1M39A

Solution structure of the c-terminal fragment (f86-i165) of the human centrin 2 in calcium saturated form
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
FGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C-terminal half of human centrin 2 behaves like a regulatory EF-hand domain
pubmed doi rcsb
molecule keywords Caltractin, isoform 1
molecule tags Cell cycle
source organism Homo sapiens
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1m39A01
2AAOA 1IQ3A 4DUQA 1UHIA 3CR5X 1GGZA 1KWOC 5CPVA 4A4CA 4YGEB 3NSOA 1IRJA 1OE9B 1Y1XA 2L4IA 2OS8C 1IGVA 5F6TA 1WLZA 4JQ0D 1S5GY 3DF0A 3SIAA 3BYAA 2K2FA 4PCWA 4GBAA 2LVJA 2E30A 2LP3A 3KPXA 2NZ0A 3PLFB 2JNXA 3SIBA 4XJKA 1IJ5A 1FW4A 3CLNA 2OTGC 1EG3A 4MRYA 1R6PA 1BJFA 1IG5A 1DJXA 2LMTA 2LMVA 2PRUA 3TS5B 2L2EA 1KFXL 2WNDA 1G8IA 1BR1B 1DGUA 3SG6A 5ER5A 2F2OA 2HPSA 3PALA 2L50A 3VRPA 1ZUZA 3SG4A 1SYMA 2LUCA 1QLKA 1JUOA 3VGOA 1IH0A 1WDCC 4MN0A 4ORCB 2Y1NA 4N1GA 4PHKA 1CLBA 1V1FA 1UWOA 2L4HA 4USLA 1QXPA 2LVKA 1SNLA 1UURA 1TIZA 4R1EA 3VROA 1ZMZA 3O6BA 1TN4A 1W7IB 1Y6WA 2IS9A 2LAPA 1JFKA 1TNPA 3BUMB 2M7NA 1NUBA 1AHRA 2JPTA 3AKAA 2JC2A 1QTXA 1FBVA 2KI4B 2ZRTA 5CSNA 1UHKA 1YVLA 2PMYA 2KAVA 1B8LA 3D0YB 1M31A 3FWCA 3DVKA 3OX6A 3EK8A 3KHEA 2M7LA 3SG7A 3ZNIA 1CDLA 1GQMA 2HQWA 1KSOA 1M46A 1XK4A 2KFHA 4D1EA 3CR4X 1BR4B 1VRKA 4WQ2A 4GPLB 1DTLA 4MEWA 1Q80A 2KSPA 4YGBB 1OOJA 2LV7A 3LL8B 1NCZA 1N65A 5AFPA 4OV2A 4NDBA 3PM8A 2B1UA 1DJGA 1LA0A 2VRGA 3TDUA 2MHHA 3FWBA 1J7OA 1QIVA 3I5HB 2LP2A 1SBJA 1SPYA 4U8DA 2DOQA 1J55A 2I18A 1G4YR 3A4UB 2KGBC 1J7PA 3I5GB 3VRNA 4C0JA 3JTDB 2WC8A 2O60A 2KNEA 1NP8A 2BECA 2QACA 1XVJA 1SCVA 5G08A 1OZSA 4GGFA 4P5OE 5HLOA 1YRUB 4HRGA 1MWNA 1UHJA 3EKHA 4MSPA 2CBLA 1K95A 4CIDA 1SRAA 4C0KA 1SL9A 2BKIB 4MRXA 1MHOA 4GGFC 3BUOB 4OR9B 2HQ8A 3SG2A 3VRQA 1MR8A 5PALA 2PSRA 1H8BA 2K0JA 1JF2A 1K9PA 1XO5A 5I2OA 2CT9A 2WCFA 1YX8A 2CXJA 5CSFA 1SK6D 1TRFA 3D10A 2EC6B 1PVAA 1L2OC 2JOJA 2L0PA 5HKZA 3LLEA 3PFVA 2KI6D 3HX4A 4MVFA 3K21A 3OB1B 1IJ6A 1QLSA 4AQIA 2KDHA 1DF0B 1AJ4A 1CM1A 3BOWB 1S5GZ 1DGVA 1XYDA 2WCBA 1JFJA 2JZIA 3TDIA 2F8PA 1QX2A 2LVIA 1MQ1A 1KQMB 1DJWA 3LK1A 1QASA 2O5GA 4ORAB 3NSKA 3RM1A 1BMOA 2BKHB 4JWQA 5DKNA 1M45A 3TUYC 1QV1A 4YGAA 2MJWB 5HLVA 4DIRA 1CKKA 1B1GA 1H4BA 1QS7A 4N5XA 4PE1A 2KYFA 5K89A 2K7OA 1OMRA 1OQPA 1WRZA 2MAZA 2PVBA 1L2OB 3FS7A 3O2PA 3DVMA 1B8CA 1EH2A 4ICBA 3EVUA 1MF8B 2JULA 5AANA 5TNCA 2NLNA 2BCBA 3PN7C 1UHNA 1S6JA 1KK8C 4C0LA 5KU1A 1QJTA 1PK0D 5AXIA 4AOMA 1RK9A 2ZNEA 1YTZC 4FTGA 4Q04A 2BE6A 5HYDA 4E68A 3D0YA 3KO0A 4DCKA 3IQQA 4PE0A 4TNCA 1DJIA 2BCXA 1F8HA 5HKWA 2M1KB 1KWOB 1RECA 1KCYA 1XFUO 2KAXA 2OS8B 4MZLA 1J1DA 4MBEA 1QX5B 2BL0C 1N2DA 3BUWB 3I5IC 3WXAA 4CPVA 1YUSA 2KGRA 1LINA 1AVSA 5FYXA 3O78A 1S26D 1U5IB 2JQ6A 4I5KA 2OTGB 1CNPA 4PHMA 2LNKA 2ZN8A 1XFWO 3I5FC 3IQOA 5CSJA 1A29A 2KOTA 1SL7A 2NCOA 1A75B 2TN4A 3PN7B 4OVNF 2L98A 4A4BA 1OMVA 3DD4A 2FJUB 1CFPA 1LKJA 1N0YA 2BCAA 2JWWA 3RLZA 2ZNDA 5J3XA 2KQYA 5DKQA 5I2QA 4QJ5B 4GFTA 1ZFSA 4NQGA 3KF9A 1YUTA 1IWQA 1A03A 1JC2A 1WDCB 2K7BA 4YI8A 1TCFA 1S6CA 1DVIA 1WRLA 2F3YA 2LANA 2AUCA 3BUNB 2V53A 3C1VA 4PE4A 1NSHA 1TOPA 1KFUL 4N1FA 1PSBA 2JT8A 1BODA 1C07A 1TNWA 2K7DA 1PVBA 2Y1MA 1DJHA 2K8MB 4L9MA 1LVCD 3NXAA 2F2PA 2KFGA 2M49B 1TCOB 2HETA 2KI6C 1X02A 4AQJA 2PALA 4BY4A 2K2AA 1KFXS 1BOCA 2JNFA 2LE9B 2PASA 5I8NA 2LCPA 2ZN9A 2Q4UA 1NCXA 2BBNA 1XA5A 3EVVA 3ICBA 3GOFA 4FQOA 5D69A 4QJ4B 4HRHA 1CMFA 4HSZA 1AP4A 1K90D 1S36A 2FCEA 1DF0A 2JTTA 3DVJA 2ZKMX 3BOWA 1CDMA 1ALVA 1NX3A 1SKTA 3FIAA 2AMIA 2L5XB 4ORBB 5GQQC 1JSAA 2H61A 3BQ3A 5DKRA 2ISDA 3SG5A 4PE7A 3F45A 3CZTX 2BE4A 1PRWA 2LUXA 1SCMC 3CR2A 1ODBA 1UP5A 1ZACA 1HT9A 1C7WA 1LA3A 1B47A 1S6IA 1XFXO 1EL4A 4JPZB 1UUSA 4MZJA 4YI9A 1JBAA 1YUUA 1QV0A 1NWDA 2SASA 1KSMA 2JTZA 4PALA 1CFFA 3HCMA 2LM5A 2KBIA 1SR6C 2M1UA 4OCIA 4F0ZB 1JWDA 4YGCB 4PDZA 4ZCUA 1OMDA 3O4YA 1FI6A 3JVTC 2LLTA 1RTP1 4HREE 2MA2A 4I5JA 2LMUA 1SMGA 1EXRA 1DJYA 1TTXA 5JJGA 2RGIA 2FCDA 1XFYO 1ALWA 3MSEB 5KTYA 2R2IA 2M97A 1F4OA 3KEVA 1LXFC 5D7FA 1EG4A 4WQ3A 3ZWHA 3NSLA 1CTRA 4IL1A 1BF5A 1BG1A 3TS5C 2NXQA 1FPWA 5I2LA 4M2OA 3WHTB 1DJZA 2K61A 2I2RE 1S1EA 3PSRA 3QRXA 1U5IA 1CLLA 2F33A 1BLQA 1XFZO 2KFFA 2ZRSA 3EVRA 1PULA 3OB2B 4OKHA 5AEQA 1PSRA 2K7CA 3A8RA 1J7RA 2CTNA 1CDPA 3OHMB 4YBHB 1G33A 5IBWA 1DT7B 1A75A 3BXKA 1K96A 2KAYA 1RFJA 3CWGA 1B9AA 3CS1A 3WHUB 3AKBA 3EKJA 3WNXB 1UHHA 4BY5A 1J1EA 2ZFDA 1Y1UA 3E3RA 3M0WA 1J7QA 4I5LB 1FF1A 3TUYB 4YRUA 1SW8A 1SY9A 2KHNA 2JRFA 2MLEC 4XYNA 5CSIA 4I5NB 4M2PA 1NX0A 2GGMA 2KI4C 1KK7Z 2CCMA 1C7VA 5JOLA 1E8AA 5ER4X 1QVIZ 1L7ZA 2QPTA 3LCPC 3GK2A 4GUKA 1WRKA 1K9UA 4NDDA 2P6BB 1YRTB 1WLMA 2SCPA 2EGDA 1NCYA 1CLMA 2KYCA 1IQ5A 2Q91A 4GNKB 2I94A 1KK8B 4P2YB 1K94A 2I7AA 1PALA 2WORA 3DF0B 1FI5A 1KK7Y 2JXLA 2A4JA 1NYAA 4XJKB 1BT6A 1GJYA 1QATA 2Y5IA 1QVIY 1MXEA 1Y1AA 1CMGA 3CGAA 3I5HC 2LLSA 4DRWA 4PHNA 3AAJA 2GV5A 2BL0B 2BBMA 3I5GC 3I5IB 3NSIA 1K9KA 2F3ZA 2NCPA 1K93D 1XK4C 2WOSA 3JTDC 2M9GA 4ZCVA 5HKYA 1TNQA 1F54A 1F55A 4ETOA 4MZKA 1ZOTB 1AJ5A 1S3PA 2KQ6A 2Y4QA 3I5FB 3IF7A 1B4CA 1WY9A 1CM4A 1RJVA 3CTNA 1D1OA 2CNPA 1F4QA 4DS7A 2MLFC 3TDZA 5BPJA 1BU3A 3GK4X 2D8NA 2GGZA 3GK1A 1SL8A 4QJ3B 2LVVA 3VRRA 1RWYA 2M8UA 2H2KA 5KSZA 1NX1A 2G2BA 1XFVO 2EC6C 1YURA 4GGNA 1Y0VH 1HQVA 1MUXA 2M3WA 4YGDB 2LLUA 1A2XA 4PHJA 1CB1A 3H4SE 2M29A 2MBXA 2KBMA 2HF5A 2LHLA 3OP0A 1F71A 1NIWA 1YVHA 1K8UA 1B7TZ 3AAKA 1YR5A 4WRIA 1IKUA 4CFRA 1GGWA 2JXCA 4M2QA 1JF0A 2H61C 2M0RA 1OZOA 2JT0A 1K2HA 3PATA 3BUXB 1CDNA 1KQMC 1OSAA 3LK0A 3OX5A 1AK8A 1R2UA 2E6WA 1AUIB 2WCEA 4NDCA 2JU0A 3SJSA 4CLNA 3DVEA 4GAOA 2FOTA 2LHIA 1MXLC 2G9BA 1F70A 2COLB 3SG3A 1B7TY 2LC5A 1YX7A 3TZ1A 1RROA 1NPQA 2MRDA 1B8RA 1EJ3A 1CFDA 2JT3A 1M63B 1V1GA 1QIWA 5AERA 1KFUS 1KQVA 1W7JB 1SCMB 5B8IB 2OPOA 2EHBA 3EK7A 1A4PA 3EK4A 4CFQA 1M39A 4MLWA 1CFCA 2L51A 1TNXA 1NX2A 1SR6B 4UPGA 1DMOA 1QX7A 3JVTB
