1KK7Z

Scallop myosin in the near rigor conformation
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
154
structure length
154
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords MYOSIN HEAVY CHAIN, STRIATED MUSCLE
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
total genus 35
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Z01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Z02
1M63B 3FS7A 1QTXA 4C0JA 2LLTA 4MBEA 4AOMA 1H4BA 1QV1A 4NDDA 1U5IB 1JSAA 4PHNA 4WQ2A 1CM1A 1V1GA 1Y0VH 1YURA 4PE7A 1M31A 1SCMC 3I5HB 3SG2A 1KSMA 1XFYO 3TZ1A 1RTP1 3DF0B 4ZCVA 3DVJA 1ZACA 3SG6A 2Y1NA 2RGIA 4BY5A 1A2XA 1SL8A 3EK7A 2F2OA 4HRHA 3MSEB 3VRRA 4JQ0D 2GV5A 2LP3A 2MLFC 2L4IA 2KI6C 4M2OA 5DKRA 1KCYA 1GGZA 1BJFA 3WHUB 1PSBA 1CDPA 2KQ6A 1S6CA 4ORAB 2JT0A 2ISDA 1SCVA 3BYAA 1MR8A 4CPVA 4P2YB 2LC5A 2HPSA 1LA3A 3OHMB 1OSAA 2JZIA 5JOLA 1WLZA 2BCBA 4N1GA 2KHNA 3HX4A 1CNPA 1DTLA 4GFTA 4GPLB 4CFRA 1BR4B 2F3ZA 3VGOA 3GK4X 1MWNA 2Q4UA 1CLLA 4ICBA 2K2AA 4QJ4B 1MF8B 4UPGA 3CWGA 3I5HC 2L98A 1CLMA 1Y1XA 4YBHB 1D1OA 2R2IA 1DJWA 2IS9A 5I2QA 4F0ZB 4YGBB 2BCAA 1JFKA 1PSRA 4DS7A 1YVLA 3RLZA 2K8MB 2LVVA 2COLB 1AUIB 3PN7C 2KAVA 1QVIZ 4DUQA 2LMUA 4ETOA 4I5KA 2SASA 2F8PA 1SR6B 2JXCA 2KFFA 3BXKA 4N1FA 2M49B 4M2QA 4OR9B 1HT9A 1OQPA 3O4YA 4YGAA 3LLEA 2NCPA 5AXIA 1U5IA 1ZOTB 2LLSA 1CDNA 3PALA 1XVJA 1SKTA 2O60A 2NZ0A 1IJ6A 1B8RA 3BUXB 4GNKB 1EG3A 3DF0A 4PALA 5JJGA 1L2OC 2LNKA 1NCZA 3ICBA 3ZWHA 1WDCB 2P6BB 4MZLA 1B7TZ 2QPTA 4PCWA 2M97A 3NSKA 2ZKMX 3BUOB 4A4CA 5HLVA 3LK0A 1ALWA 1WRZA 4YI9A 4DIRA 3FWCA 4MZJA 3SIAA 3DD4A 1QIWA 2G2BA 4HREE 2M8UA 3A4UB 2HF5A 1QX2A 1TIZA 2Y4QA 1IQ3A 3GK1A 2KYCA 3CR4X 1JBAA 1QASA 3RM1A 1X02A 1QXPA 2JNFA 1YUSA 1OZSA 3PATA 1XFUO 2M3WA 2ZNEA 1SL9A 1EH2A 1IKUA 1J7OA 2K7BA 1K9KA 3A8RA 1AVSA 3BQ3A 4OVNF 2MRDA 4USLA 4XYNA 2MHHA 3VRNA 1SR6C 4MN0A 1RK9A 2MAZA 1NX0A 4MRXA 1YRUB 3NSLA 1CMGA 1NX1A 1J1DA 2M29A 3D10A 2M9GA 3VRQA 1K2HA 5KTYA 1YR5A 4C0KA 4E68A 1MXEA 2HQWA 2BKIB 2F33A 1WDCC 3FIAA 2KI4C 4MEWA 3SIBA 4GAOA 1IQ5A 2LMVA 1UHKA 2LLUA 4JWQA 1NCXA 1TN4A 1UWOA 1FPWA 3I5FC 2G9BA 1DVIA 1UHJA 1WLMA 2KYFA 1WY9A 2LUCA 1JFJA 2KSPA 4MRYA 1GQMA 2PVBA 1J7PA 2L4HA 4C0LA 3AKAA 1UHIA 1FF1A 2PALA 4CIDA 3NSOA 5I8NA 1CMFA 1JWDA 2MA2A 1N2DA 2HQ8A 1CDMA 1UURA 5I2OA 2KNEA 1KK7Y 2A4JA 1XK4A 2JRFA 3VRPA 1K96A 3DVMA 2AMIA 1SYMA 2BECA 1ALVA 4NQGA 2I2RE 1SRAA 1Y1UA 1B47A 2M0RA 1KWOB 5D7FA 2Q91A 3CR5X 1S6IA 4HSZA 1WRKA 1JF0A 2EC6B 2LVJA 2KGBC 1J7QA 1K93D 4U8DA 1CTRA 2DOQA 3H4SE 1QLKA 1TNQA 3AAJA 3PM8A 5CSNA 1IWQA 2PSRA 2VRGA 1XFVO 3TDUA 2QACA 1QJTA 1LA0A 1NP8A 2WOSA 3O6BA 5F6TA 2CTNA 3NXAA 5HLOA 5HYDA 1NCYA 2EGDA 3DVKA 2JC2A 4GGNA 1DMOA 4YI8A 2M7LA 1KFXS 4DRWA 3WNXB 1MXLC 1F8HA 3KPXA 2KDHA 1CFCA 1S5GZ 4R1EA 1AP4A 3I5IB 1IGVA 1OOJA 1CLBA 2BCXA 1C7VA 1M45A 2FOTA 5CSJA 3JVTB 1F70A 2I7AA 1TRFA 1G8IA 4AQIA 2NCOA 2MLEC 1A75B 3AAKA 2NXQA 3F45A 2Y1MA 4ORBB 1S6JA 1ZFSA 1TTXA 1TCOB 2K7CA 4CFQA 3GK2A 4IL1A 1KFUL 1FBVA 5B8IB 4YGEB 4DCKA 1QX5B 2LANA 1QIVA 4OCIA 1RWYA 2EC6C 2OTGB 2LVIA 4YRUA 2BL0B 1JUOA 4WRIA 1NWDA 5AFPA 1KQMB 1SL7A 5KU1A 1S1EA 1QV0A 1AHRA 5CSFA 1YX7A 2KFGA 1K9UA 5PALA 1L7ZA 2GGZA 1QVIY 2KOTA 2H2KA 3SG3A 4XJKB 4PDZA 1DJXA 2BE4A 3SG4A 2LE9B 2WORA 2K61A 4GBAA 1HQVA 1EL4A 1M46A 1YUTA 2OPOA 4Q04A 1MHOA 2D8NA 1DGUA 1G33A 5ER5A 2FCEA 1F55A 1R6PA 1UHNA 2KI6D 1A4PA 2AUCA 4PHJA 1C7WA 1NX3A 3CR2A 1K8UA 1IG5A 1BT6A 1YX8A 1NX2A 4YGDB 3WHTB 4AQJA 2F2PA 2PRUA 2ZRSA 1MUXA 1S36A 2BBMA 3D0YB 2JWWA 2KBIA 1C07A 2OTGC 5ER4X 1A29A 2BL0C 1YTZC 2MJWB 2KFHA 2JXLA 2ZFDA 2F3YA 1KQMC 1SW8A 1RFJA 4HRGA 4MZKA 3TUYB 3WXAA 1B8CA 1TNWA 5KSZA 4M2PA 3KHEA 3SG7A 1N0YA 4I5LB 2LCPA 4I5NB 1N65A 3E3RA 1Q80A 1XK4C 2V53A 2LM5A 1S26D 1XO5A 1CFPA 2FJUB 3PLFB 1A75A 2HETA 2LVKA 1F71A 1NIWA 1UP5A 4MVFA 2L0PA 1TOPA 1EG4A 1SY9A 1K95A 1SCMB 1CFDA 1NUBA 3EK4A 1DF0B 1OMRA 1J55A 1PRWA 2JQ6A 3NSIA 1SNLA 3BUWB 1K94A 1EJ3A 3O78A 2MBXA 2KGRA 1A03A 1SK6D 1DJIA 1ZUZA 1PVBA 2LHLA 3I5GB 1K90D 3CLNA 2JTTA 4P5OE 1BLQA 2WCFA 1YUUA 2ZN9A 2ZNDA 2LMTA 1GJYA 4FTGA 2JT8A 2PMYA 1B8LA 1PVAA 1V1FA 1Y6WA 4XJKA 1WRLA 2JULA 2K7OA 2JU0A 5FYXA 3TUYC 2LV7A 3CTNA 1R2UA 1YRTB 2Y5IA 1KK7Z 2I18A 1OE9B 1JF2A 1S3PA 1GGWA 3CZTX 4QJ3B 4N5XA 4L9MA 1AJ4A 1XA5A 3KO0A 1M39A 3TS5B 2K2FA 3ZNIA 2WCEA 3BUNB 1AK8A 4D1EA 1IH0A 5K89A 2LAPA 1FI6A 2M7NA 2SCPA 4PE1A 3M0WA 1AJ5A 2TN4A 1YVHA 3D0YA 1BF5A 1KK8B 2JOJA 2K7DA 2CNPA 3PFVA 3BOWB 2LHIA 1QLSA 2M1KB 3EVUA 1J7RA 3I5GC 3TDZA 5I2LA 3DVEA 2LP2A 1LKJA 1RECA 3PN7B 5HKYA 2K0JA 2JPTA 4OKHA 1H8BA 1QS7A 1F4OA 1Y1AA 3BUMB 1EXRA 4TNCA 4MLWA 2CBLA 3IQOA 1KSOA 2CT9A 2L50A 1G4YR 4PHMA 1LINA 1DGVA 5HKWA 2JNXA 1DJHA 5TNCA 1TCFA 2PASA 1IRJA 1IJ5A 1CKKA 2WC8A 1DF0A 4BY4A 1KWOC 3SG5A 1BMOA 1L2OB 1S5GY 4I5JA 3TS5C 3LK1A 1B4CA 1OZOA 1E8AA 2BKHB 4NDCA 3KF9A 2EHBA 5CPVA 3TDIA 1DJZA 1TNXA 2WNDA 3EKJA 5AERA 1KK8C 2KAYA 1MQ1A 4PE0A 3JTDB 1SPYA 2L5XB 1DT7B 1W7JB 1FI5A 2OS8B 4QJ5B 1FW4A 3I5IC 5IBWA 1CFFA 5AANA 3LCPC 2KBMA 3JVTC 3PSRA 1JC2A 2CXJA 2ZN8A 4GGFC 1ODBA 3HCMA 4GUKA 3IQQA 4NDBA 5GQQC 5BPJA 5G08A 1XFWO 1RROA 2FCDA 2JT3A 1B7TY 3C1VA 1UUSA 5J3XA 3EK8A 3BOWA 2KQYA 2E6WA 2KI4B 1XFXO 2I94A 1BOCA 2H61C 2BBNA 1DJYA 4PHKA 2B1UA 4OV2A 5CSIA 2O5GA 3I5FB 1CM4A 1NYAA 3EKHA 5AEQA 2L2EA 2E30A 1BG1A 1SMGA 3KEVA 1NPQA 3GOFA 3JTDC 1LVCD 4JPZB 1BR1B 4GGFA 4WQ3A 1XYDA 3OB2B 1PALA 1UHHA 2OS8C 2WCBA 1KFXL 1B9AA 2AAOA 4FQOA 2NLNA 2CCMA 1ZMZA 3FWBA 1KQVA 4ZCUA 3SJSA 2L51A 3CS1A 5HKZA 5DKQA 2BE6A 1VRKA 3LL8B 2H61A 3OP0A 3OX5A 1CDLA 3O2PA 3CGAA 4PE4A 5DKNA 1F54A 4CLNA 3QRXA 1B1GA 1CB1A 1KFUS 2ZRTA 4MSPA 1RJVA 1OMDA 1TNPA 4ORCB 3IF7A 3EVRA 4A4BA 3OB1B 1W7IB 3OX6A 1K9PA 2LUXA 2M1UA 1LXFC 1PK0D 1PULA 1BU3A 1DJGA 1J1EA 3VROA 2JTZA 4YGCB 2GGMA 1OMVA 2KAXA 3EVVA 1SBJA 3AKBA 1QATA 1NSHA 1BODA 3K21A 5D69A 1QX7A 1XFZO 1F4QA
