1XA5A

Structure of calmodulin in complex with kar-2, a bis-indol alkaloid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
144
Chain Sequence
b'QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title The structure of the complex of calmodulin with KAR-2: a novel mode of binding explains the unique pharmacology of the drug
pubmed doi rcsb
molecule tags Metal binding protein
total genus 49
structure length 144
sequence length 146
ec nomenclature
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xa5A00
3LCPC 1PSBA 1TNWA 5K89A 5JOLA 3ICBA 4N5XA 2Y4QA 2F8PA 2EC6C 1WLMA 2MBXA 1KQMC 2ZFDA 2LM5A 2M97A 1QTXA 2HQ8A 3EKJA 3SG3A 1K96A 4UPGA 1IRJA 1OE9B 3AAKA 2GGZA 1GGZA 3KF9A 2JZIA 1J1EA 1UHNA 1S6CA 3VROA 2L98A 1KWOC 4FQOA 3CR4X 1VRKA 4USLA 1MXLC 3AKAA 1XK4C 3IQOA 1S6JA 3PN7C 2O5GA 1CDLA 1TIZA 1TCFA 3PM8A 2OTGB 2NZ0A 3NXAA 4TNCA 3JTDB 1V1FA 2G2BA 1X02A 5G08A 2KQ6A 4HRGA 2LVJA 2KI6D 3KEVA 4CFQA 1JFJA 4MN0A 2B1UA 2F3YA 2AAOA 1ZACA 5DKNA 1YRTB 2H2KA 2KOTA 2BL0C 2KQYA 3I5HC 4AOMA 3CS1A 1YRUB 2KNEA 4HSZA 1FW4A 1CM4A 2NCPA 4U8DA 2JNXA 2FJUB 2LMTA 4XYNA 2HPSA 3CZTX 1ALVA 4N1FA 1U5IB 1W7IB 2I2RE 1OMRA 2JPTA 1KFUS 5KTYA 4N1GA 1SR6C 1CLMA 1NYAA 1UHIA 4ETOA 2LNKA 1NP8A 4F0ZB 1BODA 1KFXS 1M46A 1EH2A 1WRZA 2MHHA 4PDZA 2LHIA 1TN4A 1IG5A 4JWQA 1G33A 2FOTA 2JTZA 1PULA 2NLNA 2FCEA 4DRWA 5CPVA 3NSOA 1QLSA 2JQ6A 2KFHA 4ICBA 1QIVA 3H4SE 3HX4A 1NCZA 1S1EA 2LP2A 3DF0B 2LVIA 1Y1XA 1B47A 1UWOA 1S5GZ 4MRXA 4NDCA 4P5OE 1CTRA 1EG3A 2BCBA 4WQ2A 3LLEA 3O2PA 3CGAA 1DT7B 1OSAA 2LVKA 1XFXO 1AJ5A 1FI6A 4HRHA 5ER5A 4PALA 2WCFA 4IL1A 3TS5C 1JBAA 1UURA 2F2PA 1KK8C 2AMIA 4AQIA 4PE0A 2BE6A 1PALA 1OMDA 1AVSA 3JVTB 1H8BA 2LVVA 1B1GA 1C7VA 2JXLA 1XA5A 1SMGA 2PMYA 1JUOA 2KYCA 2COLB 2FCDA 1WRKA 2L4HA 4FTGA 1SL8A 2KGRA 4QJ4B 5PALA 3IQQA 5I2LA 1A75B 1MQ1A 3EKHA 2JXCA 2PRUA 2K7OA 2M1KB 4DIRA 5CSJA 1OQPA 2KI4C 1RK9A 3TDIA 1QS7A 1AJ4A 1A29A 1A4PA 4XJKA 2LMUA 4M2OA 1Y0VH 5GQQC 1DVIA 4HREE 2NXQA 2ZNEA 1DJWA 2LC5A 2M1UA 5HKZA 2JNFA 2LLTA 1CLLA 2MLFC 2ZNDA 4GUKA 4CFRA 1NCXA 3I5FC 3D10A 1PSRA 2WORA 1RWYA 2KBIA 2JRFA 1IH0A 2K61A 2OS8B 3WHTB 5KSZA 2GGMA 1IJ6A 1QATA 1R2UA 2OPOA 2D8NA 1N0YA 3BUWB 3SIBA 1F4QA 1C7WA 1TNPA 1BT6A 1CNPA 2K7DA 1N65A 2GV5A 1AHRA 2BBNA 1LXFC 1SCMB 4GBAA 1K9UA 1D1OA 1EL4A 1LINA 1SBJA 1OZSA 2I18A 2MA2A 3VRNA 2WC8A 2BCXA 3TDUA 2BBMA 2O60A 4YI8A 3OHMB 2VRGA 3BXKA 1YURA 3RLZA 1WY9A 1MWNA 1NX0A 4WQ3A 1G8IA 2AUCA 1XFYO 4ORCB 2KBMA 1AP4A 1CLBA 3LK1A 2CTNA 1SKTA 1K2HA 3PLFB 3TUYB 4GNKB 1M45A 3DVMA 1DGUA 1NX3A 1CMFA 1H4BA 4YGDB 1J1DA 1JF0A 2LLSA 1B9AA 1UHJA 2JOJA 2A4JA 2EHBA 3EK4A 3KO0A 2ZN9A 1E8AA 1XYDA 4P2YB 2PASA 1YUSA 1KSOA 4YGEB 2L4IA 1TNXA 4PCWA 1JFKA 1S5GY 3GOFA 1YX7A 2WCEA 1F71A 2EC6B 1HQVA 1KQMB 1W7JB 5HLVA 2L51A 3MSEB 1QVIY 1WDCC 5AXIA 2SCPA 3DD4A 2Y1MA 2QACA 3IF7A 1F54A 3CLNA 4MEWA 3QRXA 1NIWA 3PATA 3EVUA 1F70A 3O6BA 2KAYA 1B4CA 2M3WA 1KWOB 1EXRA 5AFPA 1MHOA 3I5IC 1NX2A 3PN7B 1HT9A 2JTTA 2ZRSA 4PE7A 1ALWA 4OV2A 3DVJA 1XO5A 1J7RA 1UHHA 1SW8A 2CXJA 5AERA 1BF5A 2K0JA 4GPLB 1IWQA 1XFWO 3D0YB 4GAOA 2KFFA 2WNDA 4M2PA 1AUIB 2ZKMX 1L2OC 2NCOA 1CMGA 1J55A 1RTP1 2DOQA 4ZCVA 1FF1A 1S6IA 3BOWA 3CR5X 2CCMA 2BL0B 3I5HB 4NDBA 4OCIA 3WHUB 1WDCB 2WCBA 1B8CA 1DF0A 4YI9A 1YUTA 2BE4A 4JPZB 4OR9B 1DGVA 4AQJA 4ZCUA 2M9GA 3I5GC 3CR2A 3OP0A 2EGDA 5CSNA 2PVBA 1SRAA 1QVIZ 1C07A 4C0JA 2K2AA 2F33A 2L2EA 4NQGA 4DUQA 1SR6B 3VRRA 5HKYA 1EJ3A 2I94A 2M49B 2L0PA 3M0WA 3NSIA 1K95A 5D7FA 4E68A 4MBEA 4L9MA 1CDMA 1BR4B 1LVCD 2E6WA 2LANA 4CLNA 2V53A 5DKQA 1DJGA 1NWDA 5AANA 2PSRA 5D69A 2KAXA 2KSPA 5FYXA 1SPYA 1SNLA 3SG5A 1JSAA 4OKHA 2LHLA 1BU3A 1QJTA 1CFPA 1YVLA 2IS9A 3ZWHA 2L5XB 4DCKA 4C0LA 1QV1A 3TS5B 1BR1B 3AAJA 4GFTA 3C1VA 1R6PA 2BKIB 3EK8A 1KK8B 2F2OA 3GK2A 5HKWA 1KFUL 3SJSA 4CIDA 3OB1B 1QXPA 1B8RA 2LCPA 1UHKA 1PRWA 2R2IA 3WXAA 4YGCB 1CFDA 1XFZO 1QIWA 5TNCA 1K9KA 4QJ5B 1Y6WA 1B7TY 1SL9A 1RJVA 1CFFA 3BUMB 2H61A 2LE9B 3EVRA 1QASA 3FS7A 1DMOA 2KI4B 1RECA 2LUCA 1S26D 3LK0A 2CNPA 1SL7A 3BUOB 1SK6D 3GK4X 1G4YR 2L50A 2KI6C 3BQ3A 5I8NA 1NUBA 2HF5A 3SG4A 1KQVA 4D1EA 1TOPA 2LUXA 5CSIA 1U5IA 1MR8A 3I5FB 1JF2A 1WRLA 2I7AA 2KYFA 2Y1NA 1BOCA 1K9PA 2BCAA 1NSHA 2OTGC 2M0RA 3JTDC 2K7CA 4MZLA 4A4BA 2H61C 1XK4A 1Q80A 2F3ZA 2SASA 1CM1A 1N2DA 2TN4A 4I5LB 4C0KA 2QPTA 5HLOA 2JULA 1DTLA 2HETA 3OX6A 3D0YA 4XJKB 2M29A 1NCYA 1OOJA 2KHNA 2E30A 1LA3A 3BUXB 1B7TZ 1K8UA 1NPQA 1ODBA 1WLZA 2K8MB 2WOSA 1A2XA 1JWDA 4YGAA 2KAVA 3DF0A 2MLEC 1MF8B 3EK7A 4MSPA 2Y5IA 3WNXB 4MZKA 5JJGA 3KHEA 1FPWA 1UP5A 1SYMA 1CFCA 1RFJA 1QX2A 2HQWA 2ZN8A 2LP3A 1QV0A 4PHJA 1J7QA 1FI5A 2KGBC 1TRFA 3FWBA 1PK0D 5I2OA 2JT0A 4ORBB 3ZNIA 1ZMZA 3F45A 1M63B 3GK1A 1TNQA 1QX5B 5J3XA 1IQ5A 2BKHB 1K94A 1TTXA 4GGFA 5IBWA 1ZOTB 4I5JA 2CBLA 1KK7Z 2ZRTA 1IQ3A 2MRDA 4CPVA 3VRQA 1IJ5A 2Q91A 3DVEA 2BECA 1PVBA 1Y1UA 1S36A 1YVHA 3BUNB 1A75A 3E3RA 4A4CA 1KSMA 3AKBA 1J7OA 2JU0A 2LMVA 1KCYA 2K2FA 3O4YA 3PSRA 1AK8A 4NDDA 3PFVA 4DS7A 1NX1A 3VGOA 1UUSA 1K90D 1J7PA 4GGFC 4R1EA 3JVTC 1RROA 4I5NB 1CKKA 4I5KA 3OB2B 2K7BA 3K21A 1PVAA 3TZ1A 3I5IB 5AEQA 1IGVA 4YBHB 5BPJA 1JC2A 2M7LA 3SG6A 1XFUO 3SG7A 4MVFA 1YX8A 1DJYA 1DJXA 4MRYA 4YGBB 5DKRA 1SY9A 1L2OB 2LAPA 2Q4UA 1XVJA 1K93D 1OMVA 1ZUZA 2JC2A 4JQ0D 3SG2A 2G9BA 4PE1A 1DJIA 4BY5A 1BG1A 3VRPA 4GGNA 3FIAA 4YRUA 3I5GB 1Y1AA 5CSFA 1F8HA 1MUXA 2KFGA 1F4OA 2JT3A 3RM1A 1YUUA 2CT9A 1GQMA 3NSLA 2OS8C 1B8LA 4OVNF 4PHNA 3NSKA 3HCMA 1M39A 1V1GA 1LKJA 1CDPA 3A4UB 1L7ZA 1QLKA 4Q04A 3TDZA 3CWGA 4PHMA 1XFVO 3O78A 4QJ3B 3CTNA 5I2QA 1F55A 1DJHA 1KFXL 4WRIA 1YR5A 4MLWA 1SCMC 3BOWB 1IKUA 2M8UA 2KDHA 1DF0B 5F6TA 1MXEA 3SIAA 1OZOA 1BJFA 4BY4A 2PALA 5B8IB 1EG4A 2LLUA 1M31A 4M2QA 3FWCA 1S3PA 2ISDA 1CB1A 1SCVA 1CDNA 2M7NA 1GJYA 3DVKA 4MZJA 1GGWA 2JT8A 2RGIA 3OX5A 2JWWA 1YTZC 1A03A 4ORAB 5KU1A 3PALA 3BYAA 2LV7A 1ZFSA 3KPXA 3TUYC 3LL8B 3A8RA 1BMOA 1FBVA 4PHKA 3EVVA 1TCOB 5HYDA 1BLQA 4PE4A 5ER4X 2P6BB 2MJWB 1QX7A 1KK7Y 1DJZA 1LA0A 2MAZA