chains in the Genus database with same CATH superfamily
2AAOA 1IQ3A 4F7FA 4DUQA 1UHIA 3SS3A 3CR5X 1GGZA 1KWOC 5CPVA 4A4CA 4YGEB 3NSOA 1IRJA 1OE9B 1P28A 1Y1XA 3R1VA 2L4IA 2OS8C 1IGVA 3Q8IA 5F6TA 1WLZA 4JQ0D 1S5GY 3DF0A 3SIAA 3BYAA 2K2FA 4PCWA 1Z2CB 4GBAA 2LVJA 2E30A 2LP3A 3KPXA 2NZ0A 3PLFB 2JNXA 3SIBA 4XJKA 1IJ5A 1FW4A 3CLNA 2OTGC 1EG3A 4MRYA 3K1EA 1R6PA 1BJFA 1IG5A 1DJXA 2LMTA 2LMVA 2PRUA 3TS5B 2L2EA 3DY9A 1KFXL 2WNDA 1G8IA 1BR1B 1DGUA 2WCJA 3SG6A 5ER5A 2F2OA 2HPSA 3PALA 2L50A 4INWA 2KLEA 3EG5B 3VRPA 1ZUZA 3SG4A 1SYMA 2LUCA 1QLKA 1JUOA 3VGOA 1IH0A 1WDCC 4MN0A 4ORCB 2Y1NA 4N1GA 4PHKA 1CLBA 1V1FA 1UWOA 2L4HA 4USLA 1QXPA 2LVKA 1SNLA 1UURA 1TIZA 2WC6A 4R1EA 3VROA 1IIOA 3DXLA 1ZMZA 3O6BA 1TN4A 1W7IB 1Y6WA 2IS9A 2LAPA 2PQLA 1JFKA 1TNPA 3BUMB 1TUZA 1NUBA 2M7NA 1AHRA 2JPTA 3AKAA 2WC5A 2JC2A 1QTXA 1FBVA 2KI4B 2ZRTA 5CSNA 1UHKA 1YVLA 2PMYA 2KAVA 1B8LA 3D0YB 1M31A 3FWCA 3DVKA 3OX6A 3EK8A 3KHEA 2M7LA 3SG7A 3ZNIA 1CDLA 1GQMA 2HQWA 1KSOA 1M46A 1XK4A 2KFHA 4D1EA 3CR4X 1BR4B 1VRKA 4WQ2A 4GPLB 1DTLA 4MEWA 1Q80A 2KSPA 2L2CA 4YGBB 1OOJA 2LV7A 3LL8B 1NCZA 1N65A 5AFPA 3BJHA 4NDBA 3PM8A 4OV2A 2B1UA 1DJGA 1LA0A 2VRGA 2BNXA 3TDUA 2MHHA 3FWBA 3N7HA 1J7OA 1QIVA 3I5HB 5FI7A 3OBVA 2LP2A 1SBJA 1SPYA 4U8DA 2DOQA 1J55A 2I18A 1G4YR 1OOFA 3A4UB 2KGBC 1J7PA 3I5GB 3VRNA 5HL1A 4C0JA 2QEBA 3JTDB 2WC8A 3B88A 1DQEA 2O60A 2KNEA 1NP8A 2BECA 4PT1A 2QACA 1XVJA 3D73A 1SCVA 1DEKA 1OZSA 3D78A 4GGFA 4P5OE 1LS8A 5D3OA 5G08A 5HLOA 1JBAA 1YRUB 4HRGA 1MWNA 1UHJA 3EKHA 4MSPA 2CBLA 1K95A 4CIDA 4JKTA 1SRAA 4C0KA 1SL9A 2BKIB 4MRXA 1MHOA 4GGFC 3BUOB 2FJYA 4OR9B 2HQ8A 5I94A 3SG2A 3VRQA 1MR8A 5PALA 2PSRA 3S0AA 1H8BA 2K0JA 1JF2A 1SSEB 1K9PA 1XO5A 5I2OA 2CT9A 2WCFA 1YX8A 2CXJA 5CSFA 1SK6D 1TRFA 3D10A 2EC6B 1PVAA 1L2OC 2JOJA 2L0PA 5HKZA 3LLEA 3PFVA 2KI6D 3HX4A 3V2LA 4MVFA 3K21A 3OB1B 1IJ6A 1QLSA 4AQIA 2KDHA 1DF0B 1AJ4A 1CM1A 3BOWB 1Z4HA 1S5GZ 1DGVA 1XYDA 2WCBA 1JFJA 2JZIA 3TDIA 2F8PA 1QX2A 3R1OA 2LVIA 2P70A 3FE8A 1MQ1A 1KQMB 1DJWA 3LK1A 1QASA 2O5GA 4ORAB 3NSKA 3RM1A 1BMOA 2BKHB 4JWQA 3L4AA 1M45A 5DKNA 3TUYC 1QV1A 4YGAA 2MJWB 5HLVA 4DIRA 1CKKA 1B1GA 1H4BA 1QS7A 4N5XA 4PE1A 3B7AA 2KYFA 5K89A 2K7OA 1OMRA 1OQPA 1WRZA 2MAZA 2PVBA 1L2OB 3FS7A 3O2PA 3DVMA 1B8CA 1EH2A 4ICBA 3EVUA 1MF8B 2JULA 5AANA 5TNCA 2NLNA 2BCBA 3PN7C 1UHNA 1S6JA 1KK8C 4C0LA 5KU1A 3PM2A 1QJTA 1PK0D 5AXIA 4AOMA 1RK9A 2ZNEA 3D74A 1YTZC 4FTGA 4Q04A 2BE6A 5HYDA 4E68A 3D0YA 3KO0A 4DCKA 3IQQA 4PE0A 4TNCA 1DJIA 2BCXA 1F8HA 2QEOA 5DICA 5HKWA 2M1KB 1KWOB 1RECA 1KCYA 2L5YA 1XFUO 2KAXA 2OS8B 4MZLA 1J1DA 3S0BA 4MBEA 1QX5B 2BL0C 1N2DA 3BUWB 3I5IC 3WXAA 4CPVA 1YUSA 2KGRA 1LINA 1AVSA 5FYXA 3SS4A 3O78A 1S26D 1U5IB 2JQ6A 3CZ2A 4I5KA 2OTGB 1CNPA 4PHMA 2LNKA 2ZN8A 1XFWO 3I5FC 3IQOA 5CSJA 1A29A 2KOTA 1ORGA 1SL7A 1A75B 2NCOA 2TN4A 3PN7B 2L98A 4OVNF 1OMVA 3DD4A 2FJUB 3NHIA 1LKJA 1N0YA 2BCAA 2ERBA 2JWWA 3RLZA 2ZNDA 5J3XA 2KQYA 5DKQA 3CZ0A 4IJ7A 4QJ5B 5I2QA 3CYZA 4GFTA 1ZFSA 4NQGA 3KF9A 1YUTA 1IWQA 1A03A 1JC2A 1WDCB 2K7BA 4YI8A 1TCFA 1S6CA 1DVIA 1WRLA 2F3YA 2LANA 2AUCA 3BUNB 2V53A 3C1VA 4OZDA 1NSHA 4PE4A 1OOHA 1TOPA 1KFUL 4N1FA 1PSBA 2JT8A 1BODA 1C07A 1TNWA 3R72A 2K7DA 3SS5A 1PVBA 2Y1MA 1DJHA 3S0EA 3NGVA 2K8MB 2BAPA 4L9MA 3CABA 1LVCD 3NXAA 2F2PA 2H8VA 2KFGA 2M49B 1TCOB 2HETA 2KI6C 1X02A 4AQJA 2PALA 4BY4A 2K2AA 1KFXS 1BOCA 2JNFA 2LE9B 2PASA 5I8NA 2LCPA 2ZN9A 2Q4UA 1NCXA 2BBNA 1XA5A 3EVVA 3ICBA 3GOFA 4FQOA 5D69A 4QJ4B 4HRHA 1CMFA 4HSZA 1AP4A 1K90D 1S36A 2FCEA 1DF0A 2JTTA 3DVJA 2ZKMX 4KYNA 3BOWA 1CDMA 1ALVA 1NX3A 4INXA 1SKTA 3FIAA 2AMIA 2L5XB 4ORBB 5GQQC 1DC1A 1JSAA 2H61A 3BQ3A 5DKRA 2ISDA 3SG5A 4PE7A 3F45A 3BFAA 3IVTA 2QEVA 3CZTX 2BE4A 1PRWA 5FI6A 2LUXA 1SCMC 3CR2A 1ODBA 1UP5A 1ZACA 1HT9A 1C7WA 1LA3A 1B47A 1S6IA 1XFXO 1EL4A 3D75A 1UUSA 4JPZB 4MZJA 2KPHA 1YUUA 1QV0A 1NWDA 2SASA 1KSMA 2JTZA 4PALA 1CFFA 3BFBA 3BFHA 3HCMA 2LM5A 2KBIA 1SR6C 2M1UA 4OCIA 3S0DA 4F0ZB 1JWDA 4YGCB 4PDZA 4ZCUA 1OMDA 3O4YA 1FI6A 3JVTC 2LLTA 1OOGA 1RTP1 4HREE 2MA2A 4I5JA 2LMUA 1SMGA 1EXRA 1DJYA 1TTXA 5FI2A 5JJGA 2RGIA 2FCDA 1XFYO 1ALWA 2YGUA 1XFRA 3MSEB 5KTYA 2R2IA 2M97A 1F4OA 4FQTA 2QDIA 3KEVA 3FE9A 1LXFC 1GM0A 5D7FA 1EG4A 3O4XA 4WQ3A 3ZWHA 3NSLA 1OW4A 1CTRA 4IL1A 1BF5A 1BG1A 3TS5C 2NXQA 1FPWA 5I2LA 3RZSA 1TWOA 4M2OA 3WHTB 1DJZA 2K61A 2I2RE 1S1EA 3PSRA 3QRXA 1U5IA 2KLDA 1CLLA 2F33A 1BLQA 1XFZO 2KFFA 2ZRSA 3EVRA 1PULA 3OB2B 4OKHA 5AEQA 1PSRA 2K7CA 3A8RA 1J7RA 2CTNA 1CDPA 3OHMB 4YBHB 1G33A 3S0FA 5IBWA 1DT7B 1A75A 3BXKA 1K96A 2KAYA 1RFJA 1DELA 3CWGA 1B9AA 3CS1A 3WHUB 3AKBA 3EKJA 3WNXB 1UHHA 4BY5A 1J1EA 2ZFDA 1Y1UA 3E3RA 1C3ZA 3M0WA 1J7QA 4I5LB 1FF1A 3TUYB 4YRUA 3QMEA 1SW8A 1SY9A 2KHNA 2JRFA 2MLEC 4XYNA 5CSIA 3VB1A 4I5NB 4M2PA 1NX0A 2GGMA 2KI4C 1KK7Z 2CCMA 1C7VA 2PYQA 5JOLA 4A4BA 1E8AA 1CFPA 5ER4X 1QVIZ 1L7ZA 2QPTA 3LCPC 3GK2A 4GUKA 1WRKA 1K9UA 3DYEA 4NDDA 2P6BB 1YRTB 1WLMA 3D76A 2SCPA 2EGDA 1NCYA 3UNWA 1CLMA 2KYCA 1IQ5A 2Q91A 4GNKB 2I94A 1KK8B 4P2YB 1K94A 2I7AA 1PALA 