chains in the Genus database with same CATH superfamily
1M63B 1Z2CB 1QTXA 3FS7A 4C0JA 2LLTA 4MBEA 4AOMA 1H4BA 3BFHA 4KYNA 1QV1A 4NDDA 1U5IB 1JSAA 4PHNA 4WQ2A 1CM1A 1V1GA 1Y0VH 1YURA 2WCHA 1M31A 1SCMC 4PE7A 3I5HB 3SG2A 1KSMA 1XFYO 3R1PA 1RTP1 3DF0B 4INWA 3DVJA 4ZCVA 3TZ1A 1ZACA 3SG6A 2Y1NA 2RGIA 4BY5A 2QEBA 1A2XA 1SL8A 3B7AA 2F2OA 3EK7A 4HRHA 1OOHA 3MSEB 3VRRA 4JQ0D 1TUZA 2GV5A 2LP3A 2MLFC 2L4IA 2KI6C 3NHIA 4M2OA 5DKRA 1KCYA 1GGZA 1BJFA 3WHUB 1PSBA 1CDPA 2KQ6A 1OOGA 1S6CA 4PT1A 4ORAB 2JT0A 2ISDA 1SCVA 3BYAA 1MR8A 4CPVA 4P2YB 2LC5A 2HPSA 1LA3A 3OHMB 1OSAA 2JZIA 3B6XA 5JOLA 1WLZA 2BCBA 4N1GA 2KHNA 3HX4A 1CNPA 1DTLA 4GFTA 4GPLB 4CFRA 3CABA 1BR4B 2F3ZA 3VGOA 3GK4X 1MWNA 2Q4UA 1CLLA 4ICBA 2K2AA 4QJ4B 3PM2A 1MF8B 5EL2A 3CWGA 3I5HC 4UPGA 1C3ZA 2L98A 1CLMA 1Y1XA 2WCKA 4YBHB 2R2IA 1D1OA 1DJWA 2IS9A 5I2QA 4F0ZB 4YGBB 2BCAA 1JFKA 1PSRA 4DS7A 1LS8A 1YVLA 3RLZA 2K8MB 2LVVA 2COLB 1AUIB 3PN7C 2KAVA 1QVIZ 4DUQA 2LMUA 4ETOA 3S0FA 4I5KA 2SASA 2F8PA 1SR6B 2JXCA 2KFFA 3BXKA 4N1FA 2K60A 2M49B 4M2QA 3SS3A 4OR9B 1HT9A 1OQPA 3O4YA 4YGAA 3LLEA 2NCPA 5AXIA 1U5IA 4JD9A 1ZOTB 2LLSA 1CDNA 3PALA 1XVJA 1SKTA 2O60A 2L5YA 2NZ0A 1IJ6A 1B8RA 3BUXB 4GNKB 1EG3A 3DF0A 4PALA 5JJGA 1L2OC 2LNKA 1NCZA 2ERBA 3ICBA 1WDCB 2P6BB 4MZLA 3CDNA 1B7TZ 3ZWHA 2QPTA 4PCWA 2M97A 3NSKA 2ZKMX 3BUOB 4A4CA 5HLVA 3LK0A 1ALWA 1WRZA 4YI9A 4DIRA 3FWCA 4MZJA 3SIAA 3DD4A 1QIWA 2G2BA 4HREE 2M8UA 3A4UB 2HF5A 1QX2A 1TIZA 2Y4QA 1IQ3A 3GK1A 2KYCA 3CR4X 1JBAA 1QASA 3RM1A 1X02A 1QXPA 2JNFA 3CYZA 1YUSA 3Q8IA 1OZSA 3PATA 1XFUO 2M3WA 2ZNEA 1SL9A 1EH2A 1IKUA 1GM0A 1T14A 2K7BA 1J7OA 1K9KA 3A8RA 1AVSA 3BQ3A 4OVNF 2MRDA 4USLA 4XYNA 2MHHA 3VRNA 1SR6C 4MN0A 1RK9A 2MAZA 1NX0A 4MRXA 1YRUB 3NSLA 1CMGA 1NX1A 1J1DA 2M29A 3D10A 2M9GA 4OZDA 3VRQA 1K2HA 5KTYA 1YR5A 4C0KA 4E68A 1MXEA 2HQWA 2BKIB 2F33A 5D3OA 1WDCC 3FIAA 2KI4C 4IJ7A 4MEWA 3SIBA 1DELA 4GAOA 1IQ5A 2LMVA 1UHKA 2LLUA 4JWQA 1NCXA 1TN4A 1UWOA 1FPWA 3VB1A 3I5FC 2G9BA 1C3YA 1DVIA 1UHJA 1WLMA 2KYFA 5I94A 1WY9A 2LUCA 1DC1A 1JFJA 2KSPA 4MRYA 1GQMA 2PVBA 1J7PA 2BNXA 2L4HA 4C0LA 3AKAA 1UHIA 1FF1A 2PALA 4CIDA 3NSOA 5I8NA 3DXLA 3L4LA 1CMFA 1JWDA 2MA2A 1N2DA 2HQ8A 4FQTA 3SS5A 1CDMA 1UURA 5I2OA 2KNEA 1KK7Y 2A4JA 3N7HA 5FI2A 1XK4A 2JRFA 2WCMA 3VRPA 1K96A 3DVMA 2AMIA 1SYMA 2BECA 1ALVA 4NQGA 3BFAA 2I2RE 1SRAA 1Y1UA 1B47A 2M0RA 2GTEA 1KWOB 5D7FA 2Q91A 3R1VA 3CR5X 1S6IA 4HSZA 1WRKA 1JF0A 2EC6B 2WCJA 2LVJA 2KGBC 1J7QA 1K93D 4U8DA 1CTRA 2DOQA 3H4SE 1QLKA 1TNQA 3DY9A 3CZ0A 3AAJA 3PM8A 3K1EA 5CSNA 1IWQA 1TWOA 2PSRA 1XFVO 2VRGA 2QACA 1QJTA 1LA0A 1P28A 1NP8A 3TDUA 2WOSA 3O6BA 5F6TA 2CTNA 3NXAA 5HLOA 5HYDA 1NCYA 2EGDA 3DVKA 2JC2A 4GGNA 1DMOA 4YI8A 2M7LA 1KFXS 4DRWA 3WNXB 1MXLC 2FJYA 1F8HA 3KPXA 2KDHA 1CFCA 1S5GZ 4R1EA 1AP4A 3I5IB 1IGVA 1OOJA 1CLBA 2BCXA 1C7VA 1M45A 2FOTA 5CSJA 3JVTB 1F70A 2I7AA 3S0AA 1TRFA 1G8IA 4AQIA 2NCOA 2MLEC 1A75B 1XFRA 3AAKA 3DZTA 2NXQA 3F45A 2Y1MA 4ORBB 3D76A 1S6JA 1ZFSA 1TTXA 1TCOB 2K7CA 4CFQA 3GK2A 4IL1A 1KFUL 1FBVA 5B8IB 4YGEB 4DCKA 1QX5B 2LANA 1QIVA 4OCIA 1RWYA 2EC6C 2OTGB 2LVIA 3V2LA 2BL0B 1JUOA 4WRIA 4YRUA 1NWDA 5AFPA 1KQMB 1SL7A 5KU1A 1S1EA 5HL1A 1QV0A 1AHRA 5CSFA 1YX7A 2KFGA 1K9UA 5PALA 3S0EA 1L7ZA 2PQLA 2GGZA 1QVIY 2KOTA 2H2KA 3SG3A 4XJKB 4PDZA 1DJXA 2BE4A 3SG4A 1IIOA 2LE9B 2WORA 2K61A 3DYEA 4GBAA 1HQVA 1EL4A 1M46A 1YUTA 2OPOA 4Q04A 3BFBA 1MHOA 2D8NA 3D74A 1DGUA 2QDIA 1G33A 5ER5A 2FCEA 1F55A 1R6PA 1UHNA 2KI6D 4F7FA 1A4PA 2AUCA 4PHJA 1C7WA 1NX3A 3CR2A 1K8UA 1IG5A 1BT6A 1YX8A 1NX2A 4YGDB 3WHTB 4AQJA 2F2PA 2PRUA 4JKTA 2ZRSA 3FE8A 1MUXA 1S36A 2BBMA 3D0YB 2JWWA 2KBIA 1C07A 2OTGC 5ER4X 1A29A 2BL0C 3D73A 1YTZC 2MJWB 2KFHA 2JXLA 2ZFDA 2F3YA 1KQMC 1SW8A 1RFJA 4HRGA 4MZKA 3TUYB 2P71A 3WXAA 1B8CA 1TNWA 2YGUA 5KSZA 4M2PA 3KHEA 3SG7A 1N0YA 4I5LB 3D77A 2LCPA 4I5NB 1N65A 3E3RA 1Q80A 1XK4C 2V53A 2LM5A 1S26D 1XO5A 3UNWA 1CFPA 2FJUB 3PLFB 1A75A 2HETA 2LVKA 1F71A 1NIWA 1UP5A 4MVFA 2L0PA 1TOPA 1EG4A 1SY9A 1K95A 1SCMB 1TUJA 1CFDA 1NUBA 2WC6A 3EK4A 3NGVA 1DF0B 3L47A 1OMRA 1J55A 1PRWA 2JQ6A 3NSIA 1SNLA 3BUWB 1K94A 3D75A 1OOIX 1EJ3A 3O78A 2MBXA 2KGRA 1A03A 1SK6D 1DJIA 1ZUZA 1PVBA 2LHLA 3I5GB 1K90D 3CLNA 2JTTA 4P5OE 1BLQA 2WCFA 1YUUA 3S0GA 2ZN9A 2ZNDA 2LMTA 1GJYA 4FTGA 2JT8A 2PMYA 1B8LA 1PVAA 1V1FA 1Y6WA 4XJKA 1WRLA 2JULA 2K7OA 2JU0A 5FYXA 3TUYC 2LV7A 3CTNA 1R2UA 3QMEA 1YRTB 2Y5IA 1KK7Z 2KLDA 2H8VA 2I18A 1OE9B 2QEOA 1JF2A 1S3PA 1GGWA 3CZTX 4QJ3B 4N5XA 4L9MA 1AJ4A 1XA5A 3KO0A 1M39A 1OOFA 3TS5B 2K2FA 3B88A 3ZNIA 2WCEA 3BUNB 3FE9A 1AK8A 4D1EA 1IH0A 5K89A 1DQEA 2LAPA 2M7NA 2SCPA 4PE1A 1DEKA 3M0WA 1AJ5A 2TN4A 1FI6A 1YVHA 3D0YA 2WCLA 1BF5A 1KK8B 2JOJA 2K7DA 2CNPA 3PFVA 3BOWB 2LHIA 1W9ZA 1QLSA 2M1KB 3EVUA 1J7RA 3EG5B 3I5GC 3TDZA 5I2LA 3DVEA 2LP2A 1LKJA 1RECA 3D78A 3PN7B 3PJIA 4INXA 2K0JA 2JPTA 5HKYA 4OKHA 1H8BA 1QS7A 1F4OA 1Y1AA 3BUMB 2QEVA 3O4XA 1EXRA 3NHTA 2WC5A 3L4AA 4TNCA 4MLWA 2BAPA 2KLEA 2CBLA 3IQOA 3OBVA 1KSOA 2CT9A 2L50A 1G4YR 4PHMA 1LINA 2P70A 1DGVA 5HKWA 2JNXA 1DJHA 5TNCA 1TCFA 2PASA 3IVTA 1IRJA 