chains in the Genus database with same CATH superfamily
3LCPC 1PSBA 1TNWA 5K89A 5JOLA 3ICBA 4N5XA 2Y4QA 1P28A 2F8PA 2EC6C 1WLMA 2MBXA 1KQMC 2ZFDA 2LM5A 2M97A 1QTXA 2HQ8A 3EKJA 3SG3A 1K96A 2H8VA 4UPGA 1IRJA 1OE9B 3AAKA 2GGZA 1GGZA 1XFRA 2JZIA 3CABA 3KF9A 1J1EA 3CYZA 1UHNA 1S6CA 3DXLA 3VROA 2L98A 1KWOC 4FQOA 3CR4X 1VRKA 2QEVA 4USLA 1MXLC 3AKAA 1XK4C 3SS5A 3IQOA 1S6JA 3PN7C 2O5GA 1CDLA 1TIZA 1TCFA 3PM8A 2BNXA 2OTGB 2NZ0A 3NXAA 4IJ7A 3JTDB 1V1FA 4TNCA 2G2BA 3B87A 1X02A 5G08A 2KQ6A 4HRGA 1W9ZA 2LVJA 2KI6D 3CDNA 3KEVA 4CFQA 4MN0A 2B1UA 2F3YA 1JFJA 2AAOA 1ZACA 5DKNA 1YRTB 2H2KA 2KOTA 2BL0C 2KQYA 3I5HC 4AOMA 3CS1A 1YRUB 2KNEA 4HSZA 1FW4A 1CM4A 2NCPA 2YGUA 4U8DA 2JNXA 2FJUB 1OOGA 2LMTA 2HPSA 3B86A 3CZTX 4XYNA 1ALVA 3R1VA 4N1FA 1U5IB 3L47A 3S0GA 1W7IB 2I2RE 1OMRA 2JPTA 1KFUS 5KTYA 1TUZA 4N1GA 1SR6C 1CLMA 1NYAA 1UHIA 4ETOA 2LNKA 1NP8A 4F0ZB 1BODA 1KFXS 3FE6A 1M46A 1EH2A 1WRZA 2MHHA 4PDZA 2LHIA 1TN4A 1IG5A 4JWQA 1G33A 3DZTA 2FOTA 2JTZA 1PULA 3NHIA 2NLNA 2FCEA 4DRWA 5CPVA 1OOHA 3NSOA 1QLSA 2JQ6A 2KFHA 5HL1A 3NGVA 4ICBA 1QIVA 3H4SE 3HX4A 3IVTA 1NCZA 1S1EA 2LP2A 3DF0B 1GM0A 2LVIA 1Y1XA 1B47A 1UWOA 1S5GZ 4MRXA 4NDCA 4P5OE 1CTRA 3L4AA 1EG3A 2BCBA 4WQ2A 3LLEA 3O2PA 3CGAA 1DT7B 1OSAA 2LVKA 1XFXO 1AJ5A 1FI6A 4HRHA 5ER5A 4PALA 2WCFA 4IL1A 3TS5C 1JBAA 1UURA 2F2PA 1KK8C 2AMIA 1DEKA 4AQIA 2WCHA 4PE0A 2BE6A 1PALA 1OMDA 3S0EA 1AVSA 3JVTB 1H8BA 2LVVA 1B1GA 1SSEB 1C7VA 2JXLA 1XA5A 1SMGA 2PMYA 1JUOA 2KYCA 2COLB 2FCDA 1WRKA 2L4HA 4FTGA 1SL8A 2KGRA 4QJ4B 5PALA 3D75A 3IQQA 5I2LA 1A75B 1MQ1A 3EKHA 2JXCA 2PRUA 2K7OA 2M1KB 4DIRA 5CSJA 1OQPA 2KI4C 1RK9A 3TDIA 1QS7A 1AJ4A 1A29A 1A4PA 4XJKA 2LMUA 4M2OA 3OGNA 1TUJA 1Y0VH 1DVIA 5GQQC 4HREE 2NXQA 2ZNEA 1DJWA 2LC5A 2M1UA 5HKZA 2JNFA 2LLTA 1CLLA 2MLFC 2ZNDA 3NHTA 4GUKA 4CFRA 1NCXA 3I5FC 3D10A 1PSRA 2ERBA 1RWYA 2KBIA 2WORA 2JRFA 1IH0A 2K61A 2OS8B 3WHTB 3B7AA 5KSZA 2GGMA 1IJ6A 1QATA 1R2UA 2OPOA 2D8NA 1N0YA 3BUWB 3SIBA 1F4QA 1C7WA 3RZSA 1TNPA 1BT6A 1CNPA 2K7DA 1N65A 2GV5A 1AHRA 2BBNA 1LXFC 1SCMB 4GBAA 1K9UA 1D1OA 2PYQA 1EL4A 1LINA 1SBJA 1OZSA 2I18A 2MA2A 3VRNA 2WC8A 5D3OA 2BCXA 3TDUA 2BBMA 2GTEA 2O60A 3O4XA 4YI8A 3OHMB 2VRGA 3BXKA 1YURA 3RLZA 1WY9A 1MWNA 1NX0A 4WQ3A 1G8IA 2AUCA 1XFYO 4ORCB 2KBMA 1AP4A 2FJYA 1CLBA 3LK1A 1TWOA 2CTNA 1SKTA 1K2HA 3PLFB 3TUYB 4GNKB 1M45A 3DVMA 1DGUA 3D77A 1NX3A 1CMFA 1H4BA 4YGDB 1J1DA 1JF0A 2LLSA 1B9AA 1UHJA 4KYNA 2JOJA 2A4JA 2EHBA 3EK4A 3KO0A 2ZN9A 1E8AA 1XYDA 4P2YB 2PASA 1YUSA 1KSOA 4YGEB 2L4IA 1TNXA 4PCWA 1DQEA 1JFKA 1S5GY 3GOFA 1YX7A 2WCEA 1F71A 2EC6B 1HQVA 1KQMB 1W7JB 3PM2A 2L51A 5HLVA 3MSEB 1QVIY 1WDCC 5AXIA 2SCPA 3DD4A 2Y1MA 2QACA 3IF7A 3S0AA 1F54A 3CLNA 4MEWA 3EG5B 3QRXA 1NIWA 3D73A 3PATA 3EVUA 1F70A 2QEBA 3O6BA 2KAYA 1B4CA 2M3WA 1KWOB 4OZDA 1EXRA 5AFPA 1MHOA 3I5IC 1NX2A 2WC6A 3PN7B 1HT9A 2JTTA 2ZRSA 4PE7A 1ALWA 4OV2A 3DVJA 1XO5A 1J7RA 1UHHA 1SW8A 2CXJA 5AERA 1BF5A 2K0JA 4GPLB 1IWQA 1XFWO 3D0YB 4GAOA 2KFFA 1OW4A 2WNDA 4M2PA 4F7FA 1AUIB 2ZKMX 1L2OC 2NCOA 1OOIX 1CMGA 1J55A 1RTP1 2DOQA 4ZCVA 1FF1A 3PJIA 1S6IA 3BOWA 3CR5X 2QEHA 2CCMA 2BL0B 3I5HB 4NDBA 4OCIA 3WHUB 1WDCB 2WCBA 1B8CA 3D76A 1DF0A 4YI9A 1YUTA 2BE4A 4JPZB 4OR9B 1DGVA 5EL2A 3CZ2A 4ZCUA 4AQJA 2M9GA 3I5GC 3CR2A 3OP0A 2EGDA 5CSNA 2PVBA 1SRAA 1QVIZ 1C07A 4C0JA 2K2AA 2F33A 2L2EA 4NQGA 4DUQA 1SR6B 3VRRA 5HKYA 1EJ3A 2I94A 2M49B 2L0PA 3M0WA 1C3ZA 3NSIA 3FE9A 1K95A 5FI6A 5D7FA 4E68A 4MBEA 4L9MA 1CDMA 1BR4B 1LVCD 2E6WA 2LANA 4CLNA 3Q8IA 2V53A 5DKQA 1DJGA 1NWDA 5AANA 2PSRA 5D69A 2KAXA 2KSPA 5FYXA 3V2LA 1SPYA 1SNLA 3SG5A 1JSAA 4OKHA 2L2CA 2LHLA 1BU3A 1QJTA 1CFPA 1YVLA 2IS9A 3ZWHA 2L5XB 4DCKA 4C0LA 3S0FA 1QV1A 3TS5B 1BR1B 3AAJA 4GFTA 3C1VA 1R6PA 2BKIB 3EK8A 1KK8B 2F2OA 3GK2A 5HKWA 1IIOA 1KFUL 3SJSA 4CIDA 3OB1B 1QXPA 1B8RA 2LCPA 2BAPA 1UHKA 1PRWA 2QEOA 3DY9A 2R2IA 3WXAA 4YGCB 1CFDA 1XFZO 1QIWA 2WCJA 1K9KA 5TNCA 4QJ5B 1Y6WA 5DICA 1B7TY 1SL9A 1RJVA 2KPHA 2WCKA 1CFFA 3BUMB 2H61A 5FI7A 2LE9B 3EVRA 1QASA 3FS7A 1DMOA 2P70A 2KI4B 1RECA 2LUCA 1S26D 3LK0A 2CNPA 1SL7A 1T14A 1SK6D 3BUOB 3GK4X 1G4YR 2L50A 1QWVA 2KI6C 3BQ3A 5I8NA 1NUBA 2HF5A 3SG4A 1KQVA 4D1EA 1TOPA 2LUXA 5CSIA 1U5IA 1MR8A 3I5FB 1JF2A 1WRLA 4JKTA 2I7AA 2KYFA 2Y1NA 4PT1A 1BOCA 1K9PA 2BCAA 1NSHA 2OTGC 2M0RA 3JTDC 2K7CA 3L4LA 4MZLA 4A4BA 2H61C 1XK4A 1Q80A 2F3ZA 2SASA 1CM1A 1N2DA 2TN4A 4I5LB 4C0KA 2QPTA 5HLOA 2JULA 3BFBA 1DTLA 3SS3A 2HETA 3OX6A 3D0YA 4XJKB 2M29A 1NCYA 1OOJA 2KHNA 2KLDA 1C3YA 2JPOA 1OOFA 2E30A 1LA3A 3BUXB 1B7TZ 1K8UA 1NPQA 1ODBA 1WLZA 2K8MB 2WOSA 1A2XA 1JWDA 4YGAA 2KAVA 3DF0A 2MLEC 2K60A 3S0DA 1MF8B 3EK7A 4MSPA 3B88A 2Y5IA 3VB1A 3D78A 3WNXB 4MZKA 3UNWA 3KHEA 5JJGA 1UP5A 1FPWA 1SYMA 1CFCA 1RFJA 1QX2A 2HQWA 2ZN8A 2LP3A 1QV0A 4PHJA 1J7QA 1FI5A 2KGBC 1TRFA 3FWBA 1PK0D 3K1EA 5I2OA 2JT0A 4ORBB 3ZNIA 1ZMZA 3BJHA 3F45A 1M63B 3GK1A 1TNQA 1QX5B 5J3XA 1IQ5A 2BKHB 1K94A 1TTXA 4GGFA 5IBWA 1ZOTB 4I5JA 2CBLA 1KK7Z 2ZRTA 1IQ3A 3UO9A 2MRDA 4CPVA 