2WORA 3DF0B 1FI5A 1KK7Y 2JXLA 2K60A 2WCHA 5EL2A 2A4JA 1NYAA 4XJKB 1BT6A 1GJYA 1QATA 2Y5IA 1QVIY 1MXEA 1Y1AA 1CMGA 3CGAA 3I5HC 3D77A 3CZ1A 2LLSA 1QWVA 4DRWA 3FE6A 4YI9A 4PHNA 3AAJA 2GV5A 2BL0B 2BBMA 2WCMA 3I5GC 3I5IB 3NSIA 1K9KA 2F3ZA 2NCPA 1K93D 1XK4C 2WOSA 3JTDC 2M9GA 4ZCVA 5HKYA 1TNQA 3UO9A 1F54A 1F55A 4ETOA 4MZKA 1ZOTB 1AJ5A 1S3PA 2KQ6A 2Y4QA 3I5FB 3IF7A 1B4CA 1WY9A 1CM4A 3L4LA 1RJVA 3CTNA 1D1OA 2CNPA 3R1PA 1F4QA 3B86A 4DS7A 2MLFC 3TDZA 5BPJA 1BU3A 3GK4X 2D8NA 2GGZA 4JD9A 3GK1A 1SL8A 4QJ3B 2LVVA 3VRRA 1RWYA 2M8UA 2H2KA 5KSZA 1NX1A 2G2BA 3OGNA 1T14A 2WCLA 1XFVO 2EC6C 1YURA 4GGNA 1Y0VH 1HQVA 1MUXA 2M3WA 4YGDB 2LLUA 1A2XA 4PHJA 1CB1A 3H4SE 2M29A 2MBXA 2KBMA 2HF5A 2LHLA 3OP0A 2QEHA 1F71A 1NIWA 1YVHA 1K8UA 2GTEA 2P71A 1B7TZ 3AAKA 1YR5A 4WRIA 1IKUA 3NHTA 4CFRA 1GGWA 2JXCA 4M2QA 1JF0A 2H61C 2M0RA 1OZOA 2JT0A 3CDNA 1K2HA 3PATA 3BUXB 1CDNA 1KQMC 1OSAA 3LK0A 3OX5A 1AK8A 2WCKA 1R2UA 2E6WA 1AUIB 2WCEA 4NDCA 2JU0A 3SJSA 4CLNA 3DVEA 4GAOA 2FOTA 2LHIA 1MXLC 1OOIX 2G9BA 1F70A 2COLB 3SG3A 1B7TY 2LC5A 1YX7A 3TZ1A 1RROA 1NPQA 1TUJA 1W9ZA 2MRDA 1B8RA 1EJ3A 1CFDA 3L47A 2JT3A 1M63B 1V1GA 3PJIA 1QIWA 5AERA 1KFUS 3S0GA 1W7JB 1SCMB 5B8IB 2OPOA 1KQVA 2JPOA 2EHBA 3EK7A 1A4PA 3EK4A 1C3YA 4CFQA 1M39A 4MLWA 1CFCA 3B87A 2L51A 1TNXA 1NX2A 1SR6B 4UPGA 1DMOA 1QX7A 3B6XA 3DZTA 3JVTB
chains in the Genus database with same CATH topology
2AAOA 1IQ3A 4DUQA 1UHIA 3CR5X 1GGZA 1KWOC 5CPVA 4A4CA 4YGEB 3NSOA 1IRJA 1OE9B 1Y1XA 2L4IA 2OS8C 1IGVA 5F6TA 1WLZA 4JQ0D 1S5GY 3DF0A 3SIAA 3BYAA 2K2FA 4PCWA 4GBAA 2LVJA 2E30A 2LP3A 3KPXA 2NZ0A 3PLFB 2JNXA 3SIBA 4XJKA 1IJ5A 1FW4A 3CLNA 2OTGC 1EG3A 4MRYA 1R6PA 1BJFA 1IG5A 1DJXA 2LMTA 2LMVA 2PRUA 3TS5B 2L2EA 1KFXL 2WNDA 1G8IA 1BR1B 1DGUA 3SG6A 5ER5A 2F2OA 2HPSA 3PALA 2L50A 3VRPA 1ZUZA 3SG4A 1SYMA 2LUCA 1QLKA 1JUOA 3VGOA 1IH0A 1WDCC 4MN0A 4ORCB 2Y1NA 4N1GA 4PHKA 1CLBA 1V1FA 1UWOA 2L4HA 4USLA 1QXPA 2LVKA 1SNLA 1UURA 1TIZA 4R1EA 3VROA 1ZMZA 3O6BA 1TN4A 1W7IB 1Y6WA 2IS9A 2LAPA 1JFKA 1TNPA 3BUMB 2M7NA 1NUBA 1AHRA 2JPTA 3AKAA 2JC2A 1QTXA 1FBVA 2KI4B 2ZRTA 5CSNA 1UHKA 1YVLA 2PMYA 2KAVA 1B8LA 3D0YB 1M31A 3FWCA 3DVKA 3OX6A 3EK8A 3KHEA 2M7LA 3SG7A 3ZNIA 1CDLA 1GQMA 2HQWA 1KSOA 1M46A 1XK4A 2KFHA 4D1EA 3CR4X 1BR4B 1VRKA 4WQ2A 4GPLB 1DTLA 4MEWA 1Q80A 2KSPA 4YGBB 1OOJA 2LV7A 3LL8B 1NCZA 1N65A 5AFPA 4OV2A 4NDBA 3PM8A 2B1UA 1DJGA 1LA0A 2VRGA 3TDUA 2MHHA 3FWBA 1J7OA 1QIVA 3I5HB 2LP2A 1SBJA 1SPYA 4U8DA 2DOQA 1J55A 2I18A 1G4YR 3A4UB 2KGBC 1J7PA 3I5GB 3VRNA 4C0JA 3JTDB 2WC8A 2O60A 2KNEA 1NP8A 2BECA 2QACA 1XVJA 1SCVA 5G08A 1OZSA 4GGFA 4P5OE 5HLOA 1YRUB 4HRGA 1MWNA 1UHJA 3EKHA 4MSPA 2CBLA 1K95A 4CIDA 1SRAA 4C0KA 1SL9A 2BKIB 4MRXA 1MHOA 4GGFC 3BUOB 4OR9B 2HQ8A 3SG2A 3VRQA 1MR8A 5PALA 2PSRA 1H8BA 2K0JA 1JF2A 1K9PA 1XO5A 5I2OA 2CT9A 2WCFA 1YX8A 2CXJA 5CSFA 1SK6D 1TRFA 3D10A 2EC6B 1PVAA 1L2OC 2JOJA 2L0PA 5HKZA 3LLEA 3PFVA 2KI6D 3HX4A 4MVFA 3K21A 3OB1B 1IJ6A 1QLSA 4AQIA 2KDHA 1DF0B 1AJ4A 1CM1A 3BOWB 1S5GZ 1DGVA 1XYDA 2WCBA 1JFJA 2JZIA 3TDIA 2F8PA 1QX2A 2LVIA 1MQ1A 1KQMB 1DJWA 3LK1A 1QASA 2O5GA 4ORAB 3NSKA 3RM1A 1BMOA 2BKHB 4JWQA 5DKNA 1M45A 3TUYC 1QV1A 4YGAA 2MJWB 5HLVA 4DIRA 1CKKA 1B1GA 1H4BA 1QS7A 4N5XA 4PE1A 2KYFA 5K89A 2K7OA 1OMRA 1OQPA 1WRZA 2MAZA 2PVBA 1L2OB 3FS7A 3O2PA 3DVMA 1B8CA 1EH2A 4ICBA 3EVUA 1MF8B 2JULA 5AANA 5TNCA 2NLNA 2BCBA 3PN7C 1UHNA 1S6JA 1KK8C 4C0LA 5KU1A 1QJTA 1PK0D 5AXIA 4AOMA 1RK9A 2ZNEA 1YTZC 4FTGA 4Q04A 2BE6A 5HYDA 4E68A 3D0YA 3KO0A 4DCKA 3IQQA 4PE0A 4TNCA 1DJIA 2BCXA 1F8HA 5HKWA 2M1KB 1KWOB 1RECA 1KCYA 1XFUO 2KAXA 2OS8B 4MZLA 1J1DA 4MBEA 1QX5B 2BL0C 1N2DA 3BUWB 3I5IC 3WXAA 4CPVA 1YUSA 2KGRA 1LINA 1AVSA 5FYXA 3O78A 1S26D 1U5IB 2JQ6A 4I5KA 2OTGB 1CNPA 4PHMA 2LNKA 2ZN8A 1XFWO 3I5FC 3IQOA 5CSJA 1A29A 2KOTA 1SL7A 2NCOA 1A75B 2TN4A 3PN7B 4OVNF 2L98A 4A4BA 1OMVA 3DD4A 2FJUB 1CFPA 1LKJA 1N0YA 2BCAA 2JWWA 3RLZA 2ZNDA 5J3XA 2KQYA 5DKQA 5I2QA 4QJ5B 4GFTA 1ZFSA 4NQGA 3KF9A 1YUTA 1IWQA 1A03A 1JC2A 1WDCB 2K7BA 4YI8A 1TCFA 1S6CA 1DVIA 1WRLA 2F3YA 2LANA 2AUCA 3BUNB 2V53A 3C1VA 4PE4A 1NSHA 1TOPA 1KFUL 4N1FA 1PSBA 2JT8A 1BODA 1C07A 1TNWA 2K7DA 1PVBA 2Y1MA 1DJHA 2K8MB 4L9MA 1LVCD 3NXAA 2F2PA 2KFGA 2M49B 1TCOB 2HETA 2KI6C 1X02A 4AQJA 2PALA 4BY4A 2K2AA 1KFXS 1BOCA 2JNFA 2LE9B 2PASA 5I8NA 2LCPA 2ZN9A 2Q4UA 1NCXA 2BBNA 1XA5A 3EVVA 3ICBA 3GOFA 4FQOA 5D69A 4QJ4B 4HRHA 1CMFA 4HSZA 1AP4A 1K90D 1S36A 2FCEA 1DF0A 2JTTA 3DVJA 2ZKMX 3BOWA 1CDMA 1ALVA 1NX3A 1SKTA 3FIAA 2AMIA 2L5XB 4ORBB 5GQQC 1JSAA 2H61A 3BQ3A 5DKRA 2ISDA 3SG5A 4PE7A 3F45A 3CZTX 2BE4A 1PRWA 2LUXA 1SCMC 3CR2A 1ODBA 1UP5A 1ZACA 1HT9A 1C7WA 1LA3A 1B47A 1S6IA 1XFXO 1EL4A 4JPZB 1UUSA 4MZJA 4YI9A 1JBAA 1YUUA 1QV0A 1NWDA 2SASA 1KSMA 2JTZA 4PALA 1CFFA 3HCMA 2LM5A 2KBIA 1SR6C 2M1UA 4OCIA 4F0ZB 1JWDA 4YGCB 4PDZA 4ZCUA 1OMDA 3O4YA 1FI6A 3JVTC 2LLTA 1RTP1 4HREE 2MA2A 4I5JA 2LMUA 1SMGA 1EXRA 1DJYA 1TTXA 5JJGA 2RGIA 2FCDA 1XFYO 1ALWA 3MSEB 5KTYA 2R2IA 2M97A 1F4OA 3KEVA 1LXFC 5D7FA 1EG4A 4WQ3A 3ZWHA 3NSLA 1CTRA 4IL1A 1BF5A 1BG1A 3TS5C 2NXQA 1FPWA 5I2LA 4M2OA 3WHTB 1DJZA 2K61A 2I2RE 1S1EA 3PSRA 3QRXA 1U5IA 1CLLA 2F33A 1BLQA 1XFZO 2KFFA 2ZRSA 3EVRA 1PULA 3OB2B 4OKHA 5AEQA 1PSRA 2K7CA 3A8RA 1J7RA 2CTNA 1CDPA 3OHMB 4YBHB 1G33A 5IBWA 1DT7B 1A75A 3BXKA 1K96A 2KAYA 1RFJA 3CWGA 1B9AA 3CS1A 3WHUB 3AKBA 3EKJA 3WNXB 1UHHA 4BY5A 1J1EA 2ZFDA 1Y1UA 3E3RA 3M0WA 1J7QA 4I5LB 1FF1A 3TUYB 4YRUA 1SW8A 1SY9A 2KHNA 2JRFA 2MLEC 4XYNA 5CSIA 