1KK7Z

Scallop myosin in the near rigor conformation
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
154
structure length
154
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN, STRIATED MUSCLE
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 35
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Z01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk7Z02
2H61C 2KQ6A 4OV2A 3EK7A 1IJ6A 1K94A 1B9AA 2K7BA 4DS7A 5D7FA 3D10A 3VRQA 1MR8A 1QVIZ 2IS9A 1F4QA 2JT3A 5AXIA 5DKNA 4A4CA 1S1EA 4JPZB 5AFPA 1NCYA 1DJWA 3CR4X 3EKHA 3O2PA 2L51A 2BCAA 3O6BA 3IF7A 2KFFA 4YBHB 2EHBA 3OHMB 1CFFA 1UHNA 1Q80A 3PFVA 2BECA 4GGFC 1K93D 2L5XB 2ZN9A 3BUXB 1SY9A 1XFWO 1H8BA 1CFDA 1MXLC 1YX8A 1ALWA 2M1KB 1LINA 1CM1A 2PALA 1B8LA 3MSEB 1QS7A 1N0YA 1IWQA 1F4OA 3LK0A 3BUWB 4ICBA 3LCPC 3PN7C 2KSPA 1SMGA 2L0PA 2K7CA 1DVIA 4MLWA 1EJ3A 3I5FC 3TDUA 4ETOA 3FS7A 4YGDB 3PM8A 3WHUB 4GUKA 4PE0A 1K95A 2KFHA 3OX5A 1QX7A 2MLEC 2Y5IA 1YRTB 3SIBA 1S5GZ 2L4IA 5CPVA 1KQMB 3A8RA 1ZUZA 1AUIB 4GNKB 3CLNA 1GGZA 2KYFA 1E8AA 1W7IB 4QJ5B 1TNQA 3EK8A 1NX2A 1TNWA 2HQWA 2FCDA 3WNXB 2AUCA 4PHMA 2BL0C 1OZOA 2M29A 2ISDA 3RLZA 1PVBA 1CNPA 1S5GY 3NSKA 2H61A 1UHIA 2SCPA 1YRUB 5KU1A 1R2UA 1BF5A 3JVTC 1CLLA 1Y1UA 1J7PA 1SNLA 2CT9A 1MHOA 2NCPA 2PVBA 3K21A 3CR5X 4ZCVA 1UHHA 3I5IB 3IQQA 4QJ3B 1LA3A 3VRPA 4MSPA 5PALA 3SG6A 1WLMA 2M0RA 1ZFSA 2WCEA 4PHJA 2WCBA 1QATA 1DF0A 2KI6C 2CXJA 2LM5A 3CWGA 4BY4A 1CMFA 1XO5A 3NSIA 1IQ5A 1OQPA 4MRXA 4M2QA 4MBEA 4YRUA 3DVKA 1K9PA 3GK4X 1M31A 2LLSA 1BU3A 2K2AA 3TS5B 4AQJA 1NIWA 5B8IB 4CIDA 2WNDA 1FPWA 4OKHA 2JQ6A 1F70A 1F8HA 1CB1A 1JC2A 1YTZC 3OX6A 2PRUA 2AMIA 2BCXA 2F3YA 4NDDA 1EG3A 1YVHA 3NSLA 1EXRA 1TNXA 4A4BA 2ZRTA 5CSNA 1S26D 1SRAA 2TN4A 3FWBA 2JOJA 1LXFC 1Y1XA 1QX5B 1KFUL 2PASA 1PALA 3OB2B 2FJUB 3GK1A 1CFCA 1XA5A 2L50A 3QRXA 1QIWA 1GQMA 4HRHA 1OSAA 3RM1A 4ORAB 4MZKA 2JWWA 1DF0B 2LAPA 4NDCA 3SG4A 3CS1A 2ZRSA 1JUOA 4WRIA 1KK7Z 1YR5A 2M97A 2F2PA 2JPTA 3KHEA 1WRLA 5AERA 4CFQA 2KI6D 2KAVA 2BCBA 1YX7A 3SG3A 2LUCA 1OMVA 5ER5A 2Y4QA 2GV5A 3D0YA 3DVEA 2LMUA 3BUMB 1SPYA 