2OTGC

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
total genus 38
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2otgC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2otgC02
3OB2B 4I5JA 3EKHA 5AANA 2I7AA 1SK6D 2Y1NA 2KBIA 4GUKA 1QX7A 2M8UA 1EG3A 4AQJA 1CDLA 1DT7B 2LUXA 4ETOA 2L0PA 3EK7A 4DUQA 4C0KA 4P5OE 4HRGA 2H2KA 1JFKA 4PHMA 4YGDB 1IKUA 5GQQC 3D10A 1J7PA 5AERA 3JVTB 3SG3A 4AOMA 1AP4A 1UHJA 1OOJA 2KBMA 4ICBA 4JWQA 4OCIA 3TUYB 3AKAA 2PMYA 2M9GA 4NDBA 3DVMA 5CSFA 1RK9A 2HQ8A 5HYDA 1HT9A 1QX2A 4YRUA 2LUCA 1GQMA 1HQVA 1L7ZA 4MBEA 1SRAA 1EXRA 2MAZA 5CSNA 2ZN8A 1ALWA 2WCFA 2L4IA 1J7OA 1UWOA 1XFYO 2BE4A 5HKZA 1J1DA 3BUMB 2LM5A 2PASA 4L9MA 3E3RA 4GGNA 3CR4X 3VRQA 4C0JA 2M0RA 1KWOB 1SL7A 4MZLA 1SR6B 2E30A 2LHLA 3I5HB 5TNCA 3ZNIA 4ZCVA 3I5FC 4GGFA 3NSIA 4PE1A 1FF1A 1CM1A 2P6BB 1CMFA 3WHUB 4MZJA 1QVIY 1JUOA 4ZCUA 2SASA 1CKKA 1BR4B 1DGUA 1TTXA 1F54A 1KK7Z 2O60A 1M46A 1XK4C 4PE7A 4DRWA 2JWWA 1S6IA 3RLZA 4DIRA 1CDNA 2I18A 2HETA 2K2FA 4D1EA 1KQVA 3PALA 1SBJA 1KFUL 2JXCA 2KDHA 3DVEA 1DJGA 1F8HA 1V1GA 2LNKA 3A8RA 2KQ6A 1YTZC 2M1UA 4OKHA 5AXIA 2JQ6A 4MSPA 3BUOB 2JT3A 4NDCA 1F55A 1ZACA 1JFJA 3RM1A 3SIAA 1KFXL 1UUSA 1Y1XA 1QJTA 5ER4X 1XFXO 1YVLA 4PHNA 2JNXA 1G33A 1MWNA 2EGDA 3FWCA 5CSJA 2K8MB 5D69A 1B47A 1IJ5A 2KYCA 1D1OA 2KI6C 2LMVA 1XFWO 1SW8A 2I94A 4A4CA 1K96A 3EVVA 4YI8A 1Y1UA 3GOFA 1CTRA 4QJ3B 2NCPA 3GK1A 1J55A 1PVBA 2JPTA 3TDZA 1KK8B 2R2IA 5KTYA 1SPYA 3KEVA 1QV1A 2NXQA 3H4SE 1SY9A 1TOPA 3I5IB 1QLKA 4MEWA 2LLUA 2H61A 3LL8B 3MSEB 1IH0A 1MHOA 2BE6A 1A75A 1IG5A 2BCXA 1TCOB 3AAJA 3F45A 3PATA 3TDIA 2K2AA 2LLSA 2WC8A 3GK2A 3M0WA 1A75B 2L5XB 4PHKA 4U8DA 4YBHB 4JQ0D 1XA5A 1XYDA 2EC6B 2D8NA 2Y5IA 3FIAA 3D0YA 4N1FA 1AJ5A 3EVRA 2OS8C 2JT0A 3VRRA 1PRWA 4PE4A 1FI5A 4HREE 3PFVA 3PN7C 3D0YB 1DJWA 1NX3A 2LMUA 1R2UA 4YI9A 1GJYA 2CCMA 3SG2A 2HPSA 1DJYA 2LVKA 5AEQA 4I5KA 2KGRA 3ZWHA 2BCAA 1ZFSA 1DJIA 1S5GY 2DOQA 3VRPA 1BODA 1QASA 1J7RA 2KFGA 2RGIA 5DKRA 1V1FA 2AMIA 1SNLA 2LANA 1U5IA 1G4YR 1S36A 1A29A 1Y6WA 2COLB 1JF2A 2JZIA 2L98A 3OX6A 1CLBA 1KCYA 1U5IB 1EG4A 2OTGC 1M63B 1XFZO 2M1KB 1IQ3A 2WNDA 1KSMA 4MN0A 1A2XA 4NQGA 3OHMB 4NDDA 1OQPA 1K9UA 1EL4A 4GNKB 4I5LB 1B4CA 1YUUA 2KI4C 2LCPA 1PULA 1AJ4A 2LVIA 2ZRSA 2BL0B 3O4YA 3LCPC 1IGVA 1L2OC 4GPLB 3TS5B 1B8CA 2MBXA 1IJ6A 1ZUZA 3WNXB 1QV0A 2HQWA 1NCXA 2WCEA 4A4BA 1CFDA 4WRIA 1RJVA 4YGBB 2KNEA 2SCPA 1MXEA 3I5GC 1QX5B 4MLWA 1OE9B 2FCDA 1RFJA 1TNQA 1BG1A 1B8RA 1C07A 1YVHA 4R1EA 1NSHA 1NX0A 4ORCB 1S3PA 4M2OA 5I2QA 1JWDA 1QIWA 1CB1A 3NSLA 1K93D 2KGBC 3DD4A 1SCMB 1QIVA 2PVBA 3CLNA 1JSAA 1FBVA 1YURA 3O78A 1LINA 1TNPA 1B7TZ 3BXKA 2ZRTA 5HKYA 5J3XA 4P2YB 5FYXA 4HRHA 5F6TA 1S6CA 1RECA 5KSZA 2BBNA 3OB1B 1BT6A 1VRKA 1WDCC 1N2DA 1KQMB 1OMDA 5HLVA 2MA2A 3K21A 1TRFA 1F4OA 1FPWA 4OVNF 3OP0A 2OPOA 4PDZA 1SMGA 3PM8A 2CNPA 1TN4A 2CBLA 2MRDA 1QTXA 1BLQA 1X02A 3C1VA 3CWGA 3JTDC 4GBAA 1EJ3A 2JULA 1IQ5A 3VRNA 2K7CA 1S26D 1EH2A 5D7FA 2VRGA 2K61A 2FCEA 4MRXA 2KOTA 1IWQA 1CFCA 4FQOA 5I2LA 2L50A 1WRLA 1ZOTB 4OR9B 4FTGA 1MF8B 4DS7A 3O2PA 2FJUB 4YGCB 1F71A 5JOLA 1GGWA 3EKJA 1J1EA 4PE0A 1KK7Y 1L2OB 4CFRA 2KHNA 1MUXA 4JPZB 1BU3A 3AKBA 3DVKA 4WQ2A 1C7VA 1QS7A 2JNFA 2LVVA 4CFQA 5B8IB 4E68A 1CDPA 1CMGA 1NIWA 1ALVA 3HCMA 3CGAA 1LA0A 2K7OA 2CTNA 2KFHA 2G9BA 2JC2A 3EVUA 5DKNA 1N0YA 4PALA 1NCZA 1G8IA 3JVTC 2O5GA 1KSOA 2QACA 3FWBA 1AVSA 1K9KA 3NXAA 3I5FB 2WORA 3TUYC 2M49B 2M7NA 4YGAA 1XK4A 1YRUB 1SCVA 2LAPA 1S1EA 2K7BA 2NZ0A 1S5GZ 2Y4QA 3KO0A 3IQOA 1MR8A 4F0ZB 1PSBA 4GAOA 4BY5A 3VGOA 1XVJA 1NX2A 1MXLC 1DJHA 2NCOA 1MQ1A 1DGVA 3DF0A 1OZOA 4MVFA 5JJGA 3BUXB 1DMOA 3IF7A 3DF0B 1AHRA 1KWOC 1SR6C 1NCYA 2B1UA 4USLA 1XFUO 1ODBA 1R6PA 2ZFDA 1BJFA 4UPGA 4GGFC 4XJKA 1NPQA 2BBMA 2F3YA 1DJZA 2L2EA 2V53A 2LC5A 3KPXA 2ZKMX 2I2RE 1SKTA 2E6WA 3FS7A 4XJKB 1J7QA 1LVCD 3BUWB 4Q04A 1WY9A 2KAVA 1K94A 1M45A 3SIBA 3SJSA 2LMTA 4PHJA 2KFFA 1UHHA 1JC2A 1TNWA 2LP3A 1Y0VH 3LK0A 1PSRA 1WRKA 2F2PA 5CPVA 1QLSA 5CSIA 5HLOA 1CM4A 3DVJA 1WLZA 4XYNA 1LA3A 2CXJA 1Y1AA 3WHTB 2IS9A 3NSOA 2Y1MA 1RWYA 2AUCA 5KU1A 1K2HA 4GFTA 1QVIZ 3A4UB 3IQQA 3CR5X 5HKWA 2ZNDA 4CIDA 2KAYA 2JTTA 1F4QA 1B9AA 1OMRA 3LLEA 2EHBA 4M2PA 4BY4A 4IL1A 4C0LA 1FI6A 2ZN9A 3HX4A 4CPVA 1QXPA 1YUSA 2GGMA 1YUTA 3BUNB 2OS8B 4OV2A 1KK8C 2M3WA 2JOJA 1H4BA 1S6JA 3PN7B 2BKIB 2F3ZA 1RROA 5G08A 3EK8A 1CNPA 1E8AA 3I5IC 1F70A 4AQIA 2A4JA 4MZKA 2KSPA 1K90D 1BMOA 2H61C 2KI6D 2MHHA 1NUBA 3AAKA 1CLLA 1NP8A 4N5XA 4DCKA 1GGZA 2JRFA 3OX5A 2KQYA 1M39A 1DJXA 2EC6C 2AAOA 3NSKA 1LXFC 1YRTB 5ER5A 4I5NB 2M29A 1OZSA 1UHNA 2MLFC 3QRXA 5AFPA 2OTGB 2Q4UA 3EK4A 2BCBA 3BOWA 1JF0A 2K0JA 4QJ5B 1CDMA 3TZ1A 1AK8A 2JTZA 1UURA 2LE9B 3BOWB 2M7LA 2WCBA 3BQ3A 3LK1A 1B7TY 1NWDA 2KI4B 1FW4A 2LP2A 3CZTX 2PALA 1M31A 2LVJA 5K89A 1LKJA 2BKHB 1CLMA 2F33A 2JU0A 1IRJA 1BR1B 1PALA 1UHKA 1DTLA 1K8UA 3BYAA 1H8BA 4CLNA 4ORBB 1UHIA 2M97A 2NLNA 1BOCA 2ZNEA 1PVAA 1SYMA 3PSRA 1YX7A 1OMVA 1AUIB 2PRUA 3VROA 3I5GB 5IBWA 1ZMZA 2GV5A 2MJWB 1B8LA 1KFUS 2Q91A 4QJ4B 1W7JB 1NYAA 2QPTA 4TNCA 1B1GA 1W7IB 3SG5A 3PLFB 2FOTA 2MLEC 1YR5A 2ISDA 4ORAB 5I2OA 1K95A 1RTP1 1DF0A 1NX1A 4HSZA 1CFFA 2TN4A 1PK0D 3GK4X 2BL0C 2PSRA 1KFXS 3TDUA 1DF0B 1XO5A 1SL9A 1SL8A 3TS5C 1BF5A 3O6BA 2F2OA 1TCFA 3CS1A 1A4PA 2JXLA 3SG6A 1WDCB 1A03A 5DKQA 1K9PA 4N1GA 4M2QA 2L51A 1QATA 2F8PA 2WOSA 5BPJA 4WQ3A 4YGEB 5I8NA 2LV7A 1OSAA 2KAXA 3I5HC 3SG4A 3SG7A 1WLMA 2KYFA 1SCMC 4MRYA 2G2BA 3CR2A 2GGZA 3JTDB 3KF9A 2LLTA 5PALA 1N65A 2K7DA 1TIZA 1JBAA 2BECA 3CTNA 2LHIA 1TNXA 2JT8A 1CFPA 1XFVO 1C7WA 2L4HA 2CT9A 1Q80A 1KQMC 2HF5A 1WRZA 1DVIA 1YX8A 3ICBA 3KHEA 4PCWA 1UP5A 3WXAA