1IJ5A 1CKKA 1QWVA 2WC8A 1DF0A 4BY4A 1KWOC 3SG5A 1BMOA 1L2OB 1S5GY 3BJHA 4I5JA 3TS5C 3LK1A 1OW4A 1B4CA 1OZOA 1E8AA 2BKHB 4NDCA 3KF9A 2EHBA 5CPVA 3TDIA 1DJZA 1TNXA 2PYQA 2WNDA 3EKJA 3RZSA 5AERA 1KK8C 2KAYA 1MQ1A 4PE0A 3JTDB 1SPYA 2L5XB 1DT7B 1W7JB 1FI5A 2OS8B 4QJ5B 1SSEB 1FW4A 3I5IC 3S0BA 5IBWA 1CFFA 5AANA 3LCPC 2KBMA 3JVTC 3PSRA 1JC2A 2CXJA 2ZN8A 4GGFC 1ODBA 3HCMA 4GUKA 3IQQA 4NDBA 5GQQC 5BPJA 5G08A 1XFWO 2QEHA 1RROA 2FCDA 2JT3A 1B7TY 3C1VA 2KPHA 1UUSA 3B86A 2L2CA 5J3XA 3FE6A 3EK8A 3BOWA 5FI6A 2KQYA 2E6WA 2KI4B 1XFXO 2I94A 3B87A 1BOCA 2H61C 2BBNA 1DJYA 4PHKA 2B1UA 4OV2A 5CSIA 2O5GA 3I5FB 1CM4A 1NYAA 3EKHA 5AEQA 3R1OA 2L2EA 2E30A 5DICA 1BG1A 1SMGA 3KEVA 1NPQA 3GOFA 3JTDC 1LVCD 4JPZB 1BR1B 4GGFA 4WQ3A 1XYDA 3OB2B 1PALA 1UHHA 2OS8C 2WCBA 1KFXL 1B9AA 2AAOA 4FQOA 2NLNA 2CCMA 1ZMZA 3FWBA 1KQVA 4ZCUA 3SJSA 2L51A 3CS1A 5HKZA 5DKQA 5FI7A 2BE6A 1VRKA 3R72A 3LL8B 2H61A 3OP0A 3OX5A 1CDLA 3O2PA 3CGAA 4PE4A 5DKNA 1F54A 1Z4HA 4CLNA 3QRXA 1B1GA 1CB1A 1KFUS 2ZRTA 4MSPA 1RJVA 1OMDA 1TNPA 4ORCB 3IF7A 3EVRA 3SS4A 3UO9A 4A4BA 1ORGA 3OB1B 1W7IB 3OX6A 3OGNA 1K9PA 2LUXA 2M1UA 2JPOA 1LXFC 1PK0D 1PULA 1BU3A 1DJGA 1J1EA 3VROA 2JTZA 3CZ1A 2GGMA 3CZ2A 1OMVA 4YGCB 2KAXA 3EVVA 3S0DA 1SBJA 3AKBA 1QATA 1NSHA 1BODA 3K21A 5D69A 1QX7A 1XFZO 1F4QA
chains in the Genus database with same CATH topology
1M63B 3FS7A 1QTXA 4C0JA 2LLTA 4MBEA 4AOMA 1H4BA 1QV1A 4NDDA 1U5IB 1JSAA 4PHNA 4WQ2A 1CM1A 1V1GA 1Y0VH 1YURA 4PE7A 1M31A 1SCMC 3I5HB 3SG2A 1KSMA 1XFYO 3TZ1A 1RTP1 3DF0B 4ZCVA 3DVJA 1ZACA 3SG6A 2Y1NA 2RGIA 4BY5A 1A2XA 1SL8A 3EK7A 2F2OA 4HRHA 3MSEB 3VRRA 4JQ0D 2GV5A 2LP3A 2MLFC 2L4IA 2KI6C 4M2OA 5DKRA 1KCYA 1GGZA 1BJFA 3WHUB 1PSBA 1CDPA 2KQ6A 1S6CA 4ORAB 2JT0A 2ISDA 1SCVA 3BYAA 1MR8A 4CPVA 4P2YB 2LC5A 2HPSA 1LA3A 3OHMB 1OSAA 2JZIA 5JOLA 1WLZA 2BCBA 4N1GA 2KHNA 3HX4A 1CNPA 1DTLA 4GFTA 4GPLB 4CFRA 1BR4B 2F3ZA 3VGOA 3GK4X 1MWNA 2Q4UA 1CLLA 4ICBA 2K2AA 4QJ4B 1MF8B 4UPGA 3CWGA 3I5HC 2L98A 1CLMA 1Y1XA 4YBHB 1D1OA 2R2IA 1DJWA 2IS9A 5I2QA 4F0ZB 4YGBB 2BCAA 1JFKA 1PSRA 4DS7A 1YVLA 3RLZA 2K8MB 2LVVA 2COLB 1AUIB 3PN7C 2KAVA 1QVIZ 4DUQA 2LMUA 4ETOA 4I5KA 2SASA 2F8PA 1SR6B 2JXCA 2KFFA 3BXKA 4N1FA 2M49B 4M2QA 4OR9B 1HT9A 1OQPA 3O4YA 4YGAA 3LLEA 2NCPA 5AXIA 1U5IA 1ZOTB 2LLSA 1CDNA 3PALA 1XVJA 1SKTA 2O60A 2NZ0A 1IJ6A 1B8RA 3BUXB 4GNKB 1EG3A 3DF0A 4PALA 5JJGA 1L2OC 2LNKA 1NCZA 3ICBA 3ZWHA 1WDCB 2P6BB 4MZLA 1B7TZ 2QPTA 4PCWA 2M97A 3NSKA 2ZKMX 3BUOB 4A4CA 5HLVA 3LK0A 1ALWA 1WRZA 4YI9A 4DIRA 3FWCA 4MZJA 3SIAA 3DD4A 1QIWA 2G2BA 4HREE 2M8UA 3A4UB 2HF5A 1QX2A 1TIZA 2Y4QA 1IQ3A 3GK1A 2KYCA 3CR4X 1JBAA 1QASA 3RM1A 1X02A 1QXPA 2JNFA 1YUSA 1OZSA 3PATA 1XFUO 2M3WA 2ZNEA 1SL9A 1EH2A 1IKUA 1J7OA 2K7BA 1K9KA 3A8RA 1AVSA 3BQ3A 4OVNF 2MRDA 4USLA 4XYNA 2MHHA 3VRNA 1SR6C 4MN0A 1RK9A 2MAZA 1NX0A 4MRXA 1YRUB 3NSLA 1CMGA 1NX1A 1J1DA 2M29A 3D10A 2M9GA 3VRQA 1K2HA 5KTYA 1YR5A 4C0KA 4E68A 1MXEA 2HQWA 2BKIB 2F33A 1WDCC 3FIAA 2KI4C 4MEWA 3SIBA 4GAOA 1IQ5A 2LMVA 1UHKA 2LLUA 4JWQA 1NCXA 1TN4A 1UWOA 1FPWA 3I5FC 2G9BA 1DVIA 1UHJA 1WLMA 2KYFA 1WY9A 2LUCA 1JFJA 2KSPA 4MRYA 1GQMA 2PVBA 1J7PA 2L4HA 4C0LA 3AKAA 1UHIA 1FF1A 2PALA 4CIDA 3NSOA 5I8NA 1CMFA 1JWDA 2MA2A 1N2DA 2HQ8A 1CDMA 1UURA 5I2OA 2KNEA 1KK7Y 2A4JA 1XK4A 2JRFA 3VRPA 1K96A 3DVMA 2AMIA 1SYMA 2BECA 1ALVA 4NQGA 2I2RE 1SRAA 1Y1UA 1B47A 2M0RA 1KWOB 5D7FA 2Q91A 3CR5X 1S6IA 4HSZA 1WRKA 1JF0A 2EC6B 2LVJA 2KGBC 1J7QA 1K93D 4U8DA 1CTRA 2DOQA 3H4SE 1QLKA 1TNQA 3AAJA 3PM8A 5CSNA 1IWQA 2PSRA 2VRGA 1XFVO 3TDUA 2QACA 1QJTA 1LA0A 1NP8A 2WOSA 3O6BA 5F6TA 2CTNA 3NXAA 5HLOA 5HYDA 1NCYA 2EGDA 3DVKA 2JC2A 4GGNA 1DMOA 4YI8A 2M7LA 1KFXS 4DRWA 3WNXB 1MXLC 1F8HA 3KPXA 2KDHA 1CFCA 1S5GZ 4R1EA 1AP4A 3I5IB 1IGVA 1OOJA 1CLBA 2BCXA 1C7VA 1M45A 2FOTA 5CSJA 3JVTB 1F70A 2I7AA 1TRFA 1G8IA 4AQIA 2NCOA 2MLEC 1A75B 3AAKA 2NXQA 3F45A 2Y1MA 4ORBB 1S6JA 1ZFSA 1TTXA 1TCOB 2K7CA 4CFQA 3GK2A 4IL1A 1KFUL 1FBVA 5B8IB 4YGEB 4DCKA 1QX5B 2LANA 1QIVA 4OCIA 1RWYA 2EC6C 2OTGB 2LVIA 4YRUA 2BL0B 1JUOA 4WRIA 1NWDA 5AFPA 1KQMB 1SL7A 5KU1A 1S1EA 1QV0A 1AHRA 5CSFA 1YX7A 2KFGA 1K9UA 5PALA 1L7ZA 2GGZA 1QVIY 2KOTA 2H2KA 3SG3A 4XJKB 4PDZA 1DJXA 2BE4A 3SG4A 2LE9B 2WORA 2K61A 4GBAA 1HQVA 1EL4A 1M46A 1YUTA 2OPOA 4Q04A 1MHOA 2D8NA 1DGUA 1G33A 5ER5A 2FCEA 1F55A 1R6PA 1UHNA 2KI6D 1A4PA 2AUCA 4PHJA 1C7WA 1NX3A 3CR2A 1K8UA 1IG5A 1BT6A 1YX8A 1NX2A 4YGDB 3WHTB 4AQJA 2F2PA 2PRUA 2ZRSA 1MUXA 1S36A 2BBMA 3D0YB 2JWWA 2KBIA 1C07A 2OTGC 5ER4X 1A29A 2BL0C 1YTZC 2MJWB 2KFHA 2JXLA 2ZFDA 2F3YA 1KQMC 1SW8A 1RFJA 4HRGA 4MZKA 3TUYB 3WXAA 1B8CA 1TNWA 5KSZA 4M2PA 3KHEA 3SG7A 1N0YA 4I5LB 2LCPA 4I5NB 1N65A 3E3RA 1Q80A 1XK4C 2V53A 2LM5A 1S26D 1XO5A 1CFPA 2FJUB 3PLFB 1A75A 2HETA 2LVKA 1F71A 1NIWA 1UP5A 4MVFA 2L0PA 1TOPA 1EG4A 1SY9A 1K95A 1SCMB 1CFDA 1NUBA 3EK4A 1DF0B 1OMRA 1J55A 1PRWA 2JQ6A 3NSIA 1SNLA 3BUWB 1K94A 1EJ3A 3O78A 2MBXA 2KGRA 1A03A 1SK6D 1DJIA 1ZUZA 1PVBA 2LHLA 3I5GB 1K90D 3CLNA 2JTTA 4P5OE 1BLQA 2WCFA 1YUUA 2ZN9A 2ZNDA 2LMTA 1GJYA 4FTGA 2JT8A 2PMYA 1B8LA 1PVAA 1V1FA 1Y6WA 4XJKA 1WRLA 2JULA 2K7OA 2JU0A 5FYXA 3TUYC 2LV7A 3CTNA 1R2UA 1YRTB 2Y5IA 1KK7Z 2I18A 1OE9B 1JF2A 1S3PA 1GGWA 3CZTX 4QJ3B 4N5XA 4L9MA 1AJ4A 1XA5A 3KO0A 1M39A 3TS5B 2K2FA 3ZNIA 2WCEA 3BUNB 1AK8A 4D1EA 1IH0A 5K89A 2LAPA 1FI6A 2M7NA 2SCPA 4PE1A 3M0WA 1AJ5A 2TN4A 1YVHA 3D0YA 1BF5A 1KK8B 2JOJA 2K7DA 2CNPA 3PFVA 3BOWB 2LHIA 1QLSA 2M1KB 3EVUA 1J7RA 3I5GC 3TDZA 5I2LA 3DVEA 2LP2A 