1NX2A

Calpain domain vi
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
173
structure length
173
Chain Sequence
b'EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 66
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx2A00
3AKAA 4TNCA 2KAVA 1C7WA 1AP4A 2ZN9A 1MHOA 2CBLA 5AEQA 1SL9A 3WHUB 3IQOA 2L0PA 1A4PA 1TNWA 1DVIA 1JF2A 1SW8A 5AFPA 2JT3A 1WRKA 4MRXA 1OMDA 1A2XA 1B9AA 2F2PA 1W7IB 4OCIA 4DS7A 1XFUO 1KK7Z 1DF0B 1AJ5A 2EC6B 2Y4QA 1CDMA 4A4BA 3HCMA 2KBMA 5BPJA 2BBNA 1K9KA 3NSOA 5CSIA 5F6TA 3DD4A 5JOLA 1RJVA 1S26D 1K96A 3AAJA 5DKRA 2LP2A 2ZNDA 5CSNA 2OS8C 4YRUA 4DRWA 4PE7A 2BKIB 1IRJA 1OOJA 3BOWB 4YI8A 3PN7B 2BE6A 1EG3A 2JQ6A 2D8NA 4PHMA 2ZRSA 3D0YB 4XJKA 5AANA 1KK8C 4NQGA 5HKZA 1A75A 2MBXA 2CNPA 2RGIA 4MEWA 3OP0A 1RROA 2OPOA 2F8PA 2G9BA 2KBIA 1IGVA 1M31A 2PVBA 4M2PA 2GGMA 1JUOA 1B47A 1YX7A 1JWDA 2JXCA 1OZOA 1K2HA 1TCOB 1NIWA 2ZN8A 3KF9A 1IJ6A 3PALA 2CTNA 2JZIA 2LUXA 1FI6A 1ALVA 1S36A 1SYMA 1TNPA 1NX2A 1W7JB 1KSOA 3PLFB 3VRRA 2KI6D 1QV0A 3LLEA 1SNLA 1MF8B 1SCVA 2K2AA 2K7CA 3SJSA 2SCPA 1S6CA 2KQ6A 3PATA 3ZNIA 5HYDA 4I5LB 1AK8A 2KDHA 4BY5A 2HF5A 1F54A 1Y0VH 1SL7A 1LA3A 2IS9A 1CLMA 3D10A 1DJYA 4HREE 2PMYA 4HRHA 1XVJA 4QJ4B 1XFWO 1BU3A 3KHEA 3EK4A 1ZOTB 2B1UA 2KFGA 1FBVA 3EVVA 1HT9A 1JFJA 1XYDA 4YGCB 3I5HC 5ER4X 1A75B 3JTDC 1SR6C 3CGAA 4GBAA 3CLNA 3GK4X 3A4UB 1F71A 1N65A 2K61A 2VRGA 5I2OA 1JFKA 1LA0A 1IKUA 3SIBA 2A4JA 1N0YA 4DCKA 4AQJA 2BECA 4ORBB 4PHNA 1YX8A 2FJUB 1PRWA 2K7OA 2LMTA 2V53A 2K7DA 2MHHA 3TS5C 1PVBA 1NCXA 1TOPA 2LP3A 2OTGC 3FIAA 1OZSA 1UHNA 1KQMB 5FYXA 2JULA 2LANA 3F45A 1BLQA 1F4OA 1Y1AA 1EXRA 5KU1A 2MLFC 1QLSA 2ZRTA 3A8RA 2BL0B 2BCAA 3NSIA 1CM1A 1ZACA 3O6BA 1ODBA 1TNXA 4ICBA 2JRFA 1TIZA 3TUYB 3TDZA 2BCXA 3CZTX 1CLBA 4PDZA 3AAKA 2KFFA 3I5GC 2K2FA 1CDPA 1UHIA 2LC5A 4MZKA 4ORAB 1KFXS 1SPYA 1YVHA 2CCMA 1B8CA 4JQ0D 4DIRA 2LVVA 3BUNB 3VRPA 4XYNA 2JTZA 4QJ5B 3EVRA 2JU0A 3GK1A 1HQVA 4MZLA 3PFVA 1YURA 2PALA 2PSRA 4M2QA 1YRUB 2MJWB 3SG3A 1YTZC 3EVUA 4N1GA 4U8DA 4GGNA 2MRDA 4D1EA 2K8MB 1L2OC 1CFCA 2KYFA 2Y5IA 4ORCB 2ISDA 2BKHB 2BBMA 1ALWA 1JSAA 2LCPA 1TNQA 1KSMA 1RTP1 1NYAA 1UURA 3DF0A 4MRYA 1YVLA 2CT9A 1TCFA 5ER5A 2M7LA 1FI5A 1XA5A 4QJ3B 1PK0D 1F55A 2JT8A 3O4YA 1J1DA 1LVCD 2EHBA 1WDCC 1JBAA 3KPXA 5TNCA 2BE4A 1BMOA 2L4IA 5I2LA 1YUSA 3MSEB 1QTXA 2JXLA 2OS8B 4C0KA 1CFPA 1QXPA 1SBJA 2F3ZA 2JOJA 3CR2A 1MXEA 5I2QA 1KK8B 3EK8A 1C7VA 1UHKA 3BQ3A 3TZ1A 1H4BA 1BR1B 1RECA 3WNXB 3GK2A 1B8RA 1PSRA 2ZKMX 2M8UA 1S5GZ 3GOFA 1QX7A 1M46A 2P6BB 1QS7A 1EL4A 4GGFA 1CTRA 2NLNA 1G4YR 1B7TZ 2GGZA 2I94A 1DT7B 1CMFA 3DVMA 2M97A 2JNFA 1M63B 1CM4A 2M9GA 3RM1A 1WRZA 4I5KA 3PSRA 3VRNA 2QACA 1CKKA 2KAYA 2L4HA 1EJ3A 2L50A 2M0RA 1J7PA 2KI6C 2H2KA 4OV2A 2LNKA 4AQIA 1RFJA 1NX3A 1XK4A 4WQ3A 1F70A 1J1EA 1CLLA 2LVJA 1KWOC 2L98A 3OB1B 1J7QA 1DTLA 1LXFC 3CR5X 4C0LA 1K8UA 1SL8A 5DKQA 1KWOB 1UWOA 3IQQA 1WLMA 1GJYA 4CFQA 1UP5A 1FF1A 5HLVA 2NCOA 1XFXO 5DKNA 3C1VA 4XJKB 1E8AA 2KGRA 2M7NA 4MBEA 2CXJA 3BUWB 1K94A 1UUSA 2JTTA 1S6JA 1L7ZA 2PASA 4HSZA 1DJXA 3I5HB 1NPQA 1SK6D 3JTDB 4MLWA 1SR6B 4N5XA 4YGDB 4GGFC 2LLSA 2K0JA 1IH0A 3FS7A 5HLOA 1QX5B 1S1EA 4ZCVA 2I7AA 2JNXA 1KK7Y 2KI4C 1DJGA 3EKJA 3BUMB 1G8IA 1QJTA 3PM8A 3WXAA 1RK9A 1IQ3A 2GV5A 3TDUA 3TS5B 1NUBA 1VRKA 2LAPA 3DVKA 4P5OE 1XK4C 5J3XA 2OTGB 4GAOA 1A03A 4OR9B 1ZMZA 1M45A 2LLUA 1RWYA 3FWBA 4PHKA 4JPZB 3SIAA 1NCZA 4GFTA 3BUXB 4L9MA 1WY9A 4HRGA 2FCDA 3K21A 2KQYA 1WRLA 5D69A 1KCYA 2KSPA 2E30A 4CFRA 5I8NA 4PE4A 3EK7A 1XFZO 1AUIB 2WOSA 1J55A 1PVAA 2JWWA 3H4SE 1ZUZA 1MXLC 2H61C 3I5GB 1DF0A 2Q91A 4ETOA 1QV1A 1LKJA 4PE1A 1F4QA 3NXAA 1Y1UA 2KHNA 1YUUA 3CR4X 1R6PA 1MR8A 1CMGA 3JVTC 1B7TY 2Q4UA 2NZ0A 4E68A 4I5NB 1J7OA 1MUXA 4WRIA 2LLTA 5CSJA 4NDCA 1PSBA 2COLB 2F3YA 3E3RA 4R1EA 4BY4A 1YR5A 2WORA 3RLZA 5HKWA 4GUKA 3OHMB 5GQQC 2EGDA 1BT6A 2KYCA 4FQOA 2M3WA 2HQ8A 2LVIA 1L2OB 3SG6A 1GGWA 3QRXA 1K90D 1CFFA 1YUTA 4YGBB 3EKHA 1S6IA 3HX4A 4F0ZB 1FPWA 1QIVA 2WNDA 1KFXL 1TRFA 5CPVA 5G08A 2M49B 2O60A 1DJHA 2G2BA 3KO0A 1WDCB 3TDIA 5AXIA 2M1KB 3DVEA 2LE9B 3FWCA 5IBWA 1CDNA 4CLNA 1DGVA 2O5GA 4YBHB 3LL8B 2MAZA 4USLA 2SASA 2PRUA 2EC6C 2K7BA 2KNEA 1B8LA 1DGUA 1TN4A 4MN0A 2WCEA 1J7RA 5PALA 1F8HA 3SG7A 3BXKA 1SMGA 1QIWA 2LVKA 3VGOA 4DUQA 1SKTA 2JC2A 2I2RE 1BJFA 1K9PA 3LK1A 1D1OA 1XFVO 2KFHA 2MLEC 1OSAA 1NX0A 2NCPA 3PN7C 1QATA 1C07A 2ZNEA 1IJ5A 3IF7A 3OX5A 1IQ5A 1OMRA 3AKBA 1GQMA 2LMVA 1S3PA 1G33A 3SG2A 1BOCA 4YGEB 1BR4B 2DOQA 1QLKA 1DMOA 1NSHA 1X02A 2FCEA 4CPVA 1MQ1A 2WCBA 3DF0B 1U5IA 3CTNA 4YGAA 1B1GA 4UPGA 1JC2A 1EH2A 1NCYA 4FTGA 4YI9A 4JWQA 1AVSA 1QVIZ 1NWDA 1YRTB 3KEVA 4WQ2A 1FW4A 2NXQA 3DVJA 1PULA 4I5JA 1K95A 3O2PA 2LHIA 1QX2A 1R2UA 1SCMC 1KFUS 4N1FA 5CSFA 1CFDA 3I5IC 1A29A 2F2OA 2H61A 1SCMB 1V1FA 4NDDA 1N2DA 2L5XB 3CS1A 4OVNF 1BODA 2AAOA 3I5IB 4AOMA 5HKYA 4MSPA 1CDLA 2Y1MA 5K89A 1NP8A 1DJWA 2JT0A 2TN4A 1CB1A 3OX6A 1B4CA 1Q80A 1XFYO 4MVFA 2BCBA 2WC8A 3O78A 1LINA 1V1GA 2HPSA 3M0WA 3SG4A 1Y1XA 2KI4B 4A4CA 1IWQA 1EG4A 1K93D 5AERA 2JPTA 3CWGA 2M29A 3SG5A 1TTXA 2LMUA 1UHHA 3LK0A 1U5IB 3BUOB 3NSKA 1WLZA 4CIDA 1KFUL 1OMVA 3OB2B 1IG5A 1OE9B 1Y6WA 3WHTB 3ICBA 2KAXA 1PALA 1MWNA 3VRQA 3BYAA 5KSZA 5D7FA 4Q04A 2AMIA 3ZWHA 1M39A 1CNPA 2KOTA 2E6WA 2WCFA 1AHRA 1NX1A 2AUCA 3LCPC 1K9UA 1SRAA 4ZCUA 4M2OA 1KQMC 1SY9A 1GGZA 1DJIA 2ZFDA 2LV7A 3I5FC 2LM5A 2QPTA 3NSLA 2M1UA 4GPLB 1S5GY 2L2EA 4GNKB 4PALA 2LUCA 2BL0C 3I5FB 1UHJA 4P2YB 4PE0A 5JJGA 5KTYA 1AJ4A 4IL1A 4PCWA 2F33A 2I18A 1DJZA 2LHLA 3TUYC 2MA2A 2R2IA 3JVTB 3BOWA 4NDBA 1JF0A 4OKHA 5B8IB 1KQVA 2KGBC 4MZJA 2HQWA 3D0YA 4PHJA 2FOTA 2L51A 4C0JA 1H8BA 1BF5A 1ZFSA 1BG1A 2Y1NA 3VROA 1OQPA 1XO5A 1QASA 1QVIY 2HETA