chains in the Genus database with same CATH superfamily
3OB2B 4I5JA 2YGUA 3EKHA 5AANA 1C3YA 2I7AA 1SK6D 2KLDA 2Y1NA 3B87A 2KBIA 4GUKA 4JD9A 3QMEA 1QX7A 2M8UA 1EG3A 4AQJA 2PYQA 1CDLA 1DT7B 2LUXA 3IVTA 4ETOA 2QEOA 2L0PA 3EK7A 5FI7A 3BFBA 4DUQA 1C3ZA 4C0KA 4P5OE 4HRGA 2H2KA 1JFKA 4PHMA 4YGDB 1IKUA 5GQQC 3D10A 1J7PA 5AERA 4INXA 3JVTB 3SG3A 3CYZA 4AOMA 1AP4A 1UHJA 2L2CA 1OOJA 2KBMA 4ICBA 4JWQA 4OCIA 3TUYB 3AKAA 2PMYA 2M9GA 4NDBA 1DEKA 3DVMA 3DYEA 5EL2A 5CSFA 1RK9A 2HQ8A 5HYDA 1HT9A 1QX2A 4YRUA 2LUCA 1GQMA 1HQVA 1L7ZA 4MBEA 1SRAA 1EXRA 3S0EA 2MAZA 5CSNA 2ZN8A 1ALWA 2WCFA 2L4IA 1J7OA 1UWOA 1XFYO 2BE4A 5HKZA 1J1DA 3BUMB 2LM5A 2PASA 4L9MA 3E3RA 3S0BA 4GGNA 3N7HA 3CR4X 3VRQA 4C0JA 2M0RA 1KWOB 1SL7A 4MZLA 1SR6B 2E30A 1XFRA 2LHLA 3I5HB 5TNCA 3ZNIA 4ZCVA 3I5FC 4GGFA 3NSIA 1TUZA 4PE1A 3S0GA 4INWA 1FF1A 1CM1A 2P6BB 1CMFA 3WHUB 4MZJA 1QVIY 1JUOA 4ZCUA 2SASA 1CKKA 1BR4B 1DGUA 1TTXA 3BFAA 1F54A 1KK7Z 3B6XA 2O60A 1M46A 1XK4C 3D77A 1LS8A 4PE7A 4DRWA 2JWWA 1S6IA 3RLZA 1Z2CB 3K1EA 4DIRA 1CDNA 2I18A 2HETA 2K2FA 4D1EA 1TWOA 1KQVA 2WCHA 1DQEA 2KPHA 3PALA 1SBJA 1KFUL 2JXCA 2KDHA 3DVEA 1DJGA 1F8HA 1V1GA 2LNKA 3A8RA 2KQ6A 1YTZC 2M1UA 4OKHA 5AXIA 2JQ6A 2WCJA 4MSPA 2QEHA 3BUOB 2JT3A 4NDCA 1F55A 1ZACA 3VB1A 1JFJA 3RM1A 3SIAA 2WCMA 1KFXL 1UUSA 1Y1XA 1QJTA 5ER4X 1XFXO 1YVLA 4PHNA 2JNXA 4PT1A 4OZDA 1G33A 1MWNA 2EGDA 3FWCA 5CSJA 2K8MB 2QEBA 1B47A 5D69A 1IJ5A 2KYCA 1D1OA 2KI6C 1T14A 1XFWO 2LMVA 1SW8A 2I94A 4A4CA 1K96A 2QEVA 3EVVA 1Y1UA 4YI8A 3GOFA 1CTRA 4QJ3B 2NCPA 3GK1A 1J55A 1PVBA 2JPTA 3TDZA 1KK8B 2R2IA 5KTYA 1SPYA 2H8VA 1QV1A 3KEVA 2NXQA 3H4SE 1SY9A 1TOPA 3I5IB 1QLKA 4MEWA 3SS3A 2LLUA 2H61A 3LL8B 3MSEB 1IH0A 1MHOA 2BE6A 1A75A 1IG5A 2BCXA 1TCOB 3AAJA 3F45A 3PATA 3TDIA 2K2AA 2LLSA 2WC8A 3GK2A 3M0WA 1A75B 2L5XB 4PHKA 4U8DA 1GM0A 4YBHB 1OOIX 4JQ0D 5HL1A 1XA5A 1XYDA 2EC6B 2D8NA 2Y5IA 3FIAA 3D0YA 4N1FA 1AJ5A 3EVRA 2OS8C 2JT0A 3VRRA 1PRWA 4PE4A 1FI5A 4HREE 3PFVA 3PN7C 3D0YB 1DJWA 5FI2A 3SS4A 1NX3A 2LMUA 1R2UA 4YI9A 1GJYA 2CCMA 3D73A 3SG2A 3EG5B 2HPSA 1DJYA 2GTEA 2LVKA 3CDNA 5AEQA 4I5KA 2KGRA 3ZWHA 2BCAA 1ZFSA 1DJIA 1S5GY 2DOQA 3VRPA 1BODA 1QASA 3D75A 2P70A 1J7RA 2KFGA 2RGIA 5DKRA 1V1FA 2AMIA 1SNLA 2LANA 1U5IA 1G4YR 1S36A 1A29A 3FE6A 1Y6WA 2COLB 1JF2A 2JZIA 2L98A 3OX6A 1CLBA 1KCYA 1U5IB 1EG4A 2OTGC 1M63B 1XFZO 2M1KB 1IQ3A 2WNDA 1KSMA 4MN0A 1A2XA 4NQGA 3OHMB 4NDDA 1OQPA 1K9UA 1EL4A 4GNKB 4I5LB 1B4CA 1YUUA 2KI4C 2LCPA 1DC1A 2PQLA 3RZSA 1PULA 1AJ4A 2LVIA 2ZRSA 3UNWA 2BL0B 3O4YA 3LCPC 1IGVA 1L2OC 4GPLB 3S0FA 3TS5B 1B8CA 2MBXA 1IJ6A 1ZUZA 3WNXB 1QV0A 2ERBA 1NCXA 2HQWA 2WCEA 4A4BA 1CFDA 4WRIA 1RJVA 4YGBB 2KNEA 2SCPA 1MXEA 3I5GC 1QX5B 4MLWA 1OE9B 2FCDA 1RFJA 1TNQA 3B86A 3R1VA 1BG1A 4FQTA 1B8RA 1C07A 1YVHA 4R1EA 1NSHA 1NX0A 4ORCB 1S3PA 4M2OA 5I2QA 1JWDA 1QIWA 1CB1A 3NSLA 1K93D 2KGBC 3DD4A 1SCMB 1QIVA 2PVBA 3CLNA 1JSAA 1FBVA 1YURA 3O78A 1LINA 1TNPA 1B7TZ 3BXKA 3CABA 2ZRTA 5HKYA 5J3XA 4P2YB 5FYXA 4HRHA 5F6TA 1S6CA 1RECA 5KSZA 2BBNA 3OB1B 1BT6A 1VRKA 1WDCC 1N2DA 1KQMB 1OMDA 5HLVA 2MA2A 3K21A 1TRFA 1F4OA 1FPWA 4OVNF 3OP0A 4IJ7A 1IIOA 1TUJA 2OPOA 4PDZA 1SMGA 3PM8A 2CNPA 1TN4A 2CBLA 2MRDA 1QTXA 1BLQA 1X02A 3C1VA 3CWGA 3JTDC 3CZ2A 4GBAA 1EJ3A 2JULA 1IQ5A 2KLEA 2K7CA 3VRNA 1S26D 3B88A 5D7FA 1EH2A 2VRGA 2K61A 2FCEA 4MRXA 2KOTA 1IWQA 1CFCA 4FQOA 2WC6A 5I2LA 2L50A 1WRLA 1ZOTB 4OR9B 4FTGA 1MF8B 4DS7A 3O2PA 2FJUB 4YGCB 1F71A 3DXLA 3DZTA 3EKJA 1J1EA 3D76A 5JOLA 4KYNA 4PE0A 1GGWA 1KK7Y 1L2OB 4CFRA 2KHNA 1MUXA 4JPZB 1BU3A 1QWVA 3AKBA 3DVKA 4WQ2A 1C7VA 1QS7A 2JNFA 3Q8IA 2LVVA 4CFQA 5B8IB 4E68A 1CDPA 1CMGA 1NIWA 2WCKA 1ALVA 3HCMA 3CGAA 1LA0A 2K7OA 2CTNA 2KFHA 2G9BA 2JC2A 3BJHA 3EVUA 5DKNA 1N0YA 4PALA 1NCZA 3NHIA 1G8IA 3S0AA 3JVTC 1DELA 2O5GA 4F7FA 1KSOA 2QACA 3FWBA 1AVSA 1K9KA 3NXAA 3I5FB 2WORA 3TUYC 2M49B 2M7NA 4YGAA 1Z4HA 1XK4A 1YRUB 1SCVA 2LAPA 1S1EA 2K7BA 2NZ0A 1S5GZ 2Y4QA 3KO0A 1W9ZA 3IQOA 1MR8A 3L47A 4F0ZB 1PSBA 4GAOA 4BY5A 3VGOA 1XVJA 1NX2A 1MXLC 1DJHA 2NCOA 1MQ1A 1DGVA 3DF0A 1OZOA 4MVFA 5JJGA 3BUXB 3FE9A 1DMOA 3SS5A 3IF7A 3DF0B 1AHRA 1KWOC 1SR6C 1NCYA 2B1UA 4USLA 1XFUO 1ODBA 1R6PA 2ZFDA 1BJFA 4UPGA 4GGFC 4XJKA 1NPQA 2BBMA 2F3YA 1DJZA 2L2EA 2V53A 2LC5A 3KPXA 2ZKMX 2I2RE 3S0DA 1SKTA 2E6WA 3FS7A 4XJKB 1J7QA 1LVCD 2K60A 3BUWB 4Q04A 1WY9A 2KAVA 1K94A 2WC5A 1M45A 3SIBA 3SJSA 2LMTA 4PHJA 2KFFA 1UHHA 1JC2A 1TNWA 3D74A 2LP3A 1Y0VH 3LK0A 3CZ0A 1PSRA 1WRKA 2F2PA 5CPVA 1QLSA 5CSIA 5HLOA 1CM4A 3DVJA 1WLZA 4XYNA 1LA3A 2CXJA 1Y1AA 3WHTB 2IS9A 3NSOA 2Y1MA 1RWYA 2AUCA 5KU1A 1K2HA 4GFTA 1QVIZ 3A4UB 3IQQA 3CR5X 1ORGA 5HKWA 2ZNDA 4CIDA 2KAYA 2JTTA 1F4QA 1B9AA 1OMRA 3LLEA 2EHBA 4M2PA 4BY4A 4IL1A 4C0LA 1FI6A 3L4AA 2ZN9A 3L4LA 3HX4A 3PM2A 4CPVA 1QXPA 1YUSA 2GGMA 1YUTA 3BUNB 2OS8B 4OV2A 1KK8C 1SSEB 2JOJA 2M3WA 1H4BA 1S6JA 3PN7B 3R72A 2BKIB 1OW4A 1RROA 2F3ZA 5G08A 3EK8A 1CNPA 1E8AA 3I5IC 5FI6A 2L5YA 1F70A 4AQIA 2A4JA 3OBVA 1P28A 4MZKA 2KSPA 1K90D 1BMOA 2H61C 2KI6D 2MHHA 1NUBA 3AAKA 1CLLA 1NP8A 4N5XA 4DCKA 1GGZA 3DY9A 3UO9A 3OGNA 5D3OA 2JRFA 5I94A 1OOGA 3OX5A 2KQYA 2BAPA 1M39A 2BNXA 1DJXA 2EC6C 3FE8A 2AAOA 3NSKA 1LXFC 1YRTB 5ER5A 4I5NB 2M29A 1OZSA 1UHNA 2MLFC 3QRXA 5AFPA 2OTGB 2Q4UA 3EK4A 2BCBA 