1MQ1A 1SCVA 1TRFA 1BODA 1OE9B 1RTP1 1UUSA 4NQGA 1JBAA 3I5FB 3EK4A 5IBWA 4YGAA 1CDLA 2I94A 2LVKA 2E30A 1JF2A 3I5HB 1FI5A 3F45A 1BT6A 3GOFA 1LKJA 1CFPA 4MZLA 2B1UA 2JXCA 1J55A 2D8NA 4PHNA 1BLQA 1IG5A 2MA2A 1QASA 2ZFDA 1XK4C 1ZMZA 1G8IA 1A75A 2JXLA 4I5KA 2WORA 2BL0B 1FI6A 4GBAA 1PSRA 5HLOA 4DUQA 1VRKA 2PSRA 3JVTB 3D0YB 1N2DA 3WXAA 3H4SE 1KSOA 3E3RA 1MWNA 4M2OA 2JNXA 5DKQA 1EH2A 1CDPA 2MLFC 2KBIA 1DJZA 4PE1A 2LLTA 5TNCA 1TOPA 3O78A 1NX0A 1NWDA 1YVLA 4USLA 4QJ4B 3EVUA 5I2QA 2OTGB 1LA0A 1NCXA 1S3PA 5JJGA 1KWOC 1IQ3A 1A03A 1CDMA 2BE6A 3I5GC 3I5HC 1A75B 2R2IA 1G4YR 1XVJA 4YI8A 1UP5A 1YUTA 3EVVA 1CM4A 1K96A 4NDBA 3KO0A 3LLEA 1RFJA 1SW8A 3AAKA 4PDZA 1K90D 1DJYA 5DKRA 1ODBA 1KSMA 4YGBB 5I2LA 4MRYA 1NX3A 4BY5A 4XYNA 1MUXA 1YURA 1XFZO 1JFKA 3LL8B 2QPTA 4HRGA 5J3XA 1QX2A 5HKYA 3EKJA 1HQVA 2EGDA 1AJ5A 4C0JA 1SL8A 3OP0A 1XK4A 1Y1AA 2LP3A 3TZ1A 4GAOA 2Q4UA 2I2RE 4WQ2A 4FQOA 2BKHB 1KFXL 1QIVA 1XFUO 2CCMA 1M39A 4CLNA 3BXKA 1IKUA 2OTGC 3SG5A 4GFTA 1AHRA 2I18A 1B7TY 1OZSA 2LLUA 5F6TA 2KOTA 1CDNA 2VRGA 1V1FA 4D1EA 1GGWA 5G08A 1KFXS 1OOJA 2CTNA 3FWCA 1C07A 1CMGA 2I7AA 1KQVA 1MF8B 2M8UA 5HLVA 1L2OB 1F54A 1IRJA 1DGUA 4I5JA 2KFGA 3TDIA 1QTXA 2EC6C 4GPLB 4XJKA 1BR4B 2LE9B 4I5LB 2ZKMX 3PSRA 4JQ0D 4Q04A 3TDZA 4AOMA 1J7OA 1QV0A 2LVJA 1J1EA 2P6BB 1B47A 1DMOA 4N1GA 1NYAA 1S6IA 2MJWB 1CTRA 3EVRA 1NSHA 3ZWHA 4DCKA 3KPXA 2M9GA 4PHKA 2JNFA 1NP8A 2COLB 4YGEB 3VGOA 4MVFA 5CSJA 2BE4A 1XYDA 1OMRA 4TNCA 1JWDA 5AEQA 1JSAA 2KYCA 4I5NB 2KHNA 1KFUS 4GGNA 3SIAA 3AKBA 1FBVA 5FYXA 4N1FA 2RGIA 1RJVA 2FCEA 3HX4A 1A29A 5KTYA 1YUUA 2M3WA 1PVAA 1ZACA 1M45A 1JFJA 2DOQA 4XJKB 2LV7A 2KDHA 1L2OC 1KWOB 1PK0D 2GGZA 5AANA 4CFRA 3I5GB 1QV1A 3AKAA 1XFYO 1XFVO 2F3ZA 2G9BA 1ZOTB 2KAYA 2NXQA 4DIRA 2KGRA 1TN4A 1ALVA 2LMVA 1C7WA 1R6PA 1BJFA 1B8RA 1DJXA 2Q91A 2F33A 3BUNB 2BBNA 2L2EA 2NZ0A 3JTDC 2HETA 2K7DA 1DJHA 3GK2A 1BR1B 2JZIA 1V1GA 2JU0A 2LC5A 2Y1NA 4U8DA 4UPGA 2M49B 1SK6D 4JWQA 2HQ8A 2LVIA 2ZNEA 1S36A 2K7OA 2LNKA 2OPOA 1WLZA 4ORCB 4P5OE 1LVCD 1WDCB 5GQQC 2JC2A 1IH0A 1YUSA 4OR9B 2JTTA 2BKIB 1BOCA 2JTZA 