3OBVA 3VRQA 1DC1A 1IJ5A 2Q91A 3R72A 3DVEA 2BECA 1PVBA 1Y1UA 1S36A 1YVHA 3BUNB 1A75A 3E3RA 1DELA 4A4CA 1KSMA 3AKBA 1J7OA 2JU0A 4FQTA 2LMVA 4INXA 1KCYA 2K2FA 3O4YA 3PSRA 1AK8A 4NDDA 3PFVA 4DS7A 1NX1A 3VGOA 1UUSA 3R1OA 3S0BA 3CZ0A 1K90D 1J7PA 4GGFC 4R1EA 3JVTC 1RROA 2KLEA 4I5NB 1CKKA 4I5KA 3OB2B 2K7BA 3K21A 1PVAA 3TZ1A 3I5IB 5AEQA 1IGVA 4YBHB 5I94A 5BPJA 1JC2A 2M7LA 1Z2CB 3SG6A 1XFUO 3CZ1A 3SG7A 4JD9A 4MVFA 1YX8A 1DJYA 1DJXA 4MRYA 3FE8A 4YGBB 1SY9A 5DKRA 1L2OB 2LAPA 2Q4UA 1XVJA 1K93D 1OMVA 1ZUZA 2JC2A 4JQ0D 3SG2A 2G9BA 4PE1A 3QMEA 1DJIA 4BY5A 1BG1A 2WC5A 3VRPA 4GGNA 3FIAA 4YRUA 3I5GB 1Y1AA 5CSFA 1F8HA 1MUXA 2KFGA 1F4OA 2JT3A 3RM1A 1YUUA 2CT9A 1GQMA 3NSLA 2OS8C 1B8LA 4OVNF 4PHNA 3NSKA 3HCMA 1M39A 1V1GA 1LKJA 1CDPA 3A4UB 1L7ZA 1QLKA 4Q04A 3TDZA 4INWA 3CWGA 4PHMA 1XFVO 3O78A 4QJ3B 3CTNA 5I2QA 1F55A 1DJHA 1KFXL 1LS8A 4WRIA 1YR5A 4MLWA 1SCMC 3BOWB 3DYEA 1IKUA 2M8UA 2KDHA 3BFAA 1DF0B 5F6TA 1MXEA 3SIAA 1OZOA 1BJFA 3BFHA 3D74A 2PALA 4BY4A 5B8IB 1EG4A 2LLUA 1M31A 4M2QA 3FWCA 1S3PA 2ISDA 1CB1A 1SCVA 1CDNA 2M7NA 1GJYA 3DVKA 4MZJA 1GGWA 2L5YA 2JT8A 2P71A 2RGIA 3OX5A 2QDIA 2JWWA 1YTZC 1A03A 4ORAB 3SS4A 5KU1A 3PALA 3BYAA 2LV7A 1ZFSA 3KPXA 3R1PA 3TUYC 3LL8B 3A8RA 1BMOA 1FBVA 3B6XA 4PHKA 3EVVA 1TCOB 5HYDA 1BLQA 4PE4A 5ER4X 1Z4HA 2P6BB 2MJWB 2PQLA 2WCMA 1QX7A 1KK7Y 5FI2A 1DJZA 2WCLA 1ORGA 1LA0A 2MAZA 3N7HA
chains in the Genus database with same CATH topology
3LCPC 1PSBA 1TNWA 5K89A 5JOLA 3ICBA 4N5XA 2Y4QA 2F8PA 2EC6C 1WLMA 2MBXA 1KQMC 2ZFDA 2LM5A 2M97A 1QTXA 2HQ8A 3EKJA 3SG3A 1K96A 4UPGA 1IRJA 1OE9B 3AAKA 2GGZA 1GGZA 3KF9A 2JZIA 1J1EA 1UHNA 1S6CA 3VROA 2L98A 1KWOC 4FQOA 3CR4X 1VRKA 4USLA 1MXLC 3AKAA 1XK4C 3IQOA 1S6JA 3PN7C 2O5GA 1CDLA 1TIZA 1TCFA 3PM8A 2OTGB 2NZ0A 3NXAA 4TNCA 3JTDB 1V1FA 2G2BA 1X02A 5G08A 2KQ6A 4HRGA 2LVJA 2KI6D 3KEVA 4CFQA 1JFJA 4MN0A 2B1UA 2F3YA 2AAOA 1ZACA 5DKNA 1YRTB 2H2KA 2KOTA 2BL0C 2KQYA 3I5HC 4AOMA 3CS1A 1YRUB 2KNEA 4HSZA 1FW4A 1CM4A 2NCPA 4U8DA 2JNXA 2FJUB 2LMTA 4XYNA 2HPSA 3CZTX 1ALVA 4N1FA 1U5IB 1W7IB 2I2RE 1OMRA 2JPTA 1KFUS 5KTYA 4N1GA 1SR6C 1CLMA 1NYAA 1UHIA 4ETOA 2LNKA 1NP8A 4F0ZB 1BODA 1KFXS 1M46A 1EH2A 1WRZA 2MHHA 4PDZA 2LHIA 1TN4A 1IG5A 4JWQA 1G33A 2FOTA 2JTZA 1PULA 2NLNA 2FCEA 4DRWA 5CPVA 3NSOA 1QLSA 2JQ6A 2KFHA 4ICBA 1QIVA 3H4SE 3HX4A 1NCZA 1S1EA 2LP2A 3DF0B 2LVIA 1Y1XA 1B47A 1UWOA 1S5GZ 4MRXA 4NDCA 4P5OE 1CTRA 1EG3A 2BCBA 4WQ2A 3LLEA 3O2PA 3CGAA 1DT7B 1OSAA 2LVKA 1XFXO 1AJ5A 1FI6A 4HRHA 5ER5A 4PALA 2WCFA 4IL1A 3TS5C 1JBAA 1UURA 2F2PA 1KK8C 2AMIA 4AQIA 4PE0A 2BE6A 1PALA 1OMDA 1AVSA 3JVTB 1H8BA 2LVVA 1B1GA 1C7VA 2JXLA 1XA5A 1SMGA 2PMYA 1JUOA 2KYCA 2COLB 2FCDA 1WRKA 2L4HA 4FTGA 1SL8A 2KGRA 4QJ4B 5PALA 3IQQA 5I2LA 1A75B 1MQ1A 3EKHA 2JXCA 2PRUA 2K7OA 2M1KB 4DIRA 5CSJA 1OQPA 2KI4C 1RK9A 3TDIA 1QS7A 1AJ4A 1A29A 1A4PA 4XJKA 2LMUA 4M2OA 1Y0VH 5GQQC 1DVIA 4HREE 2NXQA 2ZNEA 1DJWA 2LC5A 2M1UA 5HKZA 2JNFA 2LLTA 1CLLA 2MLFC 2ZNDA 4GUKA 4CFRA 1NCXA 3I5FC 3D10A 1PSRA 2WORA 1RWYA 2KBIA 2JRFA 1IH0A 2K61A 2OS8B 3WHTB 5KSZA 2GGMA 1IJ6A 1QATA 1R2UA 2OPOA 2D8NA 1N0YA 3BUWB 3SIBA 1F4QA 1C7WA 1TNPA 1BT6A 1CNPA 2K7DA 1N65A 2GV5A 1AHRA 2BBNA 1LXFC 1SCMB 4GBAA 1K9UA 1D1OA 1EL4A 1LINA 1SBJA 1OZSA 2I18A 2MA2A 3VRNA 2WC8A 2BCXA 3TDUA 2BBMA 2O60A 4YI8A 3OHMB 2VRGA 3BXKA 1YURA 3RLZA 1WY9A 1MWNA 1NX0A 4WQ3A 1G8IA 2AUCA 1XFYO 4ORCB 2KBMA 1AP4A 1CLBA 3LK1A 2CTNA 1SKTA 1K2HA 3PLFB 3TUYB 4GNKB 1M45A 3DVMA 1DGUA 1NX3A 1CMFA 1H4BA 4YGDB 1J1DA 1JF0A 2LLSA 1B9AA 1UHJA 2JOJA 2A4JA 2EHBA 3EK4A 3KO0A 2ZN9A 1E8AA 1XYDA 4P2YB 2PASA 1YUSA 1KSOA 4YGEB 2L4IA 1TNXA 4PCWA 1JFKA 1S5GY 3GOFA 1YX7A 2WCEA 1F71A 2EC6B 1HQVA 1KQMB 1W7JB 5HLVA 2L51A 3MSEB 1QVIY 1WDCC 5AXIA 2SCPA 3DD4A 2Y1MA 2QACA 3IF7A 1F54A 3CLNA 4MEWA 3QRXA 1NIWA 3PATA 3EVUA 1F70A 3O6BA 2KAYA 1B4CA 2M3WA 1KWOB 1EXRA 5AFPA 1MHOA 3I5IC 1NX2A 3PN7B 1HT9A 2JTTA 2ZRSA 4PE7A 1ALWA 4OV2A 3DVJA 1XO5A 1J7RA 1UHHA 1SW8A 2CXJA 5AERA 1BF5A 2K0JA 4GPLB 1IWQA 1XFWO 3D0YB 4GAOA 2KFFA 2WNDA 4M2PA 1AUIB 2ZKMX 1L2OC 2NCOA 1CMGA 1J55A 1RTP1 2DOQA 4ZCVA 1FF1A 1S6IA 3BOWA 3CR5X 2CCMA 2BL0B 3I5HB 4NDBA 4OCIA 3WHUB 1WDCB 2WCBA 1B8CA 1DF0A 4YI9A 1YUTA 2BE4A 4JPZB 4OR9B 1DGVA 4AQJA 4ZCUA 2M9GA 3I5GC 3CR2A 3OP0A 2EGDA 5CSNA 2PVBA 1SRAA 1QVIZ 1C07A 4C0JA 2K2AA 2F33A 2L2EA 4NQGA 4DUQA 1SR6B 3VRRA 5HKYA 1EJ3A 2I94A 2M49B 2L0PA 3M0WA 3NSIA 1K95A 5D7FA 4E68A 4MBEA 4L9MA 1CDMA 1BR4B 1LVCD 2E6WA 2LANA 4CLNA 2V53A 5DKQA 1DJGA 1NWDA 5AANA 2PSRA 5D69A 2KAXA 2KSPA 5FYXA 1SPYA 1SNLA 3SG5A 1JSAA 4OKHA 2LHLA 1BU3A 1QJTA 1CFPA 1YVLA 2IS9A 3ZWHA 2L5XB 4DCKA 4C0LA 1QV1A 3TS5B 1BR1B 3AAJA 4GFTA 3C1VA 1R6PA 2BKIB 3EK8A 1KK8B 2F2OA 3GK2A 5HKWA 1KFUL 3SJSA 4CIDA 3OB1B 1QXPA 1B8RA 2LCPA 1UHKA 1PRWA 2R2IA 3WXAA 4YGCB 1CFDA 1XFZO 1QIWA 5TNCA 1K9KA 4QJ5B 1Y6WA 1B7TY 1SL9A 1RJVA 1CFFA 3BUMB 2H61A 2LE9B 3EVRA 1QASA 3FS7A 1DMOA 2KI4B 1RECA 2LUCA 1S26D 3LK0A 2CNPA 1SL7A 3BUOB 1SK6D 3GK4X 1G4YR 2L50A 2KI6C 3BQ3A 5I8NA 1NUBA 2HF5A 3SG4A 1KQVA 4D1EA 1TOPA 2LUXA 5CSIA 1U5IA 1MR8A 3I5FB 1JF2A 1WRLA 2I7AA 2KYFA 2Y1NA 1BOCA 1K9PA 2BCAA 1NSHA 2OTGC 2M0RA 3JTDC 2K7CA 4MZLA 4A4BA 2H61C 1XK4A 1Q80A 2F3ZA 2SASA 1CM1A 1N2DA 2TN4A 4I5LB 4C0KA 2QPTA 5HLOA 2JULA 1DTLA 2HETA 3OX6A 3D0YA 4XJKB 2M29A 1NCYA 1OOJA 2KHNA 2E30A 1LA3A 3BUXB 1B7TZ 1K8UA 1NPQA 1ODBA 1WLZA 2K8MB 2WOSA 1A2XA 1JWDA 4YGAA 2KAVA 3DF0A 2MLEC 1MF8B 3EK7A 4MSPA 2Y5IA 3WNXB 4MZKA 5JJGA 3KHEA 1FPWA 1UP5A 1SYMA 1CFCA 