DUQA 1DF0A 1IG5A 1DVIA 1TN4A 1UURA 2K8MB 3I5HC 3MSEB 1TNPA 1QATA 2NCPA 5D7FA 1B47A 1N65A 2M1UA 3OHMB 1XFZO 1LA0A 1TNXA 1MUXA 1RROA 4PHNA 3SG3A 1TCFA 4P5OE 3CWGA 1SL9A 1NX0A 4MRYA 1PULA 3NSLA 2BL0B 3LCPC 5HLOA 1NUBA 1YRUB 1F4QA 2MLFC 3I5GC 2ZNDA 2QPTA 2KFHA 2LNKA 1DGVA 3OB2B 1CDPA 4N1GA 4WRIA 2K7DA 1F4OA 4PCWA 2H61A 3E3RA 2LVVA 4NDCA 1CDNA 3K21A 3EVRA 1IQ3A 1B8CA 2LAPA 5ER5A 1IQ5A 3WHUB 1K9UA 2ZKMX 1MF8B 4L9MA 1AJ4A 4HRHA 2LCPA 2G2BA 2BCAA 3EK8A 4PE7A 4OR9B 3PFVA 1LXFC 1WRLA 3D0YB 3NSKA 2L50A 1DJZA 1U5IB 1L7ZA 1JF2A 5AEQA 3PSRA 4MZJA 1A03A 1KK8B 1L2OC 5DKRA 2LMVA 4GFTA 2BCBA 2ISDA 1K94A 3PATA 3CGAA 4AQIA 3O2PA 1TCOB 4JQ0D 2JZIA 2PRUA 3CR5X 3RLZA 1YX8A 3O4YA 4GGNA 1JBAA 1PVAA 1XK4C 3EKHA 1YVLA 1PK0D 4PALA 1KCYA 1YX7A 3QRXA 1GJYA 1OMDA 2LVIA 1QLSA 3PM8A 2JULA 3M0WA 2R2IA 1SPYA 3DF0B 4USLA 1ZFSA 2M7NA 3I5IC 1B1GA 5CSNA 2WOSA
chains in the Genus database with same CATH superfamily
1DJWA 1WLMA 4ORAB 1BR1B 1NSHA 2VRGA 1CFCA 1JWDA 1AHRA 3GK2A 1SKTA 1J7RA 4I5LB 1EG3A 1MWNA 2JPTA 1EH2A 1SCVA 1Y6WA 1NX2A 1DF0B 4BY4A 1IGVA 2F3ZA 1DMOA 5PALA 5AFPA 1F55A 3BFBA 1QV0A 1OOFA 1CFDA 1FBVA 4HRGA 1KQMB 1XK4A 5K89A 1WDCC 4YRUA 4XYNA 2F8PA 1JUOA 1K8UA 2KGRA 3B6XA 4OCIA 3ZWHA 2EC6B 1CNPA 3D77A 2BKHB 2BKIB 3VRRA 4A4CA 1J1EA 2L0PA 3BQ3A 5FYXA 3TS5C 4PDZA 2KI6C 2K2FA 2JXLA 2KI4C 3FWBA 1VRKA 1FW4A 2LUCA 2ZFDA 3VGOA 3V2LA 1CMGA 1CLLA 1YTZC 2NCOA 1B8RA 4FTGA 2P6BB 1XO5A 2PVBA 2QEOA 2FCEA 3SG6A 2SASA 4N5XA 2LV7A 4YI9A 3EK7A 3DVJA 2DOQA 1SCMC 1UHNA 3I5HB 1A2XA 4N1FA 1DJHA 3TZ1A 3BOWB 1SW8A 3HCMA 1NYAA 2OTGC 3NSIA 2KOTA 2GTEA 3BUMB 1NIWA 2GGZA 4MZLA 2BECA 2KNEA 2L2CA 1SMGA 5HL1A 2A4JA 4JPZB 3SS5A 2AMIA 1C7VA 1RFJA 2ZN8A 2EGDA 1BODA 1ZACA 1F54A 3S0FA 2KSPA 4ETOA 5JOLA 3N7HA 1B9AA 2LLUA 1XFXO 2KLEA 3H4SE 5F6TA 1YUUA 5I2OA 4GNKB 1K9KA 1F70A 1YR5A 1EJ3A 2JNFA 2FCDA 3CTNA 1F71A 3SS3A 3D75A 1TNQA 1EG4A 5HKZA 4CIDA 3D76A 1OZOA 4NDDA 2GV5A 1A4PA 3CZTX 3CDNA 1E8AA 1KK7Z 1YRTB 2TN4A 1BU3A 4FQOA 1FI6A 2JQ6A 1J7OA 2WC8A 1OSAA 4GAOA 2LANA 3DYEA 3JTDC 1IJ6A 1BOCA 2KHNA 1XYDA 1Y1XA 3PN7C 3BOWA 2KYCA 1H4BA 1XFUO 2K7CA 1NPQA 1N0YA 2PSRA 4INWA 4OV2A 4PE1A 1P28A 1SSEB 2OS8C 1OMRA 3OX5A 3JVTC 1JF0A 1KWOC 2OPOA 3D10A 1J55A 3FIAA 1QX5B 1L2OB 1A75A 1XFYO 2LE9B 2BL0C 4BY5A 2PASA 2BNXA 1YUSA 2KGBC 1KSMA 1IKUA 1Y0VH 4NQGA 4YGDB 3WXAA 1B7TZ 1TUZA 2KAVA 1S26D 1SR6B 1Z4HA 3SG4A 1RWYA 4CLNA 4QJ3B 3B87A 1S6CA 3I5FC 2L98A 1CMFA 2LUXA 1SK6D 3KPXA 1R6PA 1CDMA 1YUTA 1UHHA 1DEKA 2KDHA 1XFWO 2KBMA 2M29A 4IL1A 4PE0A 4F0ZB 5ER4X 3SIAA 1JC2A 2KAYA 1GM0A 2JTTA 3I5IB 5KSZA 3S0DA 2LHIA 3OGNA 3S0EA 1UP5A 2BE6A 1CB1A 2PALA 3LK0A 1OOIX 1DJXA 2MAZA 2LLTA 2G9BA 3SIBA 4PHMA 4GPLB 2M8UA 4D1EA 1W9ZA 4ICBA 3VROA 5I8NA 3NGVA 1YURA 3AKAA 2NZ0A 2GGMA 1S36A 4INXA 1FPWA 1W7JB 3B88A 4MN0A 2JWWA 2MA2A 2ZRTA 5KTYA 3SS4A 1S3PA 1S5GZ 3BUXB 4CPVA 4OKHA 2MHHA 2KYFA 2LP2A 5I2QA 1WDCB 1QJTA 1ALVA 2K61A 3CZ1A 4M2OA 4R1EA 5HLVA 2JPOA 4MBEA 4GGFC 1AP4A 1KQVA 1T14A 4M2PA 1QXPA 2QEHA 1QX2A 3FE9A 1B4CA 1OW4A 2BBNA 4I5KA 3TS5B 1CM1A 1QASA 2KI4B 1LA3A 2Y1NA 2WCFA 3TUYC 3R1OA 3L47A 2PYQA 2FJUB 1PSRA 4GBAA 4DRWA 2ZN9A 2JC2A 3OP0A 3TDIA 1K90D 3WNXB 2L5XB 3KF9A 3A8RA 3TDUA 1M39A 2WORA 4HSZA 1FF1A 2M1KB 3RM1A 4XJKB 3FWCA 2WC6A 1OOHA 2M3WA 3BYAA 4P2YB 3VRNA 1KK7Y 5B8IB 1C7WA 1SCMB 2CTNA 2M97A 1K93D 1ALWA 1AK8A 1OMVA 3SG7A 3DZTA 1GGWA 2I7AA 1IWQA 1X02A 1HQVA 3C1VA 4ZCUA 1KFUL 4DCKA 4A4BA 1HT9A 2OTGB 1QIWA 4GGFA 2IS9A 3WHTB 2HF5A 3EG5B 1UUSA 1Q80A 1QS7A 3OX6A 3VB1A 1PALA 1M63B 5HKYA 1TNWA 1KFUS 3CZ0A 4U8DA 4UPGA 5KU1A 1BR4B 2D8NA 4I5NB 3CS1A 4PHJA 2KI6D 2LLSA 1DT7B 5IBWA 1EXRA 1AUIB 3GK1A 1JFJA 5HKWA 2LC5A 1B8LA 1B7TY 2KLDA 3BXKA 3NSOA 1A75B 2JT8A 2F2OA 2WCLA 3I5GB 1BF5A 3ZNIA 1OOGA 1EL4A 3FS7A 2P71A 3PLFB 1NP8A 1TRFA 4GUKA 4PE4A 2HETA 1LVCD 2LHLA 2MJWB 1K9PA 1Y1AA 4KYNA 1PSBA 1OOJA 2JRFA 3DVEA 4QJ4B 2MBXA 1PVBA 1BG1A 1NX1A 2JNXA 3SJSA 2F3YA 4XJKA 4C0LA 4YBHB 3O6BA 1S6JA 2LMTA 1QVIZ 3JTDB 1D1OA 2LP3A 1NX3A 2KFFA 4E68A 1M31A 2MRDA 3HX4A 3PN7B 1SNLA 4F7FA 5CPVA 2H61C 3GK4X 5AXIA 3BFAA 4DIRA 4QJ5B 2OS8B 3OBVA 1BLQA 2BBMA 3JVTB 2HQ8A 3DXLA 2SCPA 1K95A 1KWOB 1WRKA 2LM5A 1MXEA 1SRAA 4ORCB 2K7OA 3CABA 1S5GY 1OE9B 3KO0A 5CSFA 5EL2A 1TTXA 5DKQA 1QLKA 2KAXA 2M49B 3AAJA 4AQJA 1RK9A 3GOFA 2HPSA 2KFGA 2KQ6A 3BUOB 1J1DA 1MHOA 1PRWA 2NLNA 1N2DA 1NCZA 1ZMZA 1LS8A 1DGUA 2CXJA 2L51A 3LL8B 1CM4A 2JT0A 1TWOA 4YGBB 1G8IA 1LKJA 1XFVO 2H2KA 2O60A 3PALA 3I5FB 4WQ2A 1CLBA 1FI5A 3PJIA 2ZRSA 3FE8A 1CFFA 1A29A 1UWOA 1TOPA 1IH0A 3TDZA 1G4YR 1W7IB 2I18A 2M7LA 3ICBA 5G08A 5CSJA 2WCHA 3VRQA 1RTP1 2H8VA 1WRZA 3DD4A 2K7BA 3VRPA 1XVJA 2MLEC 1IJ5A 3CR2A 1KSOA 3IQQA 2E30A 1K2HA 5D3OA 2B1UA 5TNCA 5DKNA 3CYZA 1XA5A 2L4IA 4TNCA 1S6IA 2V53A 4WQ3A 1UHIA 5DICA 2EHBA 3IF7A 2NXQA 2JT3A 2L5YA 2Q91A 1JSAA 2LVJA 