2LVVA 1BG1A 2JT8A 1UHKA 1W7JB 2KI4B 1NCZA 1SCMB 2JRFA 1DGVA 2O60A 1AJ4A 2M7LA 1SR6C 1J7RA 1BMOA 1QVIY 4PALA 1IGVA 4E68A 4R1EA 3AAJA 3CZTX 4P2YB 2OS8C 1EL4A 3DD4A 1UHJA 2K0JA 3OB1B 2E6WA 3IQOA 3NXAA 3VRRA 4OVNF 1UURA 2EC6B 3TUYC 1H4BA 1K9UA 1FF1A 1U5IA 1PSBA 1B8CA 2AAOA 3PALA 1S6CA 4PCWA 1NPQA 4PE4A 1DT7B 1FW4A 4F0ZB 1UWOA 3SG7A 1TCFA 2GGMA 1B7TZ 1SYMA 1WRKA 1TNPA 1WDCC 2M7NA 2F8PA 5ER4X 1MXEA 3PLFB 5I8NA 4ZCUA 1A2XA 1PULA 3A4UB 4PE7A 2KI4C 5HKWA 2K61A 4AQIA 1GJYA 1SCMC 2FOTA 3BOWA 3O4YA 1DJGA 1K9KA 2K8MB 1CLMA 3BUOB 2SASA 2CNPA 1QLSA 2MRDA 3BYAA 2V53A 1KCYA 3M0WA 5CSFA 2M1UA 1Y0VH 2L4HA 2MAZA 1N65A 1RK9A 5BPJA 1A4PA 2JULA 2KGBC 4L9MA 1U5IB 4MEWA 1J1DA 4YI9A 3FIAA 3LK1A 3WHTB 1D1OA 2KNEA 5JOLA 3DF0A 3KEVA 4C0KA 1QXPA 2BBMA 1WRZA 1B4CA 2WCFA 3CR2A 4GGFA 1NUBA 4HREE 1AP4A 2WC8A 3DVMA 4WQ3A 2K2FA 1QLKA 4IL1A 4M2PA 1NX1A 5D69A 4OCIA 3JTDB 1PRWA 1AVSA 1RROA 1KK8B 3DVJA 1KQMC 1EG4A 1M63B 3ICBA 1AK8A 1HT9A 4MN0A 3BOWB 4N5XA 5K89A 5CSIA 1WY9A 1F71A 2PMYA 1L7ZA 1TTXA 2LHIA 4ORBB 1JF0A 4C0LA 1F55A 2F2OA 3SG2A 2L98A 2ZNDA 1RECA 2ZN8A 3NSOA 3VROA 2H2KA 1DJIA 2A4JA 3HCMA 3PATA 2NCOA 3CTNA 1RWYA 5KSZA 5HKZA 4CPVA 1OMDA 1SL7A 4HSZA 2G2BA 4MZJA 3DF0B 3BQ3A 2KBMA 3KF9A 4DRWA 1X02A 3ZNIA 1CKKA 3I5IC 1IJ5A 5I2OA 3VRNA 2LP2A 2LHLA 3SJSA 1Y6WA 5HYDA 1SR6B 1XFXO 1C7VA 1J7QA 2QACA 2KQYA 1SL9A 2OS8B 3CGAA 1S6JA 2MHHA 1DTLA 1SBJA 2LUXA 2Y1MA 2O5GA 1B1GA 1K2HA 1TIZA 2LMTA 1SKTA 3C1VA 2HPSA 1QJTA 3TS5C 1K8UA 1G33A 2HF5A 2NLNA 1CLBA 3PN7B 3TUYB 1KK7Y 1TCOB 2WOSA 1KK8C 2CBLA 2LCPA 4YGCB 4FTGA 1M46A 2LANA 2MBXA 2KAXA 2JT0A
chains in the Genus database with same CATH superfamily
2H61C 2KQ6A 4OV2A 3EK7A 1IJ6A 1K94A 1B9AA 2K7BA 4DS7A 2KPHA 3R1VA 5D7FA 3D10A 3VRQA 1MR8A 1QVIZ 2IS9A 3CZ2A 1F4QA 2JT3A 5AXIA 5DKNA 4A4CA 3S0GA 1S1EA 3NGVA 4JPZB 5AFPA 1NCYA 1DJWA 3CR4X 3D76A 3EKHA 3S0FA 3O2PA 2L51A 2BCAA 3O6BA 3IF7A 2KFFA 4YBHB 2EHBA 3OHMB 3S0AA 1CFFA 1UHNA 3CDNA 3N7HA 1Q80A 3PFVA 2BECA 4GGFC 1K93D 2QDIA 3IVTA 2L5XB 2ZN9A 3BUXB 1SY9A 1XFWO 1H8BA 1CFDA 1MXLC 1YX8A 1ALWA 2M1KB 1LINA 1CM1A 