4I5NB 4M2PA 1NX0A 2GGMA 2KI4C 1KK7Z 2CCMA 1C7VA 5JOLA 1E8AA 5ER4X 1QVIZ 1L7ZA 2QPTA 3LCPC 3GK2A 4GUKA 1WRKA 1K9UA 4NDDA 2P6BB 1YRTB 1WLMA 2SCPA 2EGDA 1NCYA 1CLMA 2KYCA 1IQ5A 2Q91A 4GNKB 2I94A 1KK8B 4P2YB 1K94A 2I7AA 1PALA 2WORA 3DF0B 1FI5A 1KK7Y 2JXLA 2A4JA 1NYAA 4XJKB 1BT6A 1GJYA 1QATA 2Y5IA 1QVIY 1MXEA 1Y1AA 1CMGA 3CGAA 3I5HC 2LLSA 4DRWA 4PHNA 3AAJA 2GV5A 2BL0B 2BBMA 3I5GC 3I5IB 3NSIA 1K9KA 2F3ZA 2NCPA 1K93D 1XK4C 2WOSA 3JTDC 2M9GA 4ZCVA 5HKYA 1TNQA 1F54A 1F55A 4ETOA 4MZKA 1ZOTB 1AJ5A 1S3PA 2KQ6A 2Y4QA 3I5FB 3IF7A 1B4CA 1WY9A 1CM4A 1RJVA 3CTNA 1D1OA 2CNPA 1F4QA 4DS7A 2MLFC 3TDZA 5BPJA 1BU3A 3GK4X 2D8NA 2GGZA 3GK1A 1SL8A 4QJ3B 2LVVA 3VRRA 1RWYA 2M8UA 2H2KA 5KSZA 1NX1A 2G2BA 1XFVO 2EC6C 1YURA 4GGNA 1Y0VH 1HQVA 1MUXA 2M3WA 4YGDB 2LLUA 1A2XA 4PHJA 1CB1A 3H4SE 2M29A 2MBXA 2KBMA 2HF5A 2LHLA 3OP0A 1F71A 1NIWA 1YVHA 1K8UA 1B7TZ 3AAKA 1YR5A 4WRIA 1IKUA 4CFRA 1GGWA 2JXCA 4M2QA 1JF0A 2H61C 2M0RA 1OZOA 2JT0A 1K2HA 3PATA 3BUXB 1CDNA 1KQMC 1OSAA 3LK0A 3OX5A 1AK8A 1R2UA 2E6WA 1AUIB 2WCEA 4NDCA 2JU0A 3SJSA 4CLNA 3DVEA 4GAOA 2FOTA 2LHIA 1MXLC 2G9BA 1F70A 2COLB 3SG3A 1B7TY 2LC5A 1YX7A 3TZ1A 1RROA 1NPQA 2MRDA 1B8RA 1EJ3A 1CFDA 2JT3A 1M63B 1V1GA 1QIWA 5AERA 1KFUS 1KQVA 1W7JB 1SCMB 5B8IB 2OPOA 2EHBA 3EK7A 1A4PA 3EK4A 4CFQA 1M39A 4MLWA 1CFCA 2L51A 1TNXA 1NX2A 1SR6B 4UPGA 1DMOA 1QX7A 3JVTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAO A;  1IQ3 A;  4DUQ A;  1UHI A;  3CR5 X;  1GGZ A;  1KWO C;  5CPV A;  4A4C A;  4YGE B;  3NSO A;  1IRJ A;  1OE9 B;  1Y1X A;  2L4I A;  2OS8 C;  1IGV A;  5F6T A;  1WLZ A;  4JQ0 D;  1S5G Y;  3DF0 A;  3SIA A;  3BYA A;  2K2F A;  4PCW A;  4GBA A;  2LVJ A;  2E30 A;  2LP3 A;  3KPX A;  2NZ0 A;  3PLF B;  2JNX A;  3SIB A;  4XJK A;  1IJ5 A;  1FW4 A;  3CLN A;  2OTG C;  1EG3 A;  4MRY A;  1R6P A;  1BJF A;  1IG5 A;  1DJX A;  2LMT A;  2LMV A;  2PRU A;  3TS5 B;  2L2E A;  1KFX L;  2WND A;  1G8I A;  1BR1 B;  1DGU A;  3SG6 A;  5ER5 A;  2F2O A;  2HPS A;  3PAL A;  2L50 A;  3VRP A;  1ZUZ A;  3SG4 A;  1SYM A;  2LUC A;  1QLK A;  1JUO A;  3VGO A;  1IH0 A;  1WDC C;  4MN0 A;  4ORC B;  2Y1N A;  4N1G A;  4PHK A;  1CLB A;  1V1F A;  1UWO A;  2L4H A;  4USL A;  1QXP A;  2LVK A;  1SNL A;  1UUR A;  1TIZ A;  4R1E A;  3VRO A;  1ZMZ A;  3O6B A;  1TN4 A;  1W7I B;  1Y6W A;  2IS9 A;  2LAP A;  1JFK A;  1TNP A;  3BUM B;  2M7N A;  1NUB A;  1AHR A;  2JPT A;  3AKA A;  2JC2 A;  1QTX A;  1FBV A;  2KI4 B;  2ZRT A;  5CSN A;  1UHK A;  1YVL A;  2PMY A;  2KAV A;  1B8L A;  3D0Y B;  1M31 A;  3FWC A;  3DVK A;  3OX6 A;  3EK8 A;  3KHE A;  2M7L A;  3SG7 A;  3ZNI A;  1CDL A;  1GQM A;  2HQW A;  1KSO A;  1M46 A;  1XK4 A;  2KFH A;  4D1E A;  3CR4 X;  1BR4 B;  1VRK A;  4WQ2 A;  4GPL B;  1DTL A;  4MEW A;  1Q80 A;  2KSP A;  4YGB B;  1OOJ A;  2LV7 A;  3LL8 B;  1NCZ A;  1N65 A;  5AFP A;  4OV2 A;  4NDB A;  3PM8 A;  2B1U A;  1DJG A;  1LA0 A;  2VRG A;  3TDU A;  2MHH A;  3FWB A;  1J7O A;  1QIV A;  3I5H B;  2LP2 A;  1SBJ A;  1SPY A;  4U8D A;  2DOQ A;  1J55 A;  2I18 A;  1G4Y R;  3A4U B;  2KGB C;  1J7P A;  3I5G B;  3VRN A;  4C0J A;  3JTD B;  2WC8 A;  2O60 A;  2KNE A;  1NP8 A;  2BEC A;  2QAC A;  1XVJ A;  1SCV A;  5G08 A;  1OZS A;  4GGF A;  4P5O E;  5HLO A;  1YRU B;  4HRG A;  1MWN A;  1UHJ A;  3EKH A;  4MSP A;  2CBL A;  1K95 A;  4CID A;  1SRA A;  4C0K A;  1SL9 A;  2BKI B;  4MRX A;  1MHO A;  4GGF C;  3BUO B;  4OR9 B;  2HQ8 A;  3SG2 A;  3VRQ A;  1MR8 A;  5PAL A;  2PSR A;  1H8B A;  2K0J A;  1JF2 A;  1K9P A;  1XO5 A;  5I2O A;  2CT9 A;  2WCF A;  1YX8 A;  2CXJ A;  5CSF A;  1SK6 D;  1TRF A;  3D10 A;  2EC6 B;  1PVA A;  1L2O C;  2JOJ A;  2L0P A;  5HKZ A;  3LLE A;  3PFV A;  2KI6 D;  3HX4 A;  4MVF A;  3K21 A;  3OB1 B;  1IJ6 A;  1QLS A;  4AQI A;  2KDH A;  1DF0 B;  1AJ4 A;  1CM1 A;  3BOW B;  1S5G Z;  1DGV A;  1XYD A;  2WCB A;  1JFJ A;  2JZI A;  3TDI A;  2F8P A;  1QX2 A;  2LVI A;  1MQ1 A;  1KQM B;  1DJW A;  3LK1 A;  1QAS A;  2O5G A;  4ORA B;  3NSK A;  3RM1 A;  1BMO A;  2BKH B;  4JWQ A;  5DKN A;  1M45 A;  3TUY C;  1QV1 A;  4YGA A;  2MJW B;  5HLV A;  4DIR A;  1CKK A;  1B1G A;  1H4B A;  1QS7 A;  4N5X A;  4PE1 A;  2KYF A;  5K89 A;  2K7O A;  1OMR A;  1OQP A;  1WRZ A;  2MAZ A;  2PVB A;  1L2O B;  3FS7 A;  3O2P A;  3DVM A;  1B8C A;  1EH2 A;  4ICB A;  3EVU A;  1MF8 B;  2JUL A;  5AAN A;  5TNC A;  2NLN A;  2BCB A;  3PN7 C;  1UHN A;  1S6J A;  1KK8 C;  4C0L A;  5KU1 A;  1QJT A;  1PK0 D;  5AXI A;  4AOM A;  1RK9 A;  2ZNE A;  1YTZ C;  4FTG A;  4Q04 A;  2BE6 A;  5HYD A;  4E68 A;  3D0Y A;  3KO0 A;  4DCK A;  3IQQ A;  4PE0 A;  4TNC A;  1DJI A;  2BCX A;  1F8H A;  5HKW A;  2M1K B;  1KWO B;  1REC A;  1KCY A;  1XFU O;  2KAX A;  2OS8 B;  4MZL A;  1J1D A;  4MBE A;  1QX5 B;  2BL0 C;  1N2D A;  3BUW B;  3I5I C;  3WXA A;  4CPV A;  1YUS A;  2KGR A;  1LIN A;  1AVS A;  5FYX A;  3O78 A;  1S26 D;  1U5I B;  2JQ6 A;  4I5K A;  2OTG B;  1CNP A;  4PHM A;  2LNK A;  2ZN8 A;  1XFW O;  3I5F C;  3IQO A;  5CSJ A;  1A29 A;  2KOT A;  1SL7 A;  2NCO A;  1A75 B;  2TN4 A;  3PN7 B;  4OVN F;  2L98 A;  4A4B A;  1OMV A;  3DD4 A;  2FJU B;  1CFP A;  1LKJ A;  1N0Y A;  2BCA A;  2JWW A;  3RLZ A;  2ZND A;  5J3X A;  2KQY A;  5DKQ A;  5I2Q A;  4QJ5 B;  4GFT A;  1ZFS A;  4NQG A;  3KF9 A;  1YUT A;  1IWQ A;  1A03 A;  1JC2 A;  1WDC B;  2K7B A;  4YI8 A;  1TCF A;  1S6C A;  1DVI A;  1WRL A;  2F3Y A;  2LAN A;  2AUC A;  3BUN B;  2V53 A;  3C1V A;  4PE4 A;  1NSH A;  1TOP A;  1KFU L;  4N1F