1CKKA 1KFXL 2CNPA 2K2AA 1C07A 4MLWA 1WY9A 2RGIA 1TUJA 3K1EA 5AANA 3BUNB 1RECA 1SL7A 1ZUZA 5BPJA 2L4HA 1NCXA 2F2PA 3R72A 2HQWA 4MSPA 1J7QA 4HREE 2KBIA 2PMYA 1M45A 4AOMA 1KFXS 2I2RE 2I94A 3EVVA 4I5JA 1WLZA 4MRXA 4PHKA 3DVKA 4MZKA 2JXCA 5GQQC 1CLMA 2JOJA 2WCJA 2WNDA 3DVMA 4NDBA 3TUYB 1SR6C 5JJGA 1F8HA 1DJGA 1ORGA 1SYMA 1KK8C 3IQOA 5I2LA 2WCKA 3O78A 2K60A 1QWVA 4ZCVA 2KQYA 2COLB 4YGAA 1SL8A 1MXLC 3FE6A 2ZNEA 1UHKA 2JU0A 2WCBA 3AAKA 2YGUA 3Q8IA 1GGZA 4YGEB 1BT6A 2L2EA 4JWQA 1UHJA 1IRJA 2O5GA 1R2UA 2CCMA 3NXAA 1Y1UA 1QVIY 4PT1A 1QIVA 1IIOA 1QTXA 2F33A 2LVKA 1M46A 3F45A 2ERBA 2Q4UA 1MQ1A 1YVHA 3EVUA 2QACA 2QEBA 4OZDA 3KEVA 2CBLA 3CR4X 1ODBA 3D0YA 4JD9A 3SG2A 4C0JA 4MVFA 1H8BA 5AERA 1RJVA 1U5IA 5FI7A 2Y4QA 3D73A 2BCXA 1TIZA 1GQMA 1QV1A 1QX7A 3PM2A 2BE4A 4MEWA 5D69A 2K0JA 3AKBA 1CTRA 2AAOA 4DS7A 1ZOTB 4CFQA 1V1GA 1BJFA 1K96A 1XFRA 4M2QA 1G33A 4FQTA 5CSIA 4YGCB 4CFRA 5HYDA 3S0AA 2QEVA 1SBJA 5J3XA 1AJ5A 1V1FA 1KQMC 5I94A 3A4UB 2AUCA 1S1EA 2LMUA 4OVNF 1LINA 3EK4A 1DTLA 2WC5A 2E6WA 2EC6C 1DJIA 1NCYA 3CLNA 1C3YA 4Q04A 2WCMA 1MR8A 3EKJA 2WCEA 3LLEA 4ORBB 3DF0A 1CDLA 1NWDA 2CT9A 2JTZA 3BJHA 1OQPA 1SY9A 1JFKA 2BAPA 2Y5IA 3BUWB 3KHEA 1OZSA 2FOTA 2P70A 3LK1A 1DJYA 2M0RA 1BMOA 3OB1B 3L4AA 1J7PA 1CFPA 2M9GA 1AVSA 4C0KA 4YI8A 3SG5A 2Y1MA 4DUQA 1DF0A 1IG5A 1DVIA 1TN4A 1UURA 2K8MB 3I5HC 1DELA 3MSEB 1TNPA 1QATA 2NCPA 5D7FA 1B47A 3NHIA 1N65A 2M1UA 3OHMB 1XFZO 1LA0A 1TNXA 1MUXA 1RROA 4PHNA 3SG3A 1TCFA 4P5OE 3CWGA 1SL9A 3B86A 1C3ZA 1NX0A 4MRYA 3L4LA 1PULA 3NSLA 2BL0B 3LCPC 3NHTA 3B7AA 2PQLA 5HLOA 1NUBA 1YRUB 2FJYA 1F4QA 2MLFC 3I5GC 2ZNDA 2QPTA 2KFHA 2LNKA 3QMEA 4IJ7A 1DGVA 3OB2B 1CDPA 2QDIA 4N1GA 3D74A 3UNWA 4WRIA 2K7DA 1F4OA 4PCWA 1DQEA 2H61A 3DY9A 2KPHA 2LVVA 3E3RA 3O4XA 4NDCA 1CDNA 3K21A 3EVRA 1IQ3A 1B8CA 2LAPA 5ER5A 1IQ5A 3WHUB 1K9UA 2ZKMX 1MF8B 4L9MA 1AJ4A 4HRHA 2LCPA 3IVTA 2G2BA 3CZ2A 2BCAA 3EK8A 4PE7A 3D78A 3BFHA 4OR9B 3PFVA 3S0GA 3S0BA 1LXFC 1WRLA 3D0YB 3NSKA 2L50A 5FI6A 1DJZA 1U5IB 1L7ZA 1JF2A 5AEQA 3R1VA 3PSRA 4MZJA 1A03A 1KK8B 1L2OC 5DKRA 2LMVA 4GFTA 2BCBA 2ISDA 1K94A 3PATA 3CGAA 4JKTA 4AQIA 3O2PA 1TCOB 4JQ0D 2JZIA 3RZSA 2PRUA 3CR5X 3RLZA 1YX8A 3O4YA 4GGNA 1JBAA 3UO9A 1XK4C 1PVAA 3EKHA 1YVLA 3R1PA 1PK0D 4PALA 1KCYA 1YX7A 1Z2CB 3QRXA 5FI2A 1GJYA 1OMDA 2LVIA 1QLSA 3PM8A 2JULA 3M0WA 2R2IA 1SPYA 3DF0B 4USLA 1ZFSA 2M7NA 3I5IC 1DC1A 5CSNA 1B1GA 2WOSA
chains in the Genus database with same CATH topology
1DJWA 1WLMA 4ORAB 1BR1B 1NSHA 2VRGA 1CFCA 1JWDA 1AHRA 3GK2A 1SKTA 1J7RA 4I5LB 1EG3A 1MWNA 2JPTA 1EH2A 1SCVA 1Y6WA 1NX2A 1DF0B 4BY4A 1IGVA 2F3ZA 1DMOA 5PALA 5AFPA 1F55A 1QV0A 1CFDA 1FBVA 4HRGA 1KQMB 1XK4A 5K89A 1WDCC 4YRUA 4XYNA 2F8PA 1JUOA 1K8UA 2KGRA 4OCIA 3ZWHA 2EC6B 1CNPA 2BKHB 2BKIB 3VRRA 4A4CA 1J1EA 2L0PA 3BQ3A 5FYXA 3TS5C 4PDZA 2KI6C 2K2FA 2JXLA 2KI4C 3FWBA 1VRKA 1FW4A 2LUCA 2ZFDA 3VGOA 1CMGA 1CLLA 1YTZC 2NCOA 1B8RA 4FTGA 2P6BB 1XO5A 2PVBA 2FCEA 3SG6A 2SASA 4N5XA 2LV7A 4YI9A 3EK7A 3DVJA 2DOQA 1SCMC 1UHNA 3I5HB 1A2XA 4N1FA 1DJHA 3TZ1A 3BOWB 1SW8A 3HCMA 1NYAA 2OTGC 3NSIA 2KOTA 3BUMB 1NIWA 2GGZA 4MZLA 2BECA 2KNEA 1SMGA 2A4JA 4JPZB 2AMIA 1C7VA 1RFJA 2ZN8A 2EGDA 1BODA 1ZACA 1F54A 2KSPA 4ETOA 5JOLA 1B9AA 2LLUA 1XFXO 3H4SE 5F6TA 1YUUA 5I2OA 4GNKB 1K9KA 1F70A 1YR5A 1EJ3A 2JNFA 2FCDA 3CTNA 1F71A 1TNQA 1EG4A 5HKZA 4CIDA 1OZOA 4NDDA 2GV5A 1A4PA 3CZTX 1E8AA 1KK7Z 1YRTB 2TN4A 1BU3A 4FQOA 1FI6A 2JQ6A 1J7OA 2WC8A 1OSAA 4GAOA 2LANA 3JTDC 1IJ6A 1BOCA 2KHNA 1XYDA 1Y1XA 3PN7C 3BOWA 2KYCA 1XFUO 2K7CA 1NPQA 1N0YA 2PSRA 4OV2A 4PE1A 2OS8C 1OMRA 3OX5A 3JVTC 1JF0A 1KWOC 2OPOA 3D10A 1J55A 3FIAA 1QX5B 1L2OB 1A75A 1XFYO 2LE9B 2BL0C 4BY5A 2PASA 2KGBC 1YUSA 1KSMA 1IKUA 1Y0VH 4NQGA 4YGDB 3WXAA 1B7TZ 2KAVA 1S26D 1SR6B 3SG4A 1RWYA 4CLNA 4QJ3B 3I5FC 1S6CA 1CMFA 2L98A 2LUXA 1SK6D 3KPXA 1R6PA 1CDMA 1YUTA 1UHHA 2KDHA 1XFWO 2KBMA 2M29A 4IL1A 4PE0A 4F0ZB 5ER4X 3SIAA 1JC2A 2KAYA 2JTTA 3I5IB 5KSZA 2LHIA 1UP5A 2BE6A 1CB1A 2PALA 3LK0A 1DJXA 2MAZA 2LLTA 2G9BA 3SIBA 4PHMA 4GPLB 2M8UA 4D1EA 4ICBA 3VROA 5I8NA 1YURA 3AKAA 2NZ0A 2GGMA 1S36A 1FPWA 1W7JB 4MN0A 2JWWA 2MA2A 2ZRTA 5KTYA 4CPVA 1S3PA 1S5GZ 3BUXB 5I2QA 4OKHA 2MHHA 2KYFA 2LP2A 1WDCB 1QJTA 1ALVA 2K61A 4M2OA 4R1EA 5HLVA 4MBEA 4GGFC 1AP4A 1KQVA 4M2PA 1B4CA 1QXPA 1QX2A 2BBNA 4I5KA 3TS5B 1CM1A 1QASA 2KI4B 1LA3A 2Y1NA 2WCFA 3TUYC 4GBAA 2FJUB 1PSRA 4DRWA 2ZN9A 2JC2A 3OP0A 3TDIA 1K90D 3WNXB 2L5XB 3KF9A 3A8RA 3TDUA 1M39A 2WORA 4HSZA 1FF1A 2M1KB 3RM1A 4XJKB 3FWCA 4P2YB 2M3WA 3BYAA 3VRNA 1KK7Y 5B8IB 1C7WA 1SCMB 2CTNA 2M97A 1K93D 1ALWA 1AK8A 1OMVA 3SG7A 1GGWA 2I7AA 1IWQA 1X02A 1HQVA 3C1VA 4ZCUA 1KFUL 4DCKA 4A4BA 1HT9A 2OTGB 1QIWA 4GGFA 2IS9A 3WHTB 2HF5A 1UUSA 1Q80A 1QS7A 3OX6A 1PALA 1M63B 5HKYA 1TNWA 1KFUS 4UPGA 4U8DA 5KU1A 1BR4B 2D8NA 4I5NB 3CS1A 4PHJA 2KI6D 2LLSA 1DT7B 5IBWA 