1RFJA 1QX2A 2HQWA 2ZN8A 2LP3A 1QV0A 4PHJA 1J7QA 1FI5A 2KGBC 1TRFA 3FWBA 1PK0D 5I2OA 2JT0A 4ORBB 3ZNIA 1ZMZA 3F45A 1M63B 3GK1A 1TNQA 1QX5B 5J3XA 1IQ5A 2BKHB 1K94A 1TTXA 4GGFA 5IBWA 1ZOTB 4I5JA 2CBLA 1KK7Z 2ZRTA 1IQ3A 2MRDA 4CPVA 3VRQA 1IJ5A 2Q91A 3DVEA 2BECA 1PVBA 1Y1UA 1S36A 1YVHA 3BUNB 1A75A 3E3RA 4A4CA 1KSMA 3AKBA 1J7OA 2JU0A 2LMVA 1KCYA 2K2FA 3O4YA 3PSRA 1AK8A 4NDDA 3PFVA 4DS7A 1NX1A 3VGOA 1UUSA 1K90D 1J7PA 4GGFC 4R1EA 3JVTC 1RROA 4I5NB 1CKKA 4I5KA 3OB2B 2K7BA 3K21A 1PVAA 3TZ1A 3I5IB 5AEQA 1IGVA 4YBHB 5BPJA 1JC2A 2M7LA 3SG6A 1XFUO 3SG7A 4MVFA 1YX8A 1DJYA 1DJXA 4MRYA 4YGBB 5DKRA 1SY9A 1L2OB 2LAPA 2Q4UA 1XVJA 1K93D 1OMVA 1ZUZA 2JC2A 4JQ0D 3SG2A 2G9BA 4PE1A 1DJIA 4BY5A 1BG1A 3VRPA 4GGNA 3FIAA 4YRUA 3I5GB 1Y1AA 5CSFA 1F8HA 1MUXA 2KFGA 1F4OA 2JT3A 3RM1A 1YUUA 2CT9A 1GQMA 3NSLA 2OS8C 1B8LA 4OVNF 4PHNA 3NSKA 3HCMA 1M39A 1V1GA 1LKJA 1CDPA 3A4UB 1L7ZA 1QLKA 4Q04A 3TDZA 3CWGA 4PHMA 1XFVO 3O78A 4QJ3B 3CTNA 5I2QA 1F55A 1DJHA 1KFXL 4WRIA 1YR5A 4MLWA 1SCMC 3BOWB 1IKUA 2M8UA 2KDHA 1DF0B 5F6TA 1MXEA 3SIAA 1OZOA 1BJFA 4BY4A 2PALA 5B8IB 1EG4A 2LLUA 1M31A 4M2QA 3FWCA 1S3PA 2ISDA 1CB1A 1SCVA 1CDNA 2M7NA 1GJYA 3DVKA 4MZJA 1GGWA 2JT8A 2RGIA 3OX5A 2JWWA 1YTZC 1A03A 4ORAB 5KU1A 3PALA 3BYAA 2LV7A 1ZFSA 3KPXA 3TUYC 3LL8B 3A8RA 1BMOA 1FBVA 4PHKA 3EVVA 1TCOB 5HYDA 1BLQA 4PE4A 5ER4X 2P6BB 2MJWB 1QX7A 1KK7Y 1DJZA 1LA0A 2MAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCP C;  1PSB A;  1TNW A;  5K89 A;  5JOL A;  3ICB A;  4N5X A;  2Y4Q A;  2F8P A;  2EC6 C;  1WLM A;  2MBX A;  1KQM C;  2ZFD A;  2LM5 A;  2M97 A;  1QTX A;  2HQ8 A;  3EKJ A;  3SG3 A;  1K96 A;  4UPG A;  1IRJ A;  1OE9 B;  3AAK A;  2GGZ A;  1GGZ A;  3KF9 A;  2JZI A;  1J1E A;  1UHN A;  1S6C A;  3VRO A;  2L98 A;  1KWO C;  4FQO A;  3CR4 X;  1VRK A;  4USL A;  1MXL C;  3AKA A;  1XK4 C;  3IQO A;  1S6J A;  3PN7 C;  2O5G A;  1CDL A;  1TIZ A;  1TCF A;  3PM8 A;  2OTG B;  2NZ0 A;  3NXA A;  4TNC A;  3JTD B;  1V1F A;  2G2B A;  1X02 A;  5G08 A;  2KQ6 A;  4HRG A;  2LVJ A;  2KI6 D;  3KEV A;  4CFQ A;  1JFJ A;  4MN0 A;  2B1U A;  2F3Y A;  2AAO A;  1ZAC A;  5DKN A;  1YRT B;  2H2K A;  2KOT A;  2BL0 C;  2KQY A;  3I5H C;  4AOM A;  3CS1 A;  1YRU B;  2KNE A;  4HSZ A;  1FW4 A;  1CM4 A;  2NCP A;  4U8D A;  2JNX A;  2FJU B;  2LMT A;  4XYN A;  2HPS A;  3CZT X;  1ALV A;  4N1F A;  1U5I B;  1W7I B;  2I2R E;  1OMR A;  2JPT A;  1KFU S;  5KTY A;  4N1G A;  1SR6 C;  1CLM A;  1NYA A;  1UHI A;  4ETO A;  2LNK A;  1NP8 A;  4F0Z B;  1BOD A;  1KFX S;  1M46 A;  1EH2 A;  1WRZ A;  2MHH A;  4PDZ A;  2LHI A;  1TN4 A;  1IG5 A;  4JWQ A;  1G33 A;  2FOT A;  2JTZ A;  1PUL A;  2NLN A;  2FCE A;  4DRW A;  5CPV A;  3NSO A;  1QLS A;  2JQ6 A;  2KFH A;  4ICB A;  1QIV A;  3H4S E;  3HX4 A;  1NCZ A;  1S1E A;  2LP2 A;  3DF0 B;  2LVI A;  1Y1X A;  1B47 A;  1UWO A;  1S5G Z;  4MRX A;  4NDC A;  4P5O E;  1CTR A;  1EG3 A;  2BCB A;  4WQ2 A;  3LLE A;  3O2P A;  3CGA A;  1DT7 B;  1OSA A;  2LVK A;  1XFX O;  1AJ5 A;  1FI6 A;  4HRH A;  5ER5 A;  4PAL A;  2WCF A;  4IL1 A;  3TS5 C;  1JBA A;  1UUR A;  2F2P A;  1KK8 C;  2AMI A;  4AQI A;  4PE0 A;  2BE6 A;  1PAL A;  1OMD A;  1AVS A;  3JVT B;  1H8B A;  2LVV A;  1B1G A;  1C7V A;  2JXL A;  1XA5 A;  1SMG A;  2PMY A;  1JUO A;  2KYC A;  2COL B;  2FCD A;  1WRK A;  2L4H A;  4FTG A;  1SL8 A;  2KGR A;  4QJ4 B;  5PAL A;  3IQQ A;  5I2L A;  1A75 B;  1MQ1 A;  3EKH A;  2JXC A;  2PRU A;  2K7O A;  2M1K B;  4DIR A;  5CSJ A;  1OQP A;  2KI4 C;  1RK9 A;  3TDI A;  1QS7 A;  1AJ4 A;  1A29 A;  1A4P A;  4XJK A;  2LMU A;  4M2O A;  1Y0V H;  5GQQ C;  1DVI A;  4HRE E;  2NXQ A;  2ZNE A;  1DJW A;  2LC5 A;  2M1U A;  5HKZ A;  2JNF A;  2LLT A;  1CLL A;  2MLF C;  2ZND A;  4GUK A;  4CFR A;  1NCX A;  3I5F C;  3D10 A;  1PSR A;  2WOR A;  1RWY A;  2KBI A;  2JRF A;  1IH0 A;  2K61 A;  2OS8 B;  3WHT B;  5KSZ A;  2GGM A;  1IJ6 A;  1QAT A;  1R2U A;  2OPO A;  2D8N A;  1N0Y A;  3BUW B;  3SIB A;  1F4Q A;  1C7W A;  1TNP A;  1BT6 A;  1CNP A;  2K7D A;  1N65 A;  2GV5 A;  1AHR A;  2BBN A;  1LXF C;  1SCM B;  4GBA A;  1K9U A;  1D1O A;  1EL4 A;  1LIN A;  1SBJ A;  1OZS A;  2I18 A;  2MA2 A;  3VRN A;  2WC8 A;  2BCX A;  3TDU A;  2BBM A;  2O60 A;  4YI8 A;  3OHM B;  2VRG A;  3BXK A;  1YUR A;  3RLZ A;  1WY9 A;  1MWN A;  1NX0 A;  4WQ3 A;  1G8I A;  2AUC A;  1XFY O;  4ORC B;  2KBM A;  1AP4 A;  1CLB A;  3LK1 A;  2CTN A;  1SKT A;  1K2H A;  3PLF B;  3TUY B;  4GNK B;  1M45 A;  3DVM A;  1DGU A;  1NX3 A;  1CMF A;  1H4B A;  4YGD B;  1J1D A;  1JF0 A;  2LLS A;  1B9A A;  1UHJ A;  2JOJ A;  2A4J A;  2EHB A;  3EK4 A;  3KO0 A;  2ZN9 A;  1E8A A;  1XYD A;  4P2Y B;  2PAS A;  1YUS A;  1KSO A;  4YGE B;  2L4I A;  1TNX A;  4PCW A;  1JFK A;  1S5G Y;  3GOF A;  1YX7 A;  2WCE A;  1F71 A;  2EC6 B;  1HQV A;  1KQM B;  1W7J B;  5HLV A;  2L51 A;  3MSE B;  1QVI Y;  1WDC C;  5AXI A;  2SCP A;  3DD4 A;  2Y1M A;  2QAC A;  3IF7 A;  1F54 A;  3CLN A;  4MEW A;  3QRX A;  1NIW A;  3PAT A;  3EVU A;  1F70 A;  3O6B A;  2KAY A;  1B4C A;  2M3W A;  1KWO B;  1EXR A;  5AFP A;  1MHO A;  3I5I C;  1NX2 A;  3PN7 B;  1HT9 A;  2JTT A;  2ZRS A;  4PE7 A;  1ALW A;  4OV2 A;  3DVJ A;  1XO5 A;  1J7R A;  1UHH A;  1SW8 A;  2CXJ A;  5AER A;  1BF5 A;  2K0J A;  4GPL B;  1IWQ A;  1XFW O;  3D0Y B;  4GAO A;  2KFF A;  2WND A;  4M2P A;  1AUI B;  2ZKM X;  1L2O C;  2NCO A;  1CMG A;  1J55 A;  1RTP 1;  2DOQ A;  4ZCV A;  1FF1 A;  1S6I A;  3BOW A;  3CR5 X;  2CCM A;  2BL0 B;  3I5H