2JPOA 2PALA 1B8LA 3MSEB 1QS7A 1N0YA 1IWQA 3EG5B 1F4OA 1DQEA 3LK0A 3BUWB 4ICBA 3LCPC 3BJHA 3PN7C 2KSPA 1SMGA 2L0PA 2K7CA 1DVIA 4MLWA 1EJ3A 3I5FC 3TDUA 4ETOA 2GTEA 3FS7A 4YGDB 3PM8A 3WHUB 4GUKA 4PE0A 1K95A 2KFHA 3OX5A 1QX7A 2MLEC 2Y5IA 1YRTB 3SIBA 1S5GZ 2L4IA 5CPVA 1KQMB 3A8RA 1ZUZA 1AUIB 2WC5A 4GNKB 3CLNA 1GGZA 2KYFA 1E8AA 1W7IB 4QJ5B 1TNQA 3EK8A 1NX2A 1TNWA 4OZDA 2HQWA 4INWA 1DC1A 2FCDA 3WNXB 2AUCA 4PHMA 2BL0C 1OZOA 2M29A 2ISDA 3RLZA 1PVBA 3UO9A 1S5GY 3NSKA 1CNPA 3B86A 2H61A 3R72A 1UHIA 2SCPA 3DY9A 1YRUB 5KU1A 1R2UA 3SS3A 1BF5A 3JVTC 1CLLA 1Y1UA 1J7PA 1SNLA 2CT9A 1MHOA 2NCPA 2PVBA 3K21A 3CR5X 4ZCVA 1UHHA 3I5IB 3IQQA 4QJ3B 1LA3A 3VRPA 4MSPA 5PALA 1OW4A 2QEBA 3SG6A 1WLMA 2M0RA 1ZFSA 2WCEA 4PHJA 3UNWA 2WCBA 1QATA 1DF0A 2KI6C 2CXJA 2LM5A 3CWGA 4BY4A 1CMFA 1XO5A 3NSIA 1IQ5A 1OQPA 4MRXA 4M2QA 4MBEA 4YRUA 3DVKA 5I94A 1K9PA 3GK4X 1M31A 2LLSA 1BU3A 2K2AA 3TS5B 4AQJA 1NIWA 5B8IB 2QEOA 4CIDA 3NHIA 2BAPA 2WNDA 1FPWA 4OKHA 2JQ6A 1F70A 1F8HA 1CB1A 1JC2A 3L4LA 1YTZC 3OX6A 2PRUA 2AMIA 2BCXA 2F3YA 2WCHA 3DYEA 4NDDA 1EG3A 1YVHA 3NSLA 1EXRA 1TNXA 4A4BA 2ZRTA 5CSNA 1S26D 1SRAA 2TN4A 3FWBA 2JOJA 1LXFC 1Y1XA 1QX5B 1KFUL 2PASA 1PALA 3OB2B 2FJUB 3GK1A 1CFCA 1XA5A 2L50A 3QRXA 1QIWA 1GQMA 4HRHA 1OSAA 3RM1A 4ORAB 4MZKA 2JWWA 1DF0B 2LAPA 4NDCA 3SG4A 3CS1A 2ZRSA 1JUOA 4WRIA 1KK7Z 2YGUA 1YR5A 2M97A 2F2PA 2JPTA 3R1PA 3KHEA 1WRLA 5AERA 4CFQA 2KI6D 2KAVA 2BCBA 1YX7A 3SG3A 2LUCA 1OMVA 5ER5A 1OOIX 2Y4QA 1IIOA 2GV5A 3D0YA 3DVEA 2LMUA 3BUMB 2L2CA 4JD9A 1SPYA 1MQ1A 1SCVA 3O4XA 1TRFA 1BODA 1OE9B 1RTP1 1UUSA 4NQGA 1JBAA 3I5FB 3EK4A 5IBWA 4YGAA 1CDLA 2I94A 2LVKA 2E30A 1JF2A 3I5HB 1FI5A 3F45A 1BT6A 3GOFA 1LKJA 1CFPA 4MZLA 2B1UA 2JXCA 1J55A 4KYNA 2D8NA 4PHNA 1BLQA 1IG5A 2MA2A 1QASA 2ZFDA 1XK4C 1GM0A 1ZMZA 1G8IA 1A75A 2JXLA 4I5KA 3Q8IA 2WORA 2BL0B 1FI6A 4GBAA 1PSRA 5HLOA 4DUQA 3OBVA 1VRKA 2ERBA 2PSRA 3D0YB 3JVTB 1N2DA 3WXAA 3H4SE 1KSOA 3E3RA 1MWNA 5FI2A 4M2OA 2JNXA 2QEHA 5DKQA 1EH2A 1P28A 1CDPA 2MLFC 2KBIA 1DJZA 4PE1A 2LLTA 5TNCA 1TOPA 3DZTA 3O78A 1NX0A 1NWDA 1YVLA 4USLA 4QJ4B 3EVUA 