1LKJA 1RECA 3PN7B 5HKYA 2K0JA 2JPTA 4OKHA 1H8BA 1QS7A 1F4OA 1Y1AA 3BUMB 1EXRA 4TNCA 4MLWA 2CBLA 3IQOA 1KSOA 2CT9A 2L50A 1G4YR 4PHMA 1LINA 1DGVA 5HKWA 2JNXA 1DJHA 5TNCA 1TCFA 2PASA 1IRJA 1IJ5A 1CKKA 2WC8A 1DF0A 4BY4A 1KWOC 3SG5A 1BMOA 1L2OB 1S5GY 4I5JA 3TS5C 3LK1A 1B4CA 1OZOA 1E8AA 2BKHB 4NDCA 3KF9A 2EHBA 5CPVA 3TDIA 1DJZA 1TNXA 2WNDA 3EKJA 5AERA 1KK8C 2KAYA 1MQ1A 4PE0A 3JTDB 1SPYA 2L5XB 1DT7B 1W7JB 1FI5A 2OS8B 4QJ5B 1FW4A 3I5IC 5IBWA 1CFFA 5AANA 3LCPC 2KBMA 3JVTC 3PSRA 1JC2A 2CXJA 2ZN8A 4GGFC 1ODBA 3HCMA 4GUKA 3IQQA 4NDBA 5GQQC 5BPJA 5G08A 1XFWO 1RROA 2FCDA 2JT3A 1B7TY 3C1VA 1UUSA 5J3XA 3EK8A 3BOWA 2KQYA 2E6WA 2KI4B 1XFXO 2I94A 1BOCA 2H61C 2BBNA 1DJYA 4PHKA 2B1UA 4OV2A 5CSIA 2O5GA 3I5FB 1CM4A 1NYAA 3EKHA 5AEQA 2L2EA 2E30A 1BG1A 1SMGA 3KEVA 1NPQA 3GOFA 3JTDC 1LVCD 4JPZB 1BR1B 4GGFA 4WQ3A 1XYDA 3OB2B 1PALA 1UHHA 2OS8C 2WCBA 1KFXL 1B9AA 2AAOA 4FQOA 2NLNA 2CCMA 1ZMZA 3FWBA 1KQVA 4ZCUA 3SJSA 2L51A 3CS1A 5HKZA 5DKQA 2BE6A 1VRKA 3LL8B 2H61A 3OP0A 3OX5A 1CDLA 3O2PA 3CGAA 4PE4A 5DKNA 1F54A 4CLNA 3QRXA 1B1GA 1CB1A 1KFUS 2ZRTA 4MSPA 1RJVA 1OMDA 1TNPA 4ORCB 3IF7A 3EVRA 4A4BA 3OB1B 1W7IB 3OX6A 1K9PA 2LUXA 2M1UA 1LXFC 1PK0D 1PULA 1BU3A 1DJGA 1J1EA 3VROA 2JTZA 4YGCB 2GGMA 1OMVA 2KAXA 3EVVA 1SBJA 3AKBA 1QATA 1NSHA 1BODA 3K21A 5D69A 1QX7A 1XFZO 1F4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M63 B;  3FS7 A;  1QTX A;  4C0J A;  2LLT A;  4MBE A;  4AOM A;  1H4B A;  1QV1 A;  4NDD A;  1U5I B;  1JSA A;  4PHN A;  4WQ2 A;  1CM1 A;  1V1G A;  1Y0V H;  1YUR A;  4PE7 A;  1M31 A;  1SCM C;  3I5H B;  3SG2 A;  1KSM A;  1XFY O;  3TZ1 A;  1RTP 1;  3DF0 B;  4ZCV A;  3DVJ A;  1ZAC A;  3SG6 A;  2Y1N A;  2RGI A;  4BY5 A;  1A2X A;  1SL8 A;  3EK7 A;  2F2O A;  4HRH A;  3MSE B;  3VRR A;  4JQ0 D;  2GV5 A;  2LP3 A;  2MLF C;  2L4I A;  2KI6 C;  4M2O A;  5DKR A;  1KCY A;  1GGZ A;  1BJF A;  3WHU B;  1PSB A;  1CDP A;  2KQ6 A;  1S6C A;  4ORA B;  2JT0 A;  2ISD A;  1SCV A;  3BYA A;  1MR8 A;  4CPV A;  4P2Y B;  2LC5 A;  2HPS A;  1LA3 A;  3OHM B;  1OSA A;  2JZI A;  5JOL A;  1WLZ A;  2BCB A;  4N1G A;  2KHN A;  3HX4 A;  1CNP A;  1DTL A;  4GFT A;  4GPL B;  4CFR A;  1BR4 B;  2F3Z A;  3VGO A;  3GK4 X;  1MWN A;  2Q4U A;  1CLL A;  4ICB A;  2K2A A;  4QJ4 B;  1MF8 B;  4UPG A;  3CWG A;  3I5H C;  2L98 A;  1CLM A;  1Y1X A;  4YBH B;  1D1O A;  2R2I A;  1DJW A;  2IS9 A;  5I2Q A;  4F0Z B;  4YGB B;  2BCA A;  1JFK A;  1PSR A;  4DS7 A;  1YVL A;  3RLZ A;  2K8M B;  2LVV A;  2COL B;  1AUI B;  3PN7 C;  2KAV A;  1QVI Z;  4DUQ A;  2LMU A;  4ETO A;  4I5K A;  2SAS A;  2F8P A;  1SR6 B;  2JXC A;  2KFF A;  3BXK A;  4N1F A;  2M49 B;  4M2Q A;  4OR9 B;  1HT9 A;  1OQP A;  3O4Y A;  4YGA A;  3LLE A;  2NCP A;  5AXI A;  1U5I A;  1ZOT B;  2LLS A;  1CDN A;  3PAL A;  1XVJ A;  1SKT A;  2O60 A;  2NZ0 A;  1IJ6 A;  1B8R A;  3BUX B;  4GNK B;  1EG3 A;  3DF0 A;  4PAL A;  5JJG A;  1L2O C;  2LNK A;  1NCZ A;  3ICB A;  3ZWH A;  1WDC B;  2P6B B;  4MZL A;  1B7T Z;  2QPT A;  4PCW A;  2M97 A;  3NSK A;  2ZKM X;  3BUO B;  4A4C A;  5HLV A;  3LK0 A;  1ALW A;  1WRZ A;  4YI9 A;  4DIR A;  3FWC A;  4MZJ A;  3SIA A;  3DD4 A;  1QIW A;  2G2B A;  4HRE E;  2M8U A;  3A4U B;  2HF5 A;  1QX2 A;  1TIZ A;  2Y4Q A;  1IQ3 A;  3GK1 A;  2KYC A;  3CR4 X;  1JBA A;  1QAS A;  3RM1 A;  1X02 A;  1QXP A;  2JNF A;  1YUS A;  1OZS A;  3PAT A;  1XFU O;  2M3W A;  2ZNE A;  1SL9 A;  1EH2 A;  1IKU A;  1J7O A;  2K7B A;  1K9K A;  3A8R A;  1AVS A;  3BQ3 A;  4OVN F;  2MRD A;  4USL A;  4XYN A;  2MHH A;  3VRN A;  1SR6 C;  4MN0 A;  1RK9 A;  2MAZ A;  1NX0 A;  4MRX A;  1YRU B;  3NSL A;  1CMG A;  1NX1 A;  1J1D A;  2M29 A;  3D10 A;  2M9G A;  3VRQ A;  1K2H A;  5KTY A;  1YR5 A;  4C0K A;  4E68 A;  1MXE A;  2HQW A;  2BKI B;  2F33 A;  1WDC C;  3FIA A;  2KI4 C;  4MEW A;  3SIB A;  4GAO A;  1IQ5 A;  2LMV A;  1UHK A;  2LLU A;  4JWQ A;  1NCX A;  1TN4 A;  1UWO A;  1FPW A;  3I5F C;  2G9B A;  1DVI A;  1UHJ A;  1WLM A;  2KYF A;  1WY9 A;  2LUC A;  1JFJ A;  2KSP A;  4MRY A;  1GQM A;  2PVB A;  1J7P A;  2L4H A;  4C0L A;  3AKA A;  1UHI A;  1FF1 A;  2PAL A;  4CID A;  3NSO A;  5I8N A;  1CMF A;  1JWD A;  2MA2 A;  1N2D A;  2HQ8 A;  1CDM A;  1UUR A;  5I2O A;  2KNE A;  1KK7 Y;  2A4J A;  1XK4 A;  2JRF A;  3VRP A;  1K96 A;  3DVM A;  2AMI A;  1SYM A;  2BEC A;  1ALV A;  4NQG A;  2I2R E;  1SRA A;  1Y1U A;  1B47 A;  2M0R A;  1KWO B;  5D7F A;  2Q91 A;  3CR5 X;  1S6I A;  4HSZ A;  1WRK A;  1JF0 A;  2EC6 B;  2LVJ A;  2KGB C;  1J7Q A;  1K93 D;  4U8D A;  1CTR A;  2DOQ A;  3H4S E;  1QLK A;  1TNQ A;  3AAJ A;  3PM8 A;  5CSN A;  1IWQ A;  2PSR A;  2VRG A;  1XFV O;  3TDU A;  2QAC A;  1QJT A;  1LA0 A;  1NP8 A;  2WOS A;  3O6B A;  5F6T A;  2CTN A;  3NXA A;  5HLO A;  5HYD A;  1NCY A;  2EGD A;  3DVK A;  2JC2 A;  4GGN A;  1DMO A;  4YI8 A;  2M7L A;  1KFX S;  4DRW A;  3WNX B;  1MXL C;  1F8H A;  3KPX A;  2KDH A;  1CFC A;  1S5G Z;  4R1E A;  1AP4 A;  3I5I B;  1IGV A;  1OOJ A;  1CLB A;  2BCX A;  1C7V A;  1M45 A;  2FOT A;  5CSJ A;  3JVT B;  1F70 A;  2I7A A;  1TRF A;  1G8I A;  4AQI A;  2NCO A;  2MLE C;  1A75 B;  3AAK A;  2NXQ A;  3F45 A;  2Y1M A;  4ORB B;  1S6J A;  1ZFS A;  1TTX A;  1TCO B;  2K7C A;  4CFQ A;  3GK2 A;  4IL1 A;  1KFU L;  1FBV A;  5B8I B;  4YGE B;  4DCK A;  1QX5 B;  2LAN A;  1QIV A;  4OCI A;  1RWY A;  2EC6 C;  2OTG B;  2LVI A;  4YRU A;  2BL0 B;  1JUO A;  4WRI A;  1NWD A;  5AFP A;  1KQM B;  1SL7 A;  5KU1 A;  1S1E A;  1QV0 