1EXRA 1AUIB 3GK1A 1JFJA 5HKWA 2LC5A 1B8LA 1B7TY 3BXKA 3NSOA 1A75B 2JT8A 2F2OA 3I5GB 1BF5A 3ZNIA 3FS7A 1EL4A 3PLFB 1NP8A 1TRFA 4GUKA 4PE4A 2HETA 1LVCD 2LHLA 2MJWB 1K9PA 1Y1AA 1PSBA 1OOJA 2JRFA 3DVEA 4QJ4B 2MBXA 1PVBA 1BG1A 1NX1A 2JNXA 3SJSA 2F3YA 4XJKA 4C0LA 4YBHB 3O6BA 1S6JA 2LMTA 1QVIZ 3JTDB 1D1OA 2LP3A 1NX3A 2KFFA 4E68A 1M31A 2MRDA 3HX4A 3PN7B 1SNLA 5CPVA 2H61C 3GK4X 5AXIA 4DIRA 4QJ5B 2OS8B 1BLQA 2BBMA 3JVTB 2HQ8A 2SCPA 1K95A 1KWOB 1WRKA 2LM5A 1MXEA 1SRAA 4ORCB 2K7OA 1S5GY 1OE9B 3KO0A 5CSFA 1TTXA 5DKQA 1QLKA 2KAXA 2M49B 3AAJA 4AQJA 1RK9A 3GOFA 2HPSA 2KFGA 2KQ6A 3BUOB 1J1DA 1MHOA 1PRWA 2NLNA 1N2DA 1NCZA 1ZMZA 2CXJA 1DGUA 2L51A 3LL8B 1CM4A 2JT0A 4YGBB 1G8IA 1LKJA 1XFVO 2H2KA 2O60A 3PALA 3I5FB 4WQ2A 1CLBA 1FI5A 2ZRSA 1CFFA 1A29A 1UWOA 1TOPA 1IH0A 3TDZA 1G4YR 1W7IB 2I18A 2M7LA 3ICBA 5G08A 5CSJA 3VRQA 1RTP1 3DD4A 1WRZA 2K7BA 3VRPA 1XVJA 2MLEC 1IJ5A 3CR2A 1KSOA 3IQQA 2E30A 1K2HA 5TNCA 2B1UA 5DKNA 1XA5A 2L4IA 4TNCA 1S6IA 2V53A 4WQ3A 1UHIA 2EHBA 3IF7A 2NXQA 2JT3A 2Q91A 1JSAA 2LVJA 1CKKA 1KFXL 2CNPA 2K2AA 1C07A 4MLWA 1WY9A 2RGIA 5AANA 3BUNB 1RECA 1SL7A 1ZUZA 5BPJA 2L4HA 1NCXA 2F2PA 2HQWA 4MSPA 1J7QA 4HREE 2KBIA 2PMYA 1M45A 4AOMA 1KFXS 2I2RE 2I94A 3EVVA 4I5JA 1WLZA 4MRXA 4PHKA 3DVKA 4MZKA 2JXCA 5GQQC 1CLMA 2JOJA 5JJGA 2WNDA 3DVMA 4NDBA 3TUYB 1SR6C 1F8HA 1DJGA 5I2LA 1SYMA 1KK8C 3IQOA 3O78A 4ZCVA 2KQYA 2COLB 4YGAA 1SL8A 1MXLC 2ZNEA 1UHKA 2JU0A 2WCBA 3AAKA 1GGZA 4YGEB 1BT6A 2L2EA 4JWQA 1UHJA 1IRJA 2O5GA 1R2UA 2CCMA 3NXAA 1Y1UA 1QVIY 1QIVA 1QTXA 2F33A 2LVKA 1M46A 3F45A 2Q4UA 1MQ1A 1YVHA 3EVUA 2QACA 3KEVA 2CBLA 3CR4X 1ODBA 3D0YA 3SG2A 4C0JA 4MVFA 1H8BA 5AERA 1RJVA 1U5IA 2Y4QA 2BCXA 1TIZA 1GQMA 1QV1A 1QX7A 4MEWA 2BE4A 5D69A 2K0JA 3AKBA 1CTRA 2AAOA 4DS7A 1ZOTB 4CFQA 1V1GA 1BJFA 1K96A 4M2QA 5CSIA 1G33A 4YGCB 4CFRA 5HYDA 1H4BA 1SBJA 5J3XA 1AJ5A 1V1FA 1KQMC 3A4UB 2AUCA 1S1EA 2LMUA 4OVNF 1LINA 3EK4A 1DTLA 2E6WA 2EC6C 1DJIA 1NCYA 3CLNA 4Q04A 1MR8A 3EKJA 2WCEA 3LLEA 4ORBB 3DF0A 1CDLA 1NWDA 2CT9A 2JTZA 3BUWB 1OQPA 1SY9A 1JFKA 2Y5IA 3KHEA 1OZSA 2FOTA 3LK1A 1DJYA 2M0RA 1BMOA 3OB1B 1J7PA 1CFPA 2M9GA 1AVSA 4C0KA 4YI8A 3SG5A 2Y1MA 4DUQA 1DF0A 1IG5A 1DVIA 1TN4A 1UURA 2K8MB 3I5HC 3MSEB 1TNPA 1QATA 2NCPA 5D7FA 1B47A 1N65A 2M1UA 3OHMB 1XFZO 1LA0A 1TNXA 1MUXA 1RROA 4PHNA 3SG3A 1TCFA 4P5OE 3CWGA 1SL9A 1NX0A 4MRYA 1PULA 3NSLA 2BL0B 3LCPC 5HLOA 1NUBA 1YRUB 1F4QA 2MLFC 3I5GC 2ZNDA 2QPTA 2KFHA 2LNKA 1DGVA 3OB2B 1CDPA 4N1GA 4WRIA 2K7DA 1F4OA 4PCWA 2H61A 3E3RA 2LVVA 4NDCA 1CDNA 3K21A 3EVRA 1IQ3A 1B8CA 2LAPA 5ER5A 1IQ5A 3WHUB 1K9UA 2ZKMX 1MF8B 4L9MA 1AJ4A 4HRHA 2LCPA 2G2BA 2BCAA 3EK8A 4PE7A 4OR9B 3PFVA 1LXFC 1WRLA 3D0YB 3NSKA 2L50A 1DJZA 1U5IB 1L7ZA 1JF2A 5AEQA 3PSRA 4MZJA 1A03A 1KK8B 1L2OC 5DKRA 2LMVA 4GFTA 2BCBA 2ISDA 1K94A 3PATA 3CGAA 4AQIA 3O2PA 1TCOB 4JQ0D 2JZIA 2PRUA 3CR5X 3RLZA 1YX8A 3O4YA 4GGNA 1JBAA 1PVAA 1XK4C 3EKHA 1YVLA 1PK0D 4PALA 1KCYA 1YX7A 3QRXA 1GJYA 1OMDA 2LVIA 1QLSA 3PM8A 2JULA 3M0WA 2R2IA 1SPYA 3DF0B 4USLA 1ZFSA 2M7NA 3I5IC 1B1GA 5CSNA 2WOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJW A;  1WLM A;  4ORA B;  1BR1 B;  1NSH A;  2VRG A;  1CFC A;  1JWD A;  1AHR A;  3GK2 A;  1SKT A;  1J7R A;  4I5L B;  1EG3 A;  1MWN A;  2JPT A;  1EH2 A;  1SCV A;  1Y6W A;  1NX2 A;  1DF0 B;  4BY4 A;  1IGV A;  2F3Z A;  1DMO A;  5PAL A;  5AFP A;  1F55 A;  1QV0 A;  1CFD A;  1FBV A;  4HRG A;  1KQM B;  1XK4 A;  5K89 A;  1WDC C;  4YRU A;  4XYN A;  2F8P A;  1JUO A;  1K8U A;  2KGR A;  4OCI A;  3ZWH A;  2EC6 B;  1CNP A;  2BKH B;  2BKI B;  3VRR A;  4A4C A;  1J1E A;  2L0P A;  3BQ3 A;  5FYX A;  3TS5 C;  4PDZ A;  2KI6 C;  2K2F A;  2JXL A;  2KI4 C;  3FWB A;  1VRK A;  1FW4 A;  2LUC A;  2ZFD A;  3VGO A;  1CMG A;  1CLL A;  1YTZ C;  2NCO A;  1B8R A;  4FTG A;  2P6B B;  1XO5 A;  2PVB A;  2FCE A;  3SG6 A;  2SAS A;  4N5X A;  2LV7 A;  4YI9 A;  3EK7 A;  3DVJ A;  2DOQ A;  1SCM C;  1UHN A;  3I5H B;  1A2X A;  4N1F A;  1DJH A;  3TZ1 A;  3BOW B;  1SW8 A;  3HCM A;  1NYA A;  2OTG C;  3NSI A;  2KOT A;  3BUM B;  1NIW A;  2GGZ A;  4MZL A;  2BEC A;  2KNE A;  1SMG A;  2A4J A;  4JPZ B;  2AMI A;  1C7V A;  1RFJ A;  2ZN8 A;  2EGD A;  1BOD A;  1ZAC A;  1F54 A;  2KSP A;  4ETO A;  5JOL A;  1B9A A;  2LLU A;  1XFX O;  3H4S E;  5F6T A;  1YUU A;  5I2O A;  4GNK B;  1K9K A;  1F70 A;  1YR5 A;  1EJ3 A;  2JNF A;  2FCD A;  3CTN A;  1F71 A;  1TNQ A;  1EG4 A;  5HKZ A;  4CID A;  1OZO A;  4NDD A;  2GV5 A;  1A4P A;  3CZT X;  1E8A A;  1KK7 Z;  1YRT B;  2TN4 A;  1BU3 A;  4FQO A;  1FI6 A;  2JQ6 A;  1J7O A;  2WC8 A;  1OSA A;  4GAO A;  2LAN A;  3JTD C;  1IJ6 A;  1BOC A;  2KHN A;  1XYD A;  1Y1X A;  3PN7 C;  3BOW A;  2KYC A;  1XFU O;  2K7C A;  1NPQ A;  1N0Y A;  2PSR A;  4OV2 A;  4PE1 A;  2OS8 C;  1OMR A;  3OX5 A;  3JVT C;  1JF0 A;  1KWO C;  2OPO A;  3D10 A;  