1NX2A

Calpain domain vi
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 66
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx2A00
4I5KA 2CCMA 4PHKA 3HX4A 2LANA 1K95A 1UHHA 1YUTA 5I2LA 2F3YA 5G08A 3O4YA 2BCAA 4C0LA 1R6PA 4MBEA 3LCPC 1QX7A 3I5IC 1Q80A 2NCPA 1R2UA 2BKIB 2WNDA 1K96A 1QIVA 3TS5C 2KYFA 1F4QA 2WCFA 1Y1AA 3DF0A 2M1UA 4YGEB 4GPLB 1WDCB 2LVIA 2KFFA 3SIAA 1M31A 1EG4A 2CXJA 2F2OA 2LE9B 5ER4X 5HKZA 1PALA 2LVJA 2QPTA 5JJGA 3JVTC 1XFZO 5AEQA 4MSPA 1TCFA 2K8MB 1DT7B 1W7IB 1XVJA 2OTGB 4N1FA 3CWGA 1CDPA 4DCKA 2EC6C 3CS1A 1U5IB 3SG2A 4PE4A 1NCZA 5DKRA 4AQIA 1TNWA 2LVVA 1QJTA 2KHNA 1ZOTB 4GGNA 4CFRA 1H8BA 2Y1NA 4M2PA 4YGBB 3DD4A 1CFFA 1G8IA 3ZNIA 2KI6D 4P2YB 1ALVA 4MVFA 1SK6D 1QS7A 1TN4A 1DJGA 4HSZA 3A4UB 4PALA 1QVIY 4HRGA 2JT0A 3BQ3A 4MN0A 1ZUZA 2BL0B 4QJ5B 3OX5A 1KCYA 5ER5A 4GBAA 1DTLA 2BBMA 2L0PA 3D10A 1IG5A 1SL9A 3SG5A 1IQ5A 4N5XA 5TNCA 2SASA 1HT9A 1KQMC 1DMOA 2K0JA 1UURA 4OVNF 4ZCUA 2KDHA 2OS8B 1B7TY 1C07A 1G33A 1WRZA 1V1GA 1B8CA 1IRJA 1IQ3A 1C7WA 1DJWA 2ZN9A 1XYDA 3RM1A 4XJKB 3WXAA 4C0KA 1OQPA 1A2XA 1ZFSA 1NWDA 5DKNA 1AJ4A 2PALA 5K89A 2M7NA 4DRWA 2V53A 1AVSA 1XK4A 2JXLA 1XO5A 5BPJA 2KAXA 1S1EA 1TOPA 1CFDA 1SBJA 2I7AA 4MZKA 3OP0A 4MZJA 1JC2A 1SRAA 1JBAA 3DVKA 4I5NB 3IF7A 1CKKA 3SG7A 1SR6C 1KFUL 1NP8A 2LMUA 1KK8C 1KQVA 1ODBA 1WY9A 1A03A 1FBVA 1YX7A 1MUXA 1LA0A 3DF0B 1SL7A 3MSEB 1N0YA 2LMVA 2MBXA 2LC5A 1L2OC 2Y1MA 2LHLA 4N1GA 5HKYA 1TRFA 1OMVA 3LLEA 1S5GY 2E30A 1LXFC 2GGMA 2ZRTA 5PALA 3BUXB 4YBHB 3CGAA 2JTTA 1OSAA 2JTZA 3PN7C 4ORBB 1EH2A 2JNXA 3VRPA 2LP2A 1WRKA 1BT6A 5GQQC 2M0RA 2K61A 1RECA 3PFVA 1QLSA 2LAPA 2ZN8A 3EK8A 5AERA 2KFGA 1GJYA 2HQ8A 2L4IA 4OV2A 1SCMC 1M39A 1OMDA 3EK4A 1CM4A 2M97A 1YVLA 5DKQA 1YUSA 3BXKA 2F8PA 2I94A 4GFTA 3JTDC 2LUCA 4JQ0D 1IKUA 2QACA 3I5GC 1K93D 1KWOC 2LLUA 2BBNA 3KO0A 1XFXO 2AUCA 4Q04A 2FOTA 4D1EA 2KI4B 1TNQA 2KQ6A 2HQWA 3LK1A 4I5LB 1G4YR 1SMGA 4PHJA 4WQ3A 2PSRA 4FTGA 4QJ4B 1K8UA 1NX1A 1PSBA 4YGDB 2B1UA 1J7QA 2R2IA 4P5OE 2L2EA 1QV1A 1J1DA 2WCEA 3CTNA 4U8DA 2F33A 1AJ5A 1K94A 5HLVA 1NX3A 1A4PA 2PVBA 3I5HC 3FIAA 1V1FA 1BR4B 2F2PA 1E8AA 1DJYA 2MLEC 3H4SE 1XFWO 4NDCA 1BR1B 2O60A 3EKJA 4A4CA 2K7CA 2LLTA 3A8RA 4PE1A 1RFJA 1CDNA 1FI6A 2OTGC 4OCIA 2EGDA 1B8RA 1OZSA 4ETOA 1MQ1A 1J55A 4M2QA 4NDDA 3O78A 3OHMB 1N2DA 2JWWA 5AFPA 2FCDA 4IL1A 5D69A 3AKBA 1NCXA 1SCVA 2WOSA 5AXIA 1EG3A 2K7BA 1UUSA 1NX2A 1CMGA 1IWQA 3I5IB 5J3XA 1VRKA 4MRYA 2JZIA 2O5GA 3TS5B 2EHBA 1F55A 2FJUB 3TUYC 1JF0A 3OB2B 2M1KB 4PE0A 2H2KA 3NSOA 2I18A 1KSOA 4YI8A 3FWCA 3TDZA 2KAYA 2JT3A 4ICBA 3VRRA 1PRWA 1FF1A 2G9BA 1CNPA 1DJHA 4JPZB 2A4JA 1ALWA 3JVTB 1K2HA 4YI9A 4OR9B 3O6BA 2KGBC 1AUIB 2H61A 2EC6B 3EVRA 3C1VA 1CDMA 2HF5A 1J1EA 1A29A 3CZTX 2Q4UA 2M8UA 1BOCA 2HPSA 1CB1A 4PDZA 1QTXA 4YRUA 1WLZA 2LMTA 2JNFA 3QRXA 3WHUB 2LUXA 1KK7Y 3I5FC 5CSFA 4YGAA 1HQVA 2PMYA 2RGIA 1CLBA 2L51A 1YTZC 4A4BA 1XA5A 1B8LA 3NSIA 1YRUB 5HKWA 2BE4A 2MAZA 2LCPA 2ZNEA 2DOQA 3GOFA 1A75A 1S6IA 1SW8A 2LM5A 1Y6WA 4NQGA 1KQMB 1QVIZ 1QLKA 2CT9A 3DVEA 1AP4A 1SNLA 2GV5A 3EK7A 2ISDA 3VGOA 1UHKA 1CFCA 5CSJA 1GGZA 1NUBA 3SG6A 1FPWA 1J7RA 4WRIA 1TCOB 1YUUA 1MR8A 2BKHB 1EJ3A 2OPOA 1S3PA 1ZACA 3BUMB 1Y1XA 1B7TZ 2KSPA 1F4OA 3BOWA 1S6CA 2KQYA 1DGVA 3KPXA 4MEWA 2KBIA 1B4CA 1MF8B 2JC2A 1JFKA 1DJZA 2KAVA 3BUOB 1RROA 2LLSA 3AAKA 3KF9A 2MA2A 3PALA 3EKHA 1BMOA 1QV0A 1QXPA 4USLA 3KHEA 1MXLC 4PHNA 4XYNA 1PSRA 5CSNA 1TIZA 2K7DA 2BCXA 1NSHA 1KK8B 1PVBA 3FS7A 3NSLA 3TZ1A 1JSAA 2NXQA 2Q91A 1BLQA 3NXAA 1QX5B 2MLFC 5I2QA 2JXCA 3LL8B 1WRLA 1MHOA 4GGFC 3VRNA 4OKHA 2ZNDA 1L2OB 3LK0A 1BG1A 2JOJA 3PLFB 2WC8A 2JULA 1F70A 4MRXA 1M46A 4ZCVA 1S6JA 4WQ2A 3D0YA 1BU3A 2KI6C 3E3RA 1YRTB 1DF0A 3PN7B 4ORCB 3ZWHA 1JWDA 1YVHA 2K2AA 3AKAA 1QIWA 1C7VA 1Y1UA 1S5GZ 3M0WA 2KGRA 3CR5X 1SYMA 3PSRA 3IQOA 4L9MA 1YR5A 1SCMB 1WDCC 5JOLA 1JF2A 1BF5A 4QJ3B 2KFHA 1TTXA 1IJ5A 2SCPA 3JTDB 1YURA 1AHRA 1KFUS 3EVVA 1SKTA 3SIBA 2JU0A 1OZOA 3I5GB 1M45A 1KWOB 4I5JA 5D7FA 1YX8A 1B1GA 1PULA 1KFXL 3CR2A 1EL4A 1SPYA 2BE6A 3BUNB 3F45A 2CTNA 2NLNA 2I2RE 1K9UA 3SJSA 1F71A 2VRGA 1XFYO 1W7JB 2KBMA 4F0ZB 1BODA 1K90D 1A75B 2M3WA 1DGUA 2NCOA 1J7OA 1F54A 2CBLA 2ZRSA 1RTP1 2ZFDA 3I5HB 2TN4A 4JWQA 1B47A 4ORAB 5FYXA 2KNEA 1ZMZA 2M9GA 3EVUA 3SG3A 2JT8A 1AK8A 2F3ZA 3NSKA 4PCWA 2BL0C 3VROA 3BOWB 1DVIA 1CLMA 4C0JA 1GQMA 1EXRA 1OMRA 2M7LA 2L98A 4MZLA 4HREE 3WHTB 5I2OA 1LKJA 1NPQA 1NYAA 4UPGA 2HETA 4FQOA 2JQ6A 2L50A 1OE9B 1LA3A 2OS8C 1RWYA 2LHIA 2LV7A 1L7ZA 1H4BA 4GUKA 2AMIA 2K7OA 2L4HA 1CMFA 2IS9A 5IBWA 1TNXA 1BJFA 2COLB 4PHMA 4PE7A 3AAJA 4TNCA 2MJWB 4DS7A 1FI5A 2PASA 1QASA 1MWNA 1NIWA 2WCBA 2L5XB 3BYAA 1WLMA 3TUYB 2LNKA 1DJIA 1X02A 1CTRA 4GGFA 4HRHA 3DVJA 3IQQA 2GGZA 3D0YB 5F6TA 3RLZA 1OOJA 4BY5A 1DF0B 1UHNA 2Y5IA 3GK4X 3VRQA 4E68A 1K9KA 2MHHA 3TDUA 2BCBA 1NCYA 2JPTA 3CLNA 5KU1A 1Y0VH 1XFUO 2NZ0A 3GK2A 4BY4A 4NDBA 1KFXS 1RK9A 2M29A 1FW4A 2ZKMX 1IH0A 4DIRA 4YGCB 2AAOA 2CNPA 2BECA 3CR4X 5KSZA 3WNXB 3ICBA 2KYCA 4DUQA 1S26D 4GAOA 1F8HA 3I5FB 1MXEA 4AOMA 1JFJA 2JRFA 2PRUA 3PM8A 1CDLA 4CIDA 5B8IB 3OX6A 1SL8A 3HCMA 1QATA 1IGVA 2MRDA 2Y4QA 3BUWB 1U5IA 1KK7Z 4CFQA 2LP3A 3OB1B 3SG4A 4CPVA 1SR6B 1PK0D 1TNPA 1LINA 1XFVO 3K21A 4GNKB 1UHJA 3DVMA 1UP5A 1IJ6A 1RJVA 2P6BB 5CPVA 2KI4C 1JUOA 2M49B 2FCEA 5CSIA 3FWBA 4MLWA 1M63B 1S36A 2H61C 1UHIA 1B9AA 1CM1A 1CFPA 1J7PA 5AANA 4R1EA 5HYDA 3KEVA 2E6WA 1CLLA 1K9PA 3O2PA 1GGWA 2LVKA 3GK1A 2K2FA 5I8NA 3TDIA 5HLOA 1SY9A 3PATA 4M2OA 2D8NA 2KOTA 5KTYA 1DJXA 1XK4C 2G2BA 1NX0A 2WORA 4XJKA 1UWOA 1QX2A 4AQJA 1PVAA 1KSMA 1LVCD 1D1OA 4CLNA 1N65A