A;  1AHR A;  5CSF A;  1YX7 A;  2KFG A;  1K9U A;  5PAL A;  1L7Z A;  2GGZ A;  1QVI Y;  2KOT A;  2H2K A;  3SG3 A;  4XJK B;  4PDZ A;  1DJX A;  2BE4 A;  3SG4 A;  2LE9 B;  2WOR A;  2K61 A;  4GBA A;  1HQV A;  1EL4 A;  1M46 A;  1YUT A;  2OPO A;  4Q04 A;  1MHO A;  2D8N A;  1DGU A;  1G33 A;  5ER5 A;  2FCE A;  1F55 A;  1R6P A;  1UHN A;  2KI6 D;  1A4P A;  2AUC A;  4PHJ A;  1C7W A;  1NX3 A;  3CR2 A;  1K8U A;  1IG5 A;  1BT6 A;  1YX8 A;  1NX2 A;  4YGD B;  3WHT B;  4AQJ A;  2F2P A;  2PRU A;  2ZRS A;  1MUX A;  1S36 A;  2BBM A;  3D0Y B;  2JWW A;  2KBI A;  1C07 A;  2OTG C;  5ER4 X;  1A29 A;  2BL0 C;  1YTZ C;  2MJW B;  2KFH A;  2JXL A;  2ZFD A;  2F3Y A;  1KQM C;  1SW8 A;  1RFJ A;  4HRG A;  4MZK A;  3TUY B;  3WXA A;  1B8C A;  1TNW A;  5KSZ A;  4M2P A;  3KHE A;  3SG7 A;  1N0Y A;  4I5L B;  2LCP A;  4I5N B;  1N65 A;  3E3R A;  1Q80 A;  1XK4 C;  2V53 A;  2LM5 A;  1S26 D;  1XO5 A;  1CFP A;  2FJU B;  3PLF B;  1A75 A;  2HET A;  2LVK A;  1F71 A;  1NIW A;  1UP5 A;  4MVF A;  2L0P A;  1TOP A;  1EG4 A;  1SY9 A;  1K95 A;  1SCM B;  1CFD A;  1NUB A;  3EK4 A;  1DF0 B;  1OMR A;  1J55 A;  1PRW A;  2JQ6 A;  3NSI A;  1SNL A;  3BUW B;  1K94 A;  1EJ3 A;  3O78 A;  2MBX A;  2KGR A;  1A03 A;  1SK6 D;  1DJI A;  1ZUZ A;  1PVB A;  2LHL A;  3I5G B;  1K90 D;  3CLN A;  2JTT A;  4P5O E;  1BLQ A;  2WCF A;  1YUU A;  2ZN9 A;  2ZND A;  2LMT A;  1GJY A;  4FTG A;  2JT8 A;  2PMY A;  1B8L A;  1PVA A;  1V1F A;  1Y6W A;  4XJK A;  1WRL A;  2JUL A;  2K7O A;  2JU0 A;  5FYX A;  3TUY C;  2LV7 A;  3CTN A;  1R2U A;  1YRT B;  2Y5I A;  1KK7 Z;  2I18 A;  1OE9 B;  1JF2 A;  1S3P A;  1GGW A;  3CZT X;  4QJ3 B;  4N5X A;  4L9M A;  1AJ4 A;  1XA5 A;  3KO0 A;  1M39 A;  3TS5 B;  2K2F A;  3ZNI A;  2WCE A;  3BUN B;  1AK8 A;  4D1E A;  1IH0 A;  5K89 A;  2LAP A;  1FI6 A;  2M7N A;  2SCP A;  4PE1 A;  3M0W A;  1AJ5 A;  2TN4 A;  1YVH A;  3D0Y A;  1BF5 A;  1KK8 B;  2JOJ A;  2K7D A;  2CNP A;  3PFV A;  3BOW B;  2LHI A;  1QLS A;  2M1K B;  3EVU A;  1J7R A;  3I5G C;  3TDZ A;  5I2L A;  3DVE A;  2LP2 A;  1LKJ A;  1REC A;  3PN7 B;  5HKY A;  2K0J A;  2JPT A;  4OKH A;  1H8B A;  1QS7 A;  1F4O A;  1Y1A A;  3BUM B;  1EXR A;  4TNC A;  4MLW A;  2CBL A;  3IQO A;  1KSO A;  2CT9 A;  2L50 A;  1G4Y R;  4PHM A;  1LIN A;  1DGV A;  5HKW A;  2JNX A;  1DJH A;  5TNC A;  1TCF A;  2PAS A;  1IRJ A;  1IJ5 A;  1CKK A;  2WC8 A;  1DF0 A;  4BY4 A;  1KWO C;  3SG5 A;  1BMO A;  1L2O B;  1S5G Y;  4I5J A;  3TS5 C;  3LK1 A;  1B4C A;  1OZO A;  1E8A A;  2BKH B;  4NDC A;  3KF9 A;  2EHB A;  5CPV A;  3TDI A;  1DJZ A;  1TNX A;  2WND A;  3EKJ A;  5AER A;  1KK8 C;  2KAY A;  1MQ1 A;  4PE0 A;  3JTD B;  1SPY A;  2L5X B;  1DT7 B;  1W7J B;  1FI5 A;  2OS8 B;  4QJ5 B;  1FW4 A;  3I5I C;  5IBW A;  1CFF A;  5AAN A;  3LCP C;  2KBM A;  3JVT C;  3PSR A;  1JC2 A;  2CXJ A;  2ZN8 A;  4GGF C;  1ODB A;  3HCM A;  4GUK A;  3IQQ A;  4NDB A;  5GQQ C;  5BPJ A;  5G08 A;  1XFW O;  1RRO A;  2FCD A;  2JT3 A;  1B7T Y;  3C1V A;  1UUS A;  5J3X A;  3EK8 A;  3BOW A;  2KQY A;  2E6W A;  2KI4 B;  1XFX O;  2I94 A;  1BOC A;  2H61 C;  2BBN A;  1DJY A;  4PHK A;  2B1U A;  4OV2 A;  5CSI A;  2O5G A;  3I5F B;  1CM4 A;  1NYA A;  3EKH A;  5AEQ A;  2L2E A;  2E30 A;  1BG1 A;  1SMG A;  3KEV A;  1NPQ A;  3GOF A;  3JTD C;  1LVC D;  4JPZ B;  1BR1 B;  4GGF A;  4WQ3 A;  1XYD A;  3OB2 B;  1PAL A;  1UHH A;  2OS8 C;  2WCB A;  1KFX L;  1B9A A;  2AAO A;  4FQO A;  2NLN A;  2CCM A;  1ZMZ A;  3FWB A;  1KQV A;  4ZCU A;  3SJS A;  2L51 A;  3CS1 A;  5HKZ A;  5DKQ A;  2BE6 A;  1VRK A;  3LL8 B;  2H61 A;  3OP0 A;  3OX5 A;  1CDL A;  3O2P A;  3CGA A;  4PE4 A;  5DKN A;  1F54 A;  4CLN A;  3QRX A;  1B1G A;  1CB1 A;  1KFU S;  2ZRT A;  4MSP A;  1RJV A;  1OMD A;  1TNP A;  4ORC B;  3IF7 A;  3EVR A;  4A4B A;  3OB1 B;  1W7I B;  3OX6 A;  1K9P A;  2LUX A;  2M1U A;  1LXF C;  1PK0 D;  1PUL A;  1BU3 A;  1DJG A;  1J1E A;  3VRO A;  2JTZ A;  4YGC B;  2GGM A;  1OMV A;  2KAX A;  3EVV A;  1SBJ A;  3AKB A;  1QAT A;  1NSH A;  1BOD A;  3K21 A;  5D69 A;  1QX7 A;  1XFZ O;  1F4Q A; 
#chains in the Genus database with same CATH topology
 1M63 B;  1Z2C B;  1QTX A;  3FS7 A;  4C0J A;  2LLT A;  4MBE A;  4AOM A;  1H4B A;  3BFH A;  4KYN A;  1QV1 A;  4NDD A;  1U5I B;  1JSA A;  4PHN A;  4WQ2 A;  1CM1 A;  1V1G A;  1Y0V H;  1YUR A;  2WCH A;  1M31 A;  1SCM C;  4PE7 A;  3I5H B;  3SG2 A;  1KSM A;  1XFY O;  3R1P A;  1RTP 1;  3DF0 B;  4INW A;  3DVJ A;  4ZCV A;  3TZ1 A;  1ZAC A;  3SG6 A;  2Y1N A;  2RGI A;  4BY5 A;  2QEB A;  1A2X A;  1SL8 A;  3B7A A;  2F2O A;  3EK7 A;  4HRH A;  1OOH A;  3MSE B;  3VRR A;  4JQ0 D;  1TUZ A;  2GV5 A;  2LP3 A;  2MLF C;  2L4I A;  2KI6 C;  3NHI A;  4M2O A;  5DKR A;  1KCY A;  1GGZ A;  1BJF A;  3WHU B;  1PSB A;  1CDP A;  2KQ6 A;  1OOG A;  1S6C A;  4PT1 A;  4ORA B;  2JT0 A;  2ISD A;  1SCV A;  3BYA A;  1MR8 A;  4CPV A;  4P2Y B;  2LC5 A;  2HPS A;  1LA3 A;  3OHM B;  1OSA A;  2JZI A;  3B6X A;  5JOL A;  1WLZ A;  2BCB A;  4N1G A;  2KHN A;  3HX4 A;  1CNP A;  1DTL A;  4GFT A;  4GPL B;  4CFR A;  3CAB A;  1BR4 B;  2F3Z A;  3VGO A;  3GK4 X;  1MWN A;  2Q4U A;  1CLL A;  4ICB A;  2K2A A;  4QJ4 B;  3PM2 A;  1MF8 B;  5EL2 A;  3CWG A;  3I5H C;  4UPG A;  1C3Z A;  2L98 A;  1CLM A;  1Y1X A;  2WCK A;  4YBH B;  2R2I A;  1D1O A;  1DJW A;  2IS9 A;  5I2Q A;  4F0Z B;  4YGB B;  2BCA A;  1JFK A;  1PSR A;  4DS7 A;  1LS8 A;  1YVL A;  3RLZ A;  2K8M B;  2LVV A;  2COL B;  1AUI B;  3PN7 C;  