5D3OA 2OTGB 5I2QA 3FE8A 1LA0A 1NCXA 1TUJA 1S3PA 5JJGA 1C3ZA 1KWOC 1IQ3A 1A03A 1CDMA 2BE6A 3I5GC 3I5HC 1A75B 3S0EA 2KLDA 2R2IA 1G4YR 1XVJA 4YI8A 3S0DA 1UP5A 1YUTA 3EVVA 1CM4A 1K96A 4NDBA 3FE6A 3KO0A 3LLEA 1RFJA 1SW8A 3AAKA 4PDZA 1K90D 1DJYA 2QEVA 5DKRA 1ODBA 1KSMA 3CYZA 4YGBB 5I2LA 4MRYA 4PT1A 1NX3A 4BY5A 4XYNA 1MUXA 1YURA 1XFZO 1JFKA 3LL8B 2QPTA 1XFRA 4HRGA 1QX2A 5J3XA 5HKYA 3EKJA 1HQVA 2EGDA 1AJ5A 4C0JA 1SL8A 2WCLA 3OP0A 1XK4A 1Y1AA 2LP3A 5FI7A 3TZ1A 4GAOA 2Q4UA 2I2RE 4WQ2A 4FQOA 2BKHB 1KFXL 1QIVA 1XFUO 2CCMA 1M39A 4CLNA 3BXKA 1IKUA 2OTGC 3SG5A 3NHTA 4GFTA 1AHRA 2I18A 1B7TY 1OZSA 2LLUA 3K1EA 5F6TA 2KOTA 1CDNA 2VRGA 1V1FA 3V2LA 4D1EA 1GGWA 5G08A 1KFXS 1OOJA 2CTNA 3FWCA 1C07A 1W9ZA 1CMGA 2I7AA 1KQVA 1MF8B 2M8UA 5HLVA 1L2OB 1F54A 1IRJA 1DGUA 4I5JA 2KFGA 3TDIA 3RZSA 1QTXA 2EC6C 4GPLB 4XJKA 1BR4B 2LE9B 3CABA 2ZKMX 3PSRA 4I5LB 4JQ0D 4Q04A 3SS5A 3TDZA 4AOMA 1J7OA 2WCKA 1QV0A 2LVJA 1TUZA 1J1EA 2P6BB 1B47A 1DMOA 4N1GA 1NYAA 1S6IA 2MJWB 1CTRA 3EVRA 1NSHA 3ZWHA 4DCKA 3KPXA 2M9GA 4PHKA 5HL1A 2JNFA 1NP8A 2COLB 4YGEB 3VGOA 4MVFA 5CSJA 3OGNA 2BE4A 1XYDA 1OMRA 4TNCA 1JWDA 5AEQA 1JSAA 2KYCA 4I5NB 2KHNA 1KFUS 4GGNA 3SIAA 3AKBA 3CZ1A 1FBVA 5FYXA 4N1FA 2RGIA 1RJVA 3B87A 1DEKA 2FCEA 3DXLA 3HX4A 3D78A 1A29A 5KTYA 1YUUA 2M3WA 2PQLA 1PVAA 1ZACA 1M45A 1JFJA 2DOQA 4XJKB 2LV7A 2KDHA 2P70A 2FJYA 1L2OC 1KWOB 1PK0D 2GGZA 1T14A 2BNXA 5AANA 4CFRA 3I5GB 1QV1A 3AKAA 1XFYO 1XFVO 2F3ZA 2G9BA 1ZOTB 2KAYA 2NXQA 4DIRA 2KGRA 3PM2A 1TN4A 1ALVA 2LMVA 1C7WA 1R6PA 1BJFA 1B8RA 1DJXA 2Q91A 2F33A 3BUNB 2BBNA 2L2EA 2NZ0A 3JTDC 2HETA 2K7DA 1DJHA 3GK2A 1BR1B 2JZIA 1V1GA 2JU0A 2LC5A 2Y1NA 4U8DA 3SS4A 4UPGA 2M49B 1SK6D 4JWQA 2HQ8A 2LVIA 2ZNEA 1S36A 5EL2A 2K7OA 2LNKA 2OPOA 1WLZA 4ORCB 4P5OE 1LVCD 1WDCB 1Z2CB 5GQQC 2JC2A 1IH0A 1YUSA 4OR9B 2JTTA 2BKIB 1BOCA 2JTZA 2LVVA 1BG1A 2JT8A 1UHKA 1W7JB 2KI4B 1Z4HA 3B6XA 1NCZA 1SCMB 2JRFA 1DGVA 1DELA 2O60A 1AJ4A 3QMEA 2M7LA 1SR6C 5FI6A 1J7RA 1BMOA 1QVIY 4PALA 1IGVA 4E68A 4R1EA 4FQTA 3AAJA 3CZTX 4P2YB 2OS8C 1EL4A 1OOFA 3B88A 3DD4A 1UHJA 2K0JA 3OB1B 2E6WA 3IQOA 