chains in the Genus database with same CATH superfamily
4I5KA 2CCMA 4PHKA 3HX4A 2LANA 1K95A 1UHHA 3S0GA 1YUTA 5I2LA 2F3YA 5G08A 3O4YA 2BCAA 3DXLA 4C0LA 1R6PA 4MBEA 3BFHA 3LCPC 1QX7A 3I5IC 1Q80A 2NCPA 1R2UA 2BKIB 2WNDA 1K96A 1QIVA 3TS5C 2KYFA 1F4QA 3V2LA 2WCFA 1Y1AA 3DF0A 2M1UA 4YGEB 4GPLB 1WDCB 2LVIA 2KFFA 3SIAA 1M31A 3CZ1A 1EG4A 2CXJA 2F2OA 2LE9B 2FJYA 5ER4X 5HKZA 1PALA 2LVJA 2QPTA 5JJGA 4F7FA 3JVTC 1XFZO 5AEQA 4MSPA 1TCFA 2K8MB 3R1PA 1W7IB 1XVJA 2OTGB 3VB1A 1DT7B 4N1FA 5FI2A 3CWGA 1CDPA 1LS8A 4DCKA 2EC6C 5HL1A 3CS1A 1U5IB 3NGVA 3SG2A 1XFRA 1NCZA 4PE4A 5DKRA 1DC1A 4AQIA 1TNWA 3D74A 2LVVA 1QJTA 2KHNA 1ZOTB 3B6XA 4GGNA 4CFRA 1H8BA 2Y1NA 4M2PA 4YGBB 3DD4A 1CFFA 1G8IA 4FQTA 3ZNIA 2KI6D 4P2YB 1ALVA 4MVFA 1SK6D 1QS7A 1TN4A 1DJGA 4HSZA 3A4UB 4PALA 3D76A 1QVIY 4HRGA 2JT0A 3S0AA 3B7AA 3BQ3A 3L47A 1ZUZA 2BL0B 4MN0A 4QJ5B 3OX5A 1KCYA 3BJHA 4JD9A 5ER5A 4GBAA 1DTLA 2BBMA 2L0PA 3D10A 1IG5A 1SL9A 3SG5A 1IQ5A 4N5XA 5TNCA 2SASA 1HT9A 1KQMC 3DYEA 2K0JA 1DMOA 1UURA 4OVNF 4ZCUA 2KDHA 2OS8B 1B7TY 1C07A 1G33A 1WRZA 1V1GA 1B8CA 1IRJA 1IQ3A 1C7WA 1DJWA 2ZN9A 1XYDA 3RM1A 4XJKB 3WXAA 4C0KA 1OQPA 1A2XA 1ZFSA 1NWDA 5DKNA 1AJ4A 2PALA 3SS4A 3UO9A 4JKTA 5K89A 2M7NA 4DRWA 2V53A 1AVSA 1XK4A 2JXLA 1XO5A 5BPJA 2KAXA 1S1EA 1TOPA 1CFDA 1SBJA 2I7AA 3PM2A 4MZKA 3OP0A 4MZJA 1JC2A 1SRAA 1JBAA 3DVKA 2K60A 4I5NB 3IF7A 1CKKA 3SG7A 1SR6C 1KFUL 1NP8A 2LMUA 1KK8C 1KQVA 1ODBA 1WY9A 1A03A 1FBVA 1YX7A 1MUXA 1LA0A 3DF0B 1SL7A 3MSEB 1N0YA 2LMVA 2MBXA 2LC5A 1L2OC 2Y1MA 2LHLA 3CDNA 4N1GA 5HKYA 1TRFA 2BAPA 1OMVA 3LLEA 3N7HA 1S5GY 2E30A 1LXFC 2GGMA 2ZRTA 5PALA 3BUXB 4YBHB 2QEHA 3CGAA 2JTTA 1OSAA 2GTEA 2JTZA 3PN7C 4ORBB 4OZDA 1EH2A 2JNXA 3SS5A 2QEOA 3VRPA 2LP2A 3S0DA 1WRKA 1BT6A 5GQQC 2M0RA 2K61A 1RECA 3PFVA 1QLSA 2LAPA 2WCKA 2ZN8A 3EK8A 5AERA 2KFGA 1GJYA 2HQ8A 2L4IA 4OV2A 1SCMC 1M39A 1OMDA 3EK4A 1CM4A 1OOGA 2M97A 1YVLA 5DKQA 1YUSA 3BXKA 2F8PA 1DQEA 2I94A 4GFTA 3JTDC 2LUCA 4JQ0D 1IKUA 2QACA 3I5GC 1K93D 1KWOC 2WC5A 2LLUA 2BBNA 3KO0A 1XFXO 2AUCA 2KPHA 2FOTA 4Q04A 4D1EA 2KI4B 1TNQA 2KQ6A 2HQWA 3LK1A 4I5LB 1G4YR 1SMGA 4PHJA 4WQ3A 2PSRA 4FTGA 4QJ4B 1K8UA 1NX1A 3CYZA 1PSBA 4YGDB 2B1UA 1J7QA 2R2IA 4P5OE 2L2EA 1QV1A 1J1DA 2WCEA 3CTNA 4U8DA 2F33A 1AJ5A 1K94A 4KYNA 1NX3A 1A4PA 2PVBA 3I5HC 5HLVA 3FIAA 1V1FA 1BR4B 2F2PA 1E8AA 1DJYA 2MLEC 2PYQA 1XFWO 3H4SE 4NDCA 1BR1B 2O60A 3EKJA 4A4CA 2K7CA 2LLTA 4INXA 3A8RA 4PE1A 1RFJA 1CDNA 1FI6A 3FE9A 2OTGC 4OCIA 2EGDA 1B8RA 3D77A 1OZSA 4ETOA 1MQ1A 1J55A 3B86A 4M2QA 4NDDA 3O78A 3OHMB 1N2DA 2JWWA 5AFPA 2FCDA 4IL1A 5D69A 3AKBA 1NCXA 1SCVA 2WOSA 1OOHA 5AXIA 1EG3A 2K7BA 1UUSA 1NX2A 1CMGA 1IWQA 3I5IB 5J3XA 1VRKA 4MRYA 2JZIA 2O5GA 3TS5B 2EHBA 1F55A 2FJUB 3TUYC 1JF0A 3OB2B 3K1EA 2M1KB 4PE0A 1P28A 2H2KA 3NSOA 2I18A 1KSOA 2KLDA 5DICA 4YI8A 3FWCA 3TDZA 2KAYA 2JT3A 4ICBA 3VRRA 1PRWA 2WCJA 1FF1A 2G9BA 2BNXA 1CNPA 1DJHA 4JPZB 2QEVA 2A4JA 1ALWA 3JVTB 1K2HA 4YI9A 4OR9B 3S0BA 3O6BA 2KGBC 1AUIB 2H61A 1TWOA 1W9ZA 5EL2A 2EC6B 3EVRA 3C1VA 1CDMA 2HF5A 1J1EA 1A29A 3Q8IA 3CZTX 2Q4UA 2M8UA 1BOCA 1Z2CB 2HPSA 1CB1A 4PDZA 1QTXA 4YRUA 1WLZA 2LMTA 3QMEA 2JNFA 3QRXA 3WHUB 2LUXA 1KK7Y 3I5FC 5CSFA 4YGAA 1HQVA 2PMYA 2RGIA 3FE6A 1CLBA 2L51A 1YTZC 4A4BA 3OGNA 1XA5A 1B8LA 1C3YA 3NSIA 1YRUB 5HKWA 2BE4A 2MAZA 2LCPA 2ZNEA 3R72A 2DOQA 3GOFA 1A75A 1S6IA 1SW8A 2LM5A 1Y6WA 4NQGA 1KQMB 1QVIZ 2WC6A 1QLKA 3NHIA 1C3ZA 2CT9A 3DVEA 1AP4A 1SNLA 2GV5A 3EK7A 2ISDA 3VGOA 1SSEB 3R1OA 1OOFA 1UHKA 1CFCA 5CSJA 1GGZA 1NUBA 3O4XA 3SG6A 1J7RA 4WRIA 1TCOB 1YUUA 1FPWA 1MR8A 2BKHB 1EJ3A 2OPOA 1S3PA 1ZACA 3BUMB 1Y1XA 1B7TZ 2KSPA 1F4OA 3BOWA 5D3OA 1S6CA 3B88A 2KQYA 3OBVA 1DGVA 1OOIX 3KPXA 4MEWA 2KBIA 1B4CA 1MF8B 2JC2A 1JFKA 1DJZA 2KAVA 3BUOB 1RROA 2LLSA 3AAKA 3DZTA 3KF9A 2MA2A 3PALA 3EKHA 2YGUA 3UNWA 1BMOA 1QV0A 1QXPA 4USLA 3KHEA 1MXLC 4PHNA 4XYNA 1PSRA 5CSNA 1TIZA 2K7DA 1NSHA 2BCXA 1KK8B 1PVBA 3FS7A 3NSLA 3TZ1A 1JSAA 2NXQA 2Q91A 1BLQA 3NXAA 1QX5B 2MLFC 5I2QA 2JXCA 3LL8B 1WRLA 1MHOA 5FI6A 4GGFC 3VRNA 4OKHA 2ZNDA 1L2OB 2JPOA 3LK0A 5I94A 3R1VA 2JOJA 1BG1A 3PLFB 1TUJA 2WC8A 2JULA 1F70A 3D73A 1M46A 1T14A 1S6JA 4MRXA 4WQ2A 4ZCVA 3D0YA 1BU3A 2KI6C 3E3RA 2P71A 1YRTB 2H8VA 1DF0A 3PN7B 4ORCB 3ZWHA 1JWDA 1YVHA 2K2AA 3AKAA 1QIWA 1C7VA 1Y1UA 3BFBA 1S5GZ 3M0WA 2KGRA 3CR5X 1SYMA 1QWVA 3PSRA 3IQOA 4L9MA 1YR5A 1SCMB 1WDCC 5JOLA 1JF2A 1BF5A 4QJ3B 2KFHA 3S0FA 1IIOA 2WCMA 1DELA 1TTXA 1IJ5A 2SCPA 3JTDB 1YURA 1AHRA 1KFUS 3EVVA 1SKTA 3SIBA 2JU0A 1OZOA 3I5GB 1M45A 1KWOB 4I5JA 5D7FA 1YX8A 1B1GA 1PULA 1KFXL 3CR2A 1EL4A 1SPYA 2BE6A 3BUNB 3F45A 2CTNA 2NLNA 2I2RE 1K9UA 3SJSA 1F71A 2VRGA 1DEKA 1W7JB 1XFYO 2KBMA 4F0ZB 1K90D 1BODA 1A75B 2M3WA 3L4LA 1DGUA 2NCOA 1J7OA 3BFAA 1F54A 2CBLA 2ZRSA 1RTP1 2ZFDA 3I5HB 2TN4A 4JWQA 1B47A 4ORAB 5FYXA 2KNEA 1ZMZA 2M9GA 3EVUA 3SG3A 2JT8A 1AK8A 2F3ZA 2KLEA 3NSKA 2WCLA 3D75A 4PCWA 2BL0C 3VROA 3BOWB 1DVIA 1CLMA 4C0JA 1GQMA 1EXRA 1OMRA 2M7LA 2L98A 4MZLA 4HREE 3S0EA 1TUZA 3WHTB 5I2OA 1LKJA 1NPQA 1NYAA 4UPGA 2HETA 4FQOA 2JQ6A 2L50A 1OE9B 1LA3A 2OS8C 1RWYA 2LHIA 4INWA 2LV7A 1L7ZA 1H4BA 4GUKA 2AMIA 2K7OA 2L4HA 1CMFA 2IS9A 5IBWA 1TNXA 1BJFA 2COLB 3NHTA 4PE7A 3AAJA 4PHMA 2MJWB 4TNCA 4DS7A 1FI5A 2PASA 1QASA 1MWNA 1NIWA 2WCBA 2L5XB 3BYAA 1WLMA 4IJ7A 3TUYB 