B;  4NDB A;  4OCI A;  3WHU B;  1WDC B;  2WCB A;  1B8C A;  1DF0 A;  4YI9 A;  1YUT A;  2BE4 A;  4JPZ B;  4OR9 B;  1DGV A;  4AQJ A;  4ZCU A;  2M9G A;  3I5G C;  3CR2 A;  3OP0 A;  2EGD A;  5CSN A;  2PVB A;  1SRA A;  1QVI Z;  1C07 A;  4C0J A;  2K2A A;  2F33 A;  2L2E A;  4NQG A;  4DUQ A;  1SR6 B;  3VRR A;  5HKY A;  1EJ3 A;  2I94 A;  2M49 B;  2L0P A;  3M0W A;  3NSI A;  1K95 A;  5D7F A;  4E68 A;  4MBE A;  4L9M A;  1CDM A;  1BR4 B;  1LVC D;  2E6W A;  2LAN A;  4CLN A;  2V53 A;  5DKQ A;  1DJG A;  1NWD A;  5AAN A;  2PSR A;  5D69 A;  2KAX A;  2KSP A;  5FYX A;  1SPY A;  1SNL A;  3SG5 A;  1JSA A;  4OKH A;  2LHL A;  1BU3 A;  1QJT A;  1CFP A;  1YVL A;  2IS9 A;  3ZWH A;  2L5X B;  4DCK A;  4C0L A;  1QV1 A;  3TS5 B;  1BR1 B;  3AAJ A;  4GFT A;  3C1V A;  1R6P A;  2BKI B;  3EK8 A;  1KK8 B;  2F2O A;  3GK2 A;  5HKW A;  1KFU L;  3SJS A;  4CID A;  3OB1 B;  1QXP A;  1B8R A;  2LCP A;  1UHK A;  1PRW A;  2R2I A;  3WXA A;  4YGC B;  1CFD A;  1XFZ O;  1QIW A;  5TNC A;  1K9K A;  4QJ5 B;  1Y6W A;  1B7T Y;  1SL9 A;  1RJV A;  1CFF A;  3BUM B;  2H61 A;  2LE9 B;  3EVR A;  1QAS A;  3FS7 A;  1DMO A;  2KI4 B;  1REC A;  2LUC A;  1S26 D;  3LK0 A;  2CNP A;  1SL7 A;  3BUO B;  1SK6 D;  3GK4 X;  1G4Y R;  2L50 A;  2KI6 C;  3BQ3 A;  5I8N A;  1NUB A;  2HF5 A;  3SG4 A;  1KQV A;  4D1E A;  1TOP A;  2LUX A;  5CSI A;  1U5I A;  1MR8 A;  3I5F B;  1JF2 A;  1WRL A;  2I7A A;  2KYF A;  2Y1N A;  1BOC A;  1K9P A;  2BCA A;  1NSH A;  2OTG C;  2M0R A;  3JTD C;  2K7C A;  4MZL A;  4A4B A;  2H61 C;  1XK4 A;  1Q80 A;  2F3Z A;  2SAS A;  1CM1 A;  1N2D A;  2TN4 A;  4I5L B;  4C0K A;  2QPT A;  5HLO A;  2JUL A;  1DTL A;  2HET A;  3OX6 A;  3D0Y A;  4XJK B;  2M29 A;  1NCY A;  1OOJ A;  2KHN A;  2E30 A;  1LA3 A;  3BUX B;  1B7T Z;  1K8U A;  1NPQ A;  1ODB A;  1WLZ A;  2K8M B;  2WOS A;  1A2X A;  1JWD A;  4YGA A;  2KAV A;  3DF0 A;  2MLE C;  1MF8 B;  3EK7 A;  4MSP A;  2Y5I A;  3WNX B;  4MZK A;  5JJG A;  3KHE A;  1FPW A;  1UP5 A;  1SYM A;  1CFC A;  1RFJ A;  1QX2 A;  2HQW A;  2ZN8 A;  2LP3 A;  1QV0 A;  4PHJ A;  1J7Q A;  1FI5 A;  2KGB C;  1TRF A;  3FWB A;  1PK0 D;  5I2O A;  2JT0 A;  4ORB B;  3ZNI A;  1ZMZ A;  3F45 A;  1M63 B;  3GK1 A;  1TNQ A;  1QX5 B;  5J3X A;  1IQ5 A;  2BKH B;  1K94 A;  1TTX A;  4GGF A;  5IBW A;  1ZOT B;  4I5J A;  2CBL A;  1KK7 Z;  2ZRT A;  1IQ3 A;  2MRD A;  4CPV A;  3VRQ A;  1IJ5 A;  2Q91 A;  3DVE A;  2BEC A;  1PVB A;  1Y1U A;  1S36 A;  1YVH A;  3BUN B;  1A75 A;  3E3R A;  4A4C A;  1KSM A;  3AKB A;  1J7O A;  2JU0 A;  2LMV A;  1KCY A;  2K2F A;  3O4Y A;  3PSR A;  1AK8 A;  4NDD A;  3PFV A;  4DS7 A;  1NX1 A;  3VGO A;  1UUS A;  1K90 D;  1J7P A;  4GGF C;  4R1E A;  3JVT C;  1RRO A;  4I5N B;  1CKK A;  4I5K A;  3OB2 B;  2K7B A;  3K21 A;  1PVA A;  3TZ1 A;  3I5I B;  5AEQ A;  1IGV A;  4YBH B;  5BPJ A;  1JC2 A;  2M7L A;  3SG6 A;  1XFU O;  3SG7 A;  4MVF A;  1YX8 A;  1DJY A;  1DJX A;  4MRY A;  4YGB B;  5DKR A;  1SY9 A;  1L2O B;  2LAP A;  2Q4U A;  1XVJ A;  1K93 D;  1OMV A;  1ZUZ A;  2JC2 A;  4JQ0 D;  3SG2 A;  2G9B A;  4PE1 A;  1DJI A;  4BY5 A;  1BG1 A;  3VRP A;  4GGN A;  3FIA A;  4YRU A;  3I5G B;  1Y1A A;  5CSF A;  1F8H A;  1MUX A;  2KFG A;  1F4O A;  2JT3 A;  3RM1 A;  1YUU A;  2CT9 A;  1GQM A;  3NSL A;  2OS8 C;  1B8L A;  4OVN F;  4PHN A;  3NSK A;  3HCM A;  1M39 A;  1V1G A;  1LKJ A;  1CDP A;  3A4U B;  1L7Z A;  1QLK A;  4Q04 A;  3TDZ A;  3CWG A;  4PHM A;  1XFV O;  3O78 A;  4QJ3 B;  3CTN A;  5I2Q A;  1F55 A;  1DJH A;  1KFX L;  4WRI A;  1YR5 A;  4MLW A;  1SCM C;  3BOW B;  1IKU A;  2M8U A;  2KDH A;  1DF0 B;  5F6T A;  1MXE A;  3SIA A;  1OZO A;  1BJF A;  4BY4 A;  2PAL A;  5B8I B;  1EG4 A;  2LLU A;  1M31 A;  4M2Q A;  3FWC A;  1S3P A;  2ISD A;  1CB1 A;  1SCV A;  1CDN A;  2M7N A;  1GJY A;  3DVK A;  4MZJ A;  1GGW A;  2JT8 A;  2RGI A;  3OX5 A;  2JWW A;  1YTZ C;  1A03 A;  4ORA B;  5KU1 A;  3PAL A;  3BYA A;  2LV7 A;  1ZFS A;  3KPX A;  3TUY C;  3LL8 B;  3A8R A;  1BMO A;  1FBV A;  4PHK A;  3EVV A;  1TCO B;  5HYD A;  1BLQ A;  4PE4 A;  5ER4 X;  2P6B B;  2MJW B;  1QX7 A;  1KK7 Y;  1DJZ A;  1LA0 A;  2MAZ A; 
#chains in the Genus database with same CATH topology
 3LCP C;  1PSB A;  1TNW A;  5K89 A;  5JOL A;  3ICB A;  4N5X A;  2Y4Q A;  1P28 A;  2F8P A;  2EC6 C;  1WLM A;  2MBX A;  1KQM C;  2ZFD A;  2LM5 A;  2M97 A;  1QTX A;  2HQ8 A;  3EKJ A;  3SG3 A;  1K96 A;  2H8V A;  4UPG A;  1IRJ A;  1OE9 B;  3AAK A;  2GGZ A;  1GGZ A;  1XFR A;  2JZI A;  3CAB A;  3KF9 A;  1J1E A;  3CYZ A;  1UHN A;  1S6C A;  3DXL A;  3VRO A;  2L98 A;  1KWO C;  4FQO A;  3CR4 X;  1VRK A;  2QEV A;  4USL A;  1MXL C;  3AKA A;  1XK4 C;  3SS5 A;  3IQO A;  1S6J A;  3PN7 C;  2O5G A;  1CDL A;  1TIZ A;  1TCF A;  3PM8 A;  2BNX A;  2OTG B;  2NZ0 A;  3NXA A;  4IJ7 A;  3JTD B;  1V1F A;  4TNC A;  2G2B A;  3B87 A;  1X02 A;  5G08 A;  2KQ6 A;  4HRG A;  1W9Z A;  2LVJ A;  2KI6 D;  3CDN A;  3KEV A;  4CFQ A;  4MN0 A;  2B1U A;  2F3Y A;  1JFJ A;  2AAO A;  1ZAC A;  5DKN A;  1YRT B;  2H2K A;  2KOT A;  2BL0 C;  2KQY A;  3I5H C;  4AOM A;  3CS1 A;  1YRU B;  2KNE A;  4HSZ A;  1FW4 A;  1CM4 A;  2NCP A;  2YGU A;  4U8D A;  2JNX A;  2FJU B;  1OOG A;  2LMT A;  2HPS A;  3B86 A;  3CZT X;  4XYN A;  1ALV A;  3R1V A;  4N1F A;  1U5I B;  3L47 A;  3S0G A;  1W7I B;  2I2R E;  1OMR A;  2JPT A;  1KFU S;  5KTY A;  1TUZ A;  4N1G A;  1SR6 C;  1CLM A;  1NYA A;  1UHI A;  4ETO A;  2LNK A;  1NP8 A;  4F0Z B;  1BOD A;  1KFX S;  3FE6 A;  1M46 