3BOWA 1JF0A 2K0JA 4QJ5B 1CDMA 3TZ1A 1AK8A 2JTZA 1UURA 2LE9B 3BOWB 2M7LA 2WCBA 3BQ3A 3LK1A 1B7TY 1NWDA 2KI4B 1FW4A 2LP2A 3CZTX 2PALA 2P71A 1M31A 2LVJA 5K89A 1LKJA 2BKHB 1CLMA 2F33A 2JU0A 1IRJA 1BR1B 1PALA 1UHKA 1DTLA 1K8UA 3BYAA 3O4XA 1H8BA 4CLNA 4ORBB 1UHIA 2M97A 2NLNA 1BOCA 2ZNEA 1OOFA 1PVAA 1SYMA 3PSRA 1YX7A 1OMVA 1AUIB 2FJYA 2PRUA 3VROA 3I5GB 5IBWA 1ZMZA 2GV5A 2MJWB 3CZ1A 1B8LA 1KFUS 2Q91A 4QJ4B 1W7JB 1NYAA 2QPTA 4TNCA 1B1GA 1W7IB 3SG5A 3PLFB 2FOTA 2MLEC 3PJIA 1YR5A 2ISDA 4ORAB 2WCLA 1K95A 1RTP1 1DF0A 1NX1A 3BFHA 4HSZA 5I2OA 2TN4A 1CFFA 1PK0D 3GK4X 3R1OA 2BL0C 2PSRA 1KFXS 1OOHA 1DF0B 1XO5A 3TDUA 2QDIA 1SL9A 3R1PA 1SL8A 3TS5C 1BF5A 3O6BA 2F2OA 1TCFA 3CS1A 1A4PA 4JKTA 2JXLA 3NHTA 3SG6A 1WDCB 1A03A 5DKQA 1K9PA 4N1GA 4M2QA 2L51A 1QATA 3B7AA 5DICA 2F8PA 2WOSA 5BPJA 4WQ3A 4YGEB 5I8NA 2LV7A 1OSAA 2KAXA 3I5HC 3SG4A 3SG7A 1WLMA 2KYFA 1SCMC 4MRYA 2G2BA 3CR2A 2GGZA 3JTDB 2JPOA 3KF9A 3V2LA 2LLTA 5PALA 1N65A 2K7DA 1TIZA 1JBAA 2BECA 3CTNA 2LHIA 1TNXA 2JT8A 1CFPA 3D78A 1XFVO 1C7WA 3NGVA 2L4HA 2CT9A 1Q80A 1KQMC 2HF5A 1WRZA 1DVIA 1YX8A 3ICBA 3KHEA 4PCWA 1UP5A 3WXAA
chains in the Genus database with same CATH topology
3OB2B 4I5JA 3EKHA 5AANA 2I7AA 1SK6D 2Y1NA 2KBIA 4GUKA 1QX7A 2M8UA 1EG3A 4AQJA 1CDLA 1DT7B 2LUXA 4ETOA 2L0PA 3EK7A 4DUQA 4C0KA 4P5OE 4HRGA 2H2KA 1JFKA 4PHMA 4YGDB 1IKUA 5GQQC 3D10A 1J7PA 5AERA 3JVTB 3SG3A 4AOMA 1AP4A 1UHJA 1OOJA 2KBMA 4ICBA 4JWQA 4OCIA 3TUYB 3AKAA 2PMYA 2M9GA 4NDBA 3DVMA 5CSFA 1RK9A 2HQ8A 5HYDA 1HT9A 1QX2A 4YRUA 2LUCA 1GQMA 1HQVA 1L7ZA 4MBEA 1SRAA 1EXRA 2MAZA 5CSNA 2ZN8A 1ALWA 2WCFA 2L4IA 1J7OA 1UWOA 1XFYO 2BE4A 5HKZA 1J1DA 3BUMB 2LM5A 2PASA 4L9MA 3E3RA 4GGNA 3CR4X 3VRQA 4C0JA 2M0RA 1KWOB 1SL7A 4MZLA 1SR6B 2E30A 2LHLA 3I5HB 5TNCA 3ZNIA 4ZCVA 3I5FC 4GGFA 3NSIA 4PE1A 1FF1A 1CM1A 2P6BB 1CMFA 3WHUB 4MZJA 1QVIY 1JUOA 4ZCUA 2SASA 1CKKA 1BR4B 1DGUA 1TTXA 1F54A 1KK7Z 2O60A 1M46A 1XK4C 4PE7A 4DRWA 2JWWA 1S6IA 3RLZA 4DIRA 1CDNA 2I18A 2HETA 2K2FA 4D1EA 1KQVA 3PALA 1SBJA 1KFUL 2JXCA 2KDHA 3DVEA 1DJGA 1F8HA 1V1GA 2LNKA 3A8RA 2KQ6A 1YTZC 2M1UA 4OKHA 5AXIA 2JQ6A 4MSPA 3BUOB 2JT3A 4NDCA 1F55A 1ZACA 1JFJA 3RM1A 3SIAA 1KFXL 1UUSA 1Y1XA 1QJTA 5ER4X 1XFXO 1YVLA 4PHNA 2JNXA 1G33A 1MWNA 2EGDA 3FWCA 5CSJA 2K8MB 5D69A 1B47A 1IJ5A 2KYCA 1D1OA 2KI6C 2LMVA 1XFWO 1SW8A 2I94A 4A4CA 1K96A 3EVVA 4YI8A 1Y1UA 3GOFA 1CTRA 4QJ3B 2NCPA 3GK1A 1J55A 1PVBA 2JPTA 3TDZA 1KK8B 2R2IA 5KTYA 1SPYA 3KEVA 1QV1A 2NXQA 3H4SE 1SY9A 1TOPA 3I5IB 1QLKA 4MEWA 2LLUA 2H61A 3LL8B 3MSEB 1IH0A 1MHOA 2BE6A 1A75A 1IG5A 2BCXA 1TCOB 3AAJA 3F45A 3PATA 3TDIA 2K2AA 2LLSA 2WC8A 3GK2A 3M0WA 1A75B 2L5XB 4PHKA 4U8DA 4YBHB 4JQ0D 1XA5A 1XYDA 2EC6B 2D8NA 2Y5IA 3FIAA 3D0YA 4N1FA 1AJ5A 3EVRA 2OS8C 2JT0A 3VRRA 1PRWA 4PE4A 1FI5A 4HREE 3PFVA 3PN7C 3D0YB 1DJWA 1NX3A 2LMUA 1R2UA 4YI9A 1GJYA 2CCMA 3SG2A 2HPSA 1DJYA 2LVKA 5AEQA 4I5KA 2KGRA 3ZWHA 2BCAA 1ZFSA 1DJIA 1S5GY 2DOQA 3VRPA 1BODA 1QASA 1J7RA 2KFGA 2RGIA 5DKRA 1V1FA 2AMIA 1SNLA 2LANA 1U5IA 1G4YR 1S36A 1A29A 1Y6WA 2COLB 1JF2A 2JZIA 2L98A 3OX6A 1CLBA 1KCYA 1U5IB 1EG4A 2OTGC 1M63B 1XFZO 2M1KB 1IQ3A 2WNDA 1KSMA 4MN0A 1A2XA 4NQGA 3OHMB 4NDDA 1OQPA 1K9UA 1EL4A 4GNKB 4I5LB 1B4CA 1YUUA 2KI4C 2LCPA 1PULA 1AJ4A 2LVIA 2ZRSA 2BL0B 3O4YA 3LCPC 1IGVA 1L2OC 4GPLB 3TS5B 1B8CA 2MBXA 1IJ6A 1ZUZA 3WNXB 1QV0A 2HQWA 1NCXA 2WCEA 4A4BA 1CFDA 4WRIA 1RJVA 4YGBB 2KNEA 2SCPA 1MXEA 3I5GC 1QX5B 4MLWA 1OE9B 2FCDA 1RFJA 1TNQA 1BG1A 1B8RA 1C07A 1YVHA 4R1EA 1NSHA 1NX0A 4ORCB 1S3PA 4M2OA 5I2QA 1JWDA 1QIWA 1CB1A 3NSLA 1K93D 2KGBC 3DD4A 1SCMB 1QIVA 2PVBA 3CLNA 1JSAA 1FBVA 1YURA 3O78A 1LINA 1TNPA 1B7TZ 3BXKA 2ZRTA 5HKYA 5J3XA 4P2YB 5FYXA 4HRHA 5F6TA 1S6CA 1RECA 5KSZA 2BBNA 3OB1B 1BT6A 1VRKA 1WDCC 1N2DA 1KQMB 1OMDA 5HLVA 2MA2A 3K21A 1TRFA 1F4OA 1FPWA 4OVNF 3OP0A 2OPOA 4PDZA 1SMGA 3PM8A 2CNPA 1TN4A 2CBLA 2MRDA 1QTXA 1BLQA 1X02A 3C1VA 3CWGA 3JTDC 4GBAA 1EJ3A 2JULA 1IQ5A 3VRNA 2K7CA 1S26D 1EH2A 5D7FA 2VRGA 2K61A 2FCEA 4MRXA 2KOTA 1IWQA 1CFCA 4FQOA 5I2LA 2L50A 1WRLA 1ZOTB 4OR9B 4FTGA 1MF8B 4DS7A 3O2PA 2FJUB 4YGCB 1F71A 5JOLA 1GGWA 3EKJA 1J1EA 4PE0A 1KK7Y 1L2OB 4CFRA 2KHNA 1MUXA 4JPZB 1BU3A 3AKBA 3DVKA 4WQ2A 1C7VA 1QS7A 2JNFA 2LVVA 4CFQA 5B8IB 4E68A 1CDPA 1CMGA 1NIWA 1ALVA 3HCMA 3CGAA 1LA0A 2K7OA 2CTNA 2KFHA 2G9BA 2JC2A 3EVUA 5DKNA 1N0YA 4PALA 1NCZA 1G8IA 3JVTC 2O5GA 1KSOA 2QACA 3FWBA 1AVSA 1K9KA 3NXAA 3I5FB 2WORA 3TUYC 2M49B 2M7NA 4YGAA 1XK4A 1YRUB 1SCVA 2LAPA 1S1EA 2K7BA 2NZ0A 1S5GZ 2Y4QA 3KO0A 3IQOA 1MR8A 4F0ZB 1PSBA 4GAOA 4BY5A 3VGOA 1XVJA 1NX2A 1MXLC 1DJHA 2NCOA 1MQ1A 1DGVA 3DF0A 1OZOA 4MVFA 5JJGA 3BUXB 1DMOA 3IF7A 3DF0B 1AHRA 1KWOC 1SR6C 1NCYA 2B1UA 4USLA 1XFUO 1ODBA 1R6PA 2ZFDA 1BJFA 4UPGA 4GGFC 4XJKA 1NPQA 2BBMA 2F3YA 1DJZA 2L2EA 2V53A 2LC5A 3KPXA 2ZKMX 2I2RE 1SKTA 2E6WA 3FS7A 4XJKB 1J7QA 1LVCD 3BUWB 4Q04A 1WY9A 2KAVA 1K94A 1M45A 3SIBA 3SJSA 2LMTA 4PHJA 2KFFA 1UHHA 1JC2A 1TNWA 2LP3A 1Y0VH 3LK0A 1PSRA 1WRKA 2F2PA 5CPVA 1QLSA 5CSIA 5HLOA 1CM4A 3DVJA 1WLZA 4XYNA 1LA3A 2CXJA 1Y1AA 3WHTB 2IS9A 3NSOA 2Y1MA 1RWYA 2AUCA 5KU1A 1K2HA 4GFTA 1QVIZ 3A4UB 3IQQA 3CR5X 5HKWA 2ZNDA 4CIDA 2KAYA 2JTTA 1F4QA 1B9AA 1OMRA 3LLEA 2EHBA 4M2PA 4BY4A 4IL1A 4C0LA 1FI6A 2ZN9A 3HX4A 4CPVA 1QXPA 1YUSA 2GGMA 1YUTA 3BUNB 2OS8B 4OV2A 1KK8C 2M3WA 2JOJA 1H4BA 1S6JA 3PN7B 2BKIB 2F3ZA 1RROA 5G08A 3EK8A 1CNPA 1E8AA 3I5IC 1F70A 4AQIA 2A4JA 4MZKA 2KSPA 1K90D 1BMOA 2H61C 2KI6D 2MHHA 1NUBA 