2LNKA 3IVTA 1DJIA 1X02A 1CTRA 4GGFA 4HRHA 3DVJA 3IQQA 2GGZA 3D0YB 5F6TA 3RLZA 1OOJA 4BY5A 1DF0B 3FE8A 1UHNA 2QDIA 2Y5IA 3CZ2A 3GK4X 3VRQA 4E68A 1K9KA 2MHHA 3TDUA 2BCBA 1NCYA 2JPTA 3CLNA 5KU1A 1Y0VH 1XFUO 2NZ0A 3GK2A 4BY4A 4NDBA 1KFXS 1RK9A 2M29A 1FW4A 3B87A 2ZKMX 2WCHA 1IH0A 2P70A 4DIRA 4YGCB 2AAOA 2CNPA 2BECA 3CR4X 5KSZA 4PT1A 2L2CA 3WNXB 3ICBA 2KYCA 4DUQA 1S26D 4GAOA 1F8HA 3I5FB 1MXEA 4AOMA 1JFJA 2JRFA 2PRUA 3PM8A 3L4AA 1CDLA 4CIDA 5B8IB 1OW4A 3OX6A 1SL8A 3HCMA 1QATA 1IGVA 2MRDA 2Y4QA 3BUWB 1U5IA 1KK7Z 4CFQA 2LP3A 3OB1B 2PQLA 3SG4A 1SR6B 4CPVA 1PK0D 1TNPA 1LINA 1XFVO 3D78A 3K21A 4GNKB 1UHJA 3DVMA 1UP5A 1IJ6A 1RJVA 2P6BB 5CPVA 2KI4C 3SS3A 1ORGA 1JUOA 2M49B 2FCEA 5CSIA 3FWBA 4MLWA 1M63B 1S36A 2H61C 1UHIA 1B9AA 1CM1A 1CFPA 1J7PA 5AANA 4R1EA 5HYDA 1GM0A 3DY9A 3KEVA 3RZSA 2E6WA 1CLLA 1K9PA 3O2PA 3CZ0A 1GGWA 2LVKA 3GK1A 2K2FA 5I8NA 3EG5B 3TDIA 5HLOA 1SY9A 3PATA 2ERBA 4M2OA 2L5YA 3CABA 2D8NA 2KOTA 5KTYA 1DJXA 1XK4C 2G2BA 1NX0A 2WORA 4XJKA 5FI7A 1Z4HA 1UWOA 3PJIA 1QX2A 4AQJA 2QEBA 1PVAA 1KSMA 1LVCD 1D1OA 4CLNA 1N65A
chains in the Genus database with same CATH topology
4I5KA 2CCMA 4PHKA 3HX4A 2LANA 1K95A 1UHHA 1YUTA 5I2LA 2F3YA 5G08A 3O4YA 2BCAA 4C0LA 1R6PA 4MBEA 3LCPC 1QX7A 3I5IC 1Q80A 2NCPA 1R2UA 2BKIB 2WNDA 1K96A 1QIVA 3TS5C 2KYFA 1F4QA 2WCFA 1Y1AA 3DF0A 2M1UA 4YGEB 4GPLB 1WDCB 2LVIA 2KFFA 3SIAA 1M31A 1EG4A 2CXJA 2F2OA 2LE9B 5ER4X 5HKZA 1PALA 2LVJA 2QPTA 5JJGA 3JVTC 1XFZO 5AEQA 4MSPA 1TCFA 2K8MB 1DT7B 1W7IB 1XVJA 2OTGB 4N1FA 3CWGA 1CDPA 4DCKA 2EC6C 3CS1A 1U5IB 3SG2A 4PE4A 1NCZA 5DKRA 4AQIA 1TNWA 2LVVA 1QJTA 2KHNA 1ZOTB 4GGNA 4CFRA 1H8BA 2Y1NA 4M2PA 4YGBB 3DD4A 1CFFA 1G8IA 3ZNIA 2KI6D 4P2YB 1ALVA 4MVFA 1SK6D 1QS7A 1TN4A 1DJGA 4HSZA 3A4UB 4PALA 1QVIY 4HRGA 2JT0A 3BQ3A 4MN0A 1ZUZA 2BL0B 4QJ5B 3OX5A 1KCYA 5ER5A 4GBAA 1DTLA 2BBMA 2L0PA 3D10A 1IG5A 1SL9A 3SG5A 1IQ5A 4N5XA 5TNCA 2SASA 1HT9A 1KQMC 1DMOA 2K0JA 1UURA 4OVNF 4ZCUA 2KDHA 2OS8B 1B7TY 1C07A 1G33A 1WRZA 1V1GA 1B8CA 1IRJA 1IQ3A 1C7WA 1DJWA 2ZN9A 1XYDA 3RM1A 4XJKB 3WXAA 4C0KA 1OQPA 1A2XA 1ZFSA 1NWDA 5DKNA 1AJ4A 2PALA 5K89A 2M7NA 4DRWA 2V53A 1AVSA 1XK4A 2JXLA 1XO5A 5BPJA 2KAXA 1S1EA 1TOPA 1CFDA 1SBJA 2I7AA 4MZKA 3OP0A 4MZJA 1JC2A 1SRAA 1JBAA 3DVKA 4I5NB 3IF7A 1CKKA 3SG7A 1SR6C 1KFUL 1NP8A 2LMUA 1KK8C 1KQVA 1ODBA 1WY9A 1A03A 1FBVA 1YX7A 1MUXA 1LA0A 3DF0B 1SL7A 3MSEB 1N0YA 2LMVA 2MBXA 2LC5A 1L2OC 2Y1MA 2LHLA 4N1GA 5HKYA 1TRFA 1OMVA 3LLEA 1S5GY 2E30A 1LXFC 2GGMA 2ZRTA 5PALA 3BUXB 4YBHB 3CGAA 2JTTA 1OSAA 2JTZA 3PN7C 4ORBB 1EH2A 2JNXA 3VRPA 2LP2A 1WRKA 1BT6A 5GQQC 2M0RA 2K61A 1RECA 3PFVA 1QLSA 2LAPA 2ZN8A 3EK8A 5AERA 2KFGA 1GJYA 2HQ8A 2L4IA 4OV2A 1SCMC 1M39A 1OMDA 3EK4A 1CM4A 2M97A 1YVLA 5DKQA 1YUSA 3BXKA 2F8PA 2I94A 4GFTA 3JTDC 2LUCA 4JQ0D 1IKUA 2QACA 3I5GC 1K93D 1KWOC 2LLUA 2BBNA 3KO0A 1XFXO 2AUCA 4Q04A 2FOTA 4D1EA 2KI4B 1TNQA 2KQ6A 2HQWA 3LK1A 4I5LB 1G4YR 1SMGA 4PHJA 4WQ3A 2PSRA 4FTGA 4QJ4B 1K8UA 1NX1A 1PSBA 4YGDB 2B1UA 1J7QA 2R2IA 4P5OE 2L2EA 1QV1A 1J1DA 2WCEA 3CTNA 4U8DA 2F33A 1AJ5A 1K94A 5HLVA 1NX3A 1A4PA 2PVBA 3I5HC 3FIAA 1V1FA 1BR4B 2F2PA 1E8AA 1DJYA 2MLEC 3H4SE 1XFWO 4NDCA 1BR1B 2O60A 3EKJA 4A4CA 2K7CA 2LLTA 3A8RA 4PE1A 1RFJA 1CDNA 1FI6A 2OTGC 4OCIA 2EGDA 1B8RA 1OZSA 4ETOA 1MQ1A 1J55A 4M2QA 4NDDA 3O78A 3OHMB 1N2DA 2JWWA 5AFPA 2FCDA 4IL1A 5D69A 3AKBA 1NCXA 1SCVA 2WOSA 5AXIA 1EG3A 2K7BA 1UUSA 1NX2A 1CMGA 1IWQA 3I5IB 5J3XA 1VRKA 4MRYA 2JZIA 2O5GA 3TS5B 2EHBA 1F55A 2FJUB 3TUYC 1JF0A 3OB2B 2M1KB 4PE0A 2H2KA 3NSOA 2I18A 1KSOA 4YI8A 3FWCA 3TDZA 2KAYA 2JT3A 4ICBA 3VRRA 1PRWA 1FF1A 2G9BA 1CNPA 1DJHA 4JPZB 2A4JA 1ALWA 3JVTB 1K2HA 4YI9A 4OR9B 3O6BA 2KGBC 1AUIB 2H61A 2EC6B 3EVRA 3C1VA 1CDMA 2HF5A 1J1EA 1A29A 3CZTX 2Q4UA 2M8UA 1BOCA 2HPSA 1CB1A 4PDZA 1QTXA 4YRUA 1WLZA 2LMTA 2JNFA 3QRXA 3WHUB 2LUXA 1KK7Y 3I5FC 5CSFA 4YGAA 1HQVA 2PMYA 2RGIA 1CLBA 2L51A 1YTZC 4A4BA 1XA5A 1B8LA 3NSIA 1YRUB 5HKWA 2BE4A 2MAZA 2LCPA 2ZNEA 2DOQA 3GOFA 1A75A 1S6IA 1SW8A 2LM5A 1Y6WA 4NQGA 1KQMB 1QVIZ 1QLKA 2CT9A 3DVEA 1AP4A 1SNLA 2GV5A 3EK7A 2ISDA 3VGOA 1UHKA 1CFCA 5CSJA 1GGZA 1NUBA 3SG6A 1FPWA 1J7RA 4WRIA 1TCOB 1YUUA 1MR8A 2BKHB 1EJ3A 2OPOA 1S3PA 1ZACA 3BUMB 1Y1XA 1B7TZ 2KSPA 1F4OA 3BOWA 1S6CA 2KQYA 1DGVA 3KPXA 4MEWA 2KBIA 1B4CA 1MF8B 2JC2A 1JFKA 1DJZA 2KAVA 3BUOB 1RROA 2LLSA 3AAKA 3KF9A 2MA2A 3PALA 3EKHA 1BMOA 1QV0A 1QXPA 4USLA 3KHEA 1MXLC 4PHNA 4XYNA 1PSRA 5CSNA 1TIZA 2K7DA 2BCXA 1NSHA 1KK8B 1PVBA 3FS7A 3NSLA 3TZ1A 1JSAA 2NXQA 2Q91A 1BLQA 3NXAA 1QX5B 2MLFC 5I2QA 2JXCA 3LL8B 1WRLA 1MHOA 4GGFC 3VRNA 4OKHA 2ZNDA 1L2OB 3LK0A 1BG1A 2JOJA 3PLFB 2WC8A 2JULA 1F70A 4MRXA 1M46A 4ZCVA 1S6JA 4WQ2A 3D0YA 1BU3A 2KI6C 3E3RA 1YRTB 1DF0A 3PN7B 4ORCB 3ZWHA 1JWDA 1YVHA 2K2AA 3AKAA 1QIWA 1C7VA 1Y1UA 1S5GZ 3M0WA 2KGRA 3CR5X 1SYMA 3PSRA 3IQOA 4L9MA 1YR5A 1SCMB 1WDCC 5JOLA 1JF2A 1BF5A 4QJ3B 2KFHA 1TTXA 1IJ5A 2SCPA 3JTDB 1YURA 1AHRA 1KFUS 3EVVA 1SKTA 3SIBA 2JU0A 1OZOA 3I5GB 1M45A 1KWOB 4I5JA 5D7FA 1YX8A 1B1GA 1PULA 1KFXL 3CR2A 1EL4A 1SPYA 2BE6A 3BUNB 3F45A 2CTNA 2NLNA 2I2RE 1K9UA 3SJSA 1F71A 2VRGA 1XFYO 1W7JB 2KBMA 4F0ZB 1BODA 1K90D 1A75B 2M3WA 1DGUA 2NCOA 1J7OA 1F54A 2CBLA 2ZRSA 1RTP1 2ZFDA 3I5HB 2TN4A 4JWQA 1B47A 4ORAB 5FYXA 2KNEA 1ZMZA 2M9GA 3EVUA 3SG3A 2JT8A 1AK8A 2F3ZA 3NSKA 4PCWA 2BL0C 3VROA 3BOWB 1DVIA 1CLMA 4C0JA 1GQMA 1EXRA 1OMRA 2M7LA 2L98A 4MZLA 4HREE 3WHTB 5I2OA 1LKJA 1NPQA 1NYAA 4UPGA 2HETA 