chains in the Genus database with same CATH superfamily
3AKAA 3DY9A 3NGVA 2KAVA 4TNCA 1C7WA 1AP4A 2PQLA 2ZN9A 1MHOA 2CBLA 3CDNA 5AEQA 3Q8IA 1OW4A 1SL9A 3V2LA 2WCKA 3WHUB 3IQOA 2L0PA 1A4PA 1TNWA 1DVIA 1JF2A 1SW8A 5AFPA 2JT3A 1WRKA 4MRXA 4IJ7A 1OMDA 1A2XA 1B9AA 3D74A 2F2PA 1W7IB 3K1EA 4OCIA 1XFUO 2WC6A 1KK7Z 1DF0B 4DS7A 1AJ5A 2EC6B 2Y4QA 1CDMA 4A4BA 3N7HA 3HCMA 2KBMA 5BPJA 2BBNA 1K9KA 3NSOA 5CSIA 5F6TA 3DD4A 5JOLA 1RJVA 1S26D 1K96A 3AAJA 3BFAA 5DKRA 2LP2A 2ZNDA 5CSNA 2OS8C 4YRUA 4DRWA 4PE7A 2BKIB 1IRJA 1OOJA 2P71A 3BOWB 4YI8A 1TWOA 3PN7B 3SS4A 2BE6A 3D78A 1EG3A 2JQ6A 2D8NA 4PHMA 2ZRSA 3D0YB 4XJKA 5FI2A 5AANA 1KK8C 4NQGA 1TUZA 5HKZA 1A75A 1Z2CB 2MBXA 2CNPA 2RGIA 4MEWA 3OP0A 5DICA 1RROA 2OPOA 2F8PA 2G9BA 2KBIA 1IGVA 1M31A 2PVBA 4M2PA 2GGMA 3RZSA 1JUOA 1B47A 1OOFA 1YX7A 2JXCA 1OZOA 1JWDA 1K2HA 1TCOB 5EL2A 1NIWA 2ZN8A 3KF9A 1IJ6A 3CABA 2CTNA 2JZIA 2LUXA 3PALA 1FI6A 1ALVA 1S36A 3UO9A 1SYMA 1TNPA 1NX2A 1W7JB 1KSOA 3PLFB 3VRRA 2KI6D 1QV0A 3LLEA 1SNLA 1MF8B 1SCVA 1ORGA 2K2AA 2K7CA 3SJSA 2YGUA 2SCPA 1S6CA 2KQ6A 3PATA 3ZNIA 5HYDA 4I5LB 1AK8A 2KDHA 4BY5A 2HF5A 2KLEA 1F54A 2P70A 1Y0VH 1SL7A 1LA3A 2IS9A 1CLMA 3D10A 1DJYA 4HREE 2PMYA 4OZDA 4HRHA 1XVJA 4QJ4B 3SS3A 4JD9A 1XFWO 1BU3A 3KHEA 3EK4A 1ZOTB 2B1UA 2KFGA 1FBVA 3EVVA 1HT9A 2WCLA 1JFJA 1XYDA 1Z4HA 4YGCB 3I5HC 5ER4X 1A75B 3JTDC 1SR6C 3CGAA 4GBAA 3CLNA 3GK4X 3A4UB 1F71A 1N65A 5FI7A 2K61A 2VRGA 3NHIA 5I2OA 1JFKA 1LA0A 1IKUA 3SIBA 2A4JA 1N0YA 4DCKA 4AQJA 2BECA 3S0FA 4ORBB 4PHNA 1YX8A 2FJUB 5D3OA 1PRWA 5HL1A 2K7OA 2LMTA 2V53A 2K7DA 2MHHA 3TS5C 1PVBA 1NCXA 3SS5A 1TOPA 2LP3A 2OTGC 3FIAA 1OZSA 1UHNA 1KQMB 4F7FA 5FYXA 2JULA 2LANA 3F45A 2WCJA 1F4OA 1BLQA 1Y1AA 1DEKA 1EXRA 5KU1A 2MLFC 1QLSA 2ZRTA 3A8RA 2BL0B 2BCAA 1OOIX 3NSIA 1CM1A 1ZACA 3O6BA 1ODBA 1TNXA 4ICBA 2JRFA 1TIZA 3TUYB 3TDZA 2BCXA 3CZTX 1CLBA 4PDZA 3AAKA 2KFFA 3I5GC 2K2FA 1CDPA 1P28A 1UHIA 2LC5A 4MZKA 1KFXS 1SPYA 1YVHA 2CCMA 1B8CA 4JQ0D 2K60A 4DIRA 2LVVA 4ORAB 3BUNB 3VRPA 4XYNA 2JTZA 4QJ5B 3EVRA 2JU0A 3GK1A 1EH2A 1HQVA 4MZLA 3PFVA 1YURA 3IVTA 2PALA 2PSRA 4M2QA 1YRUB 2MJWB 3SG3A 1YTZC 3EVUA 4N1GA 4INXA 2BNXA 3S0EA 1DC1A 4U8DA 4GGNA 2MRDA 4D1EA 2K8MB 1L2OC 3R72A 2KYFA 2Y5IA 3FE8A 1CFCA 4ORCB 2ISDA 2BKHB 2BBMA 1ALWA 1JSAA 3L47A 2LCPA 1TNQA 1KSMA 4INWA 1RTP1 1NYAA 1UURA 3DF0A 4MRYA 1YVLA 2CT9A 1TCFA 5ER5A 2M7LA 1FI5A 1XA5A 4QJ3B 1PK0D 1F55A 2JT8A 3O4YA 1J1DA 1LVCD 2EHBA 1WDCC 1JBAA 3KPXA 5TNCA 2BE4A 1BMOA 2L4IA 5I2LA 1YUSA 3MSEB 1QTXA 2JXLA 2OS8B 4C0KA 1CFPA 1QXPA 4PT1A 3FE6A 3CZ1A 1SBJA 2F3ZA 2JOJA 3CR2A 2GTEA 3R1OA 1MXEA 5I2QA 3CYZA 1KK8B 3BFBA 3EK8A 1C7VA 2BAPA 1UHKA 3BQ3A 3TZ1A 1H4BA 2WC5A 1BR1B 1RECA 3WNXB 3GK2A 1B8RA 1PSRA 1DELA 2ZKMX 2M8UA 1S5GZ 3GOFA 1QX7A 1M46A 2P6BB 1QS7A 1EL4A 3PJIA 1CTRA 3R1VA 2NLNA 1G4YR 1B7TZ 2GGZA 2I94A 5FI6A 1DT7B 3DVMA 2QDIA 2M97A 1CMFA 2JNFA 1M63B 3EG5B 1CM4A 2M9GA 3RM1A 1WRZA 4I5KA 3PSRA 3VRNA 2QACA 3OBVA 1CKKA 2KAYA 2L4HA 1EJ3A 2L50A 2M0RA 1J7PA 2KI6C 2H2KA 4OV2A 2LNKA 4AQIA 1RFJA 3O4XA 1NX3A 1XK4A 4WQ3A 1F70A 1J1EA 1CLLA 2LVJA 1KWOC 2L98A 3OB1B 2WCHA 1DTLA 1LXFC 3CR5X 4C0LA 1J7QA 1IIOA 1K8UA 1SL8A 5DKQA 1KWOB 2L2CA 1UWOA 3IQQA 1WLMA 3S0AA 1GJYA 3L4LA 1UP5A 4CFQA 1FF1A 5HLVA 2NCOA 1XFXO 5DKNA 3C1VA 1XFRA 2FJYA 1E8AA 4XJKB 2KGRA 2M7NA 4MBEA 2CXJA 3BUWB 1K94A 1UUSA 2JTTA 1S6JA 1L7ZA 2PASA 4HSZA 1DJXA 3I5HB 1NPQA 1SK6D 3JTDB 4MLWA 1SR6B 4N5XA 4YGDB 4GGFC 2LLSA 2K0JA 1IH0A 3FS7A 5HLOA 1QX5B 1S1EA 3B7AA 4ZCVA 2I7AA 2JNXA 1KK7Y 2KI4C 1DJGA 1TUJA 1T14A 3EKJA 3BUMB 1G8IA 1QJTA 3PM8A 3WXAA 1RK9A 1IQ3A 2GV5A 3TDUA 3TS5B 1NUBA 1VRKA 2LAPA 3DVKA 4P5OE 1XK4C 5J3XA 2OTGB 4GAOA 1A03A 4OR9B 1ZMZA 1M45A 2LLUA 1RWYA 3FWBA 4PHKA 4JPZB 3SIAA 3B86A 1NCZA 4GFTA 3BUXB 4L9MA 1WY9A 4HRGA 2FCDA 3K21A 2KQYA 1WRLA 5D69A 1KCYA 2ERBA 2E30A 2KSPA 4CFRA 5I8NA 4PE4A 3EK7A 1XFZO 1AUIB 2WOSA 3BFHA 1J55A 1PVAA 2JWWA 3H4SE 1ZUZA 1MXLC 2H61C 3I5GB 1DF0A 2Q91A 4ETOA 1QV1A 1LKJA 4PE1A 1F4QA 3NXAA 3OGNA 1Y1UA 2KHNA 1YUUA 3CR4X 1R6PA 1MR8A 1CMGA 3JVTC 1B7TY 2Q4UA 2NZ0A 3B88A 4E68A 4I5NB 1J7OA 1MUXA 4WRIA 2LLTA 5CSJA 4NDCA 1PSBA 2COLB 2F3YA 3E3RA 4R1EA 4BY4A 1YR5A 2WORA 3RLZA 5HKWA 4GUKA 3OHMB 5GQQC 2EGDA 1BT6A 2KYCA 4FQOA 2M3WA 2HQ8A 2LVIA 1L2OB 3SG6A 1GGWA 3QRXA 1K90D 1CFFA 1YUTA 3BJHA 1DQEA 4YGBB 3EKHA 1S6IA 3CZ0A 3HX4A 4F0ZB 2H8VA 1FPWA 1QIVA 2WNDA 1KFXL 3B6XA 1TRFA 5CPVA 5G08A 2M49B 2O60A 1DJHA 5I94A 2G2BA 3KO0A 1WDCB 3TDIA 5AXIA 2M1KB 3DVEA 3VB1A 2LE9B 3FWCA 5IBWA 1CDNA 4CLNA 1DGVA 2O5GA 4YBHB 3LL8B 2MAZA 4USLA 3UNWA 2SASA 2PRUA 2QEVA 2EC6C 2K7BA 2KNEA 1B8LA 1DGUA 1TN4A 4MN0A 3QMEA 2WCEA 1J7RA 5PALA 1F8HA 3SG7A 3BXKA 1SMGA 1QIWA 2LVKA 3VGOA 4DUQA 3S0DA 1SKTA 1SSEB 2JC2A 2I2RE 1BJFA 1K9PA 3LK1A 1D1OA 1XFVO 2KFHA 2MLEC 1OSAA 1NX0A 2KLDA 2NCPA 3PN7C 1QATA 1C07A 2ZNEA 1IJ5A 3IF7A 3CZ2A 3OX5A 1IQ5A 1OMRA 3AKBA 1GQMA 2LMVA 1S3PA 1G33A 3SG2A 1BOCA 4YGEB 1BR4B 2DOQA 1QLKA 1DMOA 1NSHA 1X02A 2FCEA 4CPVA 1MQ1A 2WCBA 3DF0B 1U5IA 3CTNA 3D77A 4YGAA 3S0GA 4UPGA 1B1GA 1NCYA 1JC2A 3NHTA 3DYEA 4FTGA 1C3ZA 4YI9A 4JWQA 1AVSA 1QVIZ 1NWDA 1YRTB 3KEVA 4WQ2A 1FW4A 2NXQA 3S0BA 3DVJA 1PULA 4I5JA 1K95A 3D75A 3O2PA 2LHIA 1QX2A 