3AAKA 1CLLA 1NP8A 4N5XA 4DCKA 1GGZA 2JRFA 3OX5A 2KQYA 1M39A 1DJXA 2EC6C 2AAOA 3NSKA 1LXFC 1YRTB 5ER5A 4I5NB 2M29A 1OZSA 1UHNA 2MLFC 3QRXA 5AFPA 2OTGB 2Q4UA 3EK4A 2BCBA 3BOWA 1JF0A 2K0JA 4QJ5B 1CDMA 3TZ1A 1AK8A 2JTZA 1UURA 2LE9B 3BOWB 2M7LA 2WCBA 3BQ3A 3LK1A 1B7TY 1NWDA 2KI4B 1FW4A 2LP2A 3CZTX 2PALA 1M31A 2LVJA 5K89A 1LKJA 2BKHB 1CLMA 2F33A 2JU0A 1IRJA 1BR1B 1PALA 1UHKA 1DTLA 1K8UA 3BYAA 1H8BA 4CLNA 4ORBB 1UHIA 2M97A 2NLNA 1BOCA 2ZNEA 1PVAA 1SYMA 3PSRA 1YX7A 1OMVA 1AUIB 2PRUA 3VROA 3I5GB 5IBWA 1ZMZA 2GV5A 2MJWB 1B8LA 1KFUS 2Q91A 4QJ4B 1W7JB 1NYAA 2QPTA 4TNCA 1B1GA 1W7IB 3SG5A 3PLFB 2FOTA 2MLEC 1YR5A 2ISDA 4ORAB 5I2OA 1K95A 1RTP1 1DF0A 1NX1A 4HSZA 1CFFA 2TN4A 1PK0D 3GK4X 2BL0C 2PSRA 1KFXS 3TDUA 1DF0B 1XO5A 1SL9A 1SL8A 3TS5C 1BF5A 3O6BA 2F2OA 1TCFA 3CS1A 1A4PA 2JXLA 3SG6A 1WDCB 1A03A 5DKQA 1K9PA 4N1GA 4M2QA 2L51A 1QATA 2F8PA 2WOSA 5BPJA 4WQ3A 4YGEB 5I8NA 2LV7A 1OSAA 2KAXA 3I5HC 3SG4A 3SG7A 1WLMA 2KYFA 1SCMC 4MRYA 2G2BA 3CR2A 2GGZA 3JTDB 3KF9A 2LLTA 5PALA 1N65A 2K7DA 1TIZA 1JBAA 2BECA 3CTNA 2LHIA 1TNXA 2JT8A 1CFPA 1XFVO 1C7WA 2L4HA 2CT9A 1Q80A 1KQMC 2HF5A 1WRZA 1DVIA 1YX8A 3ICBA 3KHEA 4PCWA 1UP5A 3WXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB2 B;  4I5J A;  3EKH A;  5AAN A;  2I7A A;  1SK6 D;  2Y1N A;  2KBI A;  4GUK A;  1QX7 A;  2M8U A;  1EG3 A;  4AQJ A;  1CDL A;  1DT7 B;  2LUX A;  4ETO A;  2L0P A;  3EK7 A;  4DUQ A;  4C0K A;  4P5O E;  4HRG A;  2H2K A;  1JFK A;  4PHM A;  4YGD B;  1IKU A;  5GQQ C;  3D10 A;  1J7P A;  5AER A;  3JVT B;  3SG3 A;  4AOM A;  1AP4 A;  1UHJ A;  1OOJ A;  2KBM A;  4ICB A;  4JWQ A;  4OCI A;  3TUY B;  3AKA A;  2PMY A;  2M9G A;  4NDB A;  3DVM A;  5CSF A;  1RK9 A;  2HQ8 A;  5HYD A;  1HT9 A;  1QX2 A;  4YRU A;  2LUC A;  1GQM A;  1HQV A;  1L7Z A;  4MBE A;  1SRA A;  1EXR A;  2MAZ A;  5CSN A;  2ZN8 A;  1ALW A;  2WCF A;  2L4I A;  1J7O A;  1UWO A;  1XFY O;  2BE4 A;  5HKZ A;  1J1D A;  3BUM B;  2LM5 A;  2PAS A;  4L9M A;  3E3R A;  4GGN A;  3CR4 X;  3VRQ A;  4C0J A;  2M0R A;  1KWO B;  1SL7 A;  4MZL A;  1SR6 B;  2E30 A;  2LHL A;  3I5H B;  5TNC A;  3ZNI A;  4ZCV A;  3I5F C;  4GGF A;  3NSI A;  4PE1 A;  1FF1 A;  1CM1 A;  2P6B B;  1CMF A;  3WHU B;  4MZJ A;  1QVI Y;  1JUO A;  4ZCU A;  2SAS A;  1CKK A;  1BR4 B;  1DGU A;  1TTX A;  1F54 A;  1KK7 Z;  2O60 A;  1M46 A;  1XK4 C;  4PE7 A;  4DRW A;  2JWW A;  1S6I A;  3RLZ A;  4DIR A;  1CDN A;  2I18 A;  2HET A;  2K2F A;  4D1E A;  1KQV A;  3PAL A;  1SBJ A;  1KFU L;  2JXC A;  2KDH A;  3DVE A;  1DJG A;  1F8H A;  1V1G A;  2LNK A;  3A8R A;  2KQ6 A;  1YTZ C;  2M1U A;  4OKH A;  5AXI A;  2JQ6 A;  4MSP A;  3BUO B;  2JT3 A;  4NDC A;  1F55 A;  1ZAC A;  1JFJ A;  3RM1 A;  3SIA A;  1KFX L;  1UUS A;  1Y1X A;  1QJT A;  5ER4 X;  1XFX O;  1YVL A;  4PHN A;  2JNX A;  1G33 A;  1MWN A;  2EGD A;  3FWC A;  5CSJ A;  2K8M B;  5D69 A;  1B47 A;  1IJ5 A;  2KYC A;  1D1O A;  2KI6 C;  2LMV A;  1XFW O;  1SW8 A;  2I94 A;  4A4C A;  1K96 A;  3EVV A;  4YI8 A;  1Y1U A;  3GOF A;  1CTR A;  4QJ3 B;  2NCP A;  3GK1 A;  1J55 A;  1PVB A;  2JPT A;  3TDZ A;  1KK8 B;  2R2I A;  5KTY A;  1SPY A;  3KEV A;  1QV1 A;  2NXQ A;  3H4S E;  1SY9 A;  1TOP A;  3I5I B;  1QLK A;  4MEW A;  2LLU A;  2H61 A;  3LL8 B;  3MSE B;  1IH0 A;  1MHO A;  2BE6 A;  1A75 A;  1IG5 A;  2BCX A;  1TCO B;  3AAJ A;  3F45 A;  3PAT A;  3TDI A;  2K2A A;  2LLS A;  2WC8 A;  3GK2 A;  3M0W A;  1A75 B;  2L5X B;  4PHK A;  4U8D A;  4YBH B;  4JQ0 D;  1XA5 A;  1XYD A;  2EC6 B;  2D8N A;  2Y5I A;  3FIA A;  3D0Y A;  4N1F A;  1AJ5 A;  3EVR A;  2OS8 C;  2JT0 A;  3VRR A;  1PRW A;  4PE4 A;  1FI5 A;  4HRE E;  3PFV A;  3PN7 C;  3D0Y B;  1DJW A;  1NX3 A;  2LMU A;  1R2U A;  4YI9 A;  1GJY A;  2CCM A;  3SG2 A;  2HPS A;  1DJY A;  2LVK A;  5AEQ A;  4I5K A;  2KGR A;  3ZWH A;  2BCA A;  1ZFS A;  1DJI A;  1S5G Y;  2DOQ A;  3VRP A;  1BOD A;  1QAS A;  1J7R A;  2KFG A;  2RGI A;  5DKR A;  1V1F A;  2AMI A;  1SNL A;  2LAN A;  1U5I A;  1G4Y R;  1S36 A;  1A29 A;  1Y6W A;  2COL B;  1JF2 A;  2JZI A;  2L98 A;  3OX6 A;  1CLB A;  1KCY A;  1U5I B;  1EG4 A;  2OTG C;  1M63 B;  1XFZ O;  2M1K B;  1IQ3 A;  2WND A;  1KSM A;  4MN0 A;  1A2X A;  4NQG A;  3OHM B;  4NDD A;  1OQP A;  1K9U A;  1EL4 A;  4GNK B;  4I5L B;  1B4C A;  1YUU A;  2KI4 C;  2LCP A;  1PUL A;  1AJ4 A;  2LVI A;  2ZRS A;  2BL0 B;  3O4Y A;  3LCP C;  1IGV A;  1L2O C;  4GPL B;  3TS5 B;  1B8C A;  2MBX A;  1IJ6 A;  1ZUZ A;  3WNX B;  1QV0 A;  2HQW A;  1NCX A;  2WCE A;  4A4B A;  1CFD A;  4WRI A;  1RJV A;  4YGB B;  2KNE A;  2SCP A;  1MXE A;  3I5G C;  1QX5 B;  4MLW A;  1OE9 B;  2FCD A;  1RFJ A;  1TNQ A;  1BG1 A;  1B8R A;  1C07 A;  1YVH A;  4R1E A;  1NSH A;  1NX0 A;  4ORC B;  1S3P A;  4M2O A;  5I2Q A;  1JWD A;  1QIW A;  1CB1 A;  3NSL A;  1K93 D;  2KGB C;  3DD4 A;  1SCM B;  1QIV A;  2PVB A;  3CLN A;  1JSA A;  1FBV A;  1YUR A;  3O78 A;  1LIN A;  1TNP A;  1B7T Z;  3BXK A;  2ZRT A;  5HKY A;  5J3X A;  4P2Y B;  5FYX A;  4HRH A;  5F6T A;  1S6C A;  1REC A;  5KSZ A;  2BBN A;  3OB1 B;  1BT6 A;  1VRK A;  1WDC C;  1N2D A;  1KQM B;  1OMD A;  5HLV A;  2MA2 A;  3K21 A;  1TRF A;  1F4O A;  1FPW A;  4OVN F;  3OP0 A;  2OPO A;  4PDZ A;  1SMG A;  3PM8 A;  2CNP A;  1TN4 A;  2CBL A;  2MRD A;  1QTX A;  1BLQ A;  1X02 A;  3C1V A;  3CWG A;  3JTD C;  4GBA A;  1EJ3 A;  2JUL A;  1IQ5 A;  3VRN A;  2K7C A;  1S26 D;  1EH2 A;  5D7F A;  2VRG A;  2K61 A;  2FCE A;  4MRX