3NXAA 3VRRA 4OVNF 1UURA 2EC6B 3TUYC 1H4BA 1K9UA 1OOGA 3L4AA 1U5IA 1PSBA 1FF1A 1B8CA 2AAOA 3PALA 1C3YA 1S6CA 4PCWA 1NPQA 4PE4A 1DT7B 1FW4A 1OOHA 1UWOA 4F0ZB 3SG7A 1TCFA 2GGMA 1B7TZ 1SYMA 1WRKA 1TNPA 1WDCC 2M7NA 2F8PA 3S0BA 1TWOA 1MXEA 5ER4X 3PLFB 5I8NA 4ZCUA 1A2XA 1PULA 3A4UB 4PE7A 2KI4C 5HKWA 2K61A 4AQIA 2WCJA 1GJYA 1SCMC 2FOTA 3BOWA 3O4YA 1DJGA 1K9KA 2K8MB 1CLMA 3BUOB 2SASA 2CNPA 1QLSA 2MRDA 3BYAA 3D74A 2V53A 1KCYA 3M0WA 5CSFA 2M1UA 1Y0VH 2L4HA 2MAZA 3B7AA 1N65A 1RK9A 5DICA 5BPJA 1A4PA 1QWVA 2JULA 2KGBC 1U5IB 4L9MA 1J1DA 3R1OA 4MEWA 4YI9A 3L47A 3FIAA 3LK1A 3WHTB 1D1OA 2KNEA 3BFHA 4INXA 5JOLA 3DF0A 3KEVA 4C0KA 1QXPA 2BBMA 1WRZA 2K60A 3D75A 1B4CA 1SSEB 2WCFA 3CR2A 4GGFA 1NUBA 4HREE 1AP4A 2WC8A 3DVMA 4WQ3A 2K2FA 1QLKA 4IL1A 4M2PA 1NX1A 5D69A 4OCIA 3JTDB 1PRWA 1AVSA 1RROA 1KK8B 3DVJA 1KQMC 1EG4A 1M63B 3ICBA 1AK8A 4JKTA 1HT9A 4MN0A 3BOWB 4N5XA 5K89A 5CSIA 1WY9A 4F7FA 1F71A 2PMYA 3CZ0A 1L7ZA 1TTXA 3BFBA 3D73A 2LHIA 4ORBB 1JF0A 4C0LA 1F55A 3D77A 2F2OA 3SG2A 1LS8A 2L98A 2ZNDA 1RECA 1ORGA 2ZN8A 3NSOA 3VROA 2H2KA 1DJIA 2A4JA 3HCMA 3PATA 2NCOA 3CTNA 1RWYA 5KSZA 5HKZA 3BFAA 3FE9A 4CPVA 1OMDA 1SL7A 4HSZA 2G2BA 3PJIA 3DF0B 3BQ3A 2KBMA 2P71A 3KF9A 4MZJA 1X02A 3VB1A 3ZNIA 4DRWA 1CKKA 3I5IC 1IJ5A 5I2OA 3VRNA 2LP2A 2LHLA 3SJSA 1Y6WA 5HYDA 1SR6B 1XFXO 1C7VA 1J7QA 2WCMA 2QACA 2KQYA 1SL9A 2OS8B 3CGAA 1S6JA 2MHHA 1DTLA 1SBJA 2LUXA 2WC6A 2O5GA 2Y1MA 1B1GA 1K2HA 1TIZA 2LMTA 1SKTA 3C1VA 2HPSA 1QJTA 3TS5C 1K8UA 1G33A 2HF5A 2NLNA 1CLBA 3PN7B 3TUYB 1KK7Y 1TCOB 2KLEA 2WOSA 1KK8C 2CBLA 2L5YA 2LCPA 4YGCB 2PYQA 4FTGA 1M46A 2H8VA 2LANA 2MBXA 4IJ7A 2KAXA 2JT0A
chains in the Genus database with same CATH topology
2H61C 2KQ6A 4OV2A 3EK7A 1IJ6A 1K94A 1B9AA 2K7BA 4DS7A 5D7FA 3D10A 3VRQA 1MR8A 1QVIZ 2IS9A 1F4QA 2JT3A 5AXIA 5DKNA 4A4CA 1S1EA 4JPZB 5AFPA 1NCYA 1DJWA 3CR4X 3EKHA 3O2PA 2L51A 2BCAA 3O6BA 3IF7A 2KFFA 4YBHB 2EHBA 3OHMB 1CFFA 1UHNA 1Q80A 3PFVA 2BECA 4GGFC 1K93D 2L5XB 2ZN9A 3BUXB 1SY9A 1XFWO 1H8BA 1CFDA 1MXLC 1YX8A 1ALWA 2M1KB 1LINA 1CM1A 2PALA 1B8LA 3MSEB 1QS7A 1N0YA 1IWQA 