1R2UA 1SCMC 1KFUS 4N1FA 5CSFA 1CFDA 2JPOA 1A29A 2F2OA 2H61A 1SCMB 1V1FA 2KPHA 3FE9A 1N2DA 3I5IC 4NDDA 2L5XB 3CS1A 4OVNF 1BODA 2AAOA 3I5IB 4GGFA 4AOMA 5HKYA 4MSPA 1CDLA 2Y1MA 2L5YA 5K89A 1NP8A 1DJWA 2JT0A 2TN4A 1CB1A 3OX6A 1B4CA 1Q80A 1XFYO 2QEHA 4MVFA 2BCBA 2WC8A 3O78A 3DZTA 1V1GA 1LINA 2HPSA 3M0WA 3SG4A 1LS8A 1Y1XA 2QEOA 2KI4B 4A4CA 1IWQA 3DXLA 2WCMA 1EG4A 1K93D 1OOGA 5AERA 1GM0A 2JPTA 3CWGA 3D73A 2M29A 3SG5A 4JKTA 1TTXA 2LMUA 1UHHA 3LK0A 1U5IB 3BUOB 3D76A 3NSKA 1WLZA 4CIDA 1KFUL 1OMVA 1OOHA 1IG5A 1QWVA 3OB2B 1OE9B 1Y6WA 3L4AA 3WHTB 3B87A 3ICBA 2KAXA 1PALA 1MWNA 3VRQA 3BYAA 5KSZA 5D7FA 4Q04A 2AMIA 3ZWHA 1M39A 1CNPA 2KOTA 2E6WA 2WCFA 1AHRA 1NX1A 2AUCA 3PM2A 3LCPC 1K9UA 1SRAA 4ZCUA 4M2OA 1KQMC 1SY9A 1GGZA 1DJIA 2ZFDA 4KYNA 2LV7A 3I5FC 2LM5A 2QPTA 3NSLA 2M1UA 4GPLB 1S5GY 2L2EA 4GNKB 4PALA 2LUCA 2BL0C 3I5FB 3R1PA 1UHJA 4FQTA 4P2YB 4PE0A 5JJGA 5KTYA 1AJ4A 4IL1A 4PCWA 1W9ZA 2F33A 1DJZA 2I18A 2LHLA 3TUYC 2MA2A 2R2IA 3JVTB 3BOWA 4NDBA 1JF0A 4OKHA 5B8IB 1KQVA 2KGBC 2PYQA 2QEBA 4MZJA 1C3YA 2HQWA 3D0YA 4PHJA 2FOTA 2L51A 4C0JA 1H8BA 1BF5A 1ZFSA 1BG1A 2Y1NA 3VROA 1OQPA 1XO5A 1QASA 1QVIY 2HETA
chains in the Genus database with same CATH topology
3AKAA 4TNCA 2KAVA 1C7WA 1AP4A 2ZN9A 1MHOA 2CBLA 5AEQA 1SL9A 3WHUB 3IQOA 2L0PA 1A4PA 1TNWA 1DVIA 1JF2A 1SW8A 5AFPA 2JT3A 1WRKA 4MRXA 1OMDA 1A2XA 1B9AA 2F2PA 1W7IB 4OCIA 4DS7A 1XFUO 1KK7Z 1DF0B 1AJ5A 2EC6B 2Y4QA 1CDMA 4A4BA 3HCMA 2KBMA 5BPJA 2BBNA 1K9KA 3NSOA 5CSIA 5F6TA 3DD4A 5JOLA 1RJVA 1S26D 1K96A 3AAJA 5DKRA 2LP2A 2ZNDA 5CSNA 2OS8C 4YRUA 4DRWA 4PE7A 2BKIB 1IRJA 1OOJA 3BOWB 4YI8A 3PN7B 2BE6A 1EG3A 2JQ6A 2D8NA 4PHMA 2ZRSA 3D0YB 4XJKA 5AANA 1KK8C 4NQGA 5HKZA 1A75A 2MBXA 2CNPA 2RGIA 4MEWA 3OP0A 1RROA 2OPOA 2F8PA 2G9BA 2KBIA 1IGVA 1M31A 2PVBA 4M2PA 2GGMA 1JUOA 1B47A 1YX7A 1JWDA 2JXCA 1OZOA 1K2HA 1TCOB 1NIWA 2ZN8A 3KF9A 1IJ6A 3PALA 2CTNA 2JZIA 2LUXA 1FI6A 1ALVA 1S36A 1SYMA 1TNPA 1NX2A 1W7JB 1KSOA 3PLFB 3VRRA 2KI6D 1QV0A 3LLEA 1SNLA 1MF8B 1SCVA 2K2AA 2K7CA 3SJSA 2SCPA 1S6CA 2KQ6A 3PATA 3ZNIA 5HYDA 4I5LB 1AK8A 2KDHA 4BY5A 2HF5A 1F54A 1Y0VH 1SL7A 1LA3A 2IS9A 1CLMA 3D10A 1DJYA 4HREE 2PMYA 4HRHA 1XVJA 4QJ4B 1XFWO 1BU3A 3KHEA 3EK4A 1ZOTB 2B1UA 2KFGA 1FBVA 3EVVA 1HT9A 1JFJA 1XYDA 4YGCB 3I5HC 5ER4X 1A75B 3JTDC 1SR6C 3CGAA 4GBAA 3CLNA 3GK4X 3A4UB 1F71A 1N65A 2K61A 2VRGA 5I2OA 1JFKA 1LA0A 1IKUA 3SIBA 2A4JA 1N0YA 4DCKA 4AQJA 2BECA 4ORBB 4PHNA 1YX8A 2FJUB 1PRWA 2K7OA 2LMTA 2V53A 2K7DA 2MHHA 3TS5C 1PVBA 1NCXA 1TOPA 2LP3A 2OTGC 3FIAA 1OZSA 1UHNA 1KQMB 5FYXA 2JULA 2LANA 3F45A 1BLQA 1F4OA 1Y1AA 1EXRA 5KU1A 2MLFC 1QLSA 2ZRTA 3A8RA 2BL0B 2BCAA 3NSIA 1CM1A 1ZACA 3O6BA 1ODBA 1TNXA 4ICBA 2JRFA 1TIZA 3TUYB 3TDZA 2BCXA 3CZTX 1CLBA 4PDZA 3AAKA 2KFFA 3I5GC 2K2FA 1CDPA 1UHIA 2LC5A 4MZKA 4ORAB 1KFXS 1SPYA 1YVHA 2CCMA 1B8CA 4JQ0D 4DIRA 2LVVA 3BUNB 3VRPA 4XYNA 2JTZA 4QJ5B 3EVRA 2JU0A 3GK1A 1HQVA 4MZLA 3PFVA 1YURA 2PALA 2PSRA 4M2QA 1YRUB 2MJWB 3SG3A 1YTZC 3EVUA 4N1GA 4U8DA 4GGNA 2MRDA 4D1EA 2K8MB 1L2OC 1CFCA 2KYFA 2Y5IA 4ORCB 2ISDA 2BKHB 2BBMA 1ALWA 1JSAA 2LCPA 1TNQA 1KSMA 1RTP1 1NYAA 1UURA 3DF0A 4MRYA 1YVLA 2CT9A 1TCFA 5ER5A 2M7LA 1FI5A 1XA5A 4QJ3B 1PK0D 1F55A 2JT8A 3O4YA 1J1DA 1LVCD 2EHBA 1WDCC 1JBAA 3KPXA 5TNCA 2BE4A 1BMOA 2L4IA 5I2LA 1YUSA 3MSEB 1QTXA 2JXLA 2OS8B 4C0KA 1CFPA 1QXPA 1SBJA 2F3ZA 2JOJA 3CR2A 1MXEA 5I2QA 1KK8B 3EK8A 1C7VA 1UHKA 3BQ3A 3TZ1A 1H4BA 1BR1B 1RECA 3WNXB 3GK2A 1B8RA 1PSRA 2ZKMX 2M8UA 1S5GZ 3GOFA 1QX7A 1M46A 2P6BB 1QS7A 1EL4A 4GGFA 1CTRA 2NLNA 1G4YR 1B7TZ 2GGZA 2I94A 1DT7B 1CMFA 3DVMA 2M97A 2JNFA 1M63B 1CM4A 2M9GA 3RM1A 1WRZA 4I5KA 3PSRA 3VRNA 2QACA 1CKKA 2KAYA 2L4HA 1EJ3A 2L50A 2M0RA 1J7PA 2KI6C 2H2KA 4OV2A 2LNKA 4AQIA 1RFJA 1NX3A 1XK4A 4WQ3A 1F70A 1J1EA 1CLLA 2LVJA 1KWOC 2L98A 3OB1B 1J7QA 1DTLA 1LXFC 3CR5X 4C0LA 1K8UA 1SL8A 5DKQA 1KWOB 1UWOA 3IQQA 1WLMA 1GJYA 4CFQA 1UP5A 1FF1A 5HLVA 2NCOA 1XFXO 5DKNA 3C1VA 4XJKB 1E8AA 2KGRA 2M7NA 4MBEA 2CXJA 3BUWB 1K94A 1UUSA 2JTTA 1S6JA 1L7ZA 2PASA 4HSZA 1DJXA 3I5HB 1NPQA 1SK6D 3JTDB 4MLWA 1SR6B 4N5XA 4YGDB 4GGFC 2LLSA 2K0JA 1IH0A 3FS7A 5HLOA 1QX5B 1S1EA 4ZCVA 2I7AA 2JNXA 1KK7Y 2KI4C 1DJGA 3EKJA 3BUMB 1G8IA 1QJTA 3PM8A 3WXAA 1RK9A 1IQ3A 2GV5A 3TDUA 3TS5B 1NUBA 1VRKA 2LAPA 3DVKA 4P5OE 1XK4C 5J3XA 2OTGB 4GAOA 1A03A 4OR9B 1ZMZA 1M45A 2LLUA 1RWYA 3FWBA 4PHKA 4JPZB 3SIAA 1NCZA 4GFTA 3BUXB 4L9MA 1WY9A 4HRGA 2FCDA 3K21A 2KQYA 1WRLA 5D69A 1KCYA 2KSPA 2E30A 4CFRA 5I8NA 4PE4A 3EK7A 1XFZO 1AUIB 2WOSA 1J55A 1PVAA 2JWWA 3H4SE 1ZUZA 1MXLC 2H61C 3I5GB 1DF0A 2Q91A 4ETOA 1QV1A 1LKJA 4PE1A 1F4QA 3NXAA 1Y1UA 2KHNA 1YUUA 3CR4X 1R6PA 1MR8A 1CMGA 3JVTC 1B7TY 2Q4UA 2NZ0A 4E68A 4I5NB 1J7OA 1MUXA 4WRIA 2LLTA 5CSJA 4NDCA 1PSBA 2COLB 2F3YA 3E3RA 4R1EA 4BY4A 1YR5A 2WORA 3RLZA 5HKWA 4GUKA 3OHMB 5GQQC 2EGDA 1BT6A 2KYCA 4FQOA 2M3WA 2HQ8A 2LVIA 1L2OB 3SG6A 1GGWA 3QRXA 1K90D 1CFFA 1YUTA 4YGBB 3EKHA 1S6IA 3HX4A 4F0ZB 1FPWA 1QIVA 2WNDA 1KFXL 1TRFA 5CPVA 5G08A 2M49B 2O60A 1DJHA 2G2BA 3KO0A 1WDCB 3TDIA 5AXIA 2M1KB 3DVEA 2LE9B 3FWCA 5IBWA 1CDNA 4CLNA 1DGVA 2O5GA 4YBHB 3LL8B 2MAZA 4USLA 2SASA 2PRUA 2EC6C 2K7BA 2KNEA 1B8LA 1DGUA 1TN4A 4MN0A 2WCEA 1J7RA 5PALA 1F8HA 3SG7A 3BXKA 1SMGA 1QIWA 2LVKA 3VGOA 4DUQA 1SKTA 2JC2A 2I2RE 1BJFA 1K9PA 3LK1A 1D1OA 1XFVO 2KFHA 2MLEC 1OSAA 1NX0A 2NCPA 3PN7C 1QATA 1C07A 2ZNEA 1IJ5A 3IF7A 3OX5A 1IQ5A 1OMRA 3AKBA 1GQMA 2LMVA 1S3PA 1G33A 3SG2A 1BOCA 4YGEB 1BR4B 