1J55 A;  3FIA A;  1QX5 B;  1L2O B;  1A75 A;  1XFY O;  2LE9 B;  2BL0 C;  4BY5 A;  2PAS A;  2KGB C;  1YUS A;  1KSM A;  1IKU A;  1Y0V H;  4NQG A;  4YGD B;  3WXA A;  1B7T Z;  2KAV A;  1S26 D;  1SR6 B;  3SG4 A;  1RWY A;  4CLN A;  4QJ3 B;  3I5F C;  1S6C A;  1CMF A;  2L98 A;  2LUX A;  1SK6 D;  3KPX A;  1R6P A;  1CDM A;  1YUT A;  1UHH A;  2KDH A;  1XFW O;  2KBM A;  2M29 A;  4IL1 A;  4PE0 A;  4F0Z B;  5ER4 X;  3SIA A;  1JC2 A;  2KAY A;  2JTT A;  3I5I B;  5KSZ A;  2LHI A;  1UP5 A;  2BE6 A;  1CB1 A;  2PAL A;  3LK0 A;  1DJX A;  2MAZ A;  2LLT A;  2G9B A;  3SIB A;  4PHM A;  4GPL B;  2M8U A;  4D1E A;  4ICB A;  3VRO A;  5I8N A;  1YUR A;  3AKA A;  2NZ0 A;  2GGM A;  1S36 A;  1FPW A;  1W7J B;  4MN0 A;  2JWW A;  2MA2 A;  2ZRT A;  5KTY A;  4CPV A;  1S3P A;  1S5G Z;  3BUX B;  5I2Q A;  4OKH A;  2MHH A;  2KYF A;  2LP2 A;  1WDC B;  1QJT A;  1ALV A;  2K61 A;  4M2O A;  4R1E A;  5HLV A;  4MBE A;  4GGF C;  1AP4 A;  1KQV A;  4M2P A;  1B4C A;  1QXP A;  1QX2 A;  2BBN A;  4I5K A;  3TS5 B;  1CM1 A;  1QAS A;  2KI4 B;  1LA3 A;  2Y1N A;  2WCF A;  3TUY C;  4GBA A;  2FJU B;  1PSR A;  4DRW A;  2ZN9 A;  2JC2 A;  3OP0 A;  3TDI A;  1K90 D;  3WNX B;  2L5X B;  3KF9 A;  3A8R A;  3TDU A;  1M39 A;  2WOR A;  4HSZ A;  1FF1 A;  2M1K B;  3RM1 A;  4XJK B;  3FWC A;  4P2Y B;  2M3W A;  3BYA A;  3VRN A;  1KK7 Y;  5B8I B;  1C7W A;  1SCM B;  2CTN A;  2M97 A;  1K93 D;  1ALW A;  1AK8 A;  1OMV A;  3SG7 A;  1GGW A;  2I7A A;  1IWQ A;  1X02 A;  1HQV A;  3C1V A;  4ZCU A;  1KFU L;  4DCK A;  4A4B A;  1HT9 A;  2OTG B;  1QIW A;  4GGF A;  2IS9 A;  3WHT B;  2HF5 A;  1UUS A;  1Q80 A;  1QS7 A;  3OX6 A;  1PAL A;  1M63 B;  5HKY A;  1TNW A;  1KFU S;  4UPG A;  4U8D A;  5KU1 A;  1BR4 B;  2D8N A;  4I5N B;  3CS1 A;  4PHJ A;  2KI6 D;  2LLS A;  1DT7 B;  5IBW A;  1EXR A;  1AUI B;  3GK1 A;  1JFJ A;  5HKW A;  2LC5 A;  1B8L A;  1B7T Y;  3BXK A;  3NSO A;  1A75 B;  2JT8 A;  2F2O A;  3I5G B;  1BF5 A;  3ZNI A;  3FS7 A;  1EL4 A;  3PLF B;  1NP8 A;  1TRF A;  4GUK A;  4PE4 A;  2HET A;  1LVC D;  2LHL A;  2MJW B;  1K9P A;  1Y1A A;  1PSB A;  1OOJ A;  2JRF A;  3DVE A;  4QJ4 B;  2MBX A;  1PVB A;  1BG1 A;  1NX1 A;  2JNX A;  3SJS A;  2F3Y A;  4XJK A;  4C0L A;  4YBH B;  3O6B A;  1S6J A;  2LMT A;  1QVI Z;  3JTD B;  1D1O A;  2LP3 A;  1NX3 A;  2KFF A;  4E68 A;  1M31 A;  2MRD A;  3HX4 A;  3PN7 B;  1SNL A;  5CPV A;  2H61 C;  3GK4 X;  5AXI A;  4DIR A;  4QJ5 B;  2OS8 B;  1BLQ A;  2BBM A;  3JVT B;  2HQ8 A;  2SCP A;  1K95 A;  1KWO B;  1WRK A;  2LM5 A;  1MXE A;  1SRA A;  4ORC B;  2K7O A;  1S5G Y;  1OE9 B;  3KO0 A;  5CSF A;  1TTX A;  5DKQ A;  1QLK A;  2KAX A;  2M49 B;  3AAJ A;  4AQJ A;  1RK9 A;  3GOF A;  2HPS A;  2KFG A;  2KQ6 A;  3BUO B;  1J1D A;  1MHO A;  1PRW A;  2NLN A;  1N2D A;  1NCZ A;  1ZMZ A;  2CXJ A;  1DGU A;  2L51 A;  3LL8 B;  1CM4 A;  2JT0 A;  4YGB B;  1G8I A;  1LKJ A;  1XFV O;  2H2K A;  2O60 A;  3PAL A;  3I5F B;  4WQ2 A;  1CLB A;  1FI5 A;  2ZRS A;  1CFF A;  1A29 A;  1UWO A;  1TOP A;  1IH0 A;  3TDZ A;  1G4Y R;  1W7I B;  2I18 A;  2M7L A;  3ICB A;  5G08 A;  5CSJ A;  3VRQ A;  1RTP 1;  3DD4 A;  1WRZ A;  2K7B A;  3VRP A;  1XVJ A;  2MLE C;  1IJ5 A;  3CR2 A;  1KSO A;  3IQQ A;  2E30 A;  1K2H A;  5TNC A;  2B1U A;  5DKN A;  1XA5 A;  2L4I A;  4TNC A;  1S6I A;  2V53 A;  4WQ3 A;  1UHI A;  2EHB A;  3IF7 A;  2NXQ A;  2JT3 A;  2Q91 A;  1JSA A;  2LVJ A;  1CKK A;  1KFX L;  2CNP A;  2K2A A;  1C07 A;  4MLW A;  1WY9 A;  2RGI A;  5AAN A;  3BUN B;  1REC A;  1SL7 A;  1ZUZ A;  5BPJ A;  2L4H A;  1NCX A;  2F2P A;  2HQW A;  4MSP A;  1J7Q A;  4HRE E;  2KBI A;  2PMY A;  1M45 A;  4AOM A;  1KFX S;  2I2R E;  2I94 A;  3EVV A;  4I5J A;  1WLZ A;  4MRX A;  4PHK A;  3DVK A;  4MZK A;  2JXC A;  5GQQ C;  1CLM A;  2JOJ A;  5JJG A;  2WND A;  3DVM A;  4NDB A;  3TUY B;  1SR6 C;  1F8H A;  1DJG A;  5I2L A;  1SYM A;  1KK8 C;  3IQO A;  3O78 A;  4ZCV A;  2KQY A;  2COL B;  4YGA A;  1SL8 A;  1MXL C;  2ZNE A;  1UHK A;  2JU0 A;  2WCB A;  3AAK A;  1GGZ A;  4YGE B;  1BT6 A;  2L2E A;  4JWQ A;  1UHJ A;  1IRJ A;  2O5G A;  1R2U A;  2CCM A;  3NXA A;  1Y1U A;  1QVI Y;  1QIV A;  1QTX A;  2F33 A;  2LVK A;  1M46 A;  3F45 A;  2Q4U A;  1MQ1 A;  1YVH A;  3EVU A;  2QAC A;  3KEV A;  2CBL A;  3CR4 X;  1ODB A;  3D0Y A;  3SG2 A;  4C0J A;  4MVF A;  1H8B A;  5AER A;  1RJV A;  1U5I A;  2Y4Q A;  2BCX A;  1TIZ A;  1GQM A;  1QV1 A;  1QX7 A;  4MEW A;  2BE4 A;  5D69 A;  2K0J A;  3AKB A;  1CTR A;  2AAO A;  4DS7 A;  1ZOT B;  4CFQ A;  1V1G A;  1BJF A;  1K96 A;  4M2Q A;  5CSI A;  1G33 A;  4YGC B;  4CFR A;  5HYD A;  1H4B A;  1SBJ A;  5J3X A;  1AJ5 A;  1V1F A;  1KQM C;  3A4U B;  2AUC A;  1S1E A;  2LMU A;  4OVN F;  1LIN A;  3EK4 A;  1DTL A;  2E6W A;  2EC6 C;  1DJI A;  1NCY A;  3CLN A;  4Q04 A;  1MR8 A;  3EKJ A;  2WCE A;  3LLE A;  4ORB B;  