2KAV A;  1QVI Z;  4DUQ A;  2LMU A;  4ETO A;  3S0F A;  4I5K A;  2SAS A;  2F8P A;  1SR6 B;  2JXC A;  2KFF A;  3BXK A;  4N1F A;  2K60 A;  2M49 B;  4M2Q A;  3SS3 A;  4OR9 B;  1HT9 A;  1OQP A;  3O4Y A;  4YGA A;  3LLE A;  2NCP A;  5AXI A;  1U5I A;  4JD9 A;  1ZOT B;  2LLS A;  1CDN A;  3PAL A;  1XVJ A;  1SKT A;  2O60 A;  2L5Y A;  2NZ0 A;  1IJ6 A;  1B8R A;  3BUX B;  4GNK B;  1EG3 A;  3DF0 A;  4PAL A;  5JJG A;  1L2O C;  2LNK A;  1NCZ A;  2ERB A;  3ICB A;  1WDC B;  2P6B B;  4MZL A;  3CDN A;  1B7T Z;  3ZWH A;  2QPT A;  4PCW A;  2M97 A;  3NSK A;  2ZKM X;  3BUO B;  4A4C A;  5HLV A;  3LK0 A;  1ALW A;  1WRZ A;  4YI9 A;  4DIR A;  3FWC A;  4MZJ A;  3SIA A;  3DD4 A;  1QIW A;  2G2B A;  4HRE E;  2M8U A;  3A4U B;  2HF5 A;  1QX2 A;  1TIZ A;  2Y4Q A;  1IQ3 A;  3GK1 A;  2KYC A;  3CR4 X;  1JBA A;  1QAS A;  3RM1 A;  1X02 A;  1QXP A;  2JNF A;  3CYZ A;  1YUS A;  3Q8I A;  1OZS A;  3PAT A;  1XFU O;  2M3W A;  2ZNE A;  1SL9 A;  1EH2 A;  1IKU A;  1GM0 A;  1T14 A;  2K7B A;  1J7O A;  1K9K A;  3A8R A;  1AVS A;  3BQ3 A;  4OVN F;  2MRD A;  4USL A;  4XYN A;  2MHH A;  3VRN A;  1SR6 C;  4MN0 A;  1RK9 A;  2MAZ A;  1NX0 A;  4MRX A;  1YRU B;  3NSL A;  1CMG A;  1NX1 A;  1J1D A;  2M29 A;  3D10 A;  2M9G A;  4OZD A;  3VRQ A;  1K2H A;  5KTY A;  1YR5 A;  4C0K A;  4E68 A;  1MXE A;  2HQW A;  2BKI B;  2F33 A;  5D3O A;  1WDC C;  3FIA A;  2KI4 C;  4IJ7 A;  4MEW A;  3SIB A;  1DEL A;  4GAO A;  1IQ5 A;  2LMV A;  1UHK A;  2LLU A;  4JWQ A;  1NCX A;  1TN4 A;  1UWO A;  1FPW A;  3VB1 A;  3I5F C;  2G9B A;  1C3Y A;  1DVI A;  1UHJ A;  1WLM A;  2KYF A;  5I94 A;  1WY9 A;  2LUC A;  1DC1 A;  1JFJ A;  2KSP A;  4MRY A;  1GQM A;  2PVB A;  1J7P A;  2BNX A;  2L4H A;  4C0L A;  3AKA A;  1UHI A;  1FF1 A;  2PAL A;  4CID A;  3NSO A;  5I8N A;  3DXL A;  3L4L A;  1CMF A;  1JWD A;  2MA2 A;  1N2D A;  2HQ8 A;  4FQT A;  3SS5 A;  1CDM A;  1UUR A;  5I2O A;  2KNE A;  1KK7 Y;  2A4J A;  3N7H A;  5FI2 A;  1XK4 A;  2JRF A;  2WCM A;  3VRP A;  1K96 A;  3DVM A;  2AMI A;  1SYM A;  2BEC A;  1ALV A;  4NQG A;  3BFA A;  2I2R E;  1SRA A;  1Y1U A;  1B47 A;  2M0R A;  2GTE A;  1KWO B;  5D7F A;  2Q91 A;  3R1V A;  3CR5 X;  1S6I A;  4HSZ A;  1WRK A;  1JF0 A;  2EC6 B;  2WCJ A;  2LVJ A;  2KGB C;  1J7Q A;  1K93 D;  4U8D A;  1CTR A;  2DOQ A;  3H4S E;  1QLK A;  1TNQ A;  3DY9 A;  3CZ0 A;  3AAJ A;  3PM8 A;  3K1E A;  5CSN A;  1IWQ A;  1TWO A;  2PSR A;  1XFV O;  2VRG A;  2QAC A;  1QJT A;  1LA0 A;  1P28 A;  1NP8 A;  3TDU A;  2WOS A;  3O6B A;  5F6T A;  2CTN A;  3NXA A;  5HLO A;  5HYD A;  1NCY A;  2EGD A;  3DVK A;  2JC2 A;  4GGN A;  1DMO A;  4YI8 A;  2M7L A;  1KFX S;  4DRW A;  3WNX B;  1MXL C;  2FJY A;  1F8H A;  3KPX A;  2KDH A;  1CFC A;  1S5G Z;  4R1E A;  1AP4 A;  3I5I B;  1IGV A;  1OOJ A;  1CLB A;  2BCX A;  1C7V A;  1M45 A;  2FOT A;  5CSJ A;  3JVT B;  1F70 A;  2I7A A;  3S0A A;  1TRF A;  1G8I A;  4AQI A;  2NCO A;  2MLE C;  1A75 B;  1XFR A;  3AAK A;  3DZT A;  2NXQ A;  3F45 A;  2Y1M A;  4ORB B;  3D76 A;  1S6J A;  1ZFS A;  1TTX A;  1TCO B;  2K7C A;  4CFQ A;  3GK2 A;  4IL1 A;  1KFU L;  1FBV A;  5B8I B;  4YGE B;  4DCK A;  1QX5 B;  2LAN A;  1QIV A;  4OCI A;  1RWY A;  2EC6 C;  2OTG B;  2LVI A;  3V2L A;  2BL0 B;  1JUO A;  4WRI A;  4YRU A;  1NWD A;  5AFP A;  1KQM B;  1SL7 A;  5KU1 A;  1S1E A;  5HL1 A;  1QV0 A;  1AHR A;  5CSF A;  1YX7 A;  2KFG A;  1K9U A;  5PAL A;  3S0E A;  1L7Z A;  2PQL A;  2GGZ A;  1QVI Y;  2KOT A;  2H2K A;  3SG3 A;  4XJK B;  4PDZ A;  1DJX A;  2BE4 A;  3SG4 A;  1IIO A;  2LE9 B;  2WOR A;  2K61 A;  3DYE A;  4GBA A;  1HQV A;  1EL4 A;  1M46 A;  1YUT A;  2OPO A;  4Q04 A;  3BFB A;  1MHO A;  2D8N A;  3D74 A;  1DGU A;  2QDI A;  1G33 A;  5ER5 A;  2FCE A;  1F55 A;  1R6P A;  1UHN A;  2KI6 D;  4F7F A;  1A4P A;  2AUC A;  4PHJ A;  1C7W A;  1NX3 A;  3CR2 A;  1K8U A;  1IG5 A;  1BT6 A;  1YX8 A;  1NX2 A;  4YGD B;  3WHT B;  4AQJ A;  2F2P A;  2PRU A;  4JKT A;  2ZRS A;  3FE8 A;  1MUX A;  1S36 A;  2BBM A;  3D0Y B;  2JWW A;  2KBI A;  1C07 A;  2OTG C;  5ER4 X;  1A29 A;  2BL0 C;  3D73 A;  1YTZ C;  2MJW B;  2KFH A;  2JXL A;  2ZFD A;  2F3Y A;  1KQM C;  1SW8 A;  1RFJ A;  4HRG A;  4MZK A;  3TUY B;  2P71 A;  3WXA A;  1B8C A;  1TNW A;  2YGU A;  5KSZ A;  4M2P A;  3KHE A;  3SG7 A;  1N0Y A;  4I5L B;  3D77 A;  2LCP A;  4I5N B;  1N65 A;  3E3R A;  1Q80 A;  1XK4 C;  2V53 A;  2LM5 A;  1S26 D;  1XO5 A;  3UNW A;  1CFP A;  2FJU B;  3PLF B;  1A75 A;  2HET A;  2LVK A;  1F71 A;  1NIW A;  1UP5 A;  4MVF A;  2L0P A;  1TOP A;  1EG4 A;  1SY9 A;  1K95 A;  1SCM B;  1TUJ A;  1CFD A;  1NUB A;  2WC6 A;  3EK4 A;  3NGV A;  1DF0 B;  3L47 A;  1OMR A;  1J55 A;  1PRW A;  2JQ6 A;  3NSI A;  1SNL A;  3BUW B;  1K94 A;  3D75 A;  1OOI X;  1EJ3 A;  3O78 A;  2MBX A;  2KGR A;  1A03 A;  1SK6 D;  1DJI A;  1ZUZ A;  1PVB A;  2LHL A;  3I5G B;  1K90 D;  3CLN A;  2JTT A;  4P5O E;  1BLQ A;  2WCF A;  1YUU A;  3S0G A;  2ZN9 A;  2ZND A;  2LMT A;  1GJY A;  4FTG A;  2JT8 A;  2PMY A;  1B8L A;  1PVA A;  1V1F A;  1Y6W A;  4XJK A;  1WRL A;  2JUL A;  2K7O A;  2JU0 A;  5FYX A;  3TUY C;  2LV7 A;  3CTN A;  1R2U A;  3QME A;  1YRT B;  2Y5I A;  1KK7 Z;  2KLD A;  2H8V A;  2I18 A;  1OE9 B;  2QEO A;  1JF2 A;  1S3P A;  1GGW A;  3CZT X;  4QJ3 B;  4N5X A;  4L9M A;  1AJ4 A;  1XA5 A;  3KO0 A;  1M39 A;  1OOF A;  3TS5 B;  2K2F A;  3B88 A;  3ZNI A;  2WCE A;  3BUN B;  3FE9 A;  1AK8 A;  4D1E A;  1IH0 A;  5K89 A;  1DQE A;  2LAP A;  2M7N A;  