2DOQA 1QLKA 1DMOA 1NSHA 1X02A 2FCEA 4CPVA 1MQ1A 2WCBA 3DF0B 1U5IA 3CTNA 4YGAA 1B1GA 4UPGA 1JC2A 1EH2A 1NCYA 4FTGA 4YI9A 4JWQA 1AVSA 1QVIZ 1NWDA 1YRTB 3KEVA 4WQ2A 1FW4A 2NXQA 3DVJA 1PULA 4I5JA 1K95A 3O2PA 2LHIA 1QX2A 1R2UA 1SCMC 1KFUS 4N1FA 5CSFA 1CFDA 3I5IC 1A29A 2F2OA 2H61A 1SCMB 1V1FA 4NDDA 1N2DA 2L5XB 3CS1A 4OVNF 1BODA 2AAOA 3I5IB 4AOMA 5HKYA 4MSPA 1CDLA 2Y1MA 5K89A 1NP8A 1DJWA 2JT0A 2TN4A 1CB1A 3OX6A 1B4CA 1Q80A 1XFYO 4MVFA 2BCBA 2WC8A 3O78A 1LINA 1V1GA 2HPSA 3M0WA 3SG4A 1Y1XA 2KI4B 4A4CA 1IWQA 1EG4A 1K93D 5AERA 2JPTA 3CWGA 2M29A 3SG5A 1TTXA 2LMUA 1UHHA 3LK0A 1U5IB 3BUOB 3NSKA 1WLZA 4CIDA 1KFUL 1OMVA 3OB2B 1IG5A 1OE9B 1Y6WA 3WHTB 3ICBA 2KAXA 1PALA 1MWNA 3VRQA 3BYAA 5KSZA 5D7FA 4Q04A 2AMIA 3ZWHA 1M39A 1CNPA 2KOTA 2E6WA 2WCFA 1AHRA 1NX1A 2AUCA 3LCPC 1K9UA 1SRAA 4ZCUA 4M2OA 1KQMC 1SY9A 1GGZA 1DJIA 2ZFDA 2LV7A 3I5FC 2LM5A 2QPTA 3NSLA 2M1UA 4GPLB 1S5GY 2L2EA 4GNKB 4PALA 2LUCA 2BL0C 3I5FB 1UHJA 4P2YB 4PE0A 5JJGA 5KTYA 1AJ4A 4IL1A 4PCWA 2F33A 2I18A 1DJZA 2LHLA 3TUYC 2MA2A 2R2IA 3JVTB 3BOWA 4NDBA 1JF0A 4OKHA 5B8IB 1KQVA 2KGBC 4MZJA 2HQWA 3D0YA 4PHJA 2FOTA 2L51A 4C0JA 1H8BA 1BF5A 1ZFSA 1BG1A 2Y1NA 3VROA 1OQPA 1XO5A 1QASA 1QVIY 2HETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKA A;  4TNC A;  2KAV A;  1C7W A;  1AP4 A;  2ZN9 A;  1MHO A;  2CBL A;  5AEQ A;  1SL9 A;  3WHU B;  3IQO A;  2L0P A;  1A4P A;  1TNW A;  1DVI A;  1JF2 A;  1SW8 A;  5AFP A;  2JT3 A;  1WRK A;  4MRX A;  1OMD A;  1A2X A;  1B9A A;  2F2P A;  1W7I B;  4OCI A;  4DS7 A;  1XFU O;  1KK7 Z;  1DF0 B;  1AJ5 A;  2EC6 B;  2Y4Q A;  1CDM A;  4A4B A;  3HCM A;  2KBM A;  5BPJ A;  2BBN A;  1K9K A;  3NSO A;  5CSI A;  5F6T A;  3DD4 A;  5JOL A;  1RJV A;  1S26 D;  1K96 A;  3AAJ A;  5DKR A;  2LP2 A;  2ZND A;  5CSN A;  2OS8 C;  4YRU A;  4DRW A;  4PE7 A;  2BKI B;  1IRJ A;  1OOJ A;  3BOW B;  4YI8 A;  3PN7 B;  2BE6 A;  1EG3 A;  2JQ6 A;  2D8N A;  4PHM A;  2ZRS A;  3D0Y B;  4XJK A;  5AAN A;  1KK8 C;  4NQG A;  5HKZ A;  1A75 A;  2MBX A;  2CNP A;  2RGI A;  4MEW A;  3OP0 A;  1RRO A;  2OPO A;  2F8P A;  2G9B A;  2KBI A;  1IGV A;  1M31 A;  2PVB A;  4M2P A;  2GGM A;  1JUO A;  1B47 A;  1YX7 A;  1JWD A;  2JXC A;  1OZO A;  1K2H A;  1TCO B;  1NIW A;  2ZN8 A;  3KF9 A;  1IJ6 A;  3PAL A;  2CTN A;  2JZI A;  2LUX A;  1FI6 A;  1ALV A;  1S36 A;  1SYM A;  1TNP A;  1NX2 A;  1W7J B;  1KSO A;  3PLF B;  3VRR A;  2KI6 D;  1QV0 A;  3LLE A;  1SNL A;  1MF8 B;  1SCV A;  2K2A A;  2K7C A;  3SJS A;  2SCP A;  1S6C A;  2KQ6 A;  3PAT A;  3ZNI A;  5HYD A;  4I5L B;  1AK8 A;  2KDH A;  4BY5 A;  2HF5 A;  1F54 A;  1Y0V H;  1SL7 A;  1LA3 A;  2IS9 A;  1CLM A;  3D10 A;  1DJY A;  4HRE E;  2PMY A;  4HRH A;  1XVJ A;  4QJ4 B;  1XFW O;  1BU3 A;  3KHE A;  3EK4 A;  1ZOT B;  2B1U A;  2KFG A;  1FBV A;  3EVV A;  1HT9 A;  1JFJ A;  1XYD A;  4YGC B;  3I5H C;  5ER4 X;  1A75 B;  3JTD C;  1SR6 C;  3CGA A;  4GBA A;  3CLN A;  3GK4 X;  3A4U B;  1F71 A;  1N65 A;  2K61 A;  2VRG A;  5I2O A;  1JFK A;  1LA0 A;  1IKU A;  3SIB A;  2A4J A;  1N0Y A;  4DCK A;  4AQJ A;  2BEC A;  4ORB B;  4PHN A;  1YX8 A;  2FJU B;  1PRW A;  2K7O A;  2LMT A;  2V53 A;  2K7D A;  2MHH A;  3TS5 C;  1PVB A;  1NCX A;  1TOP A;  2LP3 A;  2OTG C;  3FIA A;  1OZS A;  1UHN A;  1KQM B;  5FYX A;  2JUL A;  2LAN A;  3F45 A;  1BLQ A;  1F4O A;  1Y1A A;  1EXR A;  5KU1 A;  2MLF C;  1QLS A;  2ZRT A;  3A8R A;  2BL0 B;  2BCA A;  3NSI A;  1CM1 A;  1ZAC A;  3O6B A;  1ODB A;  1TNX A;  4ICB A;  2JRF A;  1TIZ A;  3TUY B;  3TDZ A;  2BCX A;  3CZT X;  1CLB A;  4PDZ A;  3AAK A;  2KFF A;  3I5G C;  2K2F A;  1CDP A;  1UHI A;  2LC5 A;  4MZK A;  4ORA B;  1KFX S;  1SPY A;  1YVH A;  2CCM A;  1B8C A;  4JQ0 D;  4DIR A;  2LVV A;  3BUN B;  3VRP A;  4XYN A;  2JTZ A;  4QJ5 B;  3EVR A;  2JU0 A;  3GK1 A;  1HQV A;  4MZL A;  3PFV A;  1YUR A;  2PAL A;  2PSR A;  4M2Q A;  1YRU B;  2MJW B;  3SG3 A;  1YTZ C;  3EVU A;  4N1G A;  4U8D A;  4GGN A;  2MRD A;  4D1E A;  2K8M B;  1L2O C;  1CFC A;  2KYF A;  2Y5I A;  4ORC B;  2ISD A;  2BKH B;  2BBM A;  1ALW A;  1JSA A;  2LCP A;  1TNQ A;  1KSM A;  1RTP 1;  1NYA A;  1UUR A;  3DF0 A;  4MRY A;  1YVL A;  2CT9 A;  1TCF A;  5ER5 A;  2M7L A;  1FI5 A;  1XA5 A;  4QJ3 B;  1PK0 D;  1F55 A;  2JT8 A;  3O4Y A;  1J1D A;  1LVC D;  2EHB A;  1WDC C;  1JBA A;  3KPX A;  5TNC A;  2BE4 A;  1BMO A;  2L4I A;  5I2L A;  1YUS A;  3MSE B;  1QTX A;  2JXL A;  2OS8 B;  4C0K A;  1CFP A;  1QXP A;  1SBJ A;  2F3Z A;  2JOJ A;  3CR2 A;  1MXE A;  5I2Q A;  1KK8 B;  3EK8 A;  1C7V A;  1UHK A;  3BQ3 A;  3TZ1 A;  1H4B A;  1BR1 B;  1REC A;  3WNX B;  3GK2 A;  1B8R A;  1PSR A;  2ZKM X;  2M8U A;  1S5G Z;  3GOF A;  1QX7 A;  1M46 A;  2P6B B;  1QS7 A;  1EL4 A;  4GGF A;  1CTR A;  2NLN A;  1G4Y R;  1B7T Z;  2GGZ A;  2I94 A;  1DT7 B;  1CMF A;  3DVM A;  2M97 A;  2JNF A;  1M63 B;  1CM4 A;  2M9G A;  3RM1 A;  1WRZ A;  4I5K A;  3PSR A;  3VRN A;  2QAC A;  1CKK A;  2KAY A;  2L4H A;  1EJ3 A;  2L50 A;  2M0R A;  1J7P A;  2KI6 C;  2H2K A;  4OV2 A;  2LNK A;  4AQI A;  1RFJ A;  1NX3 A;  1XK4 A;  4WQ3 A;  1F70 A;  1J1E A;  1CLL A;  2LVJ A;  1KWO C;  2L98 A;  3OB1 B;  1J7Q A;  1DTL A;  1LXF C;  3CR5 X;  4C0L A;  1K8U A;  1SL8 A;  5DKQ A;  1KWO B;  1UWO A;  3IQQ A;  1WLM A;  1GJY A;  4CFQ A;  1UP5 A;  1FF1 A;  5HLV A;  2NCO A;  1XFX O;  5DKN A;  3C1V A;  4XJK B;  1E8A A;  2KGR A;  2M7N A;  4MBE A;  2CXJ A;  3BUW B;  1K94 A;  1UUS A;  2JTT A;  