4FQOA 2JQ6A 2L50A 1OE9B 1LA3A 2OS8C 1RWYA 2LHIA 2LV7A 1L7ZA 1H4BA 4GUKA 2AMIA 2K7OA 2L4HA 1CMFA 2IS9A 5IBWA 1TNXA 1BJFA 2COLB 4PHMA 4PE7A 3AAJA 4TNCA 2MJWB 4DS7A 1FI5A 2PASA 1QASA 1MWNA 1NIWA 2WCBA 2L5XB 3BYAA 1WLMA 3TUYB 2LNKA 1DJIA 1X02A 1CTRA 4GGFA 4HRHA 3DVJA 3IQQA 2GGZA 3D0YB 5F6TA 3RLZA 1OOJA 4BY5A 1DF0B 1UHNA 2Y5IA 3GK4X 3VRQA 4E68A 1K9KA 2MHHA 3TDUA 2BCBA 1NCYA 2JPTA 3CLNA 5KU1A 1Y0VH 1XFUO 2NZ0A 3GK2A 4BY4A 4NDBA 1KFXS 1RK9A 2M29A 1FW4A 2ZKMX 1IH0A 4DIRA 4YGCB 2AAOA 2CNPA 2BECA 3CR4X 5KSZA 3WNXB 3ICBA 2KYCA 4DUQA 1S26D 4GAOA 1F8HA 3I5FB 1MXEA 4AOMA 1JFJA 2JRFA 2PRUA 3PM8A 1CDLA 4CIDA 5B8IB 3OX6A 1SL8A 3HCMA 1QATA 1IGVA 2MRDA 2Y4QA 3BUWB 1U5IA 1KK7Z 4CFQA 2LP3A 3OB1B 3SG4A 4CPVA 1SR6B 1PK0D 1TNPA 1LINA 1XFVO 3K21A 4GNKB 1UHJA 3DVMA 1UP5A 1IJ6A 1RJVA 2P6BB 5CPVA 2KI4C 1JUOA 2M49B 2FCEA 5CSIA 3FWBA 4MLWA 1M63B 1S36A 2H61C 1UHIA 1B9AA 1CM1A 1CFPA 1J7PA 5AANA 4R1EA 5HYDA 3KEVA 2E6WA 1CLLA 1K9PA 3O2PA 1GGWA 2LVKA 3GK1A 2K2FA 5I8NA 3TDIA 5HLOA 1SY9A 3PATA 4M2OA 2D8NA 2KOTA 5KTYA 1DJXA 1XK4C 2G2BA 1NX0A 2WORA 4XJKA 1UWOA 1QX2A 4AQJA 1PVAA 1KSMA 1LVCD 1D1OA 4CLNA 1N65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5K A;  2CCM A;  4PHK A;  3HX4 A;  2LAN A;  1K95 A;  1UHH A;  1YUT A;  5I2L A;  2F3Y A;  5G08 A;  3O4Y A;  2BCA A;  4C0L A;  1R6P A;  4MBE A;  3LCP C;  1QX7 A;  3I5I C;  1Q80 A;  2NCP A;  1R2U A;  2BKI B;  2WND A;  1K96 A;  1QIV A;  3TS5 C;  2KYF A;  1F4Q A;  2WCF A;  1Y1A A;  3DF0 A;  2M1U A;  4YGE B;  4GPL B;  1WDC B;  2LVI A;  2KFF A;  3SIA A;  1M31 A;  1EG4 A;  2CXJ A;  2F2O A;  2LE9 B;  5ER4 X;  5HKZ A;  1PAL A;  2LVJ A;  2QPT A;  5JJG A;  3JVT C;  1XFZ O;  5AEQ A;  4MSP A;  1TCF A;  2K8M B;  1DT7 B;  1W7I B;  1XVJ A;  2OTG B;  4N1F A;  3CWG A;  1CDP A;  4DCK A;  2EC6 C;  3CS1 A;  1U5I B;  3SG2 A;  4PE4 A;  1NCZ A;  5DKR A;  4AQI A;  1TNW A;  2LVV A;  1QJT A;  2KHN A;  1ZOT B;  4GGN A;  4CFR A;  1H8B A;  2Y1N A;  4M2P A;  4YGB B;  3DD4 A;  1CFF A;  1G8I A;  3ZNI A;  2KI6 D;  4P2Y B;  1ALV A;  4MVF A;  1SK6 D;  1QS7 A;  1TN4 A;  1DJG A;  4HSZ A;  3A4U B;  4PAL A;  1QVI Y;  4HRG A;  2JT0 A;  3BQ3 A;  4MN0 A;  1ZUZ A;  2BL0 B;  4QJ5 B;  3OX5 A;  1KCY A;  5ER5 A;  4GBA A;  1DTL A;  2BBM A;  2L0P A;  3D10 A;  1IG5 A;  1SL9 A;  3SG5 A;  1IQ5 A;  4N5X A;  5TNC A;  2SAS A;  1HT9 A;  1KQM C;  1DMO A;  2K0J A;  1UUR A;  4OVN F;  4ZCU A;  2KDH A;  2OS8 B;  1B7T Y;  1C07 A;  1G33 A;  1WRZ A;  1V1G A;  1B8C A;  1IRJ A;  1IQ3 A;  1C7W A;  1DJW A;  2ZN9 A;  1XYD A;  3RM1 A;  4XJK B;  3WXA A;  4C0K A;  1OQP A;  1A2X A;  1ZFS A;  1NWD A;  5DKN A;  1AJ4 A;  2PAL A;  5K89 A;  2M7N A;  4DRW A;  2V53 A;  1AVS A;  1XK4 A;  2JXL A;  1XO5 A;  5BPJ A;  2KAX A;  1S1E A;  1TOP A;  1CFD A;  1SBJ A;  2I7A A;  4MZK A;  3OP0 A;  4MZJ A;  1JC2 A;  1SRA A;  1JBA A;  3DVK A;  4I5N B;  3IF7 A;  1CKK A;  3SG7 A;  1SR6 C;  1KFU L;  1NP8 A;  2LMU A;  1KK8 C;  1KQV A;  1ODB A;  1WY9 A;  1A03 A;  1FBV A;  1YX7 A;  1MUX A;  1LA0 A;  3DF0 B;  1SL7 A;  3MSE B;  1N0Y A;  2LMV A;  2MBX A;  2LC5 A;  1L2O C;  2Y1M A;  2LHL A;  4N1G A;  5HKY A;  1TRF A;  1OMV A;  3LLE A;  1S5G Y;  2E30 A;  1LXF C;  2GGM A;  2ZRT A;  5PAL A;  3BUX B;  4YBH B;  3CGA A;  2JTT A;  1OSA A;  2JTZ A;  3PN7 C;  4ORB B;  1EH2 A;  2JNX A;  3VRP A;  2LP2 A;  1WRK A;  1BT6 A;  5GQQ C;  2M0R A;  2K61 A;  1REC A;  3PFV A;  1QLS A;  2LAP A;  2ZN8 A;  3EK8 A;  5AER A;  2KFG A;  1GJY A;  2HQ8 A;  2L4I A;  4OV2 A;  1SCM C;  1M39 A;  1OMD A;  3EK4 A;  1CM4 A;  2M97 A;  1YVL A;  5DKQ A;  1YUS A;  3BXK A;  2F8P A;  2I94 A;  4GFT A;  3JTD C;  2LUC A;  4JQ0 D;  1IKU A;  2QAC A;  3I5G C;  1K93 D;  1KWO C;  2LLU A;  2BBN A;  3KO0 A;  1XFX O;  2AUC A;  4Q04 A;  2FOT A;  4D1E A;  2KI4 B;  1TNQ A;  2KQ6 A;  2HQW A;  3LK1 A;  4I5L B;  1G4Y R;  1SMG A;  4PHJ A;  4WQ3 A;  2PSR A;  4FTG A;  4QJ4 B;  1K8U A;  1NX1 A;  1PSB A;  4YGD B;  2B1U A;  1J7Q A;  2R2I A;  4P5O E;  2L2E A;  1QV1 A;  1J1D A;  2WCE A;  3CTN A;  4U8D A;  2F33 A;  1AJ5 A;  1K94 A;  5HLV A;  1NX3 A;  1A4P A;  2PVB A;  3I5H C;  3FIA A;  1V1F A;  1BR4 B;  2F2P A;  1E8A A;  1DJY A;  2MLE C;  3H4S E;  1XFW O;  4NDC A;  1BR1 B;  2O60 A;  3EKJ A;  4A4C A;  2K7C A;  2LLT A;  3A8R A;  4PE1 A;  1RFJ A;  1CDN A;  1FI6 A;  2OTG C;  4OCI A;  2EGD A;  1B8R A;  1OZS A;  4ETO A;  1MQ1 A;  1J55 A;  4M2Q A;  4NDD A;  3O78 A;  3OHM B;  1N2D A;  2JWW A;  5AFP A;  2FCD A;  4IL1 A;  5D69 A;  3AKB A;  1NCX A;  1SCV A;  2WOS A;  5AXI A;  1EG3 A;  2K7B A;  1UUS A;  1NX2 A;  1CMG A;  1IWQ A;  3I5I B;  5J3X A;  1VRK A;  4MRY A;  2JZI A;  2O5G A;  3TS5 B;  2EHB A;  1F55 A;  2FJU B;  3TUY C;  1JF0 A;  3OB2 B;  2M1K B;  4PE0 A;  2H2K A;  3NSO A;  2I18 A;  1KSO A;  4YI8 A;  3FWC A;  3TDZ A;  2KAY A;  2JT3 A;  4ICB A;  3VRR A;  1PRW A;  1FF1 A;  2G9B A;  1CNP A;  1DJH A;  4JPZ B;  2A4J A;  1ALW A;  3JVT B;  1K2H A;  4YI9 A;  4OR9 B;  3O6B A;  2KGB C;  1AUI B;  2H61 A;  2EC6 B;  3EVR A;  3C1V A;  1CDM A;  2HF5 A;  1J1E A;  1A29 A;  3CZT X;  2Q4U A;  2M8U A;  1BOC A;  2HPS A;  1CB1 A;  4PDZ A;  1QTX A;  4YRU A;  1WLZ A;  2LMT A;  2JNF A;  3QRX A;  3WHU B;  2LUX A;  1KK7 Y;  3I5F C;  5CSF A;  4YGA A;  1HQV A;  2PMY A;  2RGI A;  1CLB A;  2L51 A;  1YTZ C;  4A4B A;  1XA5 A;  1B8L A;  3NSI A;  1YRU B;  5HKW A;  2BE4 A;  2MAZ A;  2LCP A;  2ZNE