A;  2KOT A;  1IWQ A;  1CFC A;  4FQO A;  5I2L A;  2L50 A;  1WRL A;  1ZOT B;  4OR9 B;  4FTG A;  1MF8 B;  4DS7 A;  3O2P A;  2FJU B;  4YGC B;  1F71 A;  5JOL A;  1GGW A;  3EKJ A;  1J1E A;  4PE0 A;  1KK7 Y;  1L2O B;  4CFR A;  2KHN A;  1MUX A;  4JPZ B;  1BU3 A;  3AKB A;  3DVK A;  4WQ2 A;  1C7V A;  1QS7 A;  2JNF A;  2LVV A;  4CFQ A;  5B8I B;  4E68 A;  1CDP A;  1CMG A;  1NIW A;  1ALV A;  3HCM A;  3CGA A;  1LA0 A;  2K7O A;  2CTN A;  2KFH A;  2G9B A;  2JC2 A;  3EVU A;  5DKN A;  1N0Y A;  4PAL A;  1NCZ A;  1G8I A;  3JVT C;  2O5G A;  1KSO A;  2QAC A;  3FWB A;  1AVS A;  1K9K A;  3NXA A;  3I5F B;  2WOR A;  3TUY C;  2M49 B;  2M7N A;  4YGA A;  1XK4 A;  1YRU B;  1SCV A;  2LAP A;  1S1E A;  2K7B A;  2NZ0 A;  1S5G Z;  2Y4Q A;  3KO0 A;  3IQO A;  1MR8 A;  4F0Z B;  1PSB A;  4GAO A;  4BY5 A;  3VGO A;  1XVJ A;  1NX2 A;  1MXL C;  1DJH A;  2NCO A;  1MQ1 A;  1DGV A;  3DF0 A;  1OZO A;  4MVF A;  5JJG A;  3BUX B;  1DMO A;  3IF7 A;  3DF0 B;  1AHR A;  1KWO C;  1SR6 C;  1NCY A;  2B1U A;  4USL A;  1XFU O;  1ODB A;  1R6P A;  2ZFD A;  1BJF A;  4UPG A;  4GGF C;  4XJK A;  1NPQ A;  2BBM A;  2F3Y A;  1DJZ A;  2L2E A;  2V53 A;  2LC5 A;  3KPX A;  2ZKM X;  2I2R E;  1SKT A;  2E6W A;  3FS7 A;  4XJK B;  1J7Q A;  1LVC D;  3BUW B;  4Q04 A;  1WY9 A;  2KAV A;  1K94 A;  1M45 A;  3SIB A;  3SJS A;  2LMT A;  4PHJ A;  2KFF A;  1UHH A;  1JC2 A;  1TNW A;  2LP3 A;  1Y0V H;  3LK0 A;  1PSR A;  1WRK A;  2F2P A;  5CPV A;  1QLS A;  5CSI A;  5HLO A;  1CM4 A;  3DVJ A;  1WLZ A;  4XYN A;  1LA3 A;  2CXJ A;  1Y1A A;  3WHT B;  2IS9 A;  3NSO A;  2Y1M A;  1RWY A;  2AUC A;  5KU1 A;  1K2H A;  4GFT A;  1QVI Z;  3A4U B;  3IQQ A;  3CR5 X;  5HKW A;  2ZND A;  4CID A;  2KAY A;  2JTT A;  1F4Q A;  1B9A A;  1OMR A;  3LLE A;  2EHB A;  4M2P A;  4BY4 A;  4IL1 A;  4C0L A;  1FI6 A;  2ZN9 A;  3HX4 A;  4CPV A;  1QXP A;  1YUS A;  2GGM A;  1YUT A;  3BUN B;  2OS8 B;  4OV2 A;  1KK8 C;  2M3W A;  2JOJ A;  1H4B A;  1S6J A;  3PN7 B;  2BKI B;  2F3Z A;  1RRO A;  5G08 A;  3EK8 A;  1CNP A;  1E8A A;  3I5I C;  1F70 A;  4AQI A;  2A4J A;  4MZK A;  2KSP A;  1K90 D;  1BMO A;  2H61 C;  2KI6 D;  2MHH A;  1NUB A;  3AAK A;  1CLL A;  1NP8 A;  4N5X A;  4DCK A;  1GGZ A;  2JRF A;  3OX5 A;  2KQY A;  1M39 A;  1DJX A;  2EC6 C;  2AAO A;  3NSK A;  1LXF C;  1YRT B;  5ER5 A;  4I5N B;  2M29 A;  1OZS A;  1UHN A;  2MLF C;  3QRX A;  5AFP A;  2OTG B;  2Q4U A;  3EK4 A;  2BCB A;  3BOW A;  1JF0 A;  2K0J A;  4QJ5 B;  1CDM A;  3TZ1 A;  1AK8 A;  2JTZ A;  1UUR A;  2LE9 B;  3BOW B;  2M7L A;  2WCB A;  3BQ3 A;  3LK1 A;  1B7T Y;  1NWD A;  2KI4 B;  1FW4 A;  2LP2 A;  3CZT X;  2PAL A;  1M31 A;  2LVJ A;  5K89 A;  1LKJ A;  2BKH B;  1CLM A;  2F33 A;  2JU0 A;  1IRJ A;  1BR1 B;  1PAL A;  1UHK A;  1DTL A;  1K8U A;  3BYA A;  1H8B A;  4CLN A;  4ORB B;  1UHI A;  2M97 A;  2NLN A;  1BOC A;  2ZNE A;  1PVA A;  1SYM A;  3PSR A;  1YX7 A;  1OMV A;  1AUI B;  2PRU A;  3VRO A;  3I5G B;  5IBW A;  1ZMZ A;  2GV5 A;  2MJW B;  1B8L A;  1KFU S;  2Q91 A;  4QJ4 B;  1W7J B;  1NYA A;  2QPT A;  4TNC A;  1B1G A;  1W7I B;  3SG5 A;  3PLF B;  2FOT A;  2MLE C;  1YR5 A;  2ISD A;  4ORA B;  5I2O A;  1K95 A;  1RTP 1;  1DF0 A;  1NX1 A;  4HSZ A;  1CFF A;  2TN4 A;  1PK0 D;  3GK4 X;  2BL0 C;  2PSR A;  1KFX S;  3TDU A;  1DF0 B;  1XO5 A;  1SL9 A;  1SL8 A;  3TS5 C;  1BF5 A;  3O6B A;  2F2O A;  1TCF A;  3CS1 A;  1A4P A;  2JXL A;  3SG6 A;  1WDC B;  1A03 A;  5DKQ A;  1K9P A;  4N1G A;  4M2Q A;  2L51 A;  1QAT A;  2F8P A;  2WOS A;  5BPJ A;  4WQ3 A;  4YGE B;  5I8N A;  2LV7 A;  1OSA A;  2KAX A;  3I5H C;  3SG4 A;  3SG7 A;  1WLM A;  2KYF A;  1SCM C;  4MRY A;  2G2B A;  3CR2 A;  2GGZ A;  3JTD B;  3KF9 A;  2LLT A;  5PAL A;  1N65 A;  2K7D A;  1TIZ A;  1JBA A;  2BEC A;  3CTN A;  2LHI A;  1TNX A;  2JT8 A;  1CFP A;  1XFV O;  1C7W A;  2L4H A;  2CT9 A;  1Q80 A;  1KQM C;  2HF5 A;  1WRZ A;  1DVI A;  1YX8 A;  3ICB A;  3KHE A;  4PCW A;  1UP5 A;  3WXA A; 
#chains in the Genus database with same CATH topology
 3OB2 B;  4I5J A;  2YGU A;  3EKH A;  5AAN A;  1C3Y A;  2I7A A;  1SK6 D;  2KLD A;  2Y1N A;  3B87 A;  2KBI A;  4GUK A;  4JD9 A;  3QME A;  1QX7 A;  2M8U A;  1EG3 A;  4AQJ A;  2PYQ A;  1CDL A;  1DT7 B;  2LUX A;  3IVT A;  4ETO A;  2QEO A;  2L0P A;  3EK7 A;  5FI7 A;  3BFB A;  4DUQ A;  1C3Z A;  4C0K A;  4P5O E;  4HRG A;  2H2K A;  1JFK A;  4PHM A;  4YGD B;  1IKU A;  5GQQ C;  3D10 A;  1J7P A;  5AER A;  4INX A;  3JVT B;  3SG3 A;  3CYZ A;  4AOM A;  1AP4 A;  1UHJ A;  2L2C A;  1OOJ A;  2KBM A;  4ICB A;  4JWQ A;  4OCI A;  3TUY B;  3AKA A;  2PMY A;  2M9G A;  4NDB A;  1DEK A;  3DVM A;  3DYE A;  5EL2 A;  5CSF A;  1RK9 A;  2HQ8 A;  5HYD A;  1HT9 A;  1QX2 A;  4YRU A;  2LUC A;  1GQM A;  1HQV A;  1L7Z A;  4MBE A;  1SRA A;  1EXR A;  3S0E A;  2MAZ A;  5CSN A;  2ZN8 A;  1ALW A;  2WCF A;  2L4I A;  1J7O A;  1UWO A;  1XFY O;  2BE4 A;  5HKZ A;  1J1D A;  3BUM B;  2LM5 A;  2PAS A;  4L9M A;  3E3R A;  3S0B A;  4GGN A;  3N7H A;  3CR4 X;  3VRQ A;  4C0J A;  2M0R A;  1KWO B;  1SL7 A;  4MZL A;  1SR6 B;  2E30 A;  1XFR A;  2LHL A;  3I5H B;  5TNC A;  3ZNI A;  4ZCV A;  3I5F C;  4GGF A;  3NSI A;  1TUZ A;  4PE1 A;  3S0G A;  4INW A;  1FF1 A;  1CM1 A;  2P6B B;  1CMF A;  3WHU B;  4MZJ A;  1QVI Y;  1JUO A;  4ZCU A;  2SAS A;  1CKK A;  1BR4 B;  1DGU A;  1TTX A;  3BFA A;  1F54 A;  1KK7 Z;  3B6X A;  2O60 A;  1M46 A;  1XK4 C;  3D77 A;  1LS8 A;  4PE7 A;  4DRW A;  