A;  1EH2 A;  1WRZ A;  2MHH A;  4PDZ A;  2LHI A;  1TN4 A;  1IG5 A;  4JWQ A;  1G33 A;  3DZT A;  2FOT A;  2JTZ A;  1PUL A;  3NHI A;  2NLN A;  2FCE A;  4DRW A;  5CPV A;  1OOH A;  3NSO A;  1QLS A;  2JQ6 A;  2KFH A;  5HL1 A;  3NGV A;  4ICB A;  1QIV A;  3H4S E;  3HX4 A;  3IVT A;  1NCZ A;  1S1E A;  2LP2 A;  3DF0 B;  1GM0 A;  2LVI A;  1Y1X A;  1B47 A;  1UWO A;  1S5G Z;  4MRX A;  4NDC A;  4P5O E;  1CTR A;  3L4A A;  1EG3 A;  2BCB A;  4WQ2 A;  3LLE A;  3O2P A;  3CGA A;  1DT7 B;  1OSA A;  2LVK A;  1XFX O;  1AJ5 A;  1FI6 A;  4HRH A;  5ER5 A;  4PAL A;  2WCF A;  4IL1 A;  3TS5 C;  1JBA A;  1UUR A;  2F2P A;  1KK8 C;  2AMI A;  1DEK A;  4AQI A;  2WCH A;  4PE0 A;  2BE6 A;  1PAL A;  1OMD A;  3S0E A;  1AVS A;  3JVT B;  1H8B A;  2LVV A;  1B1G A;  1SSE B;  1C7V A;  2JXL A;  1XA5 A;  1SMG A;  2PMY A;  1JUO A;  2KYC A;  2COL B;  2FCD A;  1WRK A;  2L4H A;  4FTG A;  1SL8 A;  2KGR A;  4QJ4 B;  5PAL A;  3D75 A;  3IQQ A;  5I2L A;  1A75 B;  1MQ1 A;  3EKH A;  2JXC A;  2PRU A;  2K7O A;  2M1K B;  4DIR A;  5CSJ A;  1OQP A;  2KI4 C;  1RK9 A;  3TDI A;  1QS7 A;  1AJ4 A;  1A29 A;  1A4P A;  4XJK A;  2LMU A;  4M2O A;  3OGN A;  1TUJ A;  1Y0V H;  1DVI A;  5GQQ C;  4HRE E;  2NXQ A;  2ZNE A;  1DJW A;  2LC5 A;  2M1U A;  5HKZ A;  2JNF A;  2LLT A;  1CLL A;  2MLF C;  2ZND A;  3NHT A;  4GUK A;  4CFR A;  1NCX A;  3I5F C;  3D10 A;  1PSR A;  2ERB A;  1RWY A;  2KBI A;  2WOR A;  2JRF A;  1IH0 A;  2K61 A;  2OS8 B;  3WHT B;  3B7A A;  5KSZ A;  2GGM A;  1IJ6 A;  1QAT A;  1R2U A;  2OPO A;  2D8N A;  1N0Y A;  3BUW B;  3SIB A;  1F4Q A;  1C7W A;  3RZS A;  1TNP A;  1BT6 A;  1CNP A;  2K7D A;  1N65 A;  2GV5 A;  1AHR A;  2BBN A;  1LXF C;  1SCM B;  4GBA A;  1K9U A;  1D1O A;  2PYQ A;  1EL4 A;  1LIN A;  1SBJ A;  1OZS A;  2I18 A;  2MA2 A;  3VRN A;  2WC8 A;  5D3O A;  2BCX A;  3TDU A;  2BBM A;  2GTE A;  2O60 A;  3O4X A;  4YI8 A;  3OHM B;  2VRG A;  3BXK A;  1YUR A;  3RLZ A;  1WY9 A;  1MWN A;  1NX0 A;  4WQ3 A;  1G8I A;  2AUC A;  1XFY O;  4ORC B;  2KBM A;  1AP4 A;  2FJY A;  1CLB A;  3LK1 A;  1TWO A;  2CTN A;  1SKT A;  1K2H A;  3PLF B;  3TUY B;  4GNK B;  1M45 A;  3DVM A;  1DGU A;  3D77 A;  1NX3 A;  1CMF A;  1H4B A;  4YGD B;  1J1D A;  1JF0 A;  2LLS A;  1B9A A;  1UHJ A;  4KYN A;  2JOJ A;  2A4J A;  2EHB A;  3EK4 A;  3KO0 A;  2ZN9 A;  1E8A A;  1XYD A;  4P2Y B;  2PAS A;  1YUS A;  1KSO A;  4YGE B;  2L4I A;  1TNX A;  4PCW A;  1DQE A;  1JFK A;  1S5G Y;  3GOF A;  1YX7 A;  2WCE A;  1F71 A;  2EC6 B;  1HQV A;  1KQM B;  1W7J B;  3PM2 A;  2L51 A;  5HLV A;  3MSE B;  1QVI Y;  1WDC C;  5AXI A;  2SCP A;  3DD4 A;  2Y1M A;  2QAC A;  3IF7 A;  3S0A A;  1F54 A;  3CLN A;  4MEW A;  3EG5 B;  3QRX A;  1NIW A;  3D73 A;  3PAT A;  3EVU A;  1F70 A;  2QEB A;  3O6B A;  2KAY A;  1B4C A;  2M3W A;  1KWO B;  4OZD A;  1EXR A;  5AFP A;  1MHO A;  3I5I C;  1NX2 A;  2WC6 A;  3PN7 B;  1HT9 A;  2JTT A;  2ZRS A;  4PE7 A;  1ALW A;  4OV2 A;  3DVJ A;  1XO5 A;  1J7R A;  1UHH A;  1SW8 A;  2CXJ A;  5AER A;  1BF5 A;  2K0J A;  4GPL B;  1IWQ A;  1XFW O;  3D0Y B;  4GAO A;  2KFF A;  1OW4 A;  2WND A;  4M2P A;  4F7F A;  1AUI B;  2ZKM X;  1L2O C;  2NCO A;  1OOI X;  1CMG A;  1J55 A;  1RTP 1;  2DOQ A;  4ZCV A;  1FF1 A;  3PJI A;  1S6I A;  3BOW A;  3CR5 X;  2QEH A;  2CCM A;  2BL0 B;  3I5H B;  4NDB A;  4OCI A;  3WHU B;  1WDC B;  2WCB A;  1B8C A;  3D76 A;  1DF0 A;  4YI9 A;  1YUT A;  2BE4 A;  4JPZ B;  4OR9 B;  1DGV A;  5EL2 A;  3CZ2 A;  4ZCU A;  4AQJ A;  2M9G A;  3I5G C;  3CR2 A;  3OP0 A;  2EGD A;  5CSN A;  2PVB A;  1SRA A;  1QVI Z;  1C07 A;  4C0J A;  2K2A A;  2F33 A;  2L2E A;  4NQG A;  4DUQ A;  1SR6 B;  3VRR A;  5HKY A;  1EJ3 A;  2I94 A;  2M49 B;  2L0P A;  3M0W A;  1C3Z A;  3NSI A;  3FE9 A;  1K95 A;  5FI6 A;  5D7F A;  4E68 A;  4MBE A;  4L9M A;  1CDM A;  1BR4 B;  1LVC D;  2E6W A;  2LAN A;  4CLN A;  3Q8I A;  2V53 A;  5DKQ A;  1DJG A;  1NWD A;  5AAN A;  2PSR A;  5D69 A;  2KAX A;  2KSP A;  5FYX A;  3V2L A;  1SPY A;  1SNL A;  3SG5 A;  1JSA A;  4OKH A;  2L2C A;  2LHL A;  1BU3 A;  1QJT A;  1CFP A;  1YVL A;  2IS9 A;  3ZWH A;  2L5X B;  4DCK A;  4C0L A;  3S0F A;  1QV1 A;  3TS5 B;  1BR1 B;  3AAJ A;  4GFT A;  3C1V A;  1R6P A;  2BKI B;  3EK8 A;  1KK8 B;  2F2O A;  3GK2 A;  5HKW A;  1IIO A;  1KFU L;  3SJS A;  4CID A;  3OB1 B;  1QXP A;  1B8R A;  2LCP A;  2BAP A;  1UHK A;  1PRW A;  2QEO A;  3DY9 A;  2R2I A;  3WXA A;  4YGC B;  1CFD A;  1XFZ O;  1QIW A;  2WCJ A;  1K9K A;  5TNC A;  4QJ5 B;  1Y6W A;  5DIC A;  1B7T Y;  1SL9 A;  1RJV A;  2KPH A;  2WCK A;  1CFF A;  3BUM B;  2H61 A;  5FI7 A;  2LE9 B;  3EVR A;  1QAS A;  3FS7 A;  1DMO A;  2P70 A;  2KI4 B;  1REC A;  2LUC A;  1S26 D;  3LK0 A;  2CNP A;  1SL7 A;  1T14 A;  1SK6 D;  3BUO B;  3GK4 X;  1G4Y R;  2L50 A;  1QWV A;  2KI6 C;  3BQ3 A;  5I8N A;  1NUB A;  2HF5 A;  3SG4 A;  1KQV A;  4D1E A;  1TOP A;  2LUX A;  5CSI A;  1U5I A;  1MR8 A;  3I5F B;  1JF2 A;  1WRL A;  4JKT A;  2I7A A;  2KYF A;  2Y1N A;  4PT1 A;  1BOC A;  1K9P A;  2BCA A;  1NSH A;  2OTG C;  2M0R A;  3JTD C;  2K7C A;  3L4L A;  4MZL A;  4A4B A;  2H61 C;  1XK4 A;  1Q80 A;  2F3Z A;  2SAS A;  1CM1 A;  1N2D A;  2TN4 A;  4I5L B;  4C0K A;  2QPT A;  5HLO A;  2JUL A;  3BFB A;  1DTL A;  3SS3 A;  2HET A;  3OX6 A;  3D0Y A;  4XJK B;  2M29 A;  1NCY A;  1OOJ A;  2KHN A;  2KLD A;  1C3Y A;  2JPO A;  1OOF A;  2E30 A;  1LA3 A;  3BUX B;  1B7T Z;  1K8U A;  1NPQ A;  1ODB A;  1WLZ A;  2K8M B;  2WOS A;  1A2X A;  1JWD A;  