1S6J A;  1L7Z A;  2PAS A;  4HSZ A;  1DJX A;  3I5H B;  1NPQ A;  1SK6 D;  3JTD B;  4MLW A;  1SR6 B;  4N5X A;  4YGD B;  4GGF C;  2LLS A;  2K0J A;  1IH0 A;  3FS7 A;  5HLO A;  1QX5 B;  1S1E A;  4ZCV A;  2I7A A;  2JNX A;  1KK7 Y;  2KI4 C;  1DJG A;  3EKJ A;  3BUM B;  1G8I A;  1QJT A;  3PM8 A;  3WXA A;  1RK9 A;  1IQ3 A;  2GV5 A;  3TDU A;  3TS5 B;  1NUB A;  1VRK A;  2LAP A;  3DVK A;  4P5O E;  1XK4 C;  5J3X A;  2OTG B;  4GAO A;  1A03 A;  4OR9 B;  1ZMZ A;  1M45 A;  2LLU A;  1RWY A;  3FWB A;  4PHK A;  4JPZ B;  3SIA A;  1NCZ A;  4GFT A;  3BUX B;  4L9M A;  1WY9 A;  4HRG A;  2FCD A;  3K21 A;  2KQY A;  1WRL A;  5D69 A;  1KCY A;  2KSP A;  2E30 A;  4CFR A;  5I8N A;  4PE4 A;  3EK7 A;  1XFZ O;  1AUI B;  2WOS A;  1J55 A;  1PVA A;  2JWW A;  3H4S E;  1ZUZ A;  1MXL C;  2H61 C;  3I5G B;  1DF0 A;  2Q91 A;  4ETO A;  1QV1 A;  1LKJ A;  4PE1 A;  1F4Q A;  3NXA A;  1Y1U A;  2KHN A;  1YUU A;  3CR4 X;  1R6P A;  1MR8 A;  1CMG A;  3JVT C;  1B7T Y;  2Q4U A;  2NZ0 A;  4E68 A;  4I5N B;  1J7O A;  1MUX A;  4WRI A;  2LLT A;  5CSJ A;  4NDC A;  1PSB A;  2COL B;  2F3Y A;  3E3R A;  4R1E A;  4BY4 A;  1YR5 A;  2WOR A;  3RLZ A;  5HKW A;  4GUK A;  3OHM B;  5GQQ C;  2EGD A;  1BT6 A;  2KYC A;  4FQO A;  2M3W A;  2HQ8 A;  2LVI A;  1L2O B;  3SG6 A;  1GGW A;  3QRX A;  1K90 D;  1CFF A;  1YUT A;  4YGB B;  3EKH A;  1S6I A;  3HX4 A;  4F0Z B;  1FPW A;  1QIV A;  2WND A;  1KFX L;  1TRF A;  5CPV A;  5G08 A;  2M49 B;  2O60 A;  1DJH A;  2G2B A;  3KO0 A;  1WDC B;  3TDI A;  5AXI A;  2M1K B;  3DVE A;  2LE9 B;  3FWC A;  5IBW A;  1CDN A;  4CLN A;  1DGV A;  2O5G A;  4YBH B;  3LL8 B;  2MAZ A;  4USL A;  2SAS A;  2PRU A;  2EC6 C;  2K7B A;  2KNE A;  1B8L A;  1DGU A;  1TN4 A;  4MN0 A;  2WCE A;  1J7R A;  5PAL A;  1F8H A;  3SG7 A;  3BXK A;  1SMG A;  1QIW A;  2LVK A;  3VGO A;  4DUQ A;  1SKT A;  2JC2 A;  2I2R E;  1BJF A;  1K9P A;  3LK1 A;  1D1O A;  1XFV O;  2KFH A;  2MLE C;  1OSA A;  1NX0 A;  2NCP A;  3PN7 C;  1QAT A;  1C07 A;  2ZNE A;  1IJ5 A;  3IF7 A;  3OX5 A;  1IQ5 A;  1OMR A;  3AKB A;  1GQM A;  2LMV A;  1S3P A;  1G33 A;  3SG2 A;  1BOC A;  4YGE B;  1BR4 B;  2DOQ A;  1QLK A;  1DMO A;  1NSH A;  1X02 A;  2FCE A;  4CPV A;  1MQ1 A;  2WCB A;  3DF0 B;  1U5I A;  3CTN A;  4YGA A;  1B1G A;  4UPG A;  1JC2 A;  1EH2 A;  1NCY A;  4FTG A;  4YI9 A;  4JWQ A;  1AVS A;  1QVI Z;  1NWD A;  1YRT B;  3KEV A;  4WQ2 A;  1FW4 A;  2NXQ A;  3DVJ A;  1PUL A;  4I5J A;  1K95 A;  3O2P A;  2LHI A;  1QX2 A;  1R2U A;  1SCM C;  1KFU S;  4N1F A;  5CSF A;  1CFD A;  3I5I C;  1A29 A;  2F2O A;  2H61 A;  1SCM B;  1V1F A;  4NDD A;  1N2D A;  2L5X B;  3CS1 A;  4OVN F;  1BOD A;  2AAO A;  3I5I B;  4AOM A;  5HKY A;  4MSP A;  1CDL A;  2Y1M A;  5K89 A;  1NP8 A;  1DJW A;  2JT0 A;  2TN4 A;  1CB1 A;  3OX6 A;  1B4C A;  1Q80 A;  1XFY O;  4MVF A;  2BCB A;  2WC8 A;  3O78 A;  1LIN A;  1V1G A;  2HPS A;  3M0W A;  3SG4 A;  1Y1X A;  2KI4 B;  4A4C A;  1IWQ A;  1EG4 A;  1K93 D;  5AER A;  2JPT A;  3CWG A;  2M29 A;  3SG5 A;  1TTX A;  2LMU A;  1UHH A;  3LK0 A;  1U5I B;  3BUO B;  3NSK A;  1WLZ A;  4CID A;  1KFU L;  1OMV A;  3OB2 B;  1IG5 A;  1OE9 B;  1Y6W A;  3WHT B;  3ICB A;  2KAX A;  1PAL A;  1MWN A;  3VRQ A;  3BYA A;  5KSZ A;  5D7F A;  4Q04 A;  2AMI A;  3ZWH A;  1M39 A;  1CNP A;  2KOT A;  2E6W A;  2WCF A;  1AHR A;  1NX1 A;  2AUC A;  3LCP C;  1K9U A;  1SRA A;  4ZCU A;  4M2O A;  1KQM C;  1SY9 A;  1GGZ A;  1DJI A;  2ZFD A;  2LV7 A;  3I5F C;  2LM5 A;  2QPT A;  3NSL A;  2M1U A;  4GPL B;  1S5G Y;  2L2E A;  4GNK B;  4PAL A;  2LUC A;  2BL0 C;  3I5F B;  1UHJ A;  4P2Y B;  4PE0 A;  5JJG A;  5KTY A;  1AJ4 A;  4IL1 A;  4PCW A;  2F33 A;  2I18 A;  1DJZ A;  2LHL A;  3TUY C;  2MA2 A;  2R2I A;  3JVT B;  3BOW A;  4NDB A;  1JF0 A;  4OKH A;  5B8I B;  1KQV A;  2KGB C;  4MZJ A;  2HQW A;  3D0Y A;  4PHJ A;  2FOT A;  2L51 A;  4C0J A;  1H8B A;  1BF5 A;  1ZFS A;  1BG1 A;  2Y1N A;  3VRO A;  1OQP A;  1XO5 A;  1QAS A;  1QVI Y;  2HET A; 
#chains in the Genus database with same CATH topology
 3AKA A;  3DY9 A;  3NGV A;  2KAV A;  4TNC A;  1C7W A;  1AP4 A;  2PQL A;  2ZN9 A;  1MHO A;  2CBL A;  3CDN A;  5AEQ A;  3Q8I A;  1OW4 A;  1SL9 A;  3V2L A;  2WCK A;  3WHU B;  3IQO A;  2L0P A;  1A4P A;  1TNW A;  1DVI A;  1JF2 A;  1SW8 A;  5AFP A;  2JT3 A;  1WRK A;  4MRX A;  4IJ7 A;  1OMD A;  1A2X A;  1B9A A;  3D74 A;  2F2P A;  1W7I B;  3K1E A;  4OCI A;  1XFU O;  2WC6 A;  1KK7 Z;  1DF0 B;  4DS7 A;  1AJ5 A;  2EC6 B;  2Y4Q A;  1CDM A;  4A4B A;  3N7H A;  3HCM A;  2KBM A;  5BPJ A;  2BBN A;  1K9K A;  3NSO A;  5CSI A;  5F6T A;  3DD4 A;  5JOL A;  1RJV A;  1S26 D;  1K96 A;  3AAJ A;  3BFA A;  5DKR A;  2LP2 A;  2ZND A;  5CSN A;  2OS8 C;  4YRU A;  4DRW A;  4PE7 A;  2BKI B;  1IRJ A;  1OOJ A;  2P71 A;  3BOW B;  4YI8 A;  1TWO A;  3PN7 B;  3SS4 A;  2BE6 A;  3D78 A;  1EG3 A;  2JQ6 A;  2D8N A;  4PHM A;  2ZRS A;  3D0Y B;  4XJK A;  5FI2 A;  5AAN A;  1KK8 C;  4NQG A;  1TUZ A;  5HKZ A;  1A75 A;  1Z2C B;  2MBX A;  2CNP A;  2RGI A;  4MEW A;  3OP0 A;  5DIC A;  1RRO A;  2OPO A;  2F8P A;  2G9B A;  2KBI A;  1IGV A;  1M31 A;  2PVB A;  4M2P A;  2GGM A;  3RZS A;  1JUO A;  1B47 A;  1OOF A;  1YX7 A;  2JXC A;  1OZO A;  1JWD A;  1K2H A;  1TCO B;  5EL2 A;  1NIW A;  2ZN8 A;  3KF9 A;  1IJ6 A;  3CAB A;  2CTN A;  2JZI A;  2LUX A;  3PAL A;  1FI6 A;  1ALV A;  1S36 A;  3UO9 A;  1SYM A;  1TNP A;  1NX2 A;  1W7J B;  1KSO A;  3PLF B;  3VRR A;  