3DF0 A;  1CDL A;  1NWD A;  2CT9 A;  2JTZ A;  3BUW B;  1OQP A;  1SY9 A;  1JFK A;  2Y5I A;  3KHE A;  1OZS A;  2FOT A;  3LK1 A;  1DJY A;  2M0R A;  1BMO A;  3OB1 B;  1J7P A;  1CFP A;  2M9G A;  1AVS A;  4C0K A;  4YI8 A;  3SG5 A;  2Y1M A;  4DUQ A;  1DF0 A;  1IG5 A;  1DVI A;  1TN4 A;  1UUR A;  2K8M B;  3I5H C;  3MSE B;  1TNP A;  1QAT A;  2NCP A;  5D7F A;  1B47 A;  1N65 A;  2M1U A;  3OHM B;  1XFZ O;  1LA0 A;  1TNX A;  1MUX A;  1RRO A;  4PHN A;  3SG3 A;  1TCF A;  4P5O E;  3CWG A;  1SL9 A;  1NX0 A;  4MRY A;  1PUL A;  3NSL A;  2BL0 B;  3LCP C;  5HLO A;  1NUB A;  1YRU B;  1F4Q A;  2MLF C;  3I5G C;  2ZND A;  2QPT A;  2KFH A;  2LNK A;  1DGV A;  3OB2 B;  1CDP A;  4N1G A;  4WRI A;  2K7D A;  1F4O A;  4PCW A;  2H61 A;  3E3R A;  2LVV A;  4NDC A;  1CDN A;  3K21 A;  3EVR A;  1IQ3 A;  1B8C A;  2LAP A;  5ER5 A;  1IQ5 A;  3WHU B;  1K9U A;  2ZKM X;  1MF8 B;  4L9M A;  1AJ4 A;  4HRH A;  2LCP A;  2G2B A;  2BCA A;  3EK8 A;  4PE7 A;  4OR9 B;  3PFV A;  1LXF C;  1WRL A;  3D0Y B;  3NSK A;  2L50 A;  1DJZ A;  1U5I B;  1L7Z A;  1JF2 A;  5AEQ A;  3PSR A;  4MZJ A;  1A03 A;  1KK8 B;  1L2O C;  5DKR A;  2LMV A;  4GFT A;  2BCB A;  2ISD A;  1K94 A;  3PAT A;  3CGA A;  4AQI A;  3O2P A;  1TCO B;  4JQ0 D;  2JZI A;  2PRU A;  3CR5 X;  3RLZ A;  1YX8 A;  3O4Y A;  4GGN A;  1JBA A;  1PVA A;  1XK4 C;  3EKH A;  1YVL A;  1PK0 D;  4PAL A;  1KCY A;  1YX7 A;  3QRX A;  1GJY A;  1OMD A;  2LVI A;  1QLS A;  3PM8 A;  2JUL A;  3M0W A;  2R2I A;  1SPY A;  3DF0 B;  4USL A;  1ZFS A;  2M7N A;  3I5I C;  1B1G A;  5CSN A;  2WOS A; 
#chains in the Genus database with same CATH topology
 1DJW A;  1WLM A;  4ORA B;  1BR1 B;  1NSH A;  2VRG A;  1CFC A;  1JWD A;  1AHR A;  3GK2 A;  1SKT A;  1J7R A;  4I5L B;  1EG3 A;  1MWN A;  2JPT A;  1EH2 A;  1SCV A;  1Y6W A;  1NX2 A;  1DF0 B;  4BY4 A;  1IGV A;  2F3Z A;  1DMO A;  5PAL A;  5AFP A;  1F55 A;  3BFB A;  1QV0 A;  1OOF A;  1CFD A;  1FBV A;  4HRG A;  1KQM B;  1XK4 A;  5K89 A;  1WDC C;  4YRU A;  4XYN A;  2F8P A;  1JUO A;  1K8U A;  2KGR A;  3B6X A;  4OCI A;  3ZWH A;  2EC6 B;  1CNP A;  3D77 A;  2BKH B;  2BKI B;  3VRR A;  4A4C A;  1J1E A;  2L0P A;  3BQ3 A;  5FYX A;  3TS5 C;  4PDZ A;  2KI6 C;  2K2F A;  2JXL A;  2KI4 C;  3FWB A;  1VRK A;  1FW4 A;  2LUC A;  2ZFD A;  3VGO A;  3V2L A;  1CMG A;  1CLL A;  1YTZ C;  2NCO A;  1B8R A;  4FTG A;  2P6B B;  1XO5 A;  2PVB A;  2QEO A;  2FCE A;  3SG6 A;  2SAS A;  4N5X A;  2LV7 A;  4YI9 A;  3EK7 A;  3DVJ A;  2DOQ A;  1SCM C;  1UHN A;  3I5H B;  1A2X A;  4N1F A;  1DJH A;  3TZ1 A;  3BOW B;  1SW8 A;  3HCM A;  1NYA A;  2OTG C;  3NSI A;  2KOT A;  2GTE A;  3BUM B;  1NIW A;  2GGZ A;  4MZL A;  2BEC A;  2KNE A;  2L2C A;  1SMG A;  5HL1 A;  2A4J A;  4JPZ B;  3SS5 A;  2AMI A;  1C7V A;  1RFJ A;  2ZN8 A;  2EGD A;  1BOD A;  1ZAC A;  1F54 A;  3S0F A;  2KSP A;  4ETO A;  5JOL A;  3N7H A;  1B9A A;  2LLU A;  1XFX O;  2KLE A;  3H4S E;  5F6T A;  1YUU A;  5I2O A;  4GNK B;  1K9K A;  1F70 A;  1YR5 A;  1EJ3 A;  2JNF A;  2FCD A;  3CTN A;  1F71 A;  3SS3 A;  3D75 A;  1TNQ A;  1EG4 A;  5HKZ A;  4CID A;  3D76 A;  1OZO A;  4NDD A;  2GV5 A;  1A4P A;  3CZT X;  3CDN A;  1E8A A;  1KK7 Z;  1YRT B;  2TN4 A;  1BU3 A;  4FQO A;  1FI6 A;  2JQ6 A;  1J7O A;  2WC8 A;  1OSA A;  4GAO A;  2LAN A;  3DYE A;  3JTD C;  1IJ6 A;  1BOC A;  2KHN A;  1XYD A;  1Y1X A;  3PN7 C;  3BOW A;  2KYC A;  1H4B A;  1XFU O;  2K7C A;  1NPQ A;  1N0Y A;  2PSR A;  4INW A;  4OV2 A;  4PE1 A;  1P28 A;  1SSE B;  2OS8 C;  1OMR A;  3OX5 A;  3JVT C;  1JF0 A;  1KWO C;  2OPO A;  3D10 A;  1J55 A;  3FIA A;  1QX5 B;  1L2O B;  1A75 A;  1XFY O;  2LE9 B;  2BL0 C;  4BY5 A;  2PAS A;  2BNX A;  1YUS A;  2KGB C;  1KSM A;  1IKU A;  1Y0V H;  4NQG A;  4YGD B;  3WXA A;  1B7T Z;  1TUZ A;  2KAV A;  1S26 D;  1SR6 B;  1Z4H A;  3SG4 A;  1RWY A;  4CLN A;  4QJ3 B;  3B87 A;  1S6C A;  3I5F C;  2L98 A;  1CMF A;  2LUX A;  1SK6 D;  3KPX A;  1R6P A;  1CDM A;  1YUT A;  1UHH A;  1DEK A;  2KDH A;  1XFW O;  2KBM A;  2M29 A;  4IL1 A;  4PE0 A;  4F0Z B;  5ER4 X;  3SIA A;  1JC2 A;  2KAY A;  1GM0 A;  2JTT A;  3I5I B;  5KSZ A;  3S0D A;  2LHI A;  3OGN A;  3S0E A;  1UP5 A;  2BE6 A;  1CB1 A;  2PAL A;  3LK0 A;  1OOI X;  1DJX A;  2MAZ A;  2LLT A;  2G9B A;  3SIB A;  4PHM A;  4GPL B;  2M8U A;  4D1E A;  1W9Z A;  4ICB A;  3VRO A;  5I8N A;  3NGV A;  1YUR A;  3AKA A;  2NZ0 A;  2GGM A;  1S36 A;  4INX A;  1FPW A;  1W7J B;  3B88 A;  4MN0 A;  2JWW A;  2MA2 A;  2ZRT A;  5KTY A;  3SS4 A;  1S3P A;  1S5G Z;  3BUX B;  4CPV A;  4OKH A;  2MHH A;  2KYF A;  2LP2 A;  5I2Q A;  1WDC B;  1QJT A;  1ALV A;  2K61 A;  3CZ1 A;  4M2O A;  4R1E A;  5HLV A;  2JPO A;  4MBE A;  4GGF C;  1AP4 A;  1KQV A;  1T14 A;  4M2P A;  1QXP A;  2QEH A;  1QX2 A;  3FE9 A;  1B4C A;  1OW4 A;  2BBN A;  4I5K A;  3TS5 B;  1CM1 A;  1QAS A;  2KI4 