4YGA A;  2KAV A;  3DF0 A;  2MLE C;  2K60 A;  3S0D A;  1MF8 B;  3EK7 A;  4MSP A;  3B88 A;  2Y5I A;  3VB1 A;  3D78 A;  3WNX B;  4MZK A;  3UNW A;  3KHE A;  5JJG A;  1UP5 A;  1FPW A;  1SYM A;  1CFC A;  1RFJ A;  1QX2 A;  2HQW A;  2ZN8 A;  2LP3 A;  1QV0 A;  4PHJ A;  1J7Q A;  1FI5 A;  2KGB C;  1TRF A;  3FWB A;  1PK0 D;  3K1E A;  5I2O A;  2JT0 A;  4ORB B;  3ZNI A;  1ZMZ A;  3BJH A;  3F45 A;  1M63 B;  3GK1 A;  1TNQ A;  1QX5 B;  5J3X A;  1IQ5 A;  2BKH B;  1K94 A;  1TTX A;  4GGF A;  5IBW A;  1ZOT B;  4I5J A;  2CBL A;  1KK7 Z;  2ZRT A;  1IQ3 A;  3UO9 A;  2MRD A;  4CPV A;  3OBV A;  3VRQ A;  1DC1 A;  1IJ5 A;  2Q91 A;  3R72 A;  3DVE A;  2BEC A;  1PVB A;  1Y1U A;  1S36 A;  1YVH A;  3BUN B;  1A75 A;  3E3R A;  1DEL A;  4A4C A;  1KSM A;  3AKB A;  1J7O A;  2JU0 A;  4FQT A;  2LMV A;  4INX A;  1KCY A;  2K2F A;  3O4Y A;  3PSR A;  1AK8 A;  4NDD A;  3PFV A;  4DS7 A;  1NX1 A;  3VGO A;  1UUS A;  3R1O A;  3S0B A;  3CZ0 A;  1K90 D;  1J7P A;  4GGF C;  4R1E A;  3JVT C;  1RRO A;  2KLE A;  4I5N B;  1CKK A;  4I5K A;  3OB2 B;  2K7B A;  3K21 A;  1PVA A;  3TZ1 A;  3I5I B;  5AEQ A;  1IGV A;  4YBH B;  5I94 A;  5BPJ A;  1JC2 A;  2M7L A;  1Z2C B;  3SG6 A;  1XFU O;  3CZ1 A;  3SG7 A;  4JD9 A;  4MVF A;  1YX8 A;  1DJY A;  1DJX A;  4MRY A;  3FE8 A;  4YGB B;  1SY9 A;  5DKR A;  1L2O B;  2LAP A;  2Q4U A;  1XVJ A;  1K93 D;  1OMV A;  1ZUZ A;  2JC2 A;  4JQ0 D;  3SG2 A;  2G9B A;  4PE1 A;  3QME A;  1DJI A;  4BY5 A;  1BG1 A;  2WC5 A;  3VRP A;  4GGN A;  3FIA A;  4YRU A;  3I5G B;  1Y1A A;  5CSF A;  1F8H A;  1MUX A;  2KFG A;  1F4O A;  2JT3 A;  3RM1 A;  1YUU A;  2CT9 A;  1GQM A;  3NSL A;  2OS8 C;  1B8L A;  4OVN F;  4PHN A;  3NSK A;  3HCM A;  1M39 A;  1V1G A;  1LKJ A;  1CDP A;  3A4U B;  1L7Z A;  1QLK A;  4Q04 A;  3TDZ A;  4INW A;  3CWG A;  4PHM A;  1XFV O;  3O78 A;  4QJ3 B;  3CTN A;  5I2Q A;  1F55 A;  1DJH A;  1KFX L;  1LS8 A;  4WRI A;  1YR5 A;  4MLW A;  1SCM C;  3BOW B;  3DYE A;  1IKU A;  2M8U A;  2KDH A;  3BFA A;  1DF0 B;  5F6T A;  1MXE A;  3SIA A;  1OZO A;  1BJF A;  3BFH A;  3D74 A;  2PAL A;  4BY4 A;  5B8I B;  1EG4 A;  2LLU A;  1M31 A;  4M2Q A;  3FWC A;  1S3P A;  2ISD A;  1CB1 A;  1SCV A;  1CDN A;  2M7N A;  1GJY A;  3DVK A;  4MZJ A;  1GGW A;  2L5Y A;  2JT8 A;  2P71 A;  2RGI A;  3OX5 A;  2QDI A;  2JWW A;  1YTZ C;  1A03 A;  4ORA B;  3SS4 A;  5KU1 A;  3PAL A;  3BYA A;  2LV7 A;  1ZFS A;  3KPX A;  3R1P A;  3TUY C;  3LL8 B;  3A8R A;  1BMO A;  1FBV A;  3B6X A;  4PHK A;  3EVV A;  1TCO B;  5HYD A;  1BLQ A;  4PE4 A;  5ER4 X;  1Z4H A;  2P6B B;  2MJW B;  2PQL A;  2WCM A;  1QX7 A;  1KK7 Y;  5FI2 A;  1DJZ A;  2WCL A;  1ORG A;  1LA0 A;  2MAZ A;  3N7H A; 
#chains in the Genus database with same CATH homology
 3LCP C;  1PSB A;  1TNW A;  5K89 A;  5JOL A;  3ICB A;  4N5X A;  2Y4Q A;  2F8P A;  2EC6 C;  1WLM A;  2MBX A;  1KQM C;  2ZFD A;  2LM5 A;  2M97 A;  1QTX A;  2HQ8 A;  3EKJ A;  3SG3 A;  1K96 A;  4UPG A;  1IRJ A;  1OE9 B;  3AAK A;  2GGZ A;  1GGZ A;  3KF9 A;  2JZI A;  1J1E A;  1UHN A;  1S6C A;  3VRO A;  2L98 A;  1KWO C;  4FQO A;  3CR4 X;  1VRK A;  4USL A;  1MXL C;  3AKA A;  1XK4 C;  3IQO A;  1S6J A;  3PN7 C;  2O5G A;  1CDL A;  1TIZ A;  1TCF A;  3PM8 A;  2OTG B;  2NZ0 A;  3NXA A;  4TNC A;  3JTD B;  1V1F A;  2G2B A;  1X02 A;  5G08 A;  2KQ6 A;  4HRG A;  2LVJ A;  2KI6 D;  3KEV A;  4CFQ A;  1JFJ A;  4MN0 A;  2B1U A;  2F3Y A;  2AAO A;  1ZAC A;  5DKN A;  1YRT B;  2H2K A;  2KOT A;  2BL0 C;  2KQY A;  3I5H C;  4AOM A;  3CS1 A;  1YRU B;  2KNE A;  4HSZ A;  1FW4 A;  1CM4 A;  2NCP A;  4U8D A;  2JNX A;  2FJU B;  2LMT A;  4XYN A;  2HPS A;  3CZT X;  1ALV A;  4N1F A;  1U5I B;  1W7I B;  2I2R E;  1OMR A;  2JPT A;  1KFU S;  5KTY A;  4N1G A;  1SR6 C;  1CLM A;  1NYA A;  1UHI A;  4ETO A;  2LNK A;  1NP8 A;  4F0Z B;  1BOD A;  1KFX S;  1M46 A;  1EH2 A;  1WRZ A;  2MHH A;  4PDZ A;  2LHI A;  1TN4 A;  1IG5 A;  4JWQ A;  1G33 A;  2FOT A;  2JTZ A;  1PUL A;  2NLN A;  2FCE A;  4DRW A;  5CPV A;  3NSO A;  1QLS A;  2JQ6 A;  2KFH A;  4ICB A;  1QIV A;  3H4S E;  3HX4 A;  1NCZ A;  1S1E A;  2LP2 A;  3DF0 B;  2LVI A;  1Y1X A;  1B47 A;  1UWO A;  1S5G Z;  4MRX A;  4NDC A;  4P5O E;  1CTR A;  1EG3 A;  2BCB A;  4WQ2 A;  3LLE A;  3O2P A;  3CGA A;  1DT7 B;  1OSA A;  2LVK A;  1XFX O;  1AJ5 A;  1FI6 A;  4HRH A;  5ER5 A;  4PAL A;  2WCF A;  4IL1 A;  3TS5 C;  1JBA A;  1UUR A;  2F2P A;  1KK8 C;  2AMI A;  4AQI A;  4PE0 A;  2BE6 A;  1PAL A;  1OMD A;  1AVS A;  3JVT B;  1H8B A;  2LVV A;  1B1G A;  1C7V A;  2JXL A;  1XA5 A;  1SMG A;  2PMY A;  1JUO A;  2KYC A;  2COL B;  2FCD A;  1WRK A;  2L4H A;  4FTG A;  1SL8 A;  2KGR A;  4QJ4 B;  5PAL A;  3IQQ A;  5I2L A;  1A75 B;  1MQ1 A;  3EKH A;  2JXC A;  2PRU A;  2K7O A;  2M1K B;  4DIR A;  5CSJ A;  1OQP A;  2KI4 C;  1RK9 A;  3TDI A;  1QS7 A;  1AJ4 A;  1A29 A;  1A4P A;  4XJK A;  2LMU A;  4M2O A;  1Y0V H;  5GQQ C;  1DVI A;  4HRE E;  2NXQ A;  2ZNE A;  1DJW A;  2LC5 A;  2M1U A;  5HKZ A;  2JNF A;  2LLT A;  1CLL A;  2MLF C;  2ZND A;  4GUK A;  4CFR A;  1NCX A;  3I5F C;  3D10 A;  1PSR A;  2WOR A;  1RWY A;  2KBI A;  2JRF A;  1IH0 A;  2K61 A;  2OS8 B;  3WHT B;  5KSZ A;  2GGM A;  1IJ6 A;  1QAT A;  1R2U A;  2OPO A;  2D8N A;  1N0Y A;  3BUW B;  3SIB A;  1F4Q A;  1C7W A;  1TNP A;  1BT6 A;  1CNP A;  2K7D A;  1N65 A;  2GV5 A;  1AHR A;  2BBN A;  1LXF C;  1SCM B;  4GBA A;  1K9U A;  1D1O A;  1EL4 A;  1LIN A;  1SBJ A;  1OZS A;  2I18 A;  2MA2 A;  3VRN A;  2WC8 A;  