2KI6 D;  1QV0 A;  3LLE A;  1SNL A;  1MF8 B;  1SCV A;  1ORG A;  2K2A A;  2K7C A;  3SJS A;  2YGU A;  2SCP A;  1S6C A;  2KQ6 A;  3PAT A;  3ZNI A;  5HYD A;  4I5L B;  1AK8 A;  2KDH A;  4BY5 A;  2HF5 A;  2KLE A;  1F54 A;  2P70 A;  1Y0V H;  1SL7 A;  1LA3 A;  2IS9 A;  1CLM A;  3D10 A;  1DJY A;  4HRE E;  2PMY A;  4OZD A;  4HRH A;  1XVJ A;  4QJ4 B;  3SS3 A;  4JD9 A;  1XFW O;  1BU3 A;  3KHE A;  3EK4 A;  1ZOT B;  2B1U A;  2KFG A;  1FBV A;  3EVV A;  1HT9 A;  2WCL A;  1JFJ A;  1XYD A;  1Z4H A;  4YGC B;  3I5H C;  5ER4 X;  1A75 B;  3JTD C;  1SR6 C;  3CGA A;  4GBA A;  3CLN A;  3GK4 X;  3A4U B;  1F71 A;  1N65 A;  5FI7 A;  2K61 A;  2VRG A;  3NHI A;  5I2O A;  1JFK A;  1LA0 A;  1IKU A;  3SIB A;  2A4J A;  1N0Y A;  4DCK A;  4AQJ A;  2BEC A;  3S0F A;  4ORB B;  4PHN A;  1YX8 A;  2FJU B;  5D3O A;  1PRW A;  5HL1 A;  2K7O A;  2LMT A;  2V53 A;  2K7D A;  2MHH A;  3TS5 C;  1PVB A;  1NCX A;  3SS5 A;  1TOP A;  2LP3 A;  2OTG C;  3FIA A;  1OZS A;  1UHN A;  1KQM B;  4F7F A;  5FYX A;  2JUL A;  2LAN A;  3F45 A;  2WCJ A;  1F4O A;  1BLQ A;  1Y1A A;  1DEK A;  1EXR A;  5KU1 A;  2MLF C;  1QLS A;  2ZRT A;  3A8R A;  2BL0 B;  2BCA A;  1OOI X;  3NSI A;  1CM1 A;  1ZAC A;  3O6B A;  1ODB A;  1TNX A;  4ICB A;  2JRF A;  1TIZ A;  3TUY B;  3TDZ A;  2BCX A;  3CZT X;  1CLB A;  4PDZ A;  3AAK A;  2KFF A;  3I5G C;  2K2F A;  1CDP A;  1P28 A;  1UHI A;  2LC5 A;  4MZK A;  1KFX S;  1SPY A;  1YVH A;  2CCM A;  1B8C A;  4JQ0 D;  2K60 A;  4DIR A;  2LVV A;  4ORA B;  3BUN B;  3VRP A;  4XYN A;  2JTZ A;  4QJ5 B;  3EVR A;  2JU0 A;  3GK1 A;  1EH2 A;  1HQV A;  4MZL A;  3PFV A;  1YUR A;  3IVT A;  2PAL A;  2PSR A;  4M2Q A;  1YRU B;  2MJW B;  3SG3 A;  1YTZ C;  3EVU A;  4N1G A;  4INX A;  2BNX A;  3S0E A;  1DC1 A;  4U8D A;  4GGN A;  2MRD A;  4D1E A;  2K8M B;  1L2O C;  3R72 A;  2KYF A;  2Y5I A;  3FE8 A;  1CFC A;  4ORC B;  2ISD A;  2BKH B;  2BBM A;  1ALW A;  1JSA A;  3L47 A;  2LCP A;  1TNQ A;  1KSM A;  4INW A;  1RTP 1;  1NYA A;  1UUR A;  3DF0 A;  4MRY A;  1YVL A;  2CT9 A;  1TCF A;  5ER5 A;  2M7L A;  1FI5 A;  1XA5 A;  4QJ3 B;  1PK0 D;  1F55 A;  2JT8 A;  3O4Y A;  1J1D A;  1LVC D;  2EHB A;  1WDC C;  1JBA A;  3KPX A;  5TNC A;  2BE4 A;  1BMO A;  2L4I A;  5I2L A;  1YUS A;  3MSE B;  1QTX A;  2JXL A;  2OS8 B;  4C0K A;  1CFP A;  1QXP A;  4PT1 A;  3FE6 A;  3CZ1 A;  1SBJ A;  2F3Z A;  2JOJ A;  3CR2 A;  2GTE A;  3R1O A;  1MXE A;  5I2Q A;  3CYZ A;  1KK8 B;  3BFB A;  3EK8 A;  1C7V A;  2BAP A;  1UHK A;  3BQ3 A;  3TZ1 A;  1H4B A;  2WC5 A;  1BR1 B;  1REC A;  3WNX B;  3GK2 A;  1B8R A;  1PSR A;  1DEL A;  2ZKM X;  2M8U A;  1S5G Z;  3GOF A;  1QX7 A;  1M46 A;  2P6B B;  1QS7 A;  1EL4 A;  3PJI A;  1CTR A;  3R1V A;  2NLN A;  1G4Y R;  1B7T Z;  2GGZ A;  2I94 A;  5FI6 A;  1DT7 B;  3DVM A;  2QDI A;  2M97 A;  1CMF A;  2JNF A;  1M63 B;  3EG5 B;  1CM4 A;  2M9G A;  3RM1 A;  1WRZ A;  4I5K A;  3PSR A;  3VRN A;  2QAC A;  3OBV A;  1CKK A;  2KAY A;  2L4H A;  1EJ3 A;  2L50 A;  2M0R A;  1J7P A;  2KI6 C;  2H2K A;  4OV2 A;  2LNK A;  4AQI A;  1RFJ A;  3O4X A;  1NX3 A;  1XK4 A;  4WQ3 A;  1F70 A;  1J1E A;  1CLL A;  2LVJ A;  1KWO C;  2L98 A;  3OB1 B;  2WCH A;  1DTL A;  1LXF C;  3CR5 X;  4C0L A;  1J7Q A;  1IIO A;  1K8U A;  1SL8 A;  5DKQ A;  1KWO B;  2L2C A;  1UWO A;  3IQQ A;  1WLM A;  3S0A A;  1GJY A;  3L4L A;  1UP5 A;  4CFQ A;  1FF1 A;  5HLV A;  2NCO A;  1XFX O;  5DKN A;  3C1V A;  1XFR A;  2FJY A;  1E8A A;  4XJK B;  2KGR A;  2M7N A;  4MBE A;  2CXJ A;  3BUW B;  1K94 A;  1UUS A;  2JTT A;  1S6J A;  1L7Z A;  2PAS A;  4HSZ A;  1DJX A;  3I5H B;  1NPQ A;  1SK6 D;  3JTD B;  4MLW A;  1SR6 B;  4N5X A;  4YGD B;  4GGF C;  2LLS A;  2K0J A;  1IH0 A;  3FS7 A;  5HLO A;  1QX5 B;  1S1E A;  3B7A A;  4ZCV A;  2I7A A;  2JNX A;  1KK7 Y;  2KI4 C;  1DJG A;  1TUJ A;  1T14 A;  3EKJ A;  3BUM B;  1G8I A;  1QJT A;  3PM8 A;  3WXA A;  1RK9 A;  1IQ3 A;  2GV5 A;  3TDU A;  3TS5 B;  1NUB A;  1VRK A;  2LAP A;  3DVK A;  4P5O E;  1XK4 C;  5J3X A;  2OTG B;  4GAO A;  1A03 A;  4OR9 B;  1ZMZ A;  1M45 A;  2LLU A;  1RWY A;  3FWB A;  4PHK A;  4JPZ B;  3SIA A;  3B86 A;  1NCZ A;  4GFT A;  3BUX B;  4L9M A;  1WY9 A;  4HRG A;  2FCD A;  3K21 A;  2KQY A;  1WRL A;  5D69 A;  1KCY A;  2ERB A;  2E30 A;  2KSP A;  4CFR A;  5I8N A;  4PE4 A;  3EK7 A;  1XFZ O;  1AUI B;  2WOS A;  3BFH A;  1J55 A;  1PVA A;  2JWW A;  3H4S E;  1ZUZ A;  1MXL C;  2H61 C;  3I5G B;  1DF0 A;  2Q91 A;  4ETO A;  1QV1 A;  1LKJ A;  4PE1 A;  1F4Q A;  3NXA A;  3OGN A;  1Y1U A;  2KHN A;  1YUU A;  3CR4 X;  1R6P A;  1MR8 A;  1CMG A;  3JVT C;  1B7T Y;  2Q4U A;  2NZ0 A;  3B88 A;  4E68 A;  4I5N B;  1J7O A;  1MUX A;  4WRI A;  2LLT A;  5CSJ A;  4NDC A;  1PSB A;  2COL B;  2F3Y A;  3E3R A;  4R1E A;  4BY4 A;  1YR5 A;  2WOR A;  3RLZ A;  5HKW A;  4GUK A;  3OHM B;  5GQQ C;  2EGD A;  1BT6 A;  2KYC A;  4FQO A;  2M3W A;  2HQ8 A;  2LVI A;  1L2O B;  3SG6 A;  1GGW A;  3QRX A;  1K90 D;  1CFF A;  1YUT A;  3BJH A;  1DQE A;  4YGB B;  3EKH A;  1S6I A;  3CZ0 A;  3HX4 A;  4F0Z B;  2H8V A;  1FPW A;  1QIV A;  2WND A;  1KFX L;  3B6X A;  1TRF A;  5CPV A;  5G08 A;  2M49 B;  2O60 A;  1DJH A;  5I94 A;  2G2B A;  3KO0 A;  1WDC B;  3TDI A;  5AXI A;  2M1K B;  3DVE A;  3VB1 A;  2LE9 B;  3FWC A;  5IBW A;  1CDN A;  4CLN A;  1DGV A;  2O5G A;  4YBH B;  3LL8 B;  2MAZ A;  4USL A;  3UNW A;  2SAS A;  2PRU A;  2QEV A;  2EC6 C;  2K7B A;  2KNE A;  1B8L A;  1DGU A;  1TN4 A;  