2JWW A;  1S6I A;  3RLZ A;  1Z2C B;  3K1E A;  4DIR A;  1CDN A;  2I18 A;  2HET A;  2K2F A;  4D1E A;  1TWO A;  1KQV A;  2WCH A;  1DQE A;  2KPH A;  3PAL A;  1SBJ A;  1KFU L;  2JXC A;  2KDH A;  3DVE A;  1DJG A;  1F8H A;  1V1G A;  2LNK A;  3A8R A;  2KQ6 A;  1YTZ C;  2M1U A;  4OKH A;  5AXI A;  2JQ6 A;  2WCJ A;  4MSP A;  2QEH A;  3BUO B;  2JT3 A;  4NDC A;  1F55 A;  1ZAC A;  3VB1 A;  1JFJ A;  3RM1 A;  3SIA A;  2WCM A;  1KFX L;  1UUS A;  1Y1X A;  1QJT A;  5ER4 X;  1XFX O;  1YVL A;  4PHN A;  2JNX A;  4PT1 A;  4OZD A;  1G33 A;  1MWN A;  2EGD A;  3FWC A;  5CSJ A;  2K8M B;  2QEB A;  1B47 A;  5D69 A;  1IJ5 A;  2KYC A;  1D1O A;  2KI6 C;  1T14 A;  1XFW O;  2LMV A;  1SW8 A;  2I94 A;  4A4C A;  1K96 A;  2QEV A;  3EVV A;  1Y1U A;  4YI8 A;  3GOF A;  1CTR A;  4QJ3 B;  2NCP A;  3GK1 A;  1J55 A;  1PVB A;  2JPT A;  3TDZ A;  1KK8 B;  2R2I A;  5KTY A;  1SPY A;  2H8V A;  1QV1 A;  3KEV A;  2NXQ A;  3H4S E;  1SY9 A;  1TOP A;  3I5I B;  1QLK A;  4MEW A;  3SS3 A;  2LLU A;  2H61 A;  3LL8 B;  3MSE B;  1IH0 A;  1MHO A;  2BE6 A;  1A75 A;  1IG5 A;  2BCX A;  1TCO B;  3AAJ A;  3F45 A;  3PAT A;  3TDI A;  2K2A A;  2LLS A;  2WC8 A;  3GK2 A;  3M0W A;  1A75 B;  2L5X B;  4PHK A;  4U8D A;  1GM0 A;  4YBH B;  1OOI X;  4JQ0 D;  5HL1 A;  1XA5 A;  1XYD A;  2EC6 B;  2D8N A;  2Y5I A;  3FIA A;  3D0Y A;  4N1F A;  1AJ5 A;  3EVR A;  2OS8 C;  2JT0 A;  3VRR A;  1PRW A;  4PE4 A;  1FI5 A;  4HRE E;  3PFV A;  3PN7 C;  3D0Y B;  1DJW A;  5FI2 A;  3SS4 A;  1NX3 A;  2LMU A;  1R2U A;  4YI9 A;  1GJY A;  2CCM A;  3D73 A;  3SG2 A;  3EG5 B;  2HPS A;  1DJY A;  2GTE A;  2LVK A;  3CDN A;  5AEQ A;  4I5K A;  2KGR A;  3ZWH A;  2BCA A;  1ZFS A;  1DJI A;  1S5G Y;  2DOQ A;  3VRP A;  1BOD A;  1QAS A;  3D75 A;  2P70 A;  1J7R A;  2KFG A;  2RGI A;  5DKR A;  1V1F A;  2AMI A;  1SNL A;  2LAN A;  1U5I A;  1G4Y R;  1S36 A;  1A29 A;  3FE6 A;  1Y6W A;  2COL B;  1JF2 A;  2JZI A;  2L98 A;  3OX6 A;  1CLB A;  1KCY A;  1U5I B;  1EG4 A;  2OTG C;  1M63 B;  1XFZ O;  2M1K B;  1IQ3 A;  2WND A;  1KSM A;  4MN0 A;  1A2X A;  4NQG A;  3OHM B;  4NDD A;  1OQP A;  1K9U A;  1EL4 A;  4GNK B;  4I5L B;  1B4C A;  1YUU A;  2KI4 C;  2LCP A;  1DC1 A;  2PQL A;  3RZS A;  1PUL A;  1AJ4 A;  2LVI A;  2ZRS A;  3UNW A;  2BL0 B;  3O4Y A;  3LCP C;  1IGV A;  1L2O C;  4GPL B;  3S0F A;  3TS5 B;  1B8C A;  2MBX A;  1IJ6 A;  1ZUZ A;  3WNX B;  1QV0 A;  2ERB A;  1NCX A;  2HQW A;  2WCE A;  4A4B A;  1CFD A;  4WRI A;  1RJV A;  4YGB B;  2KNE A;  2SCP A;  1MXE A;  3I5G C;  1QX5 B;  4MLW A;  1OE9 B;  2FCD A;  1RFJ A;  1TNQ A;  3B86 A;  3R1V A;  1BG1 A;  4FQT A;  1B8R A;  1C07 A;  1YVH A;  4R1E A;  1NSH A;  1NX0 A;  4ORC B;  1S3P A;  4M2O A;  5I2Q A;  1JWD A;  1QIW A;  1CB1 A;  3NSL A;  1K93 D;  2KGB C;  3DD4 A;  1SCM B;  1QIV A;  2PVB A;  3CLN A;  1JSA A;  1FBV A;  1YUR A;  3O78 A;  1LIN A;  1TNP A;  1B7T Z;  3BXK A;  3CAB A;  2ZRT A;  5HKY A;  5J3X A;  4P2Y B;  5FYX A;  4HRH A;  5F6T A;  1S6C A;  1REC A;  5KSZ A;  2BBN A;  3OB1 B;  1BT6 A;  1VRK A;  1WDC C;  1N2D A;  1KQM B;  1OMD A;  5HLV A;  2MA2 A;  3K21 A;  1TRF A;  1F4O A;  1FPW A;  4OVN F;  3OP0 A;  4IJ7 A;  1IIO A;  1TUJ A;  2OPO A;  4PDZ A;  1SMG A;  3PM8 A;  2CNP A;  1TN4 A;  2CBL A;  2MRD A;  1QTX A;  1BLQ A;  1X02 A;  3C1V A;  3CWG A;  3JTD C;  3CZ2 A;  4GBA A;  1EJ3 A;  2JUL A;  1IQ5 A;  2KLE A;  2K7C A;  3VRN A;  1S26 D;  3B88 A;  5D7F A;  1EH2 A;  2VRG A;  2K61 A;  2FCE A;  4MRX A;  2KOT A;  1IWQ A;  1CFC A;  4FQO A;  2WC6 A;  5I2L A;  2L50 A;  1WRL A;  1ZOT B;  4OR9 B;  4FTG A;  1MF8 B;  4DS7 A;  3O2P A;  2FJU B;  4YGC B;  1F71 A;  3DXL A;  3DZT A;  3EKJ A;  1J1E A;  3D76 A;  5JOL A;  4KYN A;  4PE0 A;  1GGW A;  1KK7 Y;  1L2O B;  4CFR A;  2KHN A;  1MUX A;  4JPZ B;  1BU3 A;  1QWV A;  3AKB A;  3DVK A;  4WQ2 A;  1C7V A;  1QS7 A;  2JNF A;  3Q8I A;  2LVV A;  4CFQ A;  5B8I B;  4E68 A;  1CDP A;  1CMG A;  1NIW A;  2WCK A;  1ALV A;  3HCM A;  3CGA A;  1LA0 A;  2K7O A;  2CTN A;  2KFH A;  2G9B A;  2JC2 A;  3BJH A;  3EVU A;  5DKN A;  1N0Y A;  4PAL A;  1NCZ A;  3NHI A;  1G8I A;  3S0A A;  3JVT C;  1DEL A;  2O5G A;  4F7F A;  1KSO A;  2QAC A;  3FWB A;  1AVS A;  1K9K A;  3NXA A;  3I5F B;  2WOR A;  3TUY C;  2M49 B;  2M7N A;  4YGA A;  1Z4H A;  1XK4 A;  1YRU B;  1SCV A;  2LAP A;  1S1E A;  2K7B A;  2NZ0 A;  1S5G Z;  2Y4Q A;  3KO0 A;  1W9Z A;  3IQO A;  1MR8 A;  3L47 A;  4F0Z B;  1PSB A;  4GAO A;  4BY5 A;  3VGO A;  1XVJ A;  1NX2 A;  1MXL C;  1DJH A;  2NCO A;  1MQ1 A;  1DGV A;  3DF0 A;  1OZO A;  4MVF A;  5JJG A;  3BUX B;  3FE9 A;  1DMO A;  3SS5 A;  3IF7 A;  3DF0 B;  1AHR A;  1KWO C;  1SR6 C;  1NCY A;  2B1U A;  4USL A;  1XFU O;  1ODB A;  1R6P A;  2ZFD A;  1BJF A;  4UPG A;  4GGF C;  4XJK A;  1NPQ A;  2BBM A;  2F3Y A;  1DJZ A;  2L2E A;  2V53 A;  2LC5 A;  3KPX A;  2ZKM X;  2I2R E;  3S0D A;  1SKT A;  2E6W A;  3FS7 A;  4XJK B;  1J7Q A;  1LVC D;  2K60 A;  3BUW B;  4Q04 A;  1WY9 A;  2KAV A;  1K94 A;  2WC5 A;  1M45 A;  3SIB A;  3SJS A;  2LMT A;  4PHJ A;  2KFF A;  1UHH A;  1JC2 A;  1TNW A;  3D74 A;  2LP3 A;  1Y0V H;  3LK0 A;  3CZ0 A;  1PSR A;  1WRK A;  2F2P A;  5CPV A;  1QLS A;  5CSI A;  5HLO A;  1CM4 A;  3DVJ A;  1WLZ A;  4XYN A;  1LA3 A;  2CXJ A;  1Y1A A;  3WHT B;  2IS9 A;  3NSO A;  2Y1M A;  1RWY A;  2AUC A;  5KU1 A;  1K2H A;  4GFT A;  1QVI Z;  3A4U B;  3IQQ A;  3CR5 X;  1ORG A;  5HKW A;  2ZND A;  4CID A;  