2BCX A;  3TDU A;  2BBM A;  2O60 A;  4YI8 A;  3OHM B;  2VRG A;  3BXK A;  1YUR A;  3RLZ A;  1WY9 A;  1MWN A;  1NX0 A;  4WQ3 A;  1G8I A;  2AUC A;  1XFY O;  4ORC B;  2KBM A;  1AP4 A;  1CLB A;  3LK1 A;  2CTN A;  1SKT A;  1K2H A;  3PLF B;  3TUY B;  4GNK B;  1M45 A;  3DVM A;  1DGU A;  1NX3 A;  1CMF A;  1H4B A;  4YGD B;  1J1D A;  1JF0 A;  2LLS A;  1B9A A;  1UHJ A;  2JOJ A;  2A4J A;  2EHB A;  3EK4 A;  3KO0 A;  2ZN9 A;  1E8A A;  1XYD A;  4P2Y B;  2PAS A;  1YUS A;  1KSO A;  4YGE B;  2L4I A;  1TNX A;  4PCW A;  1JFK A;  1S5G Y;  3GOF A;  1YX7 A;  2WCE A;  1F71 A;  2EC6 B;  1HQV A;  1KQM B;  1W7J B;  5HLV A;  2L51 A;  3MSE B;  1QVI Y;  1WDC C;  5AXI A;  2SCP A;  3DD4 A;  2Y1M A;  2QAC A;  3IF7 A;  1F54 A;  3CLN A;  4MEW A;  3QRX A;  1NIW A;  3PAT A;  3EVU A;  1F70 A;  3O6B A;  2KAY A;  1B4C A;  2M3W A;  1KWO B;  1EXR A;  5AFP A;  1MHO A;  3I5I C;  1NX2 A;  3PN7 B;  1HT9 A;  2JTT A;  2ZRS A;  4PE7 A;  1ALW A;  4OV2 A;  3DVJ A;  1XO5 A;  1J7R A;  1UHH A;  1SW8 A;  2CXJ A;  5AER A;  1BF5 A;  2K0J A;  4GPL B;  1IWQ A;  1XFW O;  3D0Y B;  4GAO A;  2KFF A;  2WND A;  4M2P A;  1AUI B;  2ZKM X;  1L2O C;  2NCO A;  1CMG A;  1J55 A;  1RTP 1;  2DOQ A;  4ZCV A;  1FF1 A;  1S6I A;  3BOW A;  3CR5 X;  2CCM A;  2BL0 B;  3I5H B;  4NDB A;  4OCI A;  3WHU B;  1WDC B;  2WCB A;  1B8C A;  1DF0 A;  4YI9 A;  1YUT A;  2BE4 A;  4JPZ B;  4OR9 B;  1DGV A;  4AQJ A;  4ZCU A;  2M9G A;  3I5G C;  3CR2 A;  3OP0 A;  2EGD A;  5CSN A;  2PVB A;  1SRA A;  1QVI Z;  1C07 A;  4C0J A;  2K2A A;  2F33 A;  2L2E A;  4NQG A;  4DUQ A;  1SR6 B;  3VRR A;  5HKY A;  1EJ3 A;  2I94 A;  2M49 B;  2L0P A;  3M0W A;  3NSI A;  1K95 A;  5D7F A;  4E68 A;  4MBE A;  4L9M A;  1CDM A;  1BR4 B;  1LVC D;  2E6W A;  2LAN A;  4CLN A;  2V53 A;  5DKQ A;  1DJG A;  1NWD A;  5AAN A;  2PSR A;  5D69 A;  2KAX A;  2KSP A;  5FYX A;  1SPY A;  1SNL A;  3SG5 A;  1JSA A;  4OKH A;  2LHL A;  1BU3 A;  1QJT A;  1CFP A;  1YVL A;  2IS9 A;  3ZWH A;  2L5X B;  4DCK A;  4C0L A;  1QV1 A;  3TS5 B;  1BR1 B;  3AAJ A;  4GFT A;  3C1V A;  1R6P A;  2BKI B;  3EK8 A;  1KK8 B;  2F2O A;  3GK2 A;  5HKW A;  1KFU L;  3SJS A;  4CID A;  3OB1 B;  1QXP A;  1B8R A;  2LCP A;  1UHK A;  1PRW A;  2R2I A;  3WXA A;  4YGC B;  1CFD A;  1XFZ O;  1QIW A;  5TNC A;  1K9K A;  4QJ5 B;  1Y6W A;  1B7T Y;  1SL9 A;  1RJV A;  1CFF A;  3BUM B;  2H61 A;  2LE9 B;  3EVR A;  1QAS A;  3FS7 A;  1DMO A;  2KI4 B;  1REC A;  2LUC A;  1S26 D;  3LK0 A;  2CNP A;  1SL7 A;  3BUO B;  1SK6 D;  3GK4 X;  1G4Y R;  2L50 A;  2KI6 C;  3BQ3 A;  5I8N A;  1NUB A;  2HF5 A;  3SG4 A;  1KQV A;  4D1E A;  1TOP A;  2LUX A;  5CSI A;  1U5I A;  1MR8 A;  3I5F B;  1JF2 A;  1WRL A;  2I7A A;  2KYF A;  2Y1N A;  1BOC A;  1K9P A;  2BCA A;  1NSH A;  2OTG C;  2M0R A;  3JTD C;  2K7C A;  4MZL A;  4A4B A;  2H61 C;  1XK4 A;  1Q80 A;  2F3Z A;  2SAS A;  1CM1 A;  1N2D A;  2TN4 A;  4I5L B;  4C0K A;  2QPT A;  5HLO A;  2JUL A;  1DTL A;  2HET A;  3OX6 A;  3D0Y A;  4XJK B;  2M29 A;  1NCY A;  1OOJ A;  2KHN A;  2E30 A;  1LA3 A;  3BUX B;  1B7T Z;  1K8U A;  1NPQ A;  1ODB A;  1WLZ A;  2K8M B;  2WOS A;  1A2X A;  1JWD A;  4YGA A;  2KAV A;  3DF0 A;  2MLE C;  1MF8 B;  3EK7 A;  4MSP A;  2Y5I A;  3WNX B;  4MZK A;  5JJG A;  3KHE A;  1FPW A;  1UP5 A;  1SYM A;  1CFC A;  1RFJ A;  1QX2 A;  2HQW A;  2ZN8 A;  2LP3 A;  1QV0 A;  4PHJ A;  1J7Q A;  1FI5 A;  2KGB C;  1TRF A;  3FWB A;  1PK0 D;  5I2O A;  2JT0 A;  4ORB B;  3ZNI A;  1ZMZ A;  3F45 A;  1M63 B;  3GK1 A;  1TNQ A;  1QX5 B;  5J3X A;  1IQ5 A;  2BKH B;  1K94 A;  1TTX A;  4GGF A;  5IBW A;  1ZOT B;  4I5J A;  2CBL A;  1KK7 Z;  2ZRT A;  1IQ3 A;  2MRD A;  4CPV A;  3VRQ A;  1IJ5 A;  2Q91 A;  3DVE A;  2BEC A;  1PVB A;  1Y1U A;  1S36 A;  1YVH A;  3BUN B;  1A75 A;  3E3R A;  4A4C A;  1KSM A;  3AKB A;  1J7O A;  2JU0 A;  2LMV A;  1KCY A;  2K2F A;  3O4Y A;  3PSR A;  1AK8 A;  4NDD A;  3PFV A;  4DS7 A;  1NX1 A;  3VGO A;  1UUS A;  1K90 D;  1J7P A;  4GGF C;  4R1E A;  3JVT C;  1RRO A;  4I5N B;  1CKK A;  4I5K A;  3OB2 B;  2K7B A;  3K21 A;  1PVA A;  3TZ1 A;  3I5I B;  5AEQ A;  1IGV A;  4YBH B;  5BPJ A;  1JC2 A;  2M7L A;  3SG6 A;  1XFU O;  3SG7 A;  4MVF A;  1YX8 A;  1DJY A;  1DJX A;  4MRY A;  4YGB B;  5DKR A;  1SY9 A;  1L2O B;  2LAP A;  2Q4U A;  1XVJ A;  1K93 D;  1OMV A;  1ZUZ A;  2JC2 A;  4JQ0 D;  3SG2 A;  2G9B A;  4PE1 A;  1DJI A;  4BY5 A;  1BG1 A;  3VRP A;  4GGN A;  3FIA A;  4YRU A;  3I5G B;  1Y1A A;  5CSF A;  1F8H A;  1MUX A;  2KFG A;  1F4O A;  2JT3 A;  3RM1 A;  1YUU A;  2CT9 A;  1GQM A;  3NSL A;  2OS8 C;  1B8L A;  4OVN F;  4PHN A;  3NSK A;  3HCM A;  1M39 A;  1V1G A;  1LKJ A;  1CDP A;  3A4U B;  1L7Z A;  1QLK A;  4Q04 A;  3TDZ A;  3CWG A;  4PHM A;  1XFV O;  3O78 A;  4QJ3 B;  3CTN A;  5I2Q A;  1F55 A;  1DJH A;  1KFX L;  4WRI A;  1YR5 A;  4MLW A;  1SCM C;  3BOW B;  1IKU A;  2M8U A;  2KDH A;  1DF0 B;  5F6T A;  1MXE A;  3SIA A;  1OZO A;  1BJF A;  4BY4 A;  2PAL A;  5B8I B;  1EG4 A;  2LLU A;  1M31 A;  4M2Q A;  3FWC A;  1S3P A;  2ISD A;  1CB1 A;  1SCV A;  1CDN A;  2M7N A;  1GJY A;  3DVK A;  4MZJ A;  1GGW A;  2JT8 A;  2RGI A;  3OX5 A;  2JWW A;  1YTZ C;  1A03 A;  4ORA B;  5KU1 A;  3PAL A;  3BYA A;  2LV7 A;  1ZFS A;  3KPX A;  3TUY C;  3LL8 B;  3A8R A;  1BMO A;  1FBV A;  4PHK A;  3EVV A;  1TCO B;  5HYD A;  1BLQ A;  4PE4 A;  5ER4 X;  2P6B B;  2MJW B;  1QX7 A;  1KK7 Y;  1DJZ A;  1LA0 A;  2MAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...