4MN0 A;  3QME A;  2WCE A;  1J7R A;  5PAL A;  1F8H A;  3SG7 A;  3BXK A;  1SMG A;  1QIW A;  2LVK A;  3VGO A;  4DUQ A;  3S0D A;  1SKT A;  1SSE B;  2JC2 A;  2I2R E;  1BJF A;  1K9P A;  3LK1 A;  1D1O A;  1XFV O;  2KFH A;  2MLE C;  1OSA A;  1NX0 A;  2KLD A;  2NCP A;  3PN7 C;  1QAT A;  1C07 A;  2ZNE A;  1IJ5 A;  3IF7 A;  3CZ2 A;  3OX5 A;  1IQ5 A;  1OMR A;  3AKB A;  1GQM A;  2LMV A;  1S3P A;  1G33 A;  3SG2 A;  1BOC A;  4YGE B;  1BR4 B;  2DOQ A;  1QLK A;  1DMO A;  1NSH A;  1X02 A;  2FCE A;  4CPV A;  1MQ1 A;  2WCB A;  3DF0 B;  1U5I A;  3CTN A;  3D77 A;  4YGA A;  3S0G A;  4UPG A;  1B1G A;  1NCY A;  1JC2 A;  3NHT A;  3DYE A;  4FTG A;  1C3Z A;  4YI9 A;  4JWQ A;  1AVS A;  1QVI Z;  1NWD A;  1YRT B;  3KEV A;  4WQ2 A;  1FW4 A;  2NXQ A;  3S0B A;  3DVJ A;  1PUL A;  4I5J A;  1K95 A;  3D75 A;  3O2P A;  2LHI A;  1QX2 A;  1R2U A;  1SCM C;  1KFU S;  4N1F A;  5CSF A;  1CFD A;  2JPO A;  1A29 A;  2F2O A;  2H61 A;  1SCM B;  1V1F A;  2KPH A;  3FE9 A;  1N2D A;  3I5I C;  4NDD A;  2L5X B;  3CS1 A;  4OVN F;  1BOD A;  2AAO A;  3I5I B;  4GGF A;  4AOM A;  5HKY A;  4MSP A;  1CDL A;  2Y1M A;  2L5Y A;  5K89 A;  1NP8 A;  1DJW A;  2JT0 A;  2TN4 A;  1CB1 A;  3OX6 A;  1B4C A;  1Q80 A;  1XFY O;  2QEH A;  4MVF A;  2BCB A;  2WC8 A;  3O78 A;  3DZT A;  1V1G A;  1LIN A;  2HPS A;  3M0W A;  3SG4 A;  1LS8 A;  1Y1X A;  2QEO A;  2KI4 B;  4A4C A;  1IWQ A;  3DXL A;  2WCM A;  1EG4 A;  1K93 D;  1OOG A;  5AER A;  1GM0 A;  2JPT A;  3CWG A;  3D73 A;  2M29 A;  3SG5 A;  4JKT A;  1TTX A;  2LMU A;  1UHH A;  3LK0 A;  1U5I B;  3BUO B;  3D76 A;  3NSK A;  1WLZ A;  4CID A;  1KFU L;  1OMV A;  1OOH A;  1IG5 A;  1QWV A;  3OB2 B;  1OE9 B;  1Y6W A;  3L4A A;  3WHT B;  3B87 A;  3ICB A;  2KAX A;  1PAL A;  1MWN A;  3VRQ A;  3BYA A;  5KSZ A;  5D7F A;  4Q04 A;  2AMI A;  3ZWH A;  1M39 A;  1CNP A;  2KOT A;  2E6W A;  2WCF A;  1AHR A;  1NX1 A;  2AUC A;  3PM2 A;  3LCP C;  1K9U A;  1SRA A;  4ZCU A;  4M2O A;  1KQM C;  1SY9 A;  1GGZ A;  1DJI A;  2ZFD A;  4KYN A;  2LV7 A;  3I5F C;  2LM5 A;  2QPT A;  3NSL A;  2M1U A;  4GPL B;  1S5G Y;  2L2E A;  4GNK B;  4PAL A;  2LUC A;  2BL0 C;  3I5F B;  3R1P A;  1UHJ A;  4FQT A;  4P2Y B;  4PE0 A;  5JJG A;  5KTY A;  1AJ4 A;  4IL1 A;  4PCW A;  1W9Z A;  2F33 A;  1DJZ A;  2I18 A;  2LHL A;  3TUY C;  2MA2 A;  2R2I A;  3JVT B;  3BOW A;  4NDB A;  1JF0 A;  4OKH A;  5B8I B;  1KQV A;  2KGB C;  2PYQ A;  2QEB A;  4MZJ A;  1C3Y A;  2HQW A;  3D0Y A;  4PHJ A;  2FOT A;  2L51 A;  4C0J A;  1H8B A;  1BF5 A;  1ZFS A;  1BG1 A;  2Y1N A;  3VRO A;  1OQP A;  1XO5 A;  1QAS A;  1QVI Y;  2HET A; 
#chains in the Genus database with same CATH homology
 3AKA A;  4TNC A;  2KAV A;  1C7W A;  1AP4 A;  2ZN9 A;  1MHO A;  2CBL A;  5AEQ A;  1SL9 A;  3WHU B;  3IQO A;  2L0P A;  1A4P A;  1TNW A;  1DVI A;  1JF2 A;  1SW8 A;  5AFP A;  2JT3 A;  1WRK A;  4MRX A;  1OMD A;  1A2X A;  1B9A A;  2F2P A;  1W7I B;  4OCI A;  4DS7 A;  1XFU O;  1KK7 Z;  1DF0 B;  1AJ5 A;  2EC6 B;  2Y4Q A;  1CDM A;  4A4B A;  3HCM A;  2KBM A;  5BPJ A;  2BBN A;  1K9K A;  3NSO A;  5CSI A;  5F6T A;  3DD4 A;  5JOL A;  1RJV A;  1S26 D;  1K96 A;  3AAJ A;  5DKR A;  2LP2 A;  2ZND A;  5CSN A;  2OS8 C;  4YRU A;  4DRW A;  4PE7 A;  2BKI B;  1IRJ A;  1OOJ A;  3BOW B;  4YI8 A;  3PN7 B;  2BE6 A;  1EG3 A;  2JQ6 A;  2D8N A;  4PHM A;  2ZRS A;  3D0Y B;  4XJK A;  5AAN A;  1KK8 C;  4NQG A;  5HKZ A;  1A75 A;  2MBX A;  2CNP A;  2RGI A;  4MEW A;  3OP0 A;  1RRO A;  2OPO A;  2F8P A;  2G9B A;  2KBI A;  1IGV A;  1M31 A;  2PVB A;  4M2P A;  2GGM A;  1JUO A;  1B47 A;  1YX7 A;  1JWD A;  2JXC A;  1OZO A;  1K2H A;  1TCO B;  1NIW A;  2ZN8 A;  3KF9 A;  1IJ6 A;  3PAL A;  2CTN A;  2JZI A;  2LUX A;  1FI6 A;  1ALV A;  1S36 A;  1SYM A;  1TNP A;  1NX2 A;  1W7J B;  1KSO A;  3PLF B;  3VRR A;  2KI6 D;  1QV0 A;  3LLE A;  1SNL A;  1MF8 B;  1SCV A;  2K2A A;  2K7C A;  3SJS A;  2SCP A;  1S6C A;  2KQ6 A;  3PAT A;  3ZNI A;  5HYD A;  4I5L B;  1AK8 A;  2KDH A;  4BY5 A;  2HF5 A;  1F54 A;  1Y0V H;  1SL7 A;  1LA3 A;  2IS9 A;  1CLM A;  3D10 A;  1DJY A;  4HRE E;  2PMY A;  4HRH A;  1XVJ A;  4QJ4 B;  1XFW O;  1BU3 A;  3KHE A;  3EK4 A;  1ZOT B;  2B1U A;  2KFG A;  1FBV A;  3EVV A;  1HT9 A;  1JFJ A;  1XYD A;  4YGC B;  3I5H C;  5ER4 X;  1A75 B;  3JTD C;  1SR6 C;  3CGA A;  4GBA A;  3CLN A;  3GK4 X;  3A4U B;  1F71 A;  1N65 A;  2K61 A;  2VRG A;  5I2O A;  1JFK A;  1LA0 A;  1IKU A;  3SIB A;  2A4J A;  1N0Y A;  4DCK A;  4AQJ A;  2BEC A;  4ORB B;  4PHN A;  1YX8 A;  2FJU B;  1PRW A;  2K7O A;  2LMT A;  2V53 A;  2K7D A;  2MHH A;  3TS5 C;  1PVB A;  1NCX A;  1TOP A;  2LP3 A;  2OTG C;  3FIA A;  1OZS A;  1UHN A;  1KQM B;  5FYX A;  2JUL A;  2LAN A;  3F45 A;  1BLQ A;  1F4O A;  1Y1A A;  1EXR A;  5KU1 A;  2MLF C;  1QLS A;  2ZRT A;  3A8R A;  2BL0 B;  2BCA A;  3NSI A;  1CM1 A;  1ZAC A;  3O6B A;  1ODB A;  1TNX A;  4ICB A;  2JRF A;  1TIZ A;  3TUY B;  3TDZ A;  2BCX A;  3CZT X;  1CLB A;  4PDZ A;  3AAK A;  2KFF A;  3I5G C;  2K2F A;  1CDP A;  1UHI A;  2LC5 A;  4MZK A;  4ORA B;  1KFX S;  1SPY A;  1YVH A;  2CCM A;  1B8C A;  4JQ0 D;  4DIR A;  2LVV A;  3BUN B;  3VRP A;  4XYN A;  2JTZ A;  4QJ5 B;  3EVR A;  2JU0 A;  3GK1 A;  1HQV A;  4MZL A;  3PFV A;  1YUR A;  2PAL A;  2PSR A;  4M2Q A;  1YRU B;  2MJW B;  3SG3 A;  1YTZ C;  3EVU A;  4N1G A;  4U8D A;  4GGN A;  2MRD A;  4D1E A;  2K8M B;  1L2O C;  1CFC A;  2KYF A;  2Y5I A;  4ORC B;  2ISD