2KAY A;  2JTT A;  1F4Q A;  1B9A A;  1OMR A;  3LLE A;  2EHB A;  4M2P A;  4BY4 A;  4IL1 A;  4C0L A;  1FI6 A;  3L4A A;  2ZN9 A;  3L4L A;  3HX4 A;  3PM2 A;  4CPV A;  1QXP A;  1YUS A;  2GGM A;  1YUT A;  3BUN B;  2OS8 B;  4OV2 A;  1KK8 C;  1SSE B;  2JOJ A;  2M3W A;  1H4B A;  1S6J A;  3PN7 B;  3R72 A;  2BKI B;  1OW4 A;  1RRO A;  2F3Z A;  5G08 A;  3EK8 A;  1CNP A;  1E8A A;  3I5I C;  5FI6 A;  2L5Y A;  1F70 A;  4AQI A;  2A4J A;  3OBV A;  1P28 A;  4MZK A;  2KSP A;  1K90 D;  1BMO A;  2H61 C;  2KI6 D;  2MHH A;  1NUB A;  3AAK A;  1CLL A;  1NP8 A;  4N5X A;  4DCK A;  1GGZ A;  3DY9 A;  3UO9 A;  3OGN A;  5D3O A;  2JRF A;  5I94 A;  1OOG A;  3OX5 A;  2KQY A;  2BAP A;  1M39 A;  2BNX A;  1DJX A;  2EC6 C;  3FE8 A;  2AAO A;  3NSK A;  1LXF C;  1YRT B;  5ER5 A;  4I5N B;  2M29 A;  1OZS A;  1UHN A;  2MLF C;  3QRX A;  5AFP A;  2OTG B;  2Q4U A;  3EK4 A;  2BCB A;  3BOW A;  1JF0 A;  2K0J A;  4QJ5 B;  1CDM A;  3TZ1 A;  1AK8 A;  2JTZ A;  1UUR A;  2LE9 B;  3BOW B;  2M7L A;  2WCB A;  3BQ3 A;  3LK1 A;  1B7T Y;  1NWD A;  2KI4 B;  1FW4 A;  2LP2 A;  3CZT X;  2PAL A;  2P71 A;  1M31 A;  2LVJ A;  5K89 A;  1LKJ A;  2BKH B;  1CLM A;  2F33 A;  2JU0 A;  1IRJ A;  1BR1 B;  1PAL A;  1UHK A;  1DTL A;  1K8U A;  3BYA A;  3O4X A;  1H8B A;  4CLN A;  4ORB B;  1UHI A;  2M97 A;  2NLN A;  1BOC A;  2ZNE A;  1OOF A;  1PVA A;  1SYM A;  3PSR A;  1YX7 A;  1OMV A;  1AUI B;  2FJY A;  2PRU A;  3VRO A;  3I5G B;  5IBW A;  1ZMZ A;  2GV5 A;  2MJW B;  3CZ1 A;  1B8L A;  1KFU S;  2Q91 A;  4QJ4 B;  1W7J B;  1NYA A;  2QPT A;  4TNC A;  1B1G A;  1W7I B;  3SG5 A;  3PLF B;  2FOT A;  2MLE C;  3PJI A;  1YR5 A;  2ISD A;  4ORA B;  2WCL A;  1K95 A;  1RTP 1;  1DF0 A;  1NX1 A;  3BFH A;  4HSZ A;  5I2O A;  2TN4 A;  1CFF A;  1PK0 D;  3GK4 X;  3R1O A;  2BL0 C;  2PSR A;  1KFX S;  1OOH A;  1DF0 B;  1XO5 A;  3TDU A;  2QDI A;  1SL9 A;  3R1P A;  1SL8 A;  3TS5 C;  1BF5 A;  3O6B A;  2F2O A;  1TCF A;  3CS1 A;  1A4P A;  4JKT A;  2JXL A;  3NHT A;  3SG6 A;  1WDC B;  1A03 A;  5DKQ A;  1K9P A;  4N1G A;  4M2Q A;  2L51 A;  1QAT A;  3B7A A;  5DIC A;  2F8P A;  2WOS A;  5BPJ A;  4WQ3 A;  4YGE B;  5I8N A;  2LV7 A;  1OSA A;  2KAX A;  3I5H C;  3SG4 A;  3SG7 A;  1WLM A;  2KYF A;  1SCM C;  4MRY A;  2G2B A;  3CR2 A;  2GGZ A;  3JTD B;  2JPO A;  3KF9 A;  3V2L A;  2LLT A;  5PAL A;  1N65 A;  2K7D A;  1TIZ A;  1JBA A;  2BEC A;  3CTN A;  2LHI A;  1TNX A;  2JT8 A;  1CFP A;  3D78 A;  1XFV O;  1C7W A;  3NGV A;  2L4H A;  2CT9 A;  1Q80 A;  1KQM C;  2HF5 A;  1WRZ A;  1DVI A;  1YX8 A;  3ICB A;  3KHE A;  4PCW A;  1UP5 A;  3WXA A; 
#chains in the Genus database with same CATH homology
 3OB2 B;  4I5J A;  3EKH A;  5AAN A;  2I7A A;  1SK6 D;  2Y1N A;  2KBI A;  4GUK A;  1QX7 A;  2M8U A;  1EG3 A;  4AQJ A;  1CDL A;  1DT7 B;  2LUX A;  4ETO A;  2L0P A;  3EK7 A;  4DUQ A;  4C0K A;  4P5O E;  4HRG A;  2H2K A;  1JFK A;  4PHM A;  4YGD B;  1IKU A;  5GQQ C;  3D10 A;  1J7P A;  5AER A;  3JVT B;  3SG3 A;  4AOM A;  1AP4 A;  1UHJ A;  1OOJ A;  2KBM A;  4ICB A;  4JWQ A;  4OCI A;  3TUY B;  3AKA A;  2PMY A;  2M9G A;  4NDB A;  3DVM A;  5CSF A;  1RK9 A;  2HQ8 A;  5HYD A;  1HT9 A;  1QX2 A;  4YRU A;  2LUC A;  1GQM A;  1HQV A;  1L7Z A;  4MBE A;  1SRA A;  1EXR A;  2MAZ A;  5CSN A;  2ZN8 A;  1ALW A;  2WCF A;  2L4I A;  1J7O A;  1UWO A;  1XFY O;  2BE4 A;  5HKZ A;  1J1D A;  3BUM B;  2LM5 A;  2PAS A;  4L9M A;  3E3R A;  4GGN A;  3CR4 X;  3VRQ A;  4C0J A;  2M0R A;  1KWO B;  1SL7 A;  4MZL A;  1SR6 B;  2E30 A;  2LHL A;  3I5H B;  5TNC A;  3ZNI A;  4ZCV A;  3I5F C;  4GGF A;  3NSI A;  4PE1 A;  1FF1 A;  1CM1 A;  2P6B B;  1CMF A;  3WHU B;  4MZJ A;  1QVI Y;  1JUO A;  4ZCU A;  2SAS A;  1CKK A;  1BR4 B;  1DGU A;  1TTX A;  1F54 A;  1KK7 Z;  2O60 A;  1M46 A;  1XK4 C;  4PE7 A;  4DRW A;  2JWW A;  1S6I A;  3RLZ A;  4DIR A;  1CDN A;  2I18 A;  2HET A;  2K2F A;  4D1E A;  1KQV A;  3PAL A;  1SBJ A;  1KFU L;  2JXC A;  2KDH A;  3DVE A;  1DJG A;  1F8H A;  1V1G A;  2LNK A;  3A8R A;  2KQ6 A;  1YTZ C;  2M1U A;  4OKH A;  5AXI A;  2JQ6 A;  4MSP A;  3BUO B;  2JT3 A;  4NDC A;  1F55 A;  1ZAC A;  1JFJ A;  3RM1 A;  3SIA A;  1KFX L;  1UUS A;  1Y1X A;  1QJT A;  5ER4 X;  1XFX O;  1YVL A;  4PHN A;  2JNX A;  1G33 A;  1MWN A;  2EGD A;  3FWC A;  5CSJ A;  2K8M B;  5D69 A;  1B47 A;  1IJ5 A;  2KYC A;  1D1O A;  2KI6 C;  2LMV A;  1XFW O;  1SW8 A;  2I94 A;  4A4C A;  1K96 A;  3EVV A;  4YI8 A;  1Y1U A;  3GOF A;  1CTR A;  4QJ3 B;  2NCP A;  3GK1 A;  1J55 A;  1PVB A;  2JPT A;  3TDZ A;  1KK8 B;  2R2I A;  5KTY A;  1SPY A;  3KEV A;  1QV1 A;  2NXQ A;  3H4S E;  1SY9 A;  1TOP A;  3I5I B;  1QLK A;  4MEW A;  2LLU A;  2H61 A;  3LL8 B;  3MSE B;  1IH0 A;  1MHO A;  2BE6 A;  1A75 A;  1IG5 A;  2BCX A;  1TCO B;  3AAJ A;  3F45 A;  3PAT A;  3TDI A;  2K2A A;  2LLS A;  2WC8 A;  3GK2 A;  3M0W A;  1A75 B;  2L5X B;  4PHK A;  4U8D A;  4YBH B;  4JQ0 D;  1XA5 A;  1XYD A;  2EC6 B;  2D8N A;  2Y5I A;  3FIA A;  3D0Y A;  4N1F A;  1AJ5 A;  3EVR A;  2OS8 C;  2JT0 A;  3VRR A;  1PRW A;  4PE4 A;  1FI5 A;  4HRE E;  3PFV A;  3PN7 C;  3D0Y B;  1DJW A;  1NX3 A;  2LMU A;  1R2U A;  4YI9 A;  1GJY A;  2CCM A;  3SG2 A;  2HPS A;  1DJY A;  2LVK A;  5AEQ A;  4I5K A;  2KGR A;  3ZWH A;  2BCA A;  1ZFS A;  1DJI A;  1S5G Y;  2DOQ A;  3VRP A;  1BOD A;  1QAS A;  1J7R A;  2KFG A;  2RGI A;  5DKR A;  1V1F A;  2AMI A;  1SNL A;  2LAN A;  1U5I A;  1G4Y R;  1S36 A;  1A29 A;  