B;  1LA3 A;  2Y1N A;  2WCF A;  3TUY C;  3R1O A;  3L47 A;  2PYQ A;  2FJU B;  1PSR A;  4GBA A;  4DRW A;  2ZN9 A;  2JC2 A;  3OP0 A;  3TDI A;  1K90 D;  3WNX B;  2L5X B;  3KF9 A;  3A8R A;  3TDU A;  1M39 A;  2WOR A;  4HSZ A;  1FF1 A;  2M1K B;  3RM1 A;  4XJK B;  3FWC A;  2WC6 A;  1OOH A;  2M3W A;  3BYA A;  4P2Y B;  3VRN A;  1KK7 Y;  5B8I B;  1C7W A;  1SCM B;  2CTN A;  2M97 A;  1K93 D;  1ALW A;  1AK8 A;  1OMV A;  3SG7 A;  3DZT A;  1GGW A;  2I7A A;  1IWQ A;  1X02 A;  1HQV A;  3C1V A;  4ZCU A;  1KFU L;  4DCK A;  4A4B A;  1HT9 A;  2OTG B;  1QIW A;  4GGF A;  2IS9 A;  3WHT B;  2HF5 A;  3EG5 B;  1UUS A;  1Q80 A;  1QS7 A;  3OX6 A;  3VB1 A;  1PAL A;  1M63 B;  5HKY A;  1TNW A;  1KFU S;  3CZ0 A;  4U8D A;  4UPG A;  5KU1 A;  1BR4 B;  2D8N A;  4I5N B;  3CS1 A;  4PHJ A;  2KI6 D;  2LLS A;  1DT7 B;  5IBW A;  1EXR A;  1AUI B;  3GK1 A;  1JFJ A;  5HKW A;  2LC5 A;  1B8L A;  1B7T Y;  2KLD A;  3BXK A;  3NSO A;  1A75 B;  2JT8 A;  2F2O A;  2WCL A;  3I5G B;  1BF5 A;  3ZNI A;  1OOG A;  1EL4 A;  3FS7 A;  2P71 A;  3PLF B;  1NP8 A;  1TRF A;  4GUK A;  4PE4 A;  2HET A;  1LVC D;  2LHL A;  2MJW B;  1K9P A;  1Y1A A;  4KYN A;  1PSB A;  1OOJ A;  2JRF A;  3DVE A;  4QJ4 B;  2MBX A;  1PVB A;  1BG1 A;  1NX1 A;  2JNX A;  3SJS A;  2F3Y A;  4XJK A;  4C0L A;  4YBH B;  3O6B A;  1S6J A;  2LMT A;  1QVI Z;  3JTD B;  1D1O A;  2LP3 A;  1NX3 A;  2KFF A;  4E68 A;  1M31 A;  2MRD A;  3HX4 A;  3PN7 B;  1SNL A;  4F7F A;  5CPV A;  2H61 C;  3GK4 X;  5AXI A;  3BFA A;  4DIR A;  4QJ5 B;  2OS8 B;  3OBV A;  1BLQ A;  2BBM A;  3JVT B;  2HQ8 A;  3DXL A;  2SCP A;  1K95 A;  1KWO B;  1WRK A;  2LM5 A;  1MXE A;  1SRA A;  4ORC B;  2K7O A;  3CAB A;  1S5G Y;  1OE9 B;  3KO0 A;  5CSF A;  5EL2 A;  1TTX A;  5DKQ A;  1QLK A;  2KAX A;  2M49 B;  3AAJ A;  4AQJ A;  1RK9 A;  3GOF A;  2HPS A;  2KFG A;  2KQ6 A;  3BUO B;  1J1D A;  1MHO A;  1PRW A;  2NLN A;  1N2D A;  1NCZ A;  1ZMZ A;  1LS8 A;  1DGU A;  2CXJ A;  2L51 A;  3LL8 B;  1CM4 A;  2JT0 A;  1TWO A;  4YGB B;  1G8I A;  1LKJ A;  1XFV O;  2H2K A;  2O60 A;  3PAL A;  3I5F B;  4WQ2 A;  1CLB A;  1FI5 A;  3PJI A;  2ZRS A;  3FE8 A;  1CFF A;  1A29 A;  1UWO A;  1TOP A;  1IH0 A;  3TDZ A;  1G4Y R;  1W7I B;  2I18 A;  2M7L A;  3ICB A;  5G08 A;  5CSJ A;  2WCH A;  3VRQ A;  1RTP 1;  2H8V A;  1WRZ A;  3DD4 A;  2K7B A;  3VRP A;  1XVJ A;  2MLE C;  1IJ5 A;  3CR2 A;  1KSO A;  3IQQ A;  2E30 A;  1K2H A;  5D3O A;  2B1U A;  5TNC A;  5DKN A;  3CYZ A;  1XA5 A;  2L4I A;  4TNC A;  1S6I A;  2V53 A;  4WQ3 A;  1UHI A;  5DIC A;  2EHB A;  3IF7 A;  2NXQ A;  2JT3 A;  2L5Y A;  2Q91 A;  1JSA A;  2LVJ A;  1CKK A;  1KFX L;  2CNP A;  2K2A A;  1C07 A;  4MLW A;  1WY9 A;  2RGI A;  1TUJ A;  3K1E A;  5AAN A;  3BUN B;  1REC A;  1SL7 A;  1ZUZ A;  5BPJ A;  2L4H A;  1NCX A;  2F2P A;  3R72 A;  2HQW A;  4MSP A;  1J7Q A;  4HRE E;  2KBI A;  2PMY A;  1M45 A;  4AOM A;  1KFX S;  2I2R E;  2I94 A;  3EVV A;  4I5J A;  1WLZ A;  4MRX A;  4PHK A;  3DVK A;  4MZK A;  2JXC A;  5GQQ C;  1CLM A;  2JOJ A;  2WCJ A;  2WND A;  3DVM A;  4NDB A;  3TUY B;  1SR6 C;  5JJG A;  1F8H A;  1DJG A;  1ORG A;  1SYM A;  1KK8 C;  3IQO A;  5I2L A;  2WCK A;  3O78 A;  2K60 A;  1QWV A;  4ZCV A;  2KQY A;  2COL B;  4YGA A;  1SL8 A;  1MXL C;  3FE6 A;  2ZNE A;  1UHK A;  2JU0 A;  2WCB A;  3AAK A;  2YGU A;  3Q8I A;  1GGZ A;  4YGE B;  1BT6 A;  2L2E A;  4JWQ A;  1UHJ A;  1IRJ A;  2O5G A;  1R2U A;  2CCM A;  3NXA A;  1Y1U A;  1QVI Y;  4PT1 A;  1QIV A;  1IIO A;  1QTX A;  2F33 A;  2LVK A;  1M46 A;  3F45 A;  2ERB A;  2Q4U A;  1MQ1 A;  1YVH A;  3EVU A;  2QAC A;  2QEB A;  4OZD A;  3KEV A;  2CBL A;  3CR4 X;  1ODB A;  3D0Y A;  4JD9 A;  3SG2 A;  4C0J A;  4MVF A;  1H8B A;  5AER A;  1RJV A;  1U5I A;  5FI7 A;  2Y4Q A;  3D73 A;  2BCX A;  1TIZ A;  1GQM A;  1QV1 A;  1QX7 A;  3PM2 A;  2BE4 A;  4MEW A;  5D69 A;  2K0J A;  3AKB A;  1CTR A;  2AAO A;  4DS7 A;  1ZOT B;  4CFQ A;  1V1G A;  1BJF A;  1K96 A;  1XFR A;  4M2Q A;  1G33 A;  4FQT A;  5CSI A;  4YGC B;  4CFR A;  5HYD A;  3S0A A;  2QEV A;  1SBJ A;  5J3X A;  1AJ5 A;  1V1F A;  1KQM C;  5I94 A;  3A4U B;  2AUC A;  1S1E A;  2LMU A;  4OVN F;  1LIN A;  3EK4 A;  1DTL A;  2WC5 A;  2E6W A;  2EC6 C;  1DJI A;  1NCY A;  3CLN A;  1C3Y A;  4Q04 A;  2WCM A;  1MR8 A;  3EKJ A;  2WCE A;  3LLE A;  4ORB B;  3DF0 A;  1CDL A;  1NWD A;  2CT9 A;  2JTZ A;  3BJH A;  1OQP A;  1SY9 A;  1JFK A;  2BAP A;  2Y5I A;  3BUW B;  3KHE A;  1OZS A;  2FOT A;  2P70 A;  3LK1 A;  1DJY A;  2M0R A;  1BMO A;  3OB1 B;  3L4A A;  1J7P A;  1CFP A;  2M9G A;  1AVS A;  4C0K A;  4YI8 A;  3SG5 A;  2Y1M A;  4DUQ A;  1DF0 A;  1IG5 A;  1DVI A;  1TN4 A;  1UUR A;  2K8M B;  3I5H C;  1DEL A;  3MSE B;  1TNP A;  1QAT A;  2NCP A;  5D7F A;  1B47 A;  3NHI A;  1N65 A;  2M1U A;  3OHM B;  1XFZ O;  1LA0 A;  1TNX A;  1MUX A;  1RRO A;  