1F4OA 3LK0A 3BUWB 4ICBA 3LCPC 3PN7C 2KSPA 1SMGA 2L0PA 2K7CA 1DVIA 4MLWA 1EJ3A 3I5FC 3TDUA 4ETOA 3FS7A 4YGDB 3PM8A 3WHUB 4GUKA 4PE0A 1K95A 2KFHA 3OX5A 1QX7A 2MLEC 2Y5IA 1YRTB 3SIBA 1S5GZ 2L4IA 5CPVA 1KQMB 3A8RA 1ZUZA 1AUIB 4GNKB 3CLNA 1GGZA 2KYFA 1E8AA 1W7IB 4QJ5B 1TNQA 3EK8A 1NX2A 1TNWA 2HQWA 2FCDA 3WNXB 2AUCA 4PHMA 2BL0C 1OZOA 2M29A 2ISDA 3RLZA 1PVBA 1CNPA 1S5GY 3NSKA 2H61A 1UHIA 2SCPA 1YRUB 5KU1A 1R2UA 1BF5A 3JVTC 1CLLA 1Y1UA 1J7PA 1SNLA 2CT9A 1MHOA 2NCPA 2PVBA 3K21A 3CR5X 4ZCVA 1UHHA 3I5IB 3IQQA 4QJ3B 1LA3A 3VRPA 4MSPA 5PALA 3SG6A 1WLMA 2M0RA 1ZFSA 2WCEA 4PHJA 2WCBA 1QATA 1DF0A 2KI6C 2CXJA 2LM5A 3CWGA 4BY4A 1CMFA 1XO5A 3NSIA 1IQ5A 1OQPA 4MRXA 4M2QA 4MBEA 4YRUA 3DVKA 1K9PA 3GK4X 1M31A 2LLSA 1BU3A 2K2AA 3TS5B 4AQJA 1NIWA 5B8IB 4CIDA 2WNDA 1FPWA 4OKHA 2JQ6A 1F70A 1F8HA 1CB1A 1JC2A 1YTZC 3OX6A 2PRUA 2AMIA 2BCXA 2F3YA 4NDDA 1EG3A 1YVHA 3NSLA 1EXRA 1TNXA 4A4BA 2ZRTA 5CSNA 1S26D 1SRAA 2TN4A 3FWBA 2JOJA 1LXFC 1Y1XA 1QX5B 1KFUL 2PASA 1PALA 3OB2B 2FJUB 3GK1A 1CFCA 1XA5A 2L50A 3QRXA 1QIWA 1GQMA 4HRHA 1OSAA 3RM1A 4ORAB 4MZKA 2JWWA 1DF0B 2LAPA 4NDCA 3SG4A 3CS1A 2ZRSA 1JUOA 4WRIA 1KK7Z 1YR5A 2M97A 2F2PA 2JPTA 3KHEA 1WRLA 5AERA 4CFQA 2KI6D 2KAVA 2BCBA 1YX7A 3SG3A 2LUCA 1OMVA 5ER5A 2Y4QA 2GV5A 3D0YA 3DVEA 2LMUA 3BUMB 1SPYA 1MQ1A 1SCVA 1TRFA 1BODA 1OE9B 1RTP1 1UUSA 4NQGA 1JBAA 3I5FB 3EK4A 5IBWA 4YGAA 1CDLA 2I94A 2LVKA 2E30A 1JF2A 3I5HB 1FI5A 3F45A 1BT6A 3GOFA 1LKJA 1CFPA 4MZLA 2B1UA 2JXCA 1J55A 2D8NA 4PHNA 1BLQA 1IG5A 2MA2A 1QASA 2ZFDA 1XK4C 1ZMZA 1G8IA 1A75A 2JXLA 4I5KA 2WORA 2BL0B 1FI6A 4GBAA 1PSRA 5HLOA 4DUQA 1VRKA 2PSRA 3JVTB 3D0YB 1N2DA 3WXAA 3H4SE 1KSOA 3E3RA 1MWNA 4M2OA 2JNXA 5DKQA 1EH2A 1CDPA 2MLFC 2KBIA 1DJZA 4PE1A 2LLTA 5TNCA 1TOPA 3O78A 1NX0A 1NWDA 1YVLA 4USLA 4QJ4B 3EVUA 5I2QA 2OTGB 1LA0A 1NCXA 1S3PA 5JJGA 1KWOC 1IQ3A 1A03A 1CDMA 2BE6A 3I5GC 3I5HC 1A75B 2R2IA 1G4YR 1XVJA 4YI8A 1UP5A 1YUTA 3EVVA 1CM4A 1K96A 4NDBA 3KO0A 3LLEA 1RFJA 1SW8A 3AAKA 4PDZA 1K90D 1DJYA 5DKRA 1ODBA 1KSMA 4YGBB 5I2LA 4MRYA 1NX3A 4BY5A 4XYNA 1MUXA 1YURA 1XFZO 1JFKA 3LL8B 