A;  2BKH B;  2BBM A;  1ALW A;  1JSA A;  2LCP A;  1TNQ A;  1KSM A;  1RTP 1;  1NYA A;  1UUR A;  3DF0 A;  4MRY A;  1YVL A;  2CT9 A;  1TCF A;  5ER5 A;  2M7L A;  1FI5 A;  1XA5 A;  4QJ3 B;  1PK0 D;  1F55 A;  2JT8 A;  3O4Y A;  1J1D A;  1LVC D;  2EHB A;  1WDC C;  1JBA A;  3KPX A;  5TNC A;  2BE4 A;  1BMO A;  2L4I A;  5I2L A;  1YUS A;  3MSE B;  1QTX A;  2JXL A;  2OS8 B;  4C0K A;  1CFP A;  1QXP A;  1SBJ A;  2F3Z A;  2JOJ A;  3CR2 A;  1MXE A;  5I2Q A;  1KK8 B;  3EK8 A;  1C7V A;  1UHK A;  3BQ3 A;  3TZ1 A;  1H4B A;  1BR1 B;  1REC A;  3WNX B;  3GK2 A;  1B8R A;  1PSR A;  2ZKM X;  2M8U A;  1S5G Z;  3GOF A;  1QX7 A;  1M46 A;  2P6B B;  1QS7 A;  1EL4 A;  4GGF A;  1CTR A;  2NLN A;  1G4Y R;  1B7T Z;  2GGZ A;  2I94 A;  1DT7 B;  1CMF A;  3DVM A;  2M97 A;  2JNF A;  1M63 B;  1CM4 A;  2M9G A;  3RM1 A;  1WRZ A;  4I5K A;  3PSR A;  3VRN A;  2QAC A;  1CKK A;  2KAY A;  2L4H A;  1EJ3 A;  2L50 A;  2M0R A;  1J7P A;  2KI6 C;  2H2K A;  4OV2 A;  2LNK A;  4AQI A;  1RFJ A;  1NX3 A;  1XK4 A;  4WQ3 A;  1F70 A;  1J1E A;  1CLL A;  2LVJ A;  1KWO C;  2L98 A;  3OB1 B;  1J7Q A;  1DTL A;  1LXF C;  3CR5 X;  4C0L A;  1K8U A;  1SL8 A;  5DKQ A;  1KWO B;  1UWO A;  3IQQ A;  1WLM A;  1GJY A;  4CFQ A;  1UP5 A;  1FF1 A;  5HLV A;  2NCO A;  1XFX O;  5DKN A;  3C1V A;  4XJK B;  1E8A A;  2KGR A;  2M7N A;  4MBE A;  2CXJ A;  3BUW B;  1K94 A;  1UUS A;  2JTT A;  1S6J A;  1L7Z A;  2PAS A;  4HSZ A;  1DJX A;  3I5H B;  1NPQ A;  1SK6 D;  3JTD B;  4MLW A;  1SR6 B;  4N5X A;  4YGD B;  4GGF C;  2LLS A;  2K0J A;  1IH0 A;  3FS7 A;  5HLO A;  1QX5 B;  1S1E A;  4ZCV A;  2I7A A;  2JNX A;  1KK7 Y;  2KI4 C;  1DJG A;  3EKJ A;  3BUM B;  1G8I A;  1QJT A;  3PM8 A;  3WXA A;  1RK9 A;  1IQ3 A;  2GV5 A;  3TDU A;  3TS5 B;  1NUB A;  1VRK A;  2LAP A;  3DVK A;  4P5O E;  1XK4 C;  5J3X A;  2OTG B;  4GAO A;  1A03 A;  4OR9 B;  1ZMZ A;  1M45 A;  2LLU A;  1RWY A;  3FWB A;  4PHK A;  4JPZ B;  3SIA A;  1NCZ A;  4GFT A;  3BUX B;  4L9M A;  1WY9 A;  4HRG A;  2FCD A;  3K21 A;  2KQY A;  1WRL A;  5D69 A;  1KCY A;  2KSP A;  2E30 A;  4CFR A;  5I8N A;  4PE4 A;  3EK7 A;  1XFZ O;  1AUI B;  2WOS A;  1J55 A;  1PVA A;  2JWW A;  3H4S E;  1ZUZ A;  1MXL C;  2H61 C;  3I5G B;  1DF0 A;  2Q91 A;  4ETO A;  1QV1 A;  1LKJ A;  4PE1 A;  1F4Q A;  3NXA A;  1Y1U A;  2KHN A;  1YUU A;  3CR4 X;  1R6P A;  1MR8 A;  1CMG A;  3JVT C;  1B7T Y;  2Q4U A;  2NZ0 A;  4E68 A;  4I5N B;  1J7O A;  1MUX A;  4WRI A;  2LLT A;  5CSJ A;  4NDC A;  1PSB A;  2COL B;  2F3Y A;  3E3R A;  4R1E A;  4BY4 A;  1YR5 A;  2WOR A;  3RLZ A;  5HKW A;  4GUK A;  3OHM B;  5GQQ C;  2EGD A;  1BT6 A;  2KYC A;  4FQO A;  2M3W A;  2HQ8 A;  2LVI A;  1L2O B;  3SG6 A;  1GGW A;  3QRX A;  1K90 D;  1CFF A;  1YUT A;  4YGB B;  3EKH A;  1S6I A;  3HX4 A;  4F0Z B;  1FPW A;  1QIV A;  2WND A;  1KFX L;  1TRF A;  5CPV A;  5G08 A;  2M49 B;  2O60 A;  1DJH A;  2G2B A;  3KO0 A;  1WDC B;  3TDI A;  5AXI A;  2M1K B;  3DVE A;  2LE9 B;  3FWC A;  5IBW A;  1CDN A;  4CLN A;  1DGV A;  2O5G A;  4YBH B;  3LL8 B;  2MAZ A;  4USL A;  2SAS A;  2PRU A;  2EC6 C;  2K7B A;  2KNE A;  1B8L A;  1DGU A;  1TN4 A;  4MN0 A;  2WCE A;  1J7R A;  5PAL A;  1F8H A;  3SG7 A;  3BXK A;  1SMG A;  1QIW A;  2LVK A;  3VGO A;  4DUQ A;  1SKT A;  2JC2 A;  2I2R E;  1BJF A;  1K9P A;  3LK1 A;  1D1O A;  1XFV O;  2KFH A;  2MLE C;  1OSA A;  1NX0 A;  2NCP A;  3PN7 C;  1QAT A;  1C07 A;  2ZNE A;  1IJ5 A;  3IF7 A;  3OX5 A;  1IQ5 A;  1OMR A;  3AKB A;  1GQM A;  2LMV A;  1S3P A;  1G33 A;  3SG2 A;  1BOC A;  4YGE B;  1BR4 B;  2DOQ A;  1QLK A;  1DMO A;  1NSH A;  1X02 A;  2FCE A;  4CPV A;  1MQ1 A;  2WCB A;  3DF0 B;  1U5I A;  3CTN A;  4YGA A;  1B1G A;  4UPG A;  1JC2 A;  1EH2 A;  1NCY A;  4FTG A;  4YI9 A;  4JWQ A;  1AVS A;  1QVI Z;  1NWD A;  1YRT B;  3KEV A;  4WQ2 A;  1FW4 A;  2NXQ A;  3DVJ A;  1PUL A;  4I5J A;  1K95 A;  3O2P A;  2LHI A;  1QX2 A;  1R2U A;  1SCM C;  1KFU S;  4N1F A;  5CSF A;  1CFD A;  3I5I C;  1A29 A;  2F2O A;  2H61 A;  1SCM B;  1V1F A;  4NDD A;  1N2D A;  2L5X B;  3CS1 A;  4OVN F;  1BOD A;  2AAO A;  3I5I B;  4AOM A;  5HKY A;  4MSP A;  1CDL A;  2Y1M A;  5K89 A;  1NP8 A;  1DJW A;  2JT0 A;  2TN4 A;  1CB1 A;  3OX6 A;  1B4C A;  1Q80 A;  1XFY O;  4MVF A;  2BCB A;  2WC8 A;  3O78 A;  1LIN A;  1V1G A;  2HPS A;  3M0W A;  3SG4 A;  1Y1X A;  2KI4 B;  4A4C A;  1IWQ A;  1EG4 A;  1K93 D;  5AER A;  2JPT A;  3CWG A;  2M29 A;  3SG5 A;  1TTX A;  2LMU A;  1UHH A;  3LK0 A;  1U5I B;  3BUO B;  3NSK A;  1WLZ A;  4CID A;  1KFU L;  1OMV A;  3OB2 B;  1IG5 A;  1OE9 B;  1Y6W A;  3WHT B;  3ICB A;  2KAX A;  1PAL A;  1MWN A;  3VRQ A;  3BYA A;  5KSZ A;  5D7F A;  4Q04 A;  2AMI A;  3ZWH A;  1M39 A;  1CNP A;  2KOT A;  2E6W A;  2WCF A;  1AHR A;  1NX1 A;  2AUC A;  3LCP C;  1K9U A;  1SRA A;  4ZCU A;  4M2O A;  1KQM C;  1SY9 A;  1GGZ A;  1DJI A;  2ZFD A;  2LV7 A;  3I5F C;  2LM5 A;  2QPT A;  3NSL A;  2M1U A;  4GPL B;  1S5G Y;  2L2E A;  4GNK B;  4PAL A;  2LUC A;  2BL0 C;  3I5F B;  1UHJ A;  4P2Y B;  4PE0 A;  5JJG A;  5KTY A;  1AJ4 A;  4IL1 A;  4PCW A;  2F33 A;  2I18 A;  1DJZ A;  2LHL A;  3TUY C;  2MA2 A;  2R2I A;  3JVT B;  3BOW A;  4NDB A;  1JF0 A;  4OKH A;  5B8I B;  1KQV A;  2KGB C;  4MZJ A;  2HQW A;  3D0Y A;  4PHJ A;  2FOT A;  2L51 A;  4C0J A;  1H8B A;  1BF5 A;  1ZFS A;  1BG1 A;  2Y1N A;  3VRO A;  1OQP A;  1XO5 A;  1QAS A;  1QVI Y;  2HET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...