2SCP A;  4PE1 A;  1DEK A;  3M0W A;  1AJ5 A;  2TN4 A;  1FI6 A;  1YVH A;  3D0Y A;  2WCL A;  1BF5 A;  1KK8 B;  2JOJ A;  2K7D A;  2CNP A;  3PFV A;  3BOW B;  2LHI A;  1W9Z A;  1QLS A;  2M1K B;  3EVU A;  1J7R A;  3EG5 B;  3I5G C;  3TDZ A;  5I2L A;  3DVE A;  2LP2 A;  1LKJ A;  1REC A;  3D78 A;  3PN7 B;  3PJI A;  4INX A;  2K0J A;  2JPT A;  5HKY A;  4OKH A;  1H8B A;  1QS7 A;  1F4O A;  1Y1A A;  3BUM B;  2QEV A;  3O4X A;  1EXR A;  3NHT A;  2WC5 A;  3L4A A;  4TNC A;  4MLW A;  2BAP A;  2KLE A;  2CBL A;  3IQO A;  3OBV A;  1KSO A;  2CT9 A;  2L50 A;  1G4Y R;  4PHM A;  1LIN A;  2P70 A;  1DGV A;  5HKW A;  2JNX A;  1DJH A;  5TNC A;  1TCF A;  2PAS A;  3IVT A;  1IRJ A;  1IJ5 A;  1CKK A;  1QWV A;  2WC8 A;  1DF0 A;  4BY4 A;  1KWO C;  3SG5 A;  1BMO A;  1L2O B;  1S5G Y;  3BJH A;  4I5J A;  3TS5 C;  3LK1 A;  1OW4 A;  1B4C A;  1OZO A;  1E8A A;  2BKH B;  4NDC A;  3KF9 A;  2EHB A;  5CPV A;  3TDI A;  1DJZ A;  1TNX A;  2PYQ A;  2WND A;  3EKJ A;  3RZS A;  5AER A;  1KK8 C;  2KAY A;  1MQ1 A;  4PE0 A;  3JTD B;  1SPY A;  2L5X B;  1DT7 B;  1W7J B;  1FI5 A;  2OS8 B;  4QJ5 B;  1SSE B;  1FW4 A;  3I5I C;  3S0B A;  5IBW A;  1CFF A;  5AAN A;  3LCP C;  2KBM A;  3JVT C;  3PSR A;  1JC2 A;  2CXJ A;  2ZN8 A;  4GGF C;  1ODB A;  3HCM A;  4GUK A;  3IQQ A;  4NDB A;  5GQQ C;  5BPJ A;  5G08 A;  1XFW O;  2QEH A;  1RRO A;  2FCD A;  2JT3 A;  1B7T Y;  3C1V A;  2KPH A;  1UUS A;  3B86 A;  2L2C A;  5J3X A;  3FE6 A;  3EK8 A;  3BOW A;  5FI6 A;  2KQY A;  2E6W A;  2KI4 B;  1XFX O;  2I94 A;  3B87 A;  1BOC A;  2H61 C;  2BBN A;  1DJY A;  4PHK A;  2B1U A;  4OV2 A;  5CSI A;  2O5G A;  3I5F B;  1CM4 A;  1NYA A;  3EKH A;  5AEQ A;  3R1O A;  2L2E A;  2E30 A;  5DIC A;  1BG1 A;  1SMG A;  3KEV A;  1NPQ A;  3GOF A;  3JTD C;  1LVC D;  4JPZ B;  1BR1 B;  4GGF A;  4WQ3 A;  1XYD A;  3OB2 B;  1PAL A;  1UHH A;  2OS8 C;  2WCB A;  1KFX L;  1B9A A;  2AAO A;  4FQO A;  2NLN A;  2CCM A;  1ZMZ A;  3FWB A;  1KQV A;  4ZCU A;  3SJS A;  2L51 A;  3CS1 A;  5HKZ A;  5DKQ A;  5FI7 A;  2BE6 A;  1VRK A;  3R72 A;  3LL8 B;  2H61 A;  3OP0 A;  3OX5 A;  1CDL A;  3O2P A;  3CGA A;  4PE4 A;  5DKN A;  1F54 A;  1Z4H A;  4CLN A;  3QRX A;  1B1G A;  1CB1 A;  1KFU S;  2ZRT A;  4MSP A;  1RJV A;  1OMD A;  1TNP A;  4ORC B;  3IF7 A;  3EVR A;  3SS4 A;  3UO9 A;  4A4B A;  1ORG A;  3OB1 B;  1W7I B;  3OX6 A;  3OGN A;  1K9P A;  2LUX A;  2M1U A;  2JPO A;  1LXF C;  1PK0 D;  1PUL A;  1BU3 A;  1DJG A;  1J1E A;  3VRO A;  2JTZ A;  3CZ1 A;  2GGM A;  3CZ2 A;  1OMV A;  4YGC B;  2KAX A;  3EVV A;  3S0D A;  1SBJ A;  3AKB A;  1QAT A;  1NSH A;  1BOD A;  3K21 A;  5D69 A;  1QX7 A;  1XFZ O;  1F4Q A; 
#chains in the Genus database with same CATH homology
 1M63 B;  3FS7 A;  1QTX A;  4C0J A;  2LLT A;  4MBE A;  4AOM A;  1H4B A;  1QV1 A;  4NDD A;  1U5I B;  1JSA A;  4PHN A;  4WQ2 A;  1CM1 A;  1V1G A;  1Y0V H;  1YUR A;  4PE7 A;  1M31 A;  1SCM C;  3I5H B;  3SG2 A;  1KSM A;  1XFY O;  3TZ1 A;  1RTP 1;  3DF0 B;  4ZCV A;  3DVJ A;  1ZAC A;  3SG6 A;  2Y1N A;  2RGI A;  4BY5 A;  1A2X A;  1SL8 A;  3EK7 A;  2F2O A;  4HRH A;  3MSE B;  3VRR A;  4JQ0 D;  2GV5 A;  2LP3 A;  2MLF C;  2L4I A;  2KI6 C;  4M2O A;  5DKR A;  1KCY A;  1GGZ A;  1BJF A;  3WHU B;  1PSB A;  1CDP A;  2KQ6 A;  1S6C A;  4ORA B;  2JT0 A;  2ISD A;  1SCV A;  3BYA A;  1MR8 A;  4CPV A;  4P2Y B;  2LC5 A;  2HPS A;  1LA3 A;  3OHM B;  1OSA A;  2JZI A;  5JOL A;  1WLZ A;  2BCB A;  4N1G A;  2KHN A;  3HX4 A;  1CNP A;  1DTL A;  4GFT A;  4GPL B;  4CFR A;  1BR4 B;  2F3Z A;  3VGO A;  3GK4 X;  1MWN A;  2Q4U A;  1CLL A;  4ICB A;  2K2A A;  4QJ4 B;  1MF8 B;  4UPG A;  3CWG A;  3I5H C;  2L98 A;  1CLM A;  1Y1X A;  4YBH B;  1D1O A;  2R2I A;  1DJW A;  2IS9 A;  5I2Q A;  4F0Z B;  4YGB B;  2BCA A;  1JFK A;  1PSR A;  4DS7 A;  1YVL A;  3RLZ A;  2K8M B;  2LVV A;  2COL B;  1AUI B;  3PN7 C;  2KAV A;  1QVI Z;  4DUQ A;  2LMU A;  4ETO A;  4I5K A;  2SAS A;  2F8P A;  1SR6 B;  2JXC A;  2KFF A;  3BXK A;  4N1F A;  2M49 B;  4M2Q A;  4OR9 B;  1HT9 A;  1OQP A;  3O4Y A;  4YGA A;  3LLE A;  2NCP A;  5AXI A;  1U5I A;  1ZOT B;  2LLS A;  1CDN A;  3PAL A;  1XVJ A;  1SKT A;  2O60 A;  2NZ0 A;  1IJ6 A;  1B8R A;  3BUX B;  4GNK B;  1EG3 A;  3DF0 A;  4PAL A;  5JJG A;  1L2O C;  2LNK A;  1NCZ A;  3ICB A;  3ZWH A;  1WDC B;  2P6B B;  4MZL A;  1B7T Z;  2QPT A;  4PCW A;  2M97 A;  3NSK A;  2ZKM X;  3BUO B;  4A4C A;  5HLV A;  3LK0 A;  1ALW A;  1WRZ A;  4YI9 A;  4DIR A;  3FWC A;  4MZJ A;  3SIA A;  3DD4 A;  1QIW A;  2G2B A;  4HRE E;  2M8U A;  3A4U B;  2HF5 A;  1QX2 A;  1TIZ A;  2Y4Q A;  1IQ3 A;  3GK1 A;  2KYC A;  3CR4 X;  1JBA A;  1QAS A;  3RM1 A;  1X02 A;  1QXP A;  2JNF A;  1YUS A;  1OZS A;  3PAT A;  1XFU O;  2M3W A;  2ZNE A;  1SL9 A;  1EH2 A;  1IKU A;  1J7O A;  2K7B A;  1K9K A;  3A8R A;  1AVS A;  3BQ3 A;  4OVN F;  2MRD A;  4USL A;  4XYN A;  2MHH A;  3VRN A;  1SR6 C;  4MN0 A;  1RK9 A;  2MAZ A;  1NX0 A;  4MRX A;  1YRU B;  3NSL A;  1CMG A;  1NX1 A;  1J1D A;  2M29 A;  3D10 A;  2M9G A;  3VRQ A;  1K2H A;  5KTY A;  1YR5 A;  4C0K A;  4E68 A;  1MXE A;  2HQW A;  2BKI B;  2F33 A;  1WDC C;  3FIA A;  2KI4 C;  4MEW A;  3SIB A;  4GAO A;  1IQ5 A;  2LMV A;  1UHK A;  2LLU A;  4JWQ A;  1NCX A;  1TN4 A;  1UWO A;  1FPW A;  3I5F C;  2G9B A;  1DVI A;  1UHJ A;  1WLM A;  2KYF A;  1WY9 A;  2LUC A;  1JFJ A;  2KSP A;  4MRY A;  1GQM A;  2PVB A;  1J7P A;  2L4H A;  4C0L A;  3AKA A;  1UHI A;  1FF1 A;  2PAL A;  4CID A;  3NSO