4PHN A;  3SG3 A;  1TCF A;  4P5O E;  3CWG A;  1SL9 A;  3B86 A;  1C3Z A;  1NX0 A;  4MRY A;  3L4L A;  1PUL A;  3NSL A;  2BL0 B;  3LCP C;  3NHT A;  3B7A A;  2PQL A;  5HLO A;  1NUB A;  1YRU B;  2FJY A;  1F4Q A;  2MLF C;  3I5G C;  2ZND A;  2QPT A;  2KFH A;  2LNK A;  3QME A;  4IJ7 A;  1DGV A;  3OB2 B;  1CDP A;  2QDI A;  4N1G A;  3D74 A;  3UNW A;  4WRI A;  2K7D A;  1F4O A;  4PCW A;  1DQE A;  2H61 A;  3DY9 A;  2KPH A;  2LVV A;  3E3R A;  3O4X A;  4NDC A;  1CDN A;  3K21 A;  3EVR A;  1IQ3 A;  1B8C A;  2LAP A;  5ER5 A;  1IQ5 A;  3WHU B;  1K9U A;  2ZKM X;  1MF8 B;  4L9M A;  1AJ4 A;  4HRH A;  2LCP A;  3IVT A;  2G2B A;  3CZ2 A;  2BCA A;  3EK8 A;  4PE7 A;  3D78 A;  3BFH A;  4OR9 B;  3PFV A;  3S0G A;  3S0B A;  1LXF C;  1WRL A;  3D0Y B;  3NSK A;  2L50 A;  5FI6 A;  1DJZ A;  1U5I B;  1L7Z A;  1JF2 A;  5AEQ A;  3R1V A;  3PSR A;  4MZJ A;  1A03 A;  1KK8 B;  1L2O C;  5DKR A;  2LMV A;  4GFT A;  2BCB A;  2ISD A;  1K94 A;  3PAT A;  3CGA A;  4JKT A;  4AQI A;  3O2P A;  1TCO B;  4JQ0 D;  2JZI A;  3RZS A;  2PRU A;  3CR5 X;  3RLZ A;  1YX8 A;  3O4Y A;  4GGN A;  1JBA A;  3UO9 A;  1XK4 C;  1PVA A;  3EKH A;  1YVL A;  3R1P A;  1PK0 D;  4PAL A;  1KCY A;  1YX7 A;  1Z2C B;  3QRX A;  5FI2 A;  1GJY A;  1OMD A;  2LVI A;  1QLS A;  3PM8 A;  2JUL A;  3M0W A;  2R2I A;  1SPY A;  3DF0 B;  4USL A;  1ZFS A;  2M7N A;  3I5I C;  1DC1 A;  5CSN A;  1B1G A;  2WOS A; 
#chains in the Genus database with same CATH homology
 1DJW A;  1WLM A;  4ORA B;  1BR1 B;  1NSH A;  2VRG A;  1CFC A;  1JWD A;  1AHR A;  3GK2 A;  1SKT A;  1J7R A;  4I5L B;  1EG3 A;  1MWN A;  2JPT A;  1EH2 A;  1SCV A;  1Y6W A;  1NX2 A;  1DF0 B;  4BY4 A;  1IGV A;  2F3Z A;  1DMO A;  5PAL A;  5AFP A;  1F55 A;  1QV0 A;  1CFD A;  1FBV A;  4HRG A;  1KQM B;  1XK4 A;  5K89 A;  1WDC C;  4YRU A;  4XYN A;  2F8P A;  1JUO A;  1K8U A;  2KGR A;  4OCI A;  3ZWH A;  2EC6 B;  1CNP A;  2BKH B;  2BKI B;  3VRR A;  4A4C A;  1J1E A;  2L0P A;  3BQ3 A;  5FYX A;  3TS5 C;  4PDZ A;  2KI6 C;  2K2F A;  2JXL A;  2KI4 C;  3FWB A;  1VRK A;  1FW4 A;  2LUC A;  2ZFD A;  3VGO A;  1CMG A;  1CLL A;  1YTZ C;  2NCO A;  1B8R A;  4FTG A;  2P6B B;  1XO5 A;  2PVB A;  2FCE A;  3SG6 A;  2SAS A;  4N5X A;  2LV7 A;  4YI9 A;  3EK7 A;  3DVJ A;  2DOQ A;  1SCM C;  1UHN A;  3I5H B;  1A2X A;  4N1F A;  1DJH A;  3TZ1 A;  3BOW B;  1SW8 A;  3HCM A;  1NYA A;  2OTG C;  3NSI A;  2KOT A;  3BUM B;  1NIW A;  2GGZ A;  4MZL A;  2BEC A;  2KNE A;  1SMG A;  2A4J A;  4JPZ B;  2AMI A;  1C7V A;  1RFJ A;  2ZN8 A;  2EGD A;  1BOD A;  1ZAC A;  1F54 A;  2KSP A;  4ETO A;  5JOL A;  1B9A A;  2LLU A;  1XFX O;  3H4S E;  5F6T A;  1YUU A;  5I2O A;  4GNK B;  1K9K A;  1F70 A;  1YR5 A;  1EJ3 A;  2JNF A;  2FCD A;  3CTN A;  1F71 A;  1TNQ A;  1EG4 A;  5HKZ A;  4CID A;  1OZO A;  4NDD A;  2GV5 A;  1A4P A;  3CZT X;  1E8A A;  1KK7 Z;  1YRT B;  2TN4 A;  1BU3 A;  4FQO A;  1FI6 A;  2JQ6 A;  1J7O A;  2WC8 A;  1OSA A;  4GAO A;  2LAN A;  3JTD C;  1IJ6 A;  1BOC A;  2KHN A;  1XYD A;  1Y1X A;  3PN7 C;  3BOW A;  2KYC A;  1XFU O;  2K7C A;  1NPQ A;  1N0Y A;  2PSR A;  4OV2 A;  4PE1 A;  2OS8 C;  1OMR A;  3OX5 A;  3JVT C;  1JF0 A;  1KWO C;  2OPO A;  3D10 A;  1J55 A;  3FIA A;  1QX5 B;  1L2O B;  1A75 A;  1XFY O;  2LE9 B;  2BL0 C;  4BY5 A;  2PAS A;  2KGB C;  1YUS A;  1KSM A;  1IKU A;  1Y0V H;  4NQG A;  4YGD B;  3WXA A;  1B7T Z;  2KAV A;  1S26 D;  1SR6 B;  3SG4 A;  1RWY A;  4CLN A;  4QJ3 B;  3I5F C;  1S6C A;  1CMF A;  2L98 A;  2LUX A;  1SK6 D;  3KPX A;  1R6P A;  1CDM A;  1YUT A;  1UHH A;  2KDH A;  1XFW O;  2KBM A;  2M29 A;  4IL1 A;  4PE0 A;  4F0Z B;  5ER4 X;  3SIA A;  1JC2 A;  2KAY A;  2JTT A;  3I5I B;  5KSZ A;  2LHI A;  1UP5 A;  2BE6 A;  1CB1 A;  2PAL A;  3LK0 A;  1DJX A;  2MAZ A;  2LLT A;  2G9B A;  3SIB A;  4PHM A;  4GPL B;  2M8U A;  4D1E A;  4ICB A;  3VRO A;  5I8N A;  1YUR A;  3AKA A;  2NZ0 A;  2GGM A;  1S36 A;  1FPW A;  1W7J B;  4MN0 A;  2JWW A;  2MA2 A;  2ZRT A;  5KTY A;  4CPV A;  1S3P A;  1S5G Z;  3BUX B;  5I2Q A;  4OKH A;  2MHH A;  2KYF A;  2LP2 A;  1WDC B;  1QJT A;  1ALV A;  2K61 A;  4M2O A;  4R1E A;  5HLV A;  4MBE A;  4GGF C;  1AP4 A;  1KQV A;  4M2P A;  1B4C A;  1QXP A;  1QX2 A;  2BBN A;  4I5K A;  3TS5 B;  1CM1 A;  1QAS A;  2KI4 B;  1LA3 A;  2Y1N A;  2WCF A;  3TUY C;  4GBA A;  2FJU B;  1PSR A;  4DRW A;  2ZN9 A;  2JC2 A;  3OP0 A;  3TDI A;  1K90 D;  3WNX B;  2L5X B;  3KF9 A;  3A8R A;  3TDU A;  1M39 A;  2WOR A;  4HSZ A;  1FF1 A;  2M1K B;  3RM1 A;  4XJK B;  3FWC A;  4P2Y B;  2M3W A;  3BYA A;  3VRN A;  1KK7 Y;  5B8I B;  1C7W A;  1SCM B;  2CTN A;  2M97 A;  1K93 D;  1ALW A;  1AK8 A;  1OMV A;  3SG7 A;  1GGW A;  2I7A A;  1IWQ A;  1X02 A;  1HQV A;  3C1V A;  4ZCU A;  1KFU L;  4DCK A;  4A4B A;  1HT9 A;  2OTG B;  1QIW A;  4GGF A;  2IS9 A;  3WHT B;  2HF5 A;  1UUS A;  