A;  2DOQ A;  3GOF A;  1A75 A;  1S6I A;  1SW8 A;  2LM5 A;  1Y6W A;  4NQG A;  1KQM B;  1QVI Z;  1QLK A;  2CT9 A;  3DVE A;  1AP4 A;  1SNL A;  2GV5 A;  3EK7 A;  2ISD A;  3VGO A;  1UHK A;  1CFC A;  5CSJ A;  1GGZ A;  1NUB A;  3SG6 A;  1FPW A;  1J7R A;  4WRI A;  1TCO B;  1YUU A;  1MR8 A;  2BKH B;  1EJ3 A;  2OPO A;  1S3P A;  1ZAC A;  3BUM B;  1Y1X A;  1B7T Z;  2KSP A;  1F4O A;  3BOW A;  1S6C A;  2KQY A;  1DGV A;  3KPX A;  4MEW A;  2KBI A;  1B4C A;  1MF8 B;  2JC2 A;  1JFK A;  1DJZ A;  2KAV A;  3BUO B;  1RRO A;  2LLS A;  3AAK A;  3KF9 A;  2MA2 A;  3PAL A;  3EKH A;  1BMO A;  1QV0 A;  1QXP A;  4USL A;  3KHE A;  1MXL C;  4PHN A;  4XYN A;  1PSR A;  5CSN A;  1TIZ A;  2K7D A;  2BCX A;  1NSH A;  1KK8 B;  1PVB A;  3FS7 A;  3NSL A;  3TZ1 A;  1JSA A;  2NXQ A;  2Q91 A;  1BLQ A;  3NXA A;  1QX5 B;  2MLF C;  5I2Q A;  2JXC A;  3LL8 B;  1WRL A;  1MHO A;  4GGF C;  3VRN A;  4OKH A;  2ZND A;  1L2O B;  3LK0 A;  1BG1 A;  2JOJ A;  3PLF B;  2WC8 A;  2JUL A;  1F70 A;  4MRX A;  1M46 A;  4ZCV A;  1S6J A;  4WQ2 A;  3D0Y A;  1BU3 A;  2KI6 C;  3E3R A;  1YRT B;  1DF0 A;  3PN7 B;  4ORC B;  3ZWH A;  1JWD A;  1YVH A;  2K2A A;  3AKA A;  1QIW A;  1C7V A;  1Y1U A;  1S5G Z;  3M0W A;  2KGR A;  3CR5 X;  1SYM A;  3PSR A;  3IQO A;  4L9M A;  1YR5 A;  1SCM B;  1WDC C;  5JOL A;  1JF2 A;  1BF5 A;  4QJ3 B;  2KFH A;  1TTX A;  1IJ5 A;  2SCP A;  3JTD B;  1YUR A;  1AHR A;  1KFU S;  3EVV A;  1SKT A;  3SIB A;  2JU0 A;  1OZO A;  3I5G B;  1M45 A;  1KWO B;  4I5J A;  5D7F A;  1YX8 A;  1B1G A;  1PUL A;  1KFX L;  3CR2 A;  1EL4 A;  1SPY A;  2BE6 A;  3BUN B;  3F45 A;  2CTN A;  2NLN A;  2I2R E;  1K9U A;  3SJS A;  1F71 A;  2VRG A;  1XFY O;  1W7J B;  2KBM A;  4F0Z B;  1BOD A;  1K90 D;  1A75 B;  2M3W A;  1DGU A;  2NCO A;  1J7O A;  1F54 A;  2CBL A;  2ZRS A;  1RTP 1;  2ZFD A;  3I5H B;  2TN4 A;  4JWQ A;  1B47 A;  4ORA B;  5FYX A;  2KNE A;  1ZMZ A;  2M9G A;  3EVU A;  3SG3 A;  2JT8 A;  1AK8 A;  2F3Z A;  3NSK A;  4PCW A;  2BL0 C;  3VRO A;  3BOW B;  1DVI A;  1CLM A;  4C0J A;  1GQM A;  1EXR A;  1OMR A;  2M7L A;  2L98 A;  4MZL A;  4HRE E;  3WHT B;  5I2O A;  1LKJ A;  1NPQ A;  1NYA A;  4UPG A;  2HET A;  4FQO A;  2JQ6 A;  2L50 A;  1OE9 B;  1LA3 A;  2OS8 C;  1RWY A;  2LHI A;  2LV7 A;  1L7Z A;  1H4B A;  4GUK A;  2AMI A;  2K7O A;  2L4H A;  1CMF A;  2IS9 A;  5IBW A;  1TNX A;  1BJF A;  2COL B;  4PHM A;  4PE7 A;  3AAJ A;  4TNC A;  2MJW B;  4DS7 A;  1FI5 A;  2PAS A;  1QAS A;  1MWN A;  1NIW A;  2WCB A;  2L5X B;  3BYA A;  1WLM A;  3TUY B;  2LNK A;  1DJI A;  1X02 A;  1CTR A;  4GGF A;  4HRH A;  3DVJ A;  3IQQ A;  2GGZ A;  3D0Y B;  5F6T A;  3RLZ A;  1OOJ A;  4BY5 A;  1DF0 B;  1UHN A;  2Y5I A;  3GK4 X;  3VRQ A;  4E68 A;  1K9K A;  2MHH A;  3TDU A;  2BCB A;  1NCY A;  2JPT A;  3CLN A;  5KU1 A;  1Y0V H;  1XFU O;  2NZ0 A;  3GK2 A;  4BY4 A;  4NDB A;  1KFX S;  1RK9 A;  2M29 A;  1FW4 A;  2ZKM X;  1IH0 A;  4DIR A;  4YGC B;  2AAO A;  2CNP A;  2BEC A;  3CR4 X;  5KSZ A;  3WNX B;  3ICB A;  2KYC A;  4DUQ A;  1S26 D;  4GAO A;  1F8H A;  3I5F B;  1MXE A;  4AOM A;  1JFJ A;  2JRF A;  2PRU A;  3PM8 A;  1CDL A;  4CID A;  5B8I B;  3OX6 A;  1SL8 A;  3HCM A;  1QAT A;  1IGV A;  2MRD A;  2Y4Q A;  3BUW B;  1U5I A;  1KK7 Z;  4CFQ A;  2LP3 A;  3OB1 B;  3SG4 A;  4CPV A;  1SR6 B;  1PK0 D;  1TNP A;  1LIN A;  1XFV O;  3K21 A;  4GNK B;  1UHJ A;  3DVM A;  1UP5 A;  1IJ6 A;  1RJV A;  2P6B B;  5CPV A;  2KI4 C;  1JUO A;  2M49 B;  2FCE A;  5CSI A;  3FWB A;  4MLW A;  1M63 B;  1S36 A;  2H61 C;  1UHI A;  1B9A A;  1CM1 A;  1CFP A;  1J7P A;  5AAN A;  4R1E A;  5HYD A;  3KEV A;  2E6W A;  1CLL A;  1K9P A;  3O2P A;  1GGW A;  2LVK A;  3GK1 A;  2K2F A;  5I8N A;  3TDI A;  5HLO A;  1SY9 A;  3PAT A;  4M2O A;  2D8N A;  2KOT A;  5KTY A;  1DJX A;  1XK4 C;  2G2B A;  1NX0 A;  2WOR A;  4XJK A;  1UWO A;  1QX2 A;  4AQJ A;  1PVA A;  1KSM A;  1LVC D;  1D1O A;  4CLN A;  1N65 A; 
#chains in the Genus database with same CATH topology
 4I5K A;  2CCM A;  4PHK A;  3HX4 A;  2LAN A;  1K95 A;  1UHH A;  3S0G A;  1YUT A;  5I2L A;  2F3Y A;  5G08 A;  3O4Y A;  2BCA A;  3DXL A;  4C0L A;  1R6P A;  4MBE A;  3BFH A;  3LCP C;  1QX7 A;  3I5I C;  1Q80 A;  2NCP A;  1R2U A;  2BKI B;  2WND A;  1K96 A;  1QIV A;  3TS5 C;  2KYF A;  1F4Q A;  3V2L A;  2WCF A;  1Y1A A;  3DF0 A;  2M1U A;  4YGE B;  4GPL B;  1WDC B;  2LVI A;  2KFF A;  3SIA A;  1M31 A;  3CZ1 A;  1EG4 A;  2CXJ A;  2F2O A;  2LE9 B;  2FJY A;  5ER4 X;  5HKZ A;  1PAL A;  2LVJ A;  2QPT A;  5JJG A;  4F7F A;  3JVT C;  1XFZ O;  5AEQ A;  4MSP A;  1TCF A;  2K8M B;  3R1P A;  1W7I B;  1XVJ A;  2OTG B;  3VB1 A;  1DT7 B;  4N1F A;  5FI2 A;  3CWG A;  1CDP A;  1LS8 A;  4DCK A;  2EC6 C;  5HL1 A;  3CS1 A;  1U5I B;  3NGV A;  3SG2 A;  1XFR A;  1NCZ A;  4PE4 A;  5DKR A;  1DC1 A;  4AQI A;  1TNW A;  3D74 A;  2LVV A;  1QJT A;  2KHN A;  1ZOT B;  3B6X A;  4GGN A;  4CFR A;  1H8B A;  2Y1N A;  4M2P A;  4YGB B;  3DD4 A;  1CFF A;  1G8I A;  4FQT A;  3ZNI A;  2KI6 D;  4P2Y B;  1ALV A;  4MVF A;  1SK6 D;  1QS7 A;  1TN4 A;  1DJG A;  4HSZ A;  3A4U B;  4PAL A;  3D76 A;  1QVI Y;  4HRG A;  2JT0 A;  3S0A A;  3B7A A;  3BQ3 A;  3L47 A;  1ZUZ A;  2BL0 B;  4MN0 A;  4QJ5 B;  3OX5 A;  1KCY A;  3BJH A;  4JD9 A;  5ER5 A;  4GBA A;  1DTL A;  2BBM A;  2L0P A;  3D10 A;  1IG5 A;  1SL9 A;  3SG5 A;  1IQ5 A;  4N5X A;  5TNC A;  2SAS A;  1HT9 A;  1KQM C;  3DYE A;  2K0J A;  1DMO A;  