A;  1PSB A;  2JT8 A;  1BOD A;  1C07 A;  1TNW A;  2K7D A;  1PVB A;  2Y1M A;  1DJH A;  2K8M B;  4L9M A;  1LVC D;  3NXA A;  2F2P A;  2KFG A;  2M49 B;  1TCO B;  2HET A;  2KI6 C;  1X02 A;  4AQJ A;  2PAL A;  4BY4 A;  2K2A A;  1KFX S;  1BOC A;  2JNF A;  2LE9 B;  2PAS A;  5I8N A;  2LCP A;  2ZN9 A;  2Q4U A;  1NCX A;  2BBN A;  1XA5 A;  3EVV A;  3ICB A;  3GOF A;  4FQO A;  5D69 A;  4QJ4 B;  4HRH A;  1CMF A;  4HSZ A;  1AP4 A;  1K90 D;  1S36 A;  2FCE A;  1DF0 A;  2JTT A;  3DVJ A;  2ZKM X;  3BOW A;  1CDM A;  1ALV A;  1NX3 A;  1SKT A;  3FIA A;  2AMI A;  2L5X B;  4ORB B;  5GQQ C;  1JSA A;  2H61 A;  3BQ3 A;  5DKR A;  2ISD A;  3SG5 A;  4PE7 A;  3F45 A;  3CZT X;  2BE4 A;  1PRW A;  2LUX A;  1SCM C;  3CR2 A;  1ODB A;  1UP5 A;  1ZAC A;  1HT9 A;  1C7W A;  1LA3 A;  1B47 A;  1S6I A;  1XFX O;  1EL4 A;  4JPZ B;  1UUS A;  4MZJ A;  4YI9 A;  1JBA A;  1YUU A;  1QV0 A;  1NWD A;  2SAS A;  1KSM A;  2JTZ A;  4PAL A;  1CFF A;  3HCM A;  2LM5 A;  2KBI A;  1SR6 C;  2M1U A;  4OCI A;  4F0Z B;  1JWD A;  4YGC B;  4PDZ A;  4ZCU A;  1OMD A;  3O4Y A;  1FI6 A;  3JVT C;  2LLT A;  1RTP 1;  4HRE E;  2MA2 A;  4I5J A;  2LMU A;  1SMG A;  1EXR A;  1DJY A;  1TTX A;  5JJG A;  2RGI A;  2FCD A;  1XFY O;  1ALW A;  3MSE B;  5KTY A;  2R2I A;  2M97 A;  1F4O A;  3KEV A;  1LXF C;  5D7F A;  1EG4 A;  4WQ3 A;  3ZWH A;  3NSL A;  1CTR A;  4IL1 A;  1BF5 A;  1BG1 A;  3TS5 C;  2NXQ A;  1FPW A;  5I2L A;  4M2O A;  3WHT B;  1DJZ A;  2K61 A;  2I2R E;  1S1E A;  3PSR A;  3QRX A;  1U5I A;  1CLL A;  2F33 A;  1BLQ A;  1XFZ O;  2KFF A;  2ZRS A;  3EVR A;  1PUL A;  3OB2 B;  4OKH A;  5AEQ A;  1PSR A;  2K7C A;  3A8R A;  1J7R A;  2CTN A;  1CDP A;  3OHM B;  4YBH B;  1G33 A;  5IBW A;  1DT7 B;  1A75 A;  3BXK A;  1K96 A;  2KAY A;  1RFJ A;  3CWG A;  1B9A A;  3CS1 A;  3WHU B;  3AKB A;  3EKJ A;  3WNX B;  1UHH A;  4BY5 A;  1J1E A;  2ZFD A;  1Y1U A;  3E3R A;  3M0W A;  1J7Q A;  4I5L B;  1FF1 A;  3TUY B;  4YRU A;  1SW8 A;  1SY9 A;  2KHN A;  2JRF A;  2MLE C;  4XYN A;  5CSI A;  4I5N B;  4M2P A;  1NX0 A;  2GGM A;  2KI4 C;  1KK7 Z;  2CCM A;  1C7V A;  5JOL A;  1E8A A;  5ER4 X;  1QVI Z;  1L7Z A;  2QPT A;  3LCP C;  3GK2 A;  4GUK A;  1WRK A;  1K9U A;  4NDD A;  2P6B B;  1YRT B;  1WLM A;  2SCP A;  2EGD A;  1NCY A;  1CLM A;  2KYC A;  1IQ5 A;  2Q91 A;  4GNK B;  2I94 A;  1KK8 B;  4P2Y B;  1K94 A;  2I7A A;  1PAL A;  2WOR A;  3DF0 B;  1FI5 A;  1KK7 Y;  2JXL A;  2A4J A;  1NYA A;  4XJK B;  1BT6 A;  1GJY A;  1QAT A;  2Y5I A;  1QVI Y;  1MXE A;  1Y1A A;  1CMG A;  3CGA A;  3I5H C;  2LLS A;  4DRW A;  4PHN A;  3AAJ A;  2GV5 A;  2BL0 B;  2BBM A;  3I5G C;  3I5I B;  3NSI A;  1K9K A;  2F3Z A;  2NCP A;  1K93 D;  1XK4 C;  2WOS A;  3JTD C;  2M9G A;  4ZCV A;  5HKY A;  1TNQ A;  1F54 A;  1F55 A;  4ETO A;  4MZK A;  1ZOT B;  1AJ5 A;  1S3P A;  2KQ6 A;  2Y4Q A;  3I5F B;  3IF7 A;  1B4C A;  1WY9 A;  1CM4 A;  1RJV A;  3CTN A;  1D1O A;  2CNP A;  1F4Q A;  4DS7 A;  2MLF C;  3TDZ A;  5BPJ A;  1BU3 A;  3GK4 X;  2D8N A;  2GGZ A;  3GK1 A;  1SL8 A;  4QJ3 B;  2LVV A;  3VRR A;  1RWY A;  2M8U A;  2H2K A;  5KSZ A;  1NX1 A;  2G2B A;  1XFV O;  2EC6 C;  1YUR A;  4GGN A;  1Y0V H;  1HQV A;  1MUX A;  2M3W A;  4YGD B;  2LLU A;  1A2X A;  4PHJ A;  1CB1 A;  3H4S E;  2M29 A;  2MBX A;  2KBM A;  2HF5 A;  2LHL A;  3OP0 A;  1F71 A;  1NIW A;  1YVH A;  1K8U A;  1B7T Z;  3AAK A;  1YR5 A;  4WRI A;  1IKU A;  4CFR A;  1GGW A;  2JXC A;  4M2Q A;  1JF0 A;  2H61 C;  2M0R A;  1OZO A;  2JT0 A;  1K2H A;  3PAT A;  3BUX B;  1CDN A;  1KQM C;  1OSA A;  3LK0 A;  3OX5 A;  1AK8 A;  1R2U A;  2E6W A;  1AUI B;  2WCE A;  4NDC A;  2JU0 A;  3SJS A;  4CLN A;  3DVE A;  4GAO A;  2FOT A;  2LHI A;  1MXL C;  2G9B A;  1F70 A;  2COL B;  3SG3 A;  1B7T Y;  2LC5 A;  1YX7 A;  3TZ1 A;  1RRO A;  1NPQ A;  2MRD A;  1B8R A;  1EJ3 A;  1CFD A;  2JT3 A;  1M63 B;  1V1G A;  1QIW A;  5AER A;  1KFU S;  1KQV A;  1W7J B;  1SCM B;  5B8I B;  2OPO A;  2EHB A;  3EK7 A;  1A4P A;  3EK4 A;  4CFQ A;  1M39 A;  4MLW A;  1CFC A;  2L51 A;  1TNX A;  1NX2 A;  1SR6 B;  4UPG A;  1DMO A;  1QX7 A;  3JVT B; 
#chains in the Genus database with same CATH topology
 2AAO A;  1IQ3 A;  4F7F A;  4DUQ A;  1UHI A;  3SS3 A;  3CR5 X;  1GGZ A;  1KWO C;  5CPV A;  4A4C A;  4YGE B;  3NSO A;  1IRJ A;  1OE9 B;  1P28 A;  1Y1X A;  3R1V A;  2L4I A;  2OS8 C;  1IGV A;  3Q8I A;  5F6T A;  1WLZ A;  4JQ0 D;  1S5G Y;  3DF0 A;  3SIA A;  3BYA A;  2K2F A;  4PCW A;  1Z2C B;  4GBA A;  2LVJ A;  2E30 A;  2LP3 A;  3KPX A;  2NZ0 A;  3PLF B;  2JNX A;  3SIB A;  4XJK A;  1IJ5 A;  1FW4 A;  3CLN A;  2OTG C;  1EG3 A;  4MRY A;  3K1E A;  1R6P A;  1BJF A;  1IG5 A;  1DJX A;  2LMT A;  2LMV A;  2PRU A;  3TS5 B;  2L2E A;  3DY9 A;  1KFX L;  2WND A;  1G8I A;  1BR1 B;  1DGU A;  2WCJ A;  3SG6 A;  5ER5 A;  2F2O A;  2HPS A;  3PAL A;  2L50 A;  4INW A;  2KLE A;  3EG5 B;  3VRP A;  1ZUZ A;  3SG4 A;  1SYM A;  2LUC A;  1QLK A;  1JUO A;  3VGO A;  1IH0 A;  1WDC C;  4MN0 A;  4ORC B;  2Y1N A;  4N1G A;  4PHK A;  1CLB A;  1V1F A;  1UWO A;  2L4H A;  4USL A;  1QXP A;  2LVK A;  1SNL A;  1UUR A;  1TIZ A;  2WC6 A;  4R1E A;  3VRO A;  1IIO A;  3DXL A;  1ZMZ A;  3O6B A;  1TN4 A;  1W7I B;  1Y6W A;  2IS9 A;  2LAP A;  2PQL A;  1JFK A;  1TNP A;  3BUM B;  1TUZ A;  1NUB A;  2M7N A;  1AHR A;  2JPT A;  3AKA A;  2WC5 A;  2JC2 A;  1QTX A;  1FBV A;  2KI4 B;  2ZRT A;  5CSN A;  1UHK A;  1YVL A;  2PMY A;  2KAV A;  1B8L A;  3D0Y B;  1M31 A;  3FWC A;  3DVK