1Q80 A;  1QS7 A;  3OX6 A;  1PAL A;  1M63 B;  5HKY A;  1TNW A;  1KFU S;  4UPG A;  4U8D A;  5KU1 A;  1BR4 B;  2D8N A;  4I5N B;  3CS1 A;  4PHJ A;  2KI6 D;  2LLS A;  1DT7 B;  5IBW A;  1EXR A;  1AUI B;  3GK1 A;  1JFJ A;  5HKW A;  2LC5 A;  1B8L A;  1B7T Y;  3BXK A;  3NSO A;  1A75 B;  2JT8 A;  2F2O A;  3I5G B;  1BF5 A;  3ZNI A;  3FS7 A;  1EL4 A;  3PLF B;  1NP8 A;  1TRF A;  4GUK A;  4PE4 A;  2HET A;  1LVC D;  2LHL A;  2MJW B;  1K9P A;  1Y1A A;  1PSB A;  1OOJ A;  2JRF A;  3DVE A;  4QJ4 B;  2MBX A;  1PVB A;  1BG1 A;  1NX1 A;  2JNX A;  3SJS A;  2F3Y A;  4XJK A;  4C0L A;  4YBH B;  3O6B A;  1S6J A;  2LMT A;  1QVI Z;  3JTD B;  1D1O A;  2LP3 A;  1NX3 A;  2KFF A;  4E68 A;  1M31 A;  2MRD A;  3HX4 A;  3PN7 B;  1SNL A;  5CPV A;  2H61 C;  3GK4 X;  5AXI A;  4DIR A;  4QJ5 B;  2OS8 B;  1BLQ A;  2BBM A;  3JVT B;  2HQ8 A;  2SCP A;  1K95 A;  1KWO B;  1WRK A;  2LM5 A;  1MXE A;  1SRA A;  4ORC B;  2K7O A;  1S5G Y;  1OE9 B;  3KO0 A;  5CSF A;  1TTX A;  5DKQ A;  1QLK A;  2KAX A;  2M49 B;  3AAJ A;  4AQJ A;  1RK9 A;  3GOF A;  2HPS A;  2KFG A;  2KQ6 A;  3BUO B;  1J1D A;  1MHO A;  1PRW A;  2NLN A;  1N2D A;  1NCZ A;  1ZMZ A;  2CXJ A;  1DGU A;  2L51 A;  3LL8 B;  1CM4 A;  2JT0 A;  4YGB B;  1G8I A;  1LKJ A;  1XFV O;  2H2K A;  2O60 A;  3PAL A;  3I5F B;  4WQ2 A;  1CLB A;  1FI5 A;  2ZRS A;  1CFF A;  1A29 A;  1UWO A;  1TOP A;  1IH0 A;  3TDZ A;  1G4Y R;  1W7I B;  2I18 A;  2M7L A;  3ICB A;  5G08 A;  5CSJ A;  3VRQ A;  1RTP 1;  3DD4 A;  1WRZ A;  2K7B A;  3VRP A;  1XVJ A;  2MLE C;  1IJ5 A;  3CR2 A;  1KSO A;  3IQQ A;  2E30 A;  1K2H A;  5TNC A;  2B1U A;  5DKN A;  1XA5 A;  2L4I A;  4TNC A;  1S6I A;  2V53 A;  4WQ3 A;  1UHI A;  2EHB A;  3IF7 A;  2NXQ A;  2JT3 A;  2Q91 A;  1JSA A;  2LVJ A;  1CKK A;  1KFX L;  2CNP A;  2K2A A;  1C07 A;  4MLW A;  1WY9 A;  2RGI A;  5AAN A;  3BUN B;  1REC A;  1SL7 A;  1ZUZ A;  5BPJ A;  2L4H A;  1NCX A;  2F2P A;  2HQW A;  4MSP A;  1J7Q A;  4HRE E;  2KBI A;  2PMY A;  1M45 A;  4AOM A;  1KFX S;  2I2R E;  2I94 A;  3EVV A;  4I5J A;  1WLZ A;  4MRX A;  4PHK A;  3DVK A;  4MZK A;  2JXC A;  5GQQ C;  1CLM A;  2JOJ A;  5JJG A;  2WND A;  3DVM A;  4NDB A;  3TUY B;  1SR6 C;  1F8H A;  1DJG A;  5I2L A;  1SYM A;  1KK8 C;  3IQO A;  3O78 A;  4ZCV A;  2KQY A;  2COL B;  4YGA A;  1SL8 A;  1MXL C;  2ZNE A;  1UHK A;  2JU0 A;  2WCB A;  3AAK A;  1GGZ A;  4YGE B;  1BT6 A;  2L2E A;  4JWQ A;  1UHJ A;  1IRJ A;  2O5G A;  1R2U A;  2CCM A;  3NXA A;  1Y1U A;  1QVI Y;  1QIV A;  1QTX A;  2F33 A;  2LVK A;  1M46 A;  3F45 A;  2Q4U A;  1MQ1 A;  1YVH A;  3EVU A;  2QAC A;  3KEV A;  2CBL A;  3CR4 X;  1ODB A;  3D0Y A;  3SG2 A;  4C0J A;  4MVF A;  1H8B A;  5AER A;  1RJV A;  1U5I A;  2Y4Q A;  2BCX A;  1TIZ A;  1GQM A;  1QV1 A;  1QX7 A;  4MEW A;  2BE4 A;  5D69 A;  2K0J A;  3AKB A;  1CTR A;  2AAO A;  4DS7 A;  1ZOT B;  4CFQ A;  1V1G A;  1BJF A;  1K96 A;  4M2Q A;  5CSI A;  1G33 A;  4YGC B;  4CFR A;  5HYD A;  1H4B A;  1SBJ A;  5J3X A;  1AJ5 A;  1V1F A;  1KQM C;  3A4U B;  2AUC A;  1S1E A;  2LMU A;  4OVN F;  1LIN A;  3EK4 A;  1DTL A;  2E6W A;  2EC6 C;  1DJI A;  1NCY A;  3CLN A;  4Q04 A;  1MR8 A;  3EKJ A;  2WCE A;  3LLE A;  4ORB B;  3DF0 A;  1CDL A;  1NWD A;  2CT9 A;  2JTZ A;  3BUW B;  1OQP A;  1SY9 A;  1JFK A;  2Y5I A;  3KHE A;  1OZS A;  2FOT A;  3LK1 A;  1DJY A;  2M0R A;  1BMO A;  3OB1 B;  1J7P A;  1CFP A;  2M9G A;  1AVS A;  4C0K A;  4YI8 A;  3SG5 A;  2Y1M A;  4DUQ A;  1DF0 A;  1IG5 A;  1DVI A;  1TN4 A;  1UUR A;  2K8M B;  3I5H C;  3MSE B;  1TNP A;  1QAT A;  2NCP A;  5D7F A;  1B47 A;  1N65 A;  2M1U A;  3OHM B;  1XFZ O;  1LA0 A;  1TNX A;  1MUX A;  1RRO A;  4PHN A;  3SG3 A;  1TCF A;  4P5O E;  3CWG A;  1SL9 A;  1NX0 A;  4MRY A;  1PUL A;  3NSL A;  2BL0 B;  3LCP C;  5HLO A;  1NUB A;  1YRU B;  1F4Q A;  2MLF C;  3I5G C;  2ZND A;  2QPT A;  2KFH A;  2LNK A;  1DGV A;  3OB2 B;  1CDP A;  4N1G A;  4WRI A;  2K7D A;  1F4O A;  4PCW A;  2H61 A;  3E3R A;  2LVV A;  4NDC A;  1CDN A;  3K21 A;  3EVR A;  1IQ3 A;  1B8C A;  2LAP A;  5ER5 A;  1IQ5 A;  3WHU B;  1K9U A;  2ZKM X;  1MF8 B;  4L9M A;  1AJ4 A;  4HRH A;  2LCP A;  2G2B A;  2BCA A;  3EK8 A;  4PE7 A;  4OR9 B;  3PFV A;  1LXF C;  1WRL A;  3D0Y B;  3NSK A;  2L50 A;  1DJZ A;  1U5I B;  1L7Z A;  1JF2 A;  5AEQ A;  3PSR A;  4MZJ A;  1A03 A;  1KK8 B;  1L2O C;  5DKR A;  2LMV A;  4GFT A;  2BCB A;  2ISD A;  1K94 A;  3PAT A;  3CGA A;  4AQI A;  3O2P A;  1TCO B;  4JQ0 D;  2JZI A;  2PRU A;  3CR5 X;  3RLZ A;  1YX8 A;  3O4Y A;  4GGN A;  1JBA A;  1PVA A;  1XK4 C;  3EKH A;  1YVL A;  1PK0 D;  4PAL A;  1KCY A;  1YX7 A;  3QRX A;  1GJY A;  1OMD A;  2LVI A;  1QLS A;  3PM8 A;  2JUL A;  3M0W A;  2R2I A;  1SPY A;  3DF0 B;  4USL A;  1ZFS A;  2M7N A;  3I5I C;  1B1G A;  5CSN A;  2WOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...