1UUR A;  4OVN F;  4ZCU A;  2KDH A;  2OS8 B;  1B7T Y;  1C07 A;  1G33 A;  1WRZ A;  1V1G A;  1B8C A;  1IRJ A;  1IQ3 A;  1C7W A;  1DJW A;  2ZN9 A;  1XYD A;  3RM1 A;  4XJK B;  3WXA A;  4C0K A;  1OQP A;  1A2X A;  1ZFS A;  1NWD A;  5DKN A;  1AJ4 A;  2PAL A;  3SS4 A;  3UO9 A;  4JKT A;  5K89 A;  2M7N A;  4DRW A;  2V53 A;  1AVS A;  1XK4 A;  2JXL A;  1XO5 A;  5BPJ A;  2KAX A;  1S1E A;  1TOP A;  1CFD A;  1SBJ A;  2I7A A;  3PM2 A;  4MZK A;  3OP0 A;  4MZJ A;  1JC2 A;  1SRA A;  1JBA A;  3DVK A;  2K60 A;  4I5N B;  3IF7 A;  1CKK A;  3SG7 A;  1SR6 C;  1KFU L;  1NP8 A;  2LMU A;  1KK8 C;  1KQV A;  1ODB A;  1WY9 A;  1A03 A;  1FBV A;  1YX7 A;  1MUX A;  1LA0 A;  3DF0 B;  1SL7 A;  3MSE B;  1N0Y A;  2LMV A;  2MBX A;  2LC5 A;  1L2O C;  2Y1M A;  2LHL A;  3CDN A;  4N1G A;  5HKY A;  1TRF A;  2BAP A;  1OMV A;  3LLE A;  3N7H A;  1S5G Y;  2E30 A;  1LXF C;  2GGM A;  2ZRT A;  5PAL A;  3BUX B;  4YBH B;  2QEH A;  3CGA A;  2JTT A;  1OSA A;  2GTE A;  2JTZ A;  3PN7 C;  4ORB B;  4OZD A;  1EH2 A;  2JNX A;  3SS5 A;  2QEO A;  3VRP A;  2LP2 A;  3S0D A;  1WRK A;  1BT6 A;  5GQQ C;  2M0R A;  2K61 A;  1REC A;  3PFV A;  1QLS A;  2LAP A;  2WCK A;  2ZN8 A;  3EK8 A;  5AER A;  2KFG A;  1GJY A;  2HQ8 A;  2L4I A;  4OV2 A;  1SCM C;  1M39 A;  1OMD A;  3EK4 A;  1CM4 A;  1OOG A;  2M97 A;  1YVL A;  5DKQ A;  1YUS A;  3BXK A;  2F8P A;  1DQE A;  2I94 A;  4GFT A;  3JTD C;  2LUC A;  4JQ0 D;  1IKU A;  2QAC A;  3I5G C;  1K93 D;  1KWO C;  2WC5 A;  2LLU A;  2BBN A;  3KO0 A;  1XFX O;  2AUC A;  2KPH A;  2FOT A;  4Q04 A;  4D1E A;  2KI4 B;  1TNQ A;  2KQ6 A;  2HQW A;  3LK1 A;  4I5L B;  1G4Y R;  1SMG A;  4PHJ A;  4WQ3 A;  2PSR A;  4FTG A;  4QJ4 B;  1K8U A;  1NX1 A;  3CYZ A;  1PSB A;  4YGD B;  2B1U A;  1J7Q A;  2R2I A;  4P5O E;  2L2E A;  1QV1 A;  1J1D A;  2WCE A;  3CTN A;  4U8D A;  2F33 A;  1AJ5 A;  1K94 A;  4KYN A;  1NX3 A;  1A4P A;  2PVB A;  3I5H C;  5HLV A;  3FIA A;  1V1F A;  1BR4 B;  2F2P A;  1E8A A;  1DJY A;  2MLE C;  2PYQ A;  1XFW O;  3H4S E;  4NDC A;  1BR1 B;  2O60 A;  3EKJ A;  4A4C A;  2K7C A;  2LLT A;  4INX A;  3A8R A;  4PE1 A;  1RFJ A;  1CDN A;  1FI6 A;  3FE9 A;  2OTG C;  4OCI A;  2EGD A;  1B8R A;  3D77 A;  1OZS A;  4ETO A;  1MQ1 A;  1J55 A;  3B86 A;  4M2Q A;  4NDD A;  3O78 A;  3OHM B;  1N2D A;  2JWW A;  5AFP A;  2FCD A;  4IL1 A;  5D69 A;  3AKB A;  1NCX A;  1SCV A;  2WOS A;  1OOH A;  5AXI A;  1EG3 A;  2K7B A;  1UUS A;  1NX2 A;  1CMG A;  1IWQ A;  3I5I B;  5J3X A;  1VRK A;  4MRY A;  2JZI A;  2O5G A;  3TS5 B;  2EHB A;  1F55 A;  2FJU B;  3TUY C;  1JF0 A;  3OB2 B;  3K1E A;  2M1K B;  4PE0 A;  1P28 A;  2H2K A;  3NSO A;  2I18 A;  1KSO A;  2KLD A;  5DIC A;  4YI8 A;  3FWC A;  3TDZ A;  2KAY A;  2JT3 A;  4ICB A;  3VRR A;  1PRW A;  2WCJ A;  1FF1 A;  2G9B A;  2BNX A;  1CNP A;  1DJH A;  4JPZ B;  2QEV A;  2A4J A;  1ALW A;  3JVT B;  1K2H A;  4YI9 A;  4OR9 B;  3S0B A;  3O6B A;  2KGB C;  1AUI B;  2H61 A;  1TWO A;  1W9Z A;  5EL2 A;  2EC6 B;  3EVR A;  3C1V A;  1CDM A;  2HF5 A;  1J1E A;  1A29 A;  3Q8I A;  3CZT X;  2Q4U A;  2M8U A;  1BOC A;  1Z2C B;  2HPS A;  1CB1 A;  4PDZ A;  1QTX A;  4YRU A;  1WLZ A;  2LMT A;  3QME A;  2JNF A;  3QRX A;  3WHU B;  2LUX A;  1KK7 Y;  3I5F C;  5CSF A;  4YGA A;  1HQV A;  2PMY A;  2RGI A;  3FE6 A;  1CLB A;  2L51 A;  1YTZ C;  4A4B A;  3OGN A;  1XA5 A;  1B8L A;  1C3Y A;  3NSI A;  1YRU B;  5HKW A;  2BE4 A;  2MAZ A;  2LCP A;  2ZNE A;  3R72 A;  2DOQ A;  3GOF A;  1A75 A;  1S6I A;  1SW8 A;  2LM5 A;  1Y6W A;  4NQG A;  1KQM B;  1QVI Z;  2WC6 A;  1QLK A;  3NHI A;  1C3Z A;  2CT9 A;  3DVE A;  1AP4 A;  1SNL A;  2GV5 A;  3EK7 A;  2ISD A;  3VGO A;  1SSE B;  3R1O A;  1OOF A;  1UHK A;  1CFC A;  5CSJ A;  1GGZ A;  1NUB A;  3O4X A;  3SG6 A;  1J7R A;  4WRI A;  1TCO B;  1YUU A;  1FPW A;  1MR8 A;  2BKH B;  1EJ3 A;  2OPO A;  1S3P A;  1ZAC A;  3BUM B;  1Y1X A;  1B7T Z;  2KSP A;  1F4O A;  3BOW A;  5D3O A;  1S6C A;  3B88 A;  2KQY A;  3OBV A;  1DGV A;  1OOI X;  3KPX A;  4MEW A;  2KBI A;  1B4C A;  1MF8 B;  2JC2 A;  1JFK A;  1DJZ A;  2KAV A;  3BUO B;  1RRO A;  2LLS A;  3AAK A;  3DZT A;  3KF9 A;  2MA2 A;  3PAL A;  3EKH A;  2YGU A;  3UNW A;  1BMO A;  1QV0 A;  1QXP A;  4USL A;  3KHE A;  1MXL C;  4PHN A;  4XYN A;  1PSR A;  5CSN A;  1TIZ A;  2K7D A;  1NSH A;  2BCX A;  1KK8 B;  1PVB A;  3FS7 A;  3NSL A;  3TZ1 A;  1JSA A;  2NXQ A;  2Q91 A;  1BLQ A;  3NXA A;  1QX5 B;  2MLF C;  5I2Q A;  2JXC A;  3LL8 B;  1WRL A;  1MHO A;  5FI6 A;  4GGF C;  3VRN A;  4OKH A;  2ZND A;  1L2O B;  2JPO A;  3LK0 A;  5I94 A;  3R1V A;  2JOJ A;  1BG1 A;  3PLF B;  1TUJ A;  2WC8 A;  2JUL A;  1F70 A;  3D73 A;  1M46 A;  1T14 A;  1S6J A;  4MRX A;  4WQ2 A;  4ZCV A;  3D0Y A;  1BU3 A;  2KI6 C;  3E3R A;  2P71 A;  1YRT B;  2H8V A;  1DF0 A;  3PN7 B;  4ORC B;  3ZWH A;  1JWD A;  1YVH A;  2K2A A;  3AKA A;  1QIW A;  1C7V A;  1Y1U A;  3BFB A;  1S5G Z;  3M0W A;  2KGR A;  3CR5 X;  1SYM A;  1QWV A;  3PSR A;  3IQO A;  4L9M A;  1YR5 A;  1SCM B;  1WDC C;  5JOL A;  1JF2 A;  1BF5 A;  4QJ3 B;  2KFH A;  3S0F A;  1IIO A;  2WCM A;  1DEL A;  1TTX A;  1IJ5 A;  2SCP A;  3JTD B;  1YUR A;  1AHR A;  1KFU S;  3EVV A;  1SKT A;  3SIB A;  2JU0 A;  1OZO A;  3I5G B;  1M45 A;  1KWO B;  4I5J A;  5D7F A;  1YX8 A;  1B1G A;  1PUL A;  1KFX L;  3CR2 A;  1EL4 A;  1SPY A;  2BE6 A;  3BUN B;  3F45 A;  2CTN A;  2NLN A;  2I2R E;  1K9U A;  3SJS A;  1F71 A;  2VRG A;  1DEK