A;  3OX6 A;  3EK8 A;  3KHE A;  2M7L A;  3SG7 A;  3ZNI A;  1CDL A;  1GQM A;  2HQW A;  1KSO A;  1M46 A;  1XK4 A;  2KFH A;  4D1E A;  3CR4 X;  1BR4 B;  1VRK A;  4WQ2 A;  4GPL B;  1DTL A;  4MEW A;  1Q80 A;  2KSP A;  2L2C A;  4YGB B;  1OOJ A;  2LV7 A;  3LL8 B;  1NCZ A;  1N65 A;  5AFP A;  3BJH A;  4NDB A;  3PM8 A;  4OV2 A;  2B1U A;  1DJG A;  1LA0 A;  2VRG A;  2BNX A;  3TDU A;  2MHH A;  3FWB A;  3N7H A;  1J7O A;  1QIV A;  3I5H B;  5FI7 A;  3OBV A;  2LP2 A;  1SBJ A;  1SPY A;  4U8D A;  2DOQ A;  1J55 A;  2I18 A;  1G4Y R;  1OOF A;  3A4U B;  2KGB C;  1J7P A;  3I5G B;  3VRN A;  5HL1 A;  4C0J A;  2QEB A;  3JTD B;  2WC8 A;  3B88 A;  1DQE A;  2O60 A;  2KNE A;  1NP8 A;  2BEC A;  4PT1 A;  2QAC A;  1XVJ A;  3D73 A;  1SCV A;  1DEK A;  1OZS A;  3D78 A;  4GGF A;  4P5O E;  1LS8 A;  5D3O A;  5G08 A;  5HLO A;  1JBA A;  1YRU B;  4HRG A;  1MWN A;  1UHJ A;  3EKH A;  4MSP A;  2CBL A;  1K95 A;  4CID A;  4JKT A;  1SRA A;  4C0K A;  1SL9 A;  2BKI B;  4MRX A;  1MHO A;  4GGF C;  3BUO B;  2FJY A;  4OR9 B;  2HQ8 A;  5I94 A;  3SG2 A;  3VRQ A;  1MR8 A;  5PAL A;  2PSR A;  3S0A A;  1H8B A;  2K0J A;  1JF2 A;  1SSE B;  1K9P A;  1XO5 A;  5I2O A;  2CT9 A;  2WCF A;  1YX8 A;  2CXJ A;  5CSF A;  1SK6 D;  1TRF A;  3D10 A;  2EC6 B;  1PVA A;  1L2O C;  2JOJ A;  2L0P A;  5HKZ A;  3LLE A;  3PFV A;  2KI6 D;  3HX4 A;  3V2L A;  4MVF A;  3K21 A;  3OB1 B;  1IJ6 A;  1QLS A;  4AQI A;  2KDH A;  1DF0 B;  1AJ4 A;  1CM1 A;  3BOW B;  1Z4H A;  1S5G Z;  1DGV A;  1XYD A;  2WCB A;  1JFJ A;  2JZI A;  3TDI A;  2F8P A;  1QX2 A;  3R1O A;  2LVI A;  2P70 A;  3FE8 A;  1MQ1 A;  1KQM B;  1DJW A;  3LK1 A;  1QAS A;  2O5G A;  4ORA B;  3NSK A;  3RM1 A;  1BMO A;  2BKH B;  4JWQ A;  3L4A A;  1M45 A;  5DKN A;  3TUY C;  1QV1 A;  4YGA A;  2MJW B;  5HLV A;  4DIR A;  1CKK A;  1B1G A;  1H4B A;  1QS7 A;  4N5X A;  4PE1 A;  3B7A A;  2KYF A;  5K89 A;  2K7O A;  1OMR A;  1OQP A;  1WRZ A;  2MAZ A;  2PVB A;  1L2O B;  3FS7 A;  3O2P A;  3DVM A;  1B8C A;  1EH2 A;  4ICB A;  3EVU A;  1MF8 B;  2JUL A;  5AAN A;  5TNC A;  2NLN A;  2BCB A;  3PN7 C;  1UHN A;  1S6J A;  1KK8 C;  4C0L A;  5KU1 A;  3PM2 A;  1QJT A;  1PK0 D;  5AXI A;  4AOM A;  1RK9 A;  2ZNE A;  3D74 A;  1YTZ C;  4FTG A;  4Q04 A;  2BE6 A;  5HYD A;  4E68 A;  3D0Y A;  3KO0 A;  4DCK A;  3IQQ A;  4PE0 A;  4TNC A;  1DJI A;  2BCX A;  1F8H A;  2QEO A;  5DIC A;  5HKW A;  2M1K B;  1KWO B;  1REC A;  1KCY A;  2L5Y A;  1XFU O;  2KAX A;  2OS8 B;  4MZL A;  1J1D A;  3S0B A;  4MBE A;  1QX5 B;  2BL0 C;  1N2D A;  3BUW B;  3I5I C;  3WXA A;  4CPV A;  1YUS A;  2KGR A;  1LIN A;  1AVS A;  5FYX A;  3SS4 A;  3O78 A;  1S26 D;  1U5I B;  2JQ6 A;  3CZ2 A;  4I5K A;  2OTG B;  1CNP A;  4PHM A;  2LNK A;  2ZN8 A;  1XFW O;  3I5F C;  3IQO A;  5CSJ A;  1A29 A;  2KOT A;  1ORG A;  1SL7 A;  1A75 B;  2NCO A;  2TN4 A;  3PN7 B;  2L98 A;  4OVN F;  1OMV A;  3DD4 A;  2FJU B;  3NHI A;  1LKJ A;  1N0Y A;  2BCA A;  2ERB A;  2JWW A;  3RLZ A;  2ZND A;  5J3X A;  2KQY A;  5DKQ A;  3CZ0 A;  4IJ7 A;  4QJ5 B;  5I2Q A;  3CYZ A;  4GFT A;  1ZFS A;  4NQG A;  3KF9 A;  1YUT A;  1IWQ A;  1A03 A;  1JC2 A;  1WDC B;  2K7B A;  4YI8 A;  1TCF A;  1S6C A;  1DVI A;  1WRL A;  2F3Y A;  2LAN A;  2AUC A;  3BUN B;  2V53 A;  3C1V A;  4OZD A;  1NSH A;  4PE4 A;  1OOH A;  1TOP A;  1KFU L;  4N1F A;  1PSB A;  2JT8 A;  1BOD A;  1C07 A;  1TNW A;  3R72 A;  2K7D A;  3SS5 A;  1PVB A;  2Y1M A;  1DJH A;  3S0E A;  3NGV A;  2K8M B;  2BAP A;  4L9M A;  3CAB A;  1LVC D;  3NXA A;  2F2P A;  2H8V A;  2KFG A;  2M49 B;  1TCO B;  2HET A;  2KI6 C;  1X02 A;  4AQJ A;  2PAL A;  4BY4 A;  2K2A A;  1KFX S;  1BOC A;  2JNF A;  2LE9 B;  2PAS A;  5I8N A;  2LCP A;  2ZN9 A;  2Q4U A;  1NCX A;  2BBN A;  1XA5 A;  3EVV A;  3ICB A;  3GOF A;  4FQO A;  5D69 A;  4QJ4 B;  4HRH A;  1CMF A;  4HSZ A;  1AP4 A;  1K90 D;  1S36 A;  2FCE A;  1DF0 A;  2JTT A;  3DVJ A;  2ZKM X;  4KYN A;  3BOW A;  1CDM A;  1ALV A;  1NX3 A;  4INX A;  1SKT A;  3FIA A;  2AMI A;  2L5X B;  4ORB B;  5GQQ C;  1DC1 A;  1JSA A;  2H61 A;  3BQ3 A;  5DKR A;  2ISD A;  3SG5 A;  4PE7 A;  3F45 A;  3BFA A;  3IVT A;  2QEV A;  3CZT X;  2BE4 A;  1PRW A;  5FI6 A;  2LUX A;  1SCM C;  3CR2 A;  1ODB A;  1UP5 A;  1ZAC A;  1HT9 A;  1C7W A;  1LA3 A;  1B47 A;  1S6I A;  1XFX O;  1EL4 A;  3D75 A;  1UUS A;  4JPZ B;  4MZJ A;  2KPH A;  1YUU A;  1QV0 A;  1NWD A;  2SAS A;  1KSM A;  2JTZ A;  4PAL A;  1CFF A;  3BFB A;  3BFH A;  3HCM A;  2LM5 A;  2KBI A;  1SR6 C;  2M1U A;  4OCI A;  3S0D A;  4F0Z B;  1JWD A;  4YGC B;  4PDZ A;  4ZCU A;  1OMD A;  3O4Y A;  1FI6 A;  3JVT C;  2LLT A;  1OOG A;  1RTP 1;  4HRE E;  2MA2 A;  4I5J A;  2LMU A;  1SMG A;  1EXR A;  1DJY A;  1TTX A;  5FI2 A;  5JJG A;  2RGI A;  2FCD A;  1XFY O;  1ALW A;  2YGU A;  1XFR A;  3MSE B;  5KTY A;  2R2I A;  2M97 A;  1F4O A;  4FQT A;  2QDI A;  3KEV A;  3FE9 A;  1LXF C;  1GM0 A;  5D7F A;  1EG4 A;  3O4X A;  4WQ3 A;  3ZWH A;  3NSL A;  1OW4 A;  1CTR A;  4IL1 A;  1BF5 A;  1BG1 A;  3TS5 C;  2NXQ A;  1FPW A;  5I2L A;  3RZS A;  1TWO A;  4M2O A;  3WHT B;  1DJZ A;  2K61 A;  2I2R E;  1S1E A;  3PSR A;  3QRX A;  1U5I A;  2KLD A;  1CLL A;  2F33 A;  1BLQ A;  1XFZ O;  2KFF A;  2ZRS A;  3EVR A;  1PUL A;  3OB2 B;  4OKH A;  5AEQ A;  1PSR A;  2K7C A;  3A8R A;  1J7R A;  2CTN A;  1CDP A;  3OHM B;  4YBH B;  1G33 A;  3S0F A;  5IBW A;  1DT7 B;  1A75 A;  3BXK A;  1K96 A;  2KAY A;  1RFJ A;  1DEL A;  3CWG A;  1B9A A;  3CS1 A;  3WHU B;  3AKB