1Y6W A;  2COL B;  1JF2 A;  2JZI A;  2L98 A;  3OX6 A;  1CLB A;  1KCY A;  1U5I B;  1EG4 A;  2OTG C;  1M63 B;  1XFZ O;  2M1K B;  1IQ3 A;  2WND A;  1KSM A;  4MN0 A;  1A2X A;  4NQG A;  3OHM B;  4NDD A;  1OQP A;  1K9U A;  1EL4 A;  4GNK B;  4I5L B;  1B4C A;  1YUU A;  2KI4 C;  2LCP A;  1PUL A;  1AJ4 A;  2LVI A;  2ZRS A;  2BL0 B;  3O4Y A;  3LCP C;  1IGV A;  1L2O C;  4GPL B;  3TS5 B;  1B8C A;  2MBX A;  1IJ6 A;  1ZUZ A;  3WNX B;  1QV0 A;  2HQW A;  1NCX A;  2WCE A;  4A4B A;  1CFD A;  4WRI A;  1RJV A;  4YGB B;  2KNE A;  2SCP A;  1MXE A;  3I5G C;  1QX5 B;  4MLW A;  1OE9 B;  2FCD A;  1RFJ A;  1TNQ A;  1BG1 A;  1B8R A;  1C07 A;  1YVH A;  4R1E A;  1NSH A;  1NX0 A;  4ORC B;  1S3P A;  4M2O A;  5I2Q A;  1JWD A;  1QIW A;  1CB1 A;  3NSL A;  1K93 D;  2KGB C;  3DD4 A;  1SCM B;  1QIV A;  2PVB A;  3CLN A;  1JSA A;  1FBV A;  1YUR A;  3O78 A;  1LIN A;  1TNP A;  1B7T Z;  3BXK A;  2ZRT A;  5HKY A;  5J3X A;  4P2Y B;  5FYX A;  4HRH A;  5F6T A;  1S6C A;  1REC A;  5KSZ A;  2BBN A;  3OB1 B;  1BT6 A;  1VRK A;  1WDC C;  1N2D A;  1KQM B;  1OMD A;  5HLV A;  2MA2 A;  3K21 A;  1TRF A;  1F4O A;  1FPW A;  4OVN F;  3OP0 A;  2OPO A;  4PDZ A;  1SMG A;  3PM8 A;  2CNP A;  1TN4 A;  2CBL A;  2MRD A;  1QTX A;  1BLQ A;  1X02 A;  3C1V A;  3CWG A;  3JTD C;  4GBA A;  1EJ3 A;  2JUL A;  1IQ5 A;  3VRN A;  2K7C A;  1S26 D;  1EH2 A;  5D7F A;  2VRG A;  2K61 A;  2FCE A;  4MRX A;  2KOT A;  1IWQ A;  1CFC A;  4FQO A;  5I2L A;  2L50 A;  1WRL A;  1ZOT B;  4OR9 B;  4FTG A;  1MF8 B;  4DS7 A;  3O2P A;  2FJU B;  4YGC B;  1F71 A;  5JOL A;  1GGW A;  3EKJ A;  1J1E A;  4PE0 A;  1KK7 Y;  1L2O B;  4CFR A;  2KHN A;  1MUX A;  4JPZ B;  1BU3 A;  3AKB A;  3DVK A;  4WQ2 A;  1C7V A;  1QS7 A;  2JNF A;  2LVV A;  4CFQ A;  5B8I B;  4E68 A;  1CDP A;  1CMG A;  1NIW A;  1ALV A;  3HCM A;  3CGA A;  1LA0 A;  2K7O A;  2CTN A;  2KFH A;  2G9B A;  2JC2 A;  3EVU A;  5DKN A;  1N0Y A;  4PAL A;  1NCZ A;  1G8I A;  3JVT C;  2O5G A;  1KSO A;  2QAC A;  3FWB A;  1AVS A;  1K9K A;  3NXA A;  3I5F B;  2WOR A;  3TUY C;  2M49 B;  2M7N A;  4YGA A;  1XK4 A;  1YRU B;  1SCV A;  2LAP A;  1S1E A;  2K7B A;  2NZ0 A;  1S5G Z;  2Y4Q A;  3KO0 A;  3IQO A;  1MR8 A;  4F0Z B;  1PSB A;  4GAO A;  4BY5 A;  3VGO A;  1XVJ A;  1NX2 A;  1MXL C;  1DJH A;  2NCO A;  1MQ1 A;  1DGV A;  3DF0 A;  1OZO A;  4MVF A;  5JJG A;  3BUX B;  1DMO A;  3IF7 A;  3DF0 B;  1AHR A;  1KWO C;  1SR6 C;  1NCY A;  2B1U A;  4USL A;  1XFU O;  1ODB A;  1R6P A;  2ZFD A;  1BJF A;  4UPG A;  4GGF C;  4XJK A;  1NPQ A;  2BBM A;  2F3Y A;  1DJZ A;  2L2E A;  2V53 A;  2LC5 A;  3KPX A;  2ZKM X;  2I2R E;  1SKT A;  2E6W A;  3FS7 A;  4XJK B;  1J7Q A;  1LVC D;  3BUW B;  4Q04 A;  1WY9 A;  2KAV A;  1K94 A;  1M45 A;  3SIB A;  3SJS A;  2LMT A;  4PHJ A;  2KFF A;  1UHH A;  1JC2 A;  1TNW A;  2LP3 A;  1Y0V H;  3LK0 A;  1PSR A;  1WRK A;  2F2P A;  5CPV A;  1QLS A;  5CSI A;  5HLO A;  1CM4 A;  3DVJ A;  1WLZ A;  4XYN A;  1LA3 A;  2CXJ A;  1Y1A A;  3WHT B;  2IS9 A;  3NSO A;  2Y1M A;  1RWY A;  2AUC A;  5KU1 A;  1K2H A;  4GFT A;  1QVI Z;  3A4U B;  3IQQ A;  3CR5 X;  5HKW A;  2ZND A;  4CID A;  2KAY A;  2JTT A;  1F4Q A;  1B9A A;  1OMR A;  3LLE A;  2EHB A;  4M2P A;  4BY4 A;  4IL1 A;  4C0L A;  1FI6 A;  2ZN9 A;  3HX4 A;  4CPV A;  1QXP A;  1YUS A;  2GGM A;  1YUT A;  3BUN B;  2OS8 B;  4OV2 A;  1KK8 C;  2M3W A;  2JOJ A;  1H4B A;  1S6J A;  3PN7 B;  2BKI B;  2F3Z A;  1RRO A;  5G08 A;  3EK8 A;  1CNP A;  1E8A A;  3I5I C;  1F70 A;  4AQI A;  2A4J A;  4MZK A;  2KSP A;  1K90 D;  1BMO A;  2H61 C;  2KI6 D;  2MHH A;  1NUB A;  3AAK A;  1CLL A;  1NP8 A;  4N5X A;  4DCK A;  1GGZ A;  2JRF A;  3OX5 A;  2KQY A;  1M39 A;  1DJX A;  2EC6 C;  2AAO A;  3NSK A;  1LXF C;  1YRT B;  5ER5 A;  4I5N B;  2M29 A;  1OZS A;  1UHN A;  2MLF C;  3QRX A;  5AFP A;  2OTG B;  2Q4U A;  3EK4 A;  2BCB A;  3BOW A;  1JF0 A;  2K0J A;  4QJ5 B;  1CDM A;  3TZ1 A;  1AK8 A;  2JTZ A;  1UUR A;  2LE9 B;  3BOW B;  2M7L A;  2WCB A;  3BQ3 A;  3LK1 A;  1B7T Y;  1NWD A;  2KI4 B;  1FW4 A;  2LP2 A;  3CZT X;  2PAL A;  1M31 A;  2LVJ A;  5K89 A;  1LKJ A;  2BKH B;  1CLM A;  2F33 A;  2JU0 A;  1IRJ A;  1BR1 B;  1PAL A;  1UHK A;  1DTL A;  1K8U A;  3BYA A;  1H8B A;  4CLN A;  4ORB B;  1UHI A;  2M97 A;  2NLN A;  1BOC A;  2ZNE A;  1PVA A;  1SYM A;  3PSR A;  1YX7 A;  1OMV A;  1AUI B;  2PRU A;  3VRO A;  3I5G B;  5IBW A;  1ZMZ A;  2GV5 A;  2MJW B;  1B8L A;  1KFU S;  2Q91 A;  4QJ4 B;  1W7J B;  1NYA A;  2QPT A;  4TNC A;  1B1G A;  1W7I B;  3SG5 A;  3PLF B;  2FOT A;  2MLE C;  1YR5 A;  2ISD A;  4ORA B;  5I2O A;  1K95 A;  1RTP 1;  1DF0 A;  1NX1 A;  4HSZ A;  1CFF A;  2TN4 A;  1PK0 D;  3GK4 X;  2BL0 C;  2PSR A;  1KFX S;  3TDU A;  1DF0 B;  1XO5 A;  1SL9 A;  1SL8 A;  3TS5 C;  1BF5 A;  3O6B A;  2F2O A;  1TCF A;  3CS1 A;  1A4P A;  2JXL A;  3SG6 A;  1WDC B;  1A03 A;  5DKQ A;  1K9P A;  4N1G A;  4M2Q A;  2L51 A;  1QAT A;  2F8P A;  2WOS A;  5BPJ A;  4WQ3 A;  4YGE B;  5I8N A;  2LV7 A;  1OSA A;  2KAX A;  3I5H C;  3SG4 A;  3SG7 A;  1WLM A;  2KYF A;  1SCM C;  4MRY A;  2G2B A;  3CR2 A;  2GGZ A;  3JTD B;  3KF9 A;  2LLT A;  5PAL A;  1N65 A;  2K7D A;  1TIZ A;  1JBA A;  2BEC A;  3CTN A;  2LHI A;  1TNX A;  2JT8 A;  1CFP A;  1XFV O;  1C7W A;  2L4H A;  2CT9 A;  1Q80 A;  1KQM C;  2HF5 A;  1WRZ A;  1DVI A;  1YX8 A;  3ICB A;  3KHE A;  4PCW A;  1UP5 A;  3WXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...