A;  1W7J B;  1XFY O;  2KBM A;  4F0Z B;  1K90 D;  1BOD A;  1A75 B;  2M3W A;  3L4L A;  1DGU A;  2NCO A;  1J7O A;  3BFA A;  1F54 A;  2CBL A;  2ZRS A;  1RTP 1;  2ZFD A;  3I5H B;  2TN4 A;  4JWQ A;  1B47 A;  4ORA B;  5FYX A;  2KNE A;  1ZMZ A;  2M9G A;  3EVU A;  3SG3 A;  2JT8 A;  1AK8 A;  2F3Z A;  2KLE A;  3NSK A;  2WCL A;  3D75 A;  4PCW A;  2BL0 C;  3VRO A;  3BOW B;  1DVI A;  1CLM A;  4C0J A;  1GQM A;  1EXR A;  1OMR A;  2M7L A;  2L98 A;  4MZL A;  4HRE E;  3S0E A;  1TUZ A;  3WHT B;  5I2O A;  1LKJ A;  1NPQ A;  1NYA A;  4UPG A;  2HET A;  4FQO A;  2JQ6 A;  2L50 A;  1OE9 B;  1LA3 A;  2OS8 C;  1RWY A;  2LHI A;  4INW A;  2LV7 A;  1L7Z A;  1H4B A;  4GUK A;  2AMI A;  2K7O A;  2L4H A;  1CMF A;  2IS9 A;  5IBW A;  1TNX A;  1BJF A;  2COL B;  3NHT A;  4PE7 A;  3AAJ A;  4PHM A;  2MJW B;  4TNC A;  4DS7 A;  1FI5 A;  2PAS A;  1QAS A;  1MWN A;  1NIW A;  2WCB A;  2L5X B;  3BYA A;  1WLM A;  4IJ7 A;  3TUY B;  2LNK A;  3IVT A;  1DJI A;  1X02 A;  1CTR A;  4GGF A;  4HRH A;  3DVJ A;  3IQQ A;  2GGZ A;  3D0Y B;  5F6T A;  3RLZ A;  1OOJ A;  4BY5 A;  1DF0 B;  3FE8 A;  1UHN A;  2QDI A;  2Y5I A;  3CZ2 A;  3GK4 X;  3VRQ A;  4E68 A;  1K9K A;  2MHH A;  3TDU A;  2BCB A;  1NCY A;  2JPT A;  3CLN A;  5KU1 A;  1Y0V H;  1XFU O;  2NZ0 A;  3GK2 A;  4BY4 A;  4NDB A;  1KFX S;  1RK9 A;  2M29 A;  1FW4 A;  3B87 A;  2ZKM X;  2WCH A;  1IH0 A;  2P70 A;  4DIR A;  4YGC B;  2AAO A;  2CNP A;  2BEC A;  3CR4 X;  5KSZ A;  4PT1 A;  2L2C A;  3WNX B;  3ICB A;  2KYC A;  4DUQ A;  1S26 D;  4GAO A;  1F8H A;  3I5F B;  1MXE A;  4AOM A;  1JFJ A;  2JRF A;  2PRU A;  3PM8 A;  3L4A A;  1CDL A;  4CID A;  5B8I B;  1OW4 A;  3OX6 A;  1SL8 A;  3HCM A;  1QAT A;  1IGV A;  2MRD A;  2Y4Q A;  3BUW B;  1U5I A;  1KK7 Z;  4CFQ A;  2LP3 A;  3OB1 B;  2PQL A;  3SG4 A;  1SR6 B;  4CPV A;  1PK0 D;  1TNP A;  1LIN A;  1XFV O;  3D78 A;  3K21 A;  4GNK B;  1UHJ A;  3DVM A;  1UP5 A;  1IJ6 A;  1RJV A;  2P6B B;  5CPV A;  2KI4 C;  3SS3 A;  1ORG A;  1JUO A;  2M49 B;  2FCE A;  5CSI A;  3FWB A;  4MLW A;  1M63 B;  1S36 A;  2H61 C;  1UHI A;  1B9A A;  1CM1 A;  1CFP A;  1J7P A;  5AAN A;  4R1E A;  5HYD A;  1GM0 A;  3DY9 A;  3KEV A;  3RZS A;  2E6W A;  1CLL A;  1K9P A;  3O2P A;  3CZ0 A;  1GGW A;  2LVK A;  3GK1 A;  2K2F A;  5I8N A;  3EG5 B;  3TDI A;  5HLO A;  1SY9 A;  3PAT A;  2ERB A;  4M2O A;  2L5Y A;  3CAB A;  2D8N A;  2KOT A;  5KTY A;  1DJX A;  1XK4 C;  2G2B A;  1NX0 A;  2WOR A;  4XJK A;  5FI7 A;  1Z4H A;  1UWO A;  3PJI A;  1QX2 A;  4AQJ A;  2QEB A;  1PVA A;  1KSM A;  1LVC D;  1D1O A;  4CLN A;  1N65 A; 
#chains in the Genus database with same CATH homology
 4I5K A;  2CCM A;  4PHK A;  3HX4 A;  2LAN A;  1K95 A;  1UHH A;  1YUT A;  5I2L A;  2F3Y A;  5G08 A;  3O4Y A;  2BCA A;  4C0L A;  1R6P A;  4MBE A;  3LCP C;  1QX7 A;  3I5I C;  1Q80 A;  2NCP A;  1R2U A;  2BKI B;  2WND A;  1K96 A;  1QIV A;  3TS5 C;  2KYF A;  1F4Q A;  2WCF A;  1Y1A A;  3DF0 A;  2M1U A;  4YGE B;  4GPL B;  1WDC B;  2LVI A;  2KFF A;  3SIA A;  1M31 A;  1EG4 A;  2CXJ A;  2F2O A;  2LE9 B;  5ER4 X;  5HKZ A;  1PAL A;  2LVJ A;  2QPT A;  5JJG A;  3JVT C;  1XFZ O;  5AEQ A;  4MSP A;  1TCF A;  2K8M B;  1DT7 B;  1W7I B;  1XVJ A;  2OTG B;  4N1F A;  3CWG A;  1CDP A;  4DCK A;  2EC6 C;  3CS1 A;  1U5I B;  3SG2 A;  4PE4 A;  1NCZ A;  5DKR A;  4AQI A;  1TNW A;  2LVV A;  1QJT A;  2KHN A;  1ZOT B;  4GGN A;  4CFR A;  1H8B A;  2Y1N A;  4M2P A;  4YGB B;  3DD4 A;  1CFF A;  1G8I A;  3ZNI A;  2KI6 D;  4P2Y B;  1ALV A;  4MVF A;  1SK6 D;  1QS7 A;  1TN4 A;  1DJG A;  4HSZ A;  3A4U B;  4PAL A;  1QVI Y;  4HRG A;  2JT0 A;  3BQ3 A;  4MN0 A;  1ZUZ A;  2BL0 B;  4QJ5 B;  3OX5 A;  1KCY A;  5ER5 A;  4GBA A;  1DTL A;  2BBM A;  2L0P A;  3D10 A;  1IG5 A;  1SL9 A;  3SG5 A;  1IQ5 A;  4N5X A;  5TNC A;  2SAS A;  1HT9 A;  1KQM C;  1DMO A;  2K0J A;  1UUR A;  4OVN F;  4ZCU A;  2KDH A;  2OS8 B;  1B7T Y;  1C07 A;  1G33 A;  1WRZ A;  1V1G A;  1B8C A;  1IRJ A;  1IQ3 A;  1C7W A;  1DJW A;  2ZN9 A;  1XYD A;  3RM1 A;  4XJK B;  3WXA A;  4C0K A;  1OQP A;  1A2X A;  1ZFS A;  1NWD A;  5DKN A;  1AJ4 A;  2PAL A;  5K89 A;  2M7N A;  4DRW A;  2V53 A;  1AVS A;  1XK4 A;  2JXL A;  1XO5 A;  5BPJ A;  2KAX A;  1S1E A;  1TOP A;  1CFD A;  1SBJ A;  2I7A A;  4MZK A;  3OP0 A;  4MZJ A;  1JC2 A;  1SRA A;  1JBA A;  3DVK A;  4I5N B;  3IF7 A;  1CKK A;  3SG7 A;  1SR6 C;  1KFU L;  1NP8 A;  2LMU A;  1KK8 C;  1KQV A;  1ODB A;  1WY9 A;  1A03 A;  1FBV A;  1YX7 A;  1MUX A;  1LA0 A;  3DF0 B;  1SL7 A;  3MSE B;  1N0Y A;  2LMV A;  2MBX A;  2LC5 A;  1L2O C;  2Y1M A;  2LHL A;  4N1G A;  5HKY A;  1TRF A;  1OMV A;  3LLE A;  1S5G Y;  2E30 A;  1LXF C;  2GGM A;  2ZRT A;  5PAL A;  3BUX B;  4YBH B;  3CGA A;  2JTT A;  1OSA A;  2JTZ A;  3PN7 C;  4ORB B;  1EH2 A;  2JNX A;  3VRP A;  2LP2 A;  1WRK A;  1BT6 A;  5GQQ C;  2M0R A;  2K61 A;  1REC A;  3PFV A;  1QLS A;  2LAP A;  2ZN8 A;  3EK8 A;  5AER A;  2KFG A;  1GJY A;  2HQ8 A;  2L4I A;  4OV2 A;  1SCM C;  1M39 A;  1OMD A;  3EK4 A;  1CM4 A;  2M97 A;  1YVL A;  5DKQ A;  1YUS A;  3BXK A;  2F8P A;  2I94 A;  4GFT A;  3JTD C;  2LUC A;  4JQ0 D;  1IKU A;  2QAC A;  3I5G C;  1K93 D;  1KWO C;  2LLU A;  2BBN A;  3KO0 A;  1XFX O;  2AUC A;  4Q04 A;  2FOT A;  4D1E A;  2KI4 B;  1TNQ A;  2KQ6 A;  2HQW A;  3LK1 A;  4I5L B;  1G4Y R;  1SMG A;  4PHJ A;  4WQ3 A;  2PSR A;  4FTG A;  4QJ4 B;  1K8U A;  1NX1 A;  1PSB A;  4YGD B;  2B1U A;  