A;  3EKJ A;  3WNX B;  1UHH A;  4BY5 A;  1J1E A;  2ZFD A;  1Y1U A;  3E3R A;  1C3Z A;  3M0W A;  1J7Q A;  4I5L B;  1FF1 A;  3TUY B;  4YRU A;  3QME A;  1SW8 A;  1SY9 A;  2KHN A;  2JRF A;  2MLE C;  4XYN A;  5CSI A;  3VB1 A;  4I5N B;  4M2P A;  1NX0 A;  2GGM A;  2KI4 C;  1KK7 Z;  2CCM A;  1C7V A;  2PYQ A;  5JOL A;  4A4B A;  1E8A A;  1CFP A;  5ER4 X;  1QVI Z;  1L7Z A;  2QPT A;  3LCP C;  3GK2 A;  4GUK A;  1WRK A;  1K9U A;  3DYE A;  4NDD A;  2P6B B;  1YRT B;  1WLM A;  3D76 A;  2SCP A;  2EGD A;  1NCY A;  3UNW A;  1CLM A;  2KYC A;  1IQ5 A;  2Q91 A;  4GNK B;  2I94 A;  1KK8 B;  4P2Y B;  1K94 A;  2I7A A;  1PAL A;  2WOR A;  3DF0 B;  1FI5 A;  1KK7 Y;  2JXL A;  2K60 A;  2WCH A;  5EL2 A;  2A4J A;  1NYA A;  4XJK B;  1BT6 A;  1GJY A;  1QAT A;  2Y5I A;  1QVI Y;  1MXE A;  1Y1A A;  1CMG A;  3CGA A;  3I5H C;  3D77 A;  3CZ1 A;  2LLS A;  1QWV A;  4DRW A;  3FE6 A;  4YI9 A;  4PHN A;  3AAJ A;  2GV5 A;  2BL0 B;  2BBM A;  2WCM A;  3I5G C;  3I5I B;  3NSI A;  1K9K A;  2F3Z A;  2NCP A;  1K93 D;  1XK4 C;  2WOS A;  3JTD C;  2M9G A;  4ZCV A;  5HKY A;  1TNQ A;  3UO9 A;  1F54 A;  1F55 A;  4ETO A;  4MZK A;  1ZOT B;  1AJ5 A;  1S3P A;  2KQ6 A;  2Y4Q A;  3I5F B;  3IF7 A;  1B4C A;  1WY9 A;  1CM4 A;  3L4L A;  1RJV A;  3CTN A;  1D1O A;  2CNP A;  3R1P A;  1F4Q A;  3B86 A;  4DS7 A;  2MLF C;  3TDZ A;  5BPJ A;  1BU3 A;  3GK4 X;  2D8N A;  2GGZ A;  4JD9 A;  3GK1 A;  1SL8 A;  4QJ3 B;  2LVV A;  3VRR A;  1RWY A;  2M8U A;  2H2K A;  5KSZ A;  1NX1 A;  2G2B A;  3OGN A;  1T14 A;  2WCL A;  1XFV O;  2EC6 C;  1YUR A;  4GGN A;  1Y0V H;  1HQV A;  1MUX A;  2M3W A;  4YGD B;  2LLU A;  1A2X A;  4PHJ A;  1CB1 A;  3H4S E;  2M29 A;  2MBX A;  2KBM A;  2HF5 A;  2LHL A;  3OP0 A;  2QEH A;  1F71 A;  1NIW A;  1YVH A;  1K8U A;  2GTE A;  2P71 A;  1B7T Z;  3AAK A;  1YR5 A;  4WRI A;  1IKU A;  3NHT A;  4CFR A;  1GGW A;  2JXC A;  4M2Q A;  1JF0 A;  2H61 C;  2M0R A;  1OZO A;  2JT0 A;  3CDN A;  1K2H A;  3PAT A;  3BUX B;  1CDN A;  1KQM C;  1OSA A;  3LK0 A;  3OX5 A;  1AK8 A;  2WCK A;  1R2U A;  2E6W A;  1AUI B;  2WCE A;  4NDC A;  2JU0 A;  3SJS A;  4CLN A;  3DVE A;  4GAO A;  2FOT A;  2LHI A;  1MXL C;  1OOI X;  2G9B A;  1F70 A;  2COL B;  3SG3 A;  1B7T Y;  2LC5 A;  1YX7 A;  3TZ1 A;  1RRO A;  1NPQ A;  1TUJ A;  1W9Z A;  2MRD A;  1B8R A;  1EJ3 A;  1CFD A;  3L47 A;  2JT3 A;  1M63 B;  1V1G A;  3PJI A;  1QIW A;  5AER A;  1KFU S;  3S0G A;  1W7J B;  1SCM B;  5B8I B;  2OPO A;  1KQV A;  2JPO A;  2EHB A;  3EK7 A;  1A4P A;  3EK4 A;  1C3Y A;  4CFQ A;  1M39 A;  4MLW A;  1CFC A;  3B87 A;  2L51 A;  1TNX A;  1NX2 A;  1SR6 B;  4UPG A;  1DMO A;  1QX7 A;  3B6X A;  3DZT A;  3JVT B; 
#chains in the Genus database with same CATH homology
 2AAO A;  1IQ3 A;  4DUQ A;  1UHI A;  3CR5 X;  1GGZ A;  1KWO C;  5CPV A;  4A4C A;  4YGE B;  3NSO A;  1IRJ A;  1OE9 B;  1Y1X A;  2L4I A;  2OS8 C;  1IGV A;  5F6T A;  1WLZ A;  4JQ0 D;  1S5G Y;  3DF0 A;  3SIA A;  3BYA A;  2K2F A;  4PCW A;  4GBA A;  2LVJ A;  2E30 A;  2LP3 A;  3KPX A;  2NZ0 A;  3PLF B;  2JNX A;  3SIB A;  4XJK A;  1IJ5 A;  1FW4 A;  3CLN A;  2OTG C;  1EG3 A;  4MRY A;  1R6P A;  1BJF A;  1IG5 A;  1DJX A;  2LMT A;  2LMV A;  2PRU A;  3TS5 B;  2L2E A;  1KFX L;  2WND A;  1G8I A;  1BR1 B;  1DGU A;  3SG6 A;  5ER5 A;  2F2O A;  2HPS A;  3PAL A;  2L50 A;  3VRP A;  1ZUZ A;  3SG4 A;  1SYM A;  2LUC A;  1QLK A;  1JUO A;  3VGO A;  1IH0 A;  1WDC C;  4MN0 A;  4ORC B;  2Y1N A;  4N1G A;  4PHK A;  1CLB A;  1V1F A;  1UWO A;  2L4H A;  4USL A;  1QXP A;  2LVK A;  1SNL A;  1UUR A;  1TIZ A;  4R1E A;  3VRO A;  1ZMZ A;  3O6B A;  1TN4 A;  1W7I B;  1Y6W A;  2IS9 A;  2LAP A;  1JFK A;  1TNP A;  3BUM B;  2M7N A;  1NUB A;  1AHR A;  2JPT A;  3AKA A;  2JC2 A;  1QTX A;  1FBV A;  2KI4 B;  2ZRT A;  5CSN A;  1UHK A;  1YVL A;  2PMY A;  2KAV A;  1B8L A;  3D0Y B;  1M31 A;  3FWC A;  3DVK A;  3OX6 A;  3EK8 A;  3KHE A;  2M7L A;  3SG7 A;  3ZNI A;  1CDL A;  1GQM A;  2HQW A;  1KSO A;  1M46 A;  1XK4 A;  2KFH A;  4D1E A;  3CR4 X;  1BR4 B;  1VRK A;  4WQ2 A;  4GPL B;  1DTL A;  4MEW A;  1Q80 A;  2KSP A;  4YGB B;  1OOJ A;  2LV7 A;  3LL8 B;  1NCZ A;  1N65 A;  5AFP A;  4OV2 A;  4NDB A;  3PM8 A;  2B1U A;  1DJG A;  1LA0 A;  2VRG A;  3TDU A;  2MHH A;  3FWB A;  1J7O A;  1QIV A;  3I5H B;  2LP2 A;  1SBJ A;  1SPY A;  4U8D A;  2DOQ A;  1J55 A;  2I18 A;  1G4Y R;  3A4U B;  2KGB C;  1J7P A;  3I5G B;  3VRN A;  4C0J A;  3JTD B;  2WC8 A;  2O60 A;  2KNE A;  1NP8 A;  2BEC A;  2QAC A;  1XVJ A;  1SCV A;  5G08 A;  1OZS A;  4GGF A;  4P5O E;  5HLO A;  1YRU B;  4HRG A;  1MWN A;  1UHJ A;  3EKH A;  4MSP A;  2CBL A;  1K95 A;  4CID A;  1SRA A;  4C0K A;  1SL9 A;  2BKI B;  4MRX A;  1MHO A;  4GGF C;  3BUO B;  4OR9 B;  2HQ8 A;  3SG2 A;  3VRQ A;  1MR8 A;  5PAL A;  2PSR A;  1H8B A;  2K0J A;  1JF2 A;  1K9P A;  1XO5 A;  5I2O A;  2CT9 A;  2WCF A;  1YX8 A;  2CXJ A;  5CSF A;  1SK6 D;  1TRF A;  3D10 A;  2EC6 B;  1PVA A;  1L2O C;  2JOJ A;  2L0P A;  5HKZ A;  3LLE A;  3PFV A;  2KI6 D;  3HX4 A;  4MVF A;  3K21 A;  3OB1 B;  1IJ6 A;  1QLS A;  4AQI A;  2KDH A;  1DF0 B;  1AJ4 A;  1CM1 A;  3BOW B;  1S5G Z;  1DGV A;  1XYD A;  2WCB A;  1JFJ A;  2JZI A;  3TDI A;  2F8P A;  1QX2 A;  2LVI A;  1MQ1 A;  1KQM B;  1DJW A;  3LK1 A;  1QAS A;  2O5G A;  4ORA B;  3NSK A;  3RM1 A;  1BMO A;  2BKH B;  4JWQ A;  5DKN A;  1M45 A;  3TUY C;  1QV1 A;  4YGA A;  2MJW B;  5HLV A;  4DIR A;  1CKK A;  1B1G A;  1H4B A;  1QS7 A;  4N5X A;  4PE1 