A;  5I8N A;  1CMF A;  1JWD A;  2MA2 A;  1N2D A;  2HQ8 A;  1CDM A;  1UUR A;  5I2O A;  2KNE A;  1KK7 Y;  2A4J A;  1XK4 A;  2JRF A;  3VRP A;  1K96 A;  3DVM A;  2AMI A;  1SYM A;  2BEC A;  1ALV A;  4NQG A;  2I2R E;  1SRA A;  1Y1U A;  1B47 A;  2M0R A;  1KWO B;  5D7F A;  2Q91 A;  3CR5 X;  1S6I A;  4HSZ A;  1WRK A;  1JF0 A;  2EC6 B;  2LVJ A;  2KGB C;  1J7Q A;  1K93 D;  4U8D A;  1CTR A;  2DOQ A;  3H4S E;  1QLK A;  1TNQ A;  3AAJ A;  3PM8 A;  5CSN A;  1IWQ A;  2PSR A;  2VRG A;  1XFV O;  3TDU A;  2QAC A;  1QJT A;  1LA0 A;  1NP8 A;  2WOS A;  3O6B A;  5F6T A;  2CTN A;  3NXA A;  5HLO A;  5HYD A;  1NCY A;  2EGD A;  3DVK A;  2JC2 A;  4GGN A;  1DMO A;  4YI8 A;  2M7L A;  1KFX S;  4DRW A;  3WNX B;  1MXL C;  1F8H A;  3KPX A;  2KDH A;  1CFC A;  1S5G Z;  4R1E A;  1AP4 A;  3I5I B;  1IGV A;  1OOJ A;  1CLB A;  2BCX A;  1C7V A;  1M45 A;  2FOT A;  5CSJ A;  3JVT B;  1F70 A;  2I7A A;  1TRF A;  1G8I A;  4AQI A;  2NCO A;  2MLE C;  1A75 B;  3AAK A;  2NXQ A;  3F45 A;  2Y1M A;  4ORB B;  1S6J A;  1ZFS A;  1TTX A;  1TCO B;  2K7C A;  4CFQ A;  3GK2 A;  4IL1 A;  1KFU L;  1FBV A;  5B8I B;  4YGE B;  4DCK A;  1QX5 B;  2LAN A;  1QIV A;  4OCI A;  1RWY A;  2EC6 C;  2OTG B;  2LVI A;  4YRU A;  2BL0 B;  1JUO A;  4WRI A;  1NWD A;  5AFP A;  1KQM B;  1SL7 A;  5KU1 A;  1S1E A;  1QV0 A;  1AHR A;  5CSF A;  1YX7 A;  2KFG A;  1K9U A;  5PAL A;  1L7Z A;  2GGZ A;  1QVI Y;  2KOT A;  2H2K A;  3SG3 A;  4XJK B;  4PDZ A;  1DJX A;  2BE4 A;  3SG4 A;  2LE9 B;  2WOR A;  2K61 A;  4GBA A;  1HQV A;  1EL4 A;  1M46 A;  1YUT A;  2OPO A;  4Q04 A;  1MHO A;  2D8N A;  1DGU A;  1G33 A;  5ER5 A;  2FCE A;  1F55 A;  1R6P A;  1UHN A;  2KI6 D;  1A4P A;  2AUC A;  4PHJ A;  1C7W A;  1NX3 A;  3CR2 A;  1K8U A;  1IG5 A;  1BT6 A;  1YX8 A;  1NX2 A;  4YGD B;  3WHT B;  4AQJ A;  2F2P A;  2PRU A;  2ZRS A;  1MUX A;  1S36 A;  2BBM A;  3D0Y B;  2JWW A;  2KBI A;  1C07 A;  2OTG C;  5ER4 X;  1A29 A;  2BL0 C;  1YTZ C;  2MJW B;  2KFH A;  2JXL A;  2ZFD A;  2F3Y A;  1KQM C;  1SW8 A;  1RFJ A;  4HRG A;  4MZK A;  3TUY B;  3WXA A;  1B8C A;  1TNW A;  5KSZ A;  4M2P A;  3KHE A;  3SG7 A;  1N0Y A;  4I5L B;  2LCP A;  4I5N B;  1N65 A;  3E3R A;  1Q80 A;  1XK4 C;  2V53 A;  2LM5 A;  1S26 D;  1XO5 A;  1CFP A;  2FJU B;  3PLF B;  1A75 A;  2HET A;  2LVK A;  1F71 A;  1NIW A;  1UP5 A;  4MVF A;  2L0P A;  1TOP A;  1EG4 A;  1SY9 A;  1K95 A;  1SCM B;  1CFD A;  1NUB A;  3EK4 A;  1DF0 B;  1OMR A;  1J55 A;  1PRW A;  2JQ6 A;  3NSI A;  1SNL A;  3BUW B;  1K94 A;  1EJ3 A;  3O78 A;  2MBX A;  2KGR A;  1A03 A;  1SK6 D;  1DJI A;  1ZUZ A;  1PVB A;  2LHL A;  3I5G B;  1K90 D;  3CLN A;  2JTT A;  4P5O E;  1BLQ A;  2WCF A;  1YUU A;  2ZN9 A;  2ZND A;  2LMT A;  1GJY A;  4FTG A;  2JT8 A;  2PMY A;  1B8L A;  1PVA A;  1V1F A;  1Y6W A;  4XJK A;  1WRL A;  2JUL A;  2K7O A;  2JU0 A;  5FYX A;  3TUY C;  2LV7 A;  3CTN A;  1R2U A;  1YRT B;  2Y5I A;  1KK7 Z;  2I18 A;  1OE9 B;  1JF2 A;  1S3P A;  1GGW A;  3CZT X;  4QJ3 B;  4N5X A;  4L9M A;  1AJ4 A;  1XA5 A;  3KO0 A;  1M39 A;  3TS5 B;  2K2F A;  3ZNI A;  2WCE A;  3BUN B;  1AK8 A;  4D1E A;  1IH0 A;  5K89 A;  2LAP A;  1FI6 A;  2M7N A;  2SCP A;  4PE1 A;  3M0W A;  1AJ5 A;  2TN4 A;  1YVH A;  3D0Y A;  1BF5 A;  1KK8 B;  2JOJ A;  2K7D A;  2CNP A;  3PFV A;  3BOW B;  2LHI A;  1QLS A;  2M1K B;  3EVU A;  1J7R A;  3I5G C;  3TDZ A;  5I2L A;  3DVE A;  2LP2 A;  1LKJ A;  1REC A;  3PN7 B;  5HKY A;  2K0J A;  2JPT A;  4OKH A;  1H8B A;  1QS7 A;  1F4O A;  1Y1A A;  3BUM B;  1EXR A;  4TNC A;  4MLW A;  2CBL A;  3IQO A;  1KSO A;  2CT9 A;  2L50 A;  1G4Y R;  4PHM A;  1LIN A;  1DGV A;  5HKW A;  2JNX A;  1DJH A;  5TNC A;  1TCF A;  2PAS A;  1IRJ A;  1IJ5 A;  1CKK A;  2WC8 A;  1DF0 A;  4BY4 A;  1KWO C;  3SG5 A;  1BMO A;  1L2O B;  1S5G Y;  4I5J A;  3TS5 C;  3LK1 A;  1B4C A;  1OZO A;  1E8A A;  2BKH B;  4NDC A;  3KF9 A;  2EHB A;  5CPV A;  3TDI A;  1DJZ A;  1TNX A;  2WND A;  3EKJ A;  5AER A;  1KK8 C;  2KAY A;  1MQ1 A;  4PE0 A;  3JTD B;  1SPY A;  2L5X B;  1DT7 B;  1W7J B;  1FI5 A;  2OS8 B;  4QJ5 B;  1FW4 A;  3I5I C;  5IBW A;  1CFF A;  5AAN A;  3LCP C;  2KBM A;  3JVT C;  3PSR A;  1JC2 A;  2CXJ A;  2ZN8 A;  4GGF C;  1ODB A;  3HCM A;  4GUK A;  3IQQ A;  4NDB A;  5GQQ C;  5BPJ A;  5G08 A;  1XFW O;  1RRO A;  2FCD A;  2JT3 A;  1B7T Y;  3C1V A;  1UUS A;  5J3X A;  3EK8 A;  3BOW A;  2KQY A;  2E6W A;  2KI4 B;  1XFX O;  2I94 A;  1BOC A;  2H61 C;  2BBN A;  1DJY A;  4PHK A;  2B1U A;  4OV2 A;  5CSI A;  2O5G A;  3I5F B;  1CM4 A;  1NYA A;  3EKH A;  5AEQ A;  2L2E A;  2E30 A;  1BG1 A;  1SMG A;  3KEV A;  1NPQ A;  3GOF A;  3JTD C;  1LVC D;  4JPZ B;  1BR1 B;  4GGF A;  4WQ3 A;  1XYD A;  3OB2 B;  1PAL A;  1UHH A;  2OS8 C;  2WCB A;  1KFX L;  1B9A A;  2AAO A;  4FQO A;  2NLN A;  2CCM A;  1ZMZ A;  3FWB A;  1KQV A;  4ZCU A;  3SJS A;  2L51 A;  3CS1 A;  5HKZ A;  5DKQ A;  2BE6 A;  1VRK A;  3LL8 B;  2H61 A;  3OP0 A;  3OX5 A;  1CDL A;  3O2P A;  3CGA A;  4PE4 A;  5DKN A;  1F54 A;  4CLN A;  3QRX A;  1B1G A;  1CB1 A;  1KFU S;  2ZRT A;  4MSP A;  1RJV A;  1OMD A;  1TNP A;  4ORC B;  3IF7 A;  3EVR A;  4A4B A;  3OB1 B;  1W7I B;  3OX6 A;  1K9P A;  2LUX A;  2M1U A;  1LXF C;  1PK0 D;  1PUL A;  1BU3 A;  1DJG A;  1J1E A;  3VRO A;  2JTZ A;  4YGC B;  2GGM A;  1OMV A;  2KAX A;  3EVV A;  1SBJ A;  3AKB A;  1QAT A;  1NSH A;  1BOD A;  3K21 A;  5D69 A;  1QX7 A;  1XFZ O;  1F4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...