1J7Q A;  2R2I A;  4P5O E;  2L2E A;  1QV1 A;  1J1D A;  2WCE A;  3CTN A;  4U8D A;  2F33 A;  1AJ5 A;  1K94 A;  5HLV A;  1NX3 A;  1A4P A;  2PVB A;  3I5H C;  3FIA A;  1V1F A;  1BR4 B;  2F2P A;  1E8A A;  1DJY A;  2MLE C;  3H4S E;  1XFW O;  4NDC A;  1BR1 B;  2O60 A;  3EKJ A;  4A4C A;  2K7C A;  2LLT A;  3A8R A;  4PE1 A;  1RFJ A;  1CDN A;  1FI6 A;  2OTG C;  4OCI A;  2EGD A;  1B8R A;  1OZS A;  4ETO A;  1MQ1 A;  1J55 A;  4M2Q A;  4NDD A;  3O78 A;  3OHM B;  1N2D A;  2JWW A;  5AFP A;  2FCD A;  4IL1 A;  5D69 A;  3AKB A;  1NCX A;  1SCV A;  2WOS A;  5AXI A;  1EG3 A;  2K7B A;  1UUS A;  1NX2 A;  1CMG A;  1IWQ A;  3I5I B;  5J3X A;  1VRK A;  4MRY A;  2JZI A;  2O5G A;  3TS5 B;  2EHB A;  1F55 A;  2FJU B;  3TUY C;  1JF0 A;  3OB2 B;  2M1K B;  4PE0 A;  2H2K A;  3NSO A;  2I18 A;  1KSO A;  4YI8 A;  3FWC A;  3TDZ A;  2KAY A;  2JT3 A;  4ICB A;  3VRR A;  1PRW A;  1FF1 A;  2G9B A;  1CNP A;  1DJH A;  4JPZ B;  2A4J A;  1ALW A;  3JVT B;  1K2H A;  4YI9 A;  4OR9 B;  3O6B A;  2KGB C;  1AUI B;  2H61 A;  2EC6 B;  3EVR A;  3C1V A;  1CDM A;  2HF5 A;  1J1E A;  1A29 A;  3CZT X;  2Q4U A;  2M8U A;  1BOC A;  2HPS A;  1CB1 A;  4PDZ A;  1QTX A;  4YRU A;  1WLZ A;  2LMT A;  2JNF A;  3QRX A;  3WHU B;  2LUX A;  1KK7 Y;  3I5F C;  5CSF A;  4YGA A;  1HQV A;  2PMY A;  2RGI A;  1CLB A;  2L51 A;  1YTZ C;  4A4B A;  1XA5 A;  1B8L A;  3NSI A;  1YRU B;  5HKW A;  2BE4 A;  2MAZ A;  2LCP A;  2ZNE A;  2DOQ A;  3GOF A;  1A75 A;  1S6I A;  1SW8 A;  2LM5 A;  1Y6W A;  4NQG A;  1KQM B;  1QVI Z;  1QLK A;  2CT9 A;  3DVE A;  1AP4 A;  1SNL A;  2GV5 A;  3EK7 A;  2ISD A;  3VGO A;  1UHK A;  1CFC A;  5CSJ A;  1GGZ A;  1NUB A;  3SG6 A;  1FPW A;  1J7R A;  4WRI A;  1TCO B;  1YUU A;  1MR8 A;  2BKH B;  1EJ3 A;  2OPO A;  1S3P A;  1ZAC A;  3BUM B;  1Y1X A;  1B7T Z;  2KSP A;  1F4O A;  3BOW A;  1S6C A;  2KQY A;  1DGV A;  3KPX A;  4MEW A;  2KBI A;  1B4C A;  1MF8 B;  2JC2 A;  1JFK A;  1DJZ A;  2KAV A;  3BUO B;  1RRO A;  2LLS A;  3AAK A;  3KF9 A;  2MA2 A;  3PAL A;  3EKH A;  1BMO A;  1QV0 A;  1QXP A;  4USL A;  3KHE A;  1MXL C;  4PHN A;  4XYN A;  1PSR A;  5CSN A;  1TIZ A;  2K7D A;  2BCX A;  1NSH A;  1KK8 B;  1PVB A;  3FS7 A;  3NSL A;  3TZ1 A;  1JSA A;  2NXQ A;  2Q91 A;  1BLQ A;  3NXA A;  1QX5 B;  2MLF C;  5I2Q A;  2JXC A;  3LL8 B;  1WRL A;  1MHO A;  4GGF C;  3VRN A;  4OKH A;  2ZND A;  1L2O B;  3LK0 A;  1BG1 A;  2JOJ A;  3PLF B;  2WC8 A;  2JUL A;  1F70 A;  4MRX A;  1M46 A;  4ZCV A;  1S6J A;  4WQ2 A;  3D0Y A;  1BU3 A;  2KI6 C;  3E3R A;  1YRT B;  1DF0 A;  3PN7 B;  4ORC B;  3ZWH A;  1JWD A;  1YVH A;  2K2A A;  3AKA A;  1QIW A;  1C7V A;  1Y1U A;  1S5G Z;  3M0W A;  2KGR A;  3CR5 X;  1SYM A;  3PSR A;  3IQO A;  4L9M A;  1YR5 A;  1SCM B;  1WDC C;  5JOL A;  1JF2 A;  1BF5 A;  4QJ3 B;  2KFH A;  1TTX A;  1IJ5 A;  2SCP A;  3JTD B;  1YUR A;  1AHR A;  1KFU S;  3EVV A;  1SKT A;  3SIB A;  2JU0 A;  1OZO A;  3I5G B;  1M45 A;  1KWO B;  4I5J A;  5D7F A;  1YX8 A;  1B1G A;  1PUL A;  1KFX L;  3CR2 A;  1EL4 A;  1SPY A;  2BE6 A;  3BUN B;  3F45 A;  2CTN A;  2NLN A;  2I2R E;  1K9U A;  3SJS A;  1F71 A;  2VRG A;  1XFY O;  1W7J B;  2KBM A;  4F0Z B;  1BOD A;  1K90 D;  1A75 B;  2M3W A;  1DGU A;  2NCO A;  1J7O A;  1F54 A;  2CBL A;  2ZRS A;  1RTP 1;  2ZFD A;  3I5H B;  2TN4 A;  4JWQ A;  1B47 A;  4ORA B;  5FYX A;  2KNE A;  1ZMZ A;  2M9G A;  3EVU A;  3SG3 A;  2JT8 A;  1AK8 A;  2F3Z A;  3NSK A;  4PCW A;  2BL0 C;  3VRO A;  3BOW B;  1DVI A;  1CLM A;  4C0J A;  1GQM A;  1EXR A;  1OMR A;  2M7L A;  2L98 A;  4MZL A;  4HRE E;  3WHT B;  5I2O A;  1LKJ A;  1NPQ A;  1NYA A;  4UPG A;  2HET A;  4FQO A;  2JQ6 A;  2L50 A;  1OE9 B;  1LA3 A;  2OS8 C;  1RWY A;  2LHI A;  2LV7 A;  1L7Z A;  1H4B A;  4GUK A;  2AMI A;  2K7O A;  2L4H A;  1CMF A;  2IS9 A;  5IBW A;  1TNX A;  1BJF A;  2COL B;  4PHM A;  4PE7 A;  3AAJ A;  4TNC A;  2MJW B;  4DS7 A;  1FI5 A;  2PAS A;  1QAS A;  1MWN A;  1NIW A;  2WCB A;  2L5X B;  3BYA A;  1WLM A;  3TUY B;  2LNK A;  1DJI A;  1X02 A;  1CTR A;  4GGF A;  4HRH A;  3DVJ A;  3IQQ A;  2GGZ A;  3D0Y B;  5F6T A;  3RLZ A;  1OOJ A;  4BY5 A;  1DF0 B;  1UHN A;  2Y5I A;  3GK4 X;  3VRQ A;  4E68 A;  1K9K A;  2MHH A;  3TDU A;  2BCB A;  1NCY A;  2JPT A;  3CLN A;  5KU1 A;  1Y0V H;  1XFU O;  2NZ0 A;  3GK2 A;  4BY4 A;  4NDB A;  1KFX S;  1RK9 A;  2M29 A;  1FW4 A;  2ZKM X;  1IH0 A;  4DIR A;  4YGC B;  2AAO A;  2CNP A;  2BEC A;  3CR4 X;  5KSZ A;  3WNX B;  3ICB A;  2KYC A;  4DUQ A;  1S26 D;  4GAO A;  1F8H A;  3I5F B;  1MXE A;  4AOM A;  1JFJ A;  2JRF A;  2PRU A;  3PM8 A;  1CDL A;  4CID A;  5B8I B;  3OX6 A;  1SL8 A;  3HCM A;  1QAT A;  1IGV A;  2MRD A;  2Y4Q A;  3BUW B;  1U5I A;  1KK7 Z;  4CFQ A;  2LP3 A;  3OB1 B;  3SG4 A;  4CPV A;  1SR6 B;  1PK0 D;  1TNP A;  1LIN A;  1XFV O;  3K21 A;  4GNK B;  1UHJ A;  3DVM A;  1UP5 A;  1IJ6 A;  1RJV A;  2P6B B;  5CPV A;  2KI4 C;  1JUO A;  2M49 B;  2FCE A;  5CSI A;  3FWB A;  4MLW A;  1M63 B;  1S36 A;  2H61 C;  1UHI A;  1B9A A;  1CM1 A;  1CFP A;  1J7P A;  5AAN A;  4R1E A;  5HYD A;  3KEV A;  2E6W A;  1CLL A;  1K9P A;  3O2P A;  1GGW A;  2LVK A;  3GK1 A;  2K2F A;  5I8N A;  3TDI A;  5HLO A;  1SY9 A;  3PAT A;  4M2O A;  2D8N A;  2KOT A;  5KTY A;  1DJX A;  1XK4 C;  2G2B A;  1NX0 A;  2WOR A;  4XJK A;  1UWO A;  1QX2 A;  4AQJ A;  1PVA A;  1KSM A;  1LVC D;  1D1O A;  4CLN A;  1N65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...