A;  2KYF A;  5K89 A;  2K7O A;  1OMR A;  1OQP A;  1WRZ A;  2MAZ A;  2PVB A;  1L2O B;  3FS7 A;  3O2P A;  3DVM A;  1B8C A;  1EH2 A;  4ICB A;  3EVU A;  1MF8 B;  2JUL A;  5AAN A;  5TNC A;  2NLN A;  2BCB A;  3PN7 C;  1UHN A;  1S6J A;  1KK8 C;  4C0L A;  5KU1 A;  1QJT A;  1PK0 D;  5AXI A;  4AOM A;  1RK9 A;  2ZNE A;  1YTZ C;  4FTG A;  4Q04 A;  2BE6 A;  5HYD A;  4E68 A;  3D0Y A;  3KO0 A;  4DCK A;  3IQQ A;  4PE0 A;  4TNC A;  1DJI A;  2BCX A;  1F8H A;  5HKW A;  2M1K B;  1KWO B;  1REC A;  1KCY A;  1XFU O;  2KAX A;  2OS8 B;  4MZL A;  1J1D A;  4MBE A;  1QX5 B;  2BL0 C;  1N2D A;  3BUW B;  3I5I C;  3WXA A;  4CPV A;  1YUS A;  2KGR A;  1LIN A;  1AVS A;  5FYX A;  3O78 A;  1S26 D;  1U5I B;  2JQ6 A;  4I5K A;  2OTG B;  1CNP A;  4PHM A;  2LNK A;  2ZN8 A;  1XFW O;  3I5F C;  3IQO A;  5CSJ A;  1A29 A;  2KOT A;  1SL7 A;  2NCO A;  1A75 B;  2TN4 A;  3PN7 B;  4OVN F;  2L98 A;  4A4B A;  1OMV A;  3DD4 A;  2FJU B;  1CFP A;  1LKJ A;  1N0Y A;  2BCA A;  2JWW A;  3RLZ A;  2ZND A;  5J3X A;  2KQY A;  5DKQ A;  5I2Q A;  4QJ5 B;  4GFT A;  1ZFS A;  4NQG A;  3KF9 A;  1YUT A;  1IWQ A;  1A03 A;  1JC2 A;  1WDC B;  2K7B A;  4YI8 A;  1TCF A;  1S6C A;  1DVI A;  1WRL A;  2F3Y A;  2LAN A;  2AUC A;  3BUN B;  2V53 A;  3C1V A;  4PE4 A;  1NSH A;  1TOP A;  1KFU L;  4N1F A;  1PSB A;  2JT8 A;  1BOD A;  1C07 A;  1TNW A;  2K7D A;  1PVB A;  2Y1M A;  1DJH A;  2K8M B;  4L9M A;  1LVC D;  3NXA A;  2F2P A;  2KFG A;  2M49 B;  1TCO B;  2HET A;  2KI6 C;  1X02 A;  4AQJ A;  2PAL A;  4BY4 A;  2K2A A;  1KFX S;  1BOC A;  2JNF A;  2LE9 B;  2PAS A;  5I8N A;  2LCP A;  2ZN9 A;  2Q4U A;  1NCX A;  2BBN A;  1XA5 A;  3EVV A;  3ICB A;  3GOF A;  4FQO A;  5D69 A;  4QJ4 B;  4HRH A;  1CMF A;  4HSZ A;  1AP4 A;  1K90 D;  1S36 A;  2FCE A;  1DF0 A;  2JTT A;  3DVJ A;  2ZKM X;  3BOW A;  1CDM A;  1ALV A;  1NX3 A;  1SKT A;  3FIA A;  2AMI A;  2L5X B;  4ORB B;  5GQQ C;  1JSA A;  2H61 A;  3BQ3 A;  5DKR A;  2ISD A;  3SG5 A;  4PE7 A;  3F45 A;  3CZT X;  2BE4 A;  1PRW A;  2LUX A;  1SCM C;  3CR2 A;  1ODB A;  1UP5 A;  1ZAC A;  1HT9 A;  1C7W A;  1LA3 A;  1B47 A;  1S6I A;  1XFX O;  1EL4 A;  4JPZ B;  1UUS A;  4MZJ A;  4YI9 A;  1JBA A;  1YUU A;  1QV0 A;  1NWD A;  2SAS A;  1KSM A;  2JTZ A;  4PAL A;  1CFF A;  3HCM A;  2LM5 A;  2KBI A;  1SR6 C;  2M1U A;  4OCI A;  4F0Z B;  1JWD A;  4YGC B;  4PDZ A;  4ZCU A;  1OMD A;  3O4Y A;  1FI6 A;  3JVT C;  2LLT A;  1RTP 1;  4HRE E;  2MA2 A;  4I5J A;  2LMU A;  1SMG A;  1EXR A;  1DJY A;  1TTX A;  5JJG A;  2RGI A;  2FCD A;  1XFY O;  1ALW A;  3MSE B;  5KTY A;  2R2I A;  2M97 A;  1F4O A;  3KEV A;  1LXF C;  5D7F A;  1EG4 A;  4WQ3 A;  3ZWH A;  3NSL A;  1CTR A;  4IL1 A;  1BF5 A;  1BG1 A;  3TS5 C;  2NXQ A;  1FPW A;  5I2L A;  4M2O A;  3WHT B;  1DJZ A;  2K61 A;  2I2R E;  1S1E A;  3PSR A;  3QRX A;  1U5I A;  1CLL A;  2F33 A;  1BLQ A;  1XFZ O;  2KFF A;  2ZRS A;  3EVR A;  1PUL A;  3OB2 B;  4OKH A;  5AEQ A;  1PSR A;  2K7C A;  3A8R A;  1J7R A;  2CTN A;  1CDP A;  3OHM B;  4YBH B;  1G33 A;  5IBW A;  1DT7 B;  1A75 A;  3BXK A;  1K96 A;  2KAY A;  1RFJ A;  3CWG A;  1B9A A;  3CS1 A;  3WHU B;  3AKB A;  3EKJ A;  3WNX B;  1UHH A;  4BY5 A;  1J1E A;  2ZFD A;  1Y1U A;  3E3R A;  3M0W A;  1J7Q A;  4I5L B;  1FF1 A;  3TUY B;  4YRU A;  1SW8 A;  1SY9 A;  2KHN A;  2JRF A;  2MLE C;  4XYN A;  5CSI A;  4I5N B;  4M2P A;  1NX0 A;  2GGM A;  2KI4 C;  1KK7 Z;  2CCM A;  1C7V A;  5JOL A;  1E8A A;  5ER4 X;  1QVI Z;  1L7Z A;  2QPT A;  3LCP C;  3GK2 A;  4GUK A;  1WRK A;  1K9U A;  4NDD A;  2P6B B;  1YRT B;  1WLM A;  2SCP A;  2EGD A;  1NCY A;  1CLM A;  2KYC A;  1IQ5 A;  2Q91 A;  4GNK B;  2I94 A;  1KK8 B;  4P2Y B;  1K94 A;  2I7A A;  1PAL A;  2WOR A;  3DF0 B;  1FI5 A;  1KK7 Y;  2JXL A;  2A4J A;  1NYA A;  4XJK B;  1BT6 A;  1GJY A;  1QAT A;  2Y5I A;  1QVI Y;  1MXE A;  1Y1A A;  1CMG A;  3CGA A;  3I5H C;  2LLS A;  4DRW A;  4PHN A;  3AAJ A;  2GV5 A;  2BL0 B;  2BBM A;  3I5G C;  3I5I B;  3NSI A;  1K9K A;  2F3Z A;  2NCP A;  1K93 D;  1XK4 C;  2WOS A;  3JTD C;  2M9G A;  4ZCV A;  5HKY A;  1TNQ A;  1F54 A;  1F55 A;  4ETO A;  4MZK A;  1ZOT B;  1AJ5 A;  1S3P A;  2KQ6 A;  2Y4Q A;  3I5F B;  3IF7 A;  1B4C A;  1WY9 A;  1CM4 A;  1RJV A;  3CTN A;  1D1O A;  2CNP A;  1F4Q A;  4DS7 A;  2MLF C;  3TDZ A;  5BPJ A;  1BU3 A;  3GK4 X;  2D8N A;  2GGZ A;  3GK1 A;  1SL8 A;  4QJ3 B;  2LVV A;  3VRR A;  1RWY A;  2M8U A;  2H2K A;  5KSZ A;  1NX1 A;  2G2B A;  1XFV O;  2EC6 C;  1YUR A;  4GGN A;  1Y0V H;  1HQV A;  1MUX A;  2M3W A;  4YGD B;  2LLU A;  1A2X A;  4PHJ A;  1CB1 A;  3H4S E;  2M29 A;  2MBX A;  2KBM A;  2HF5 A;  2LHL A;  3OP0 A;  1F71 A;  1NIW A;  1YVH A;  1K8U A;  1B7T Z;  3AAK A;  1YR5 A;  4WRI A;  1IKU A;  4CFR A;  1GGW A;  2JXC A;  4M2Q A;  1JF0 A;  2H61 C;  2M0R A;  1OZO A;  2JT0 A;  1K2H A;  3PAT A;  3BUX B;  1CDN A;  1KQM C;  1OSA A;  3LK0 A;  3OX5 A;  1AK8 A;  1R2U A;  2E6W A;  1AUI B;  2WCE A;  4NDC A;  2JU0 A;  3SJS A;  4CLN A;  3DVE A;  4GAO A;  2FOT A;  2LHI A;  1MXL C;  2G9B A;  1F70 A;  2COL B;  3SG3 A;  1B7T Y;  2LC5 A;  1YX7 A;  3TZ1 A;  1RRO A;  1NPQ A;  2MRD A;  1B8R A;  1EJ3 A;  1CFD A;  2JT3 A;  1M63 B;  1V1G A;  1QIW A;  5AER A;  1KFU S;  1KQV A;  1W7J B;  1SCM B;  5B8I B;  2OPO A;  2EHB A;  3EK7 A;  1A4P A;  3EK4 A;  4CFQ A;  1M39 A;  4MLW A;  1CFC A;  2L51 A;  1TNX A;  1NX2 A;  1SR6 B;  4UPG A;  1DMO A;  1QX7 A;  3JVT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...