2QPTA 4HRGA 5J3XA 1QX2A 5HKYA 3EKJA 1HQVA 2EGDA 1AJ5A 4C0JA 1SL8A 3OP0A 1XK4A 1Y1AA 2LP3A 3TZ1A 4GAOA 2Q4UA 2I2RE 4WQ2A 4FQOA 2BKHB 1KFXL 1QIVA 1XFUO 2CCMA 1M39A 4CLNA 3BXKA 1IKUA 2OTGC 3SG5A 4GFTA 1AHRA 2I18A 1B7TY 1OZSA 2LLUA 5F6TA 2KOTA 1CDNA 2VRGA 1V1FA 4D1EA 1GGWA 5G08A 1KFXS 1OOJA 2CTNA 3FWCA 1C07A 1CMGA 2I7AA 1KQVA 1MF8B 2M8UA 5HLVA 1L2OB 1F54A 1IRJA 1DGUA 4I5JA 2KFGA 3TDIA 1QTXA 2EC6C 4GPLB 4XJKA 1BR4B 2LE9B 4I5LB 2ZKMX 3PSRA 4JQ0D 4Q04A 3TDZA 4AOMA 1J7OA 1QV0A 2LVJA 1J1EA 2P6BB 1B47A 1DMOA 4N1GA 1NYAA 1S6IA 2MJWB 1CTRA 3EVRA 1NSHA 3ZWHA 4DCKA 3KPXA 2M9GA 4PHKA 2JNFA 1NP8A 2COLB 4YGEB 3VGOA 4MVFA 5CSJA 2BE4A 1XYDA 1OMRA 4TNCA 1JWDA 5AEQA 1JSAA 2KYCA 4I5NB 2KHNA 1KFUS 4GGNA 3SIAA 3AKBA 1FBVA 5FYXA 4N1FA 2RGIA 1RJVA 2FCEA 3HX4A 1A29A 5KTYA 1YUUA 2M3WA 1PVAA 1ZACA 1M45A 1JFJA 2DOQA 4XJKB 2LV7A 2KDHA 1L2OC 1KWOB 1PK0D 2GGZA 5AANA 4CFRA 3I5GB 1QV1A 3AKAA 1XFYO 1XFVO 2F3ZA 2G9BA 1ZOTB 2KAYA 2NXQA 4DIRA 2KGRA 1TN4A 1ALVA 2LMVA 1C7WA 1R6PA 1BJFA 1B8RA 1DJXA 2Q91A 2F33A 3BUNB 2BBNA 2L2EA 2NZ0A 3JTDC 2HETA 2K7DA 1DJHA 3GK2A 1BR1B 2JZIA 1V1GA 2JU0A 2LC5A 2Y1NA 4U8DA 4UPGA 2M49B 1SK6D 4JWQA 2HQ8A 2LVIA 2ZNEA 1S36A 2K7OA 2LNKA 2OPOA 1WLZA 4ORCB 4P5OE 1LVCD 1WDCB 5GQQC 2JC2A 1IH0A 1YUSA 4OR9B 2JTTA 2BKIB 1BOCA 2JTZA 2LVVA 1BG1A 2JT8A 1UHKA 1W7JB 2KI4B 1NCZA 1SCMB 2JRFA 1DGVA 2O60A 1AJ4A 2M7LA 1SR6C 1J7RA 1BMOA 1QVIY 4PALA 1IGVA 4E68A 4R1EA 3AAJA 3CZTX 4P2YB 2OS8C 1EL4A 3DD4A 1UHJA 2K0JA 3OB1B 2E6WA 3IQOA 3NXAA 3VRRA 4OVNF 1UURA 2EC6B 3TUYC 1H4BA 1K9UA 1FF1A 1U5IA 1PSBA 1B8CA 2AAOA 3PALA 1S6CA 4PCWA 1NPQA 4PE4A 1DT7B 1FW4A 4F0ZB 1UWOA 3SG7A 1TCFA 2GGMA 1B7TZ 1SYMA 1WRKA 1TNPA 1WDCC 2M7NA 2F8PA 5ER4X 1MXEA 3PLFB 5I8NA 4ZCUA 1A2XA 1PULA 3A4UB 4PE7A 2KI4C 5HKWA 2K61A 4AQIA 1GJYA 1SCMC 2FOTA 3BOWA 3O4YA 1DJGA 1K9KA 2K8MB 1CLMA 3BUOB 2SASA 2CNPA 1QLSA 2MRDA 3BYAA 2V53A 1KCYA 3M0WA 5CSFA 2M1UA 1Y0VH 2L4HA 2MAZA 1N65A 1RK9A 5BPJA 1A4PA 2JULA 2KGBC 4L9MA 1U5IB 4MEWA 1J1DA 4YI9A 3FIAA 3LK1A 3WHTB 1D1OA 2KNEA 5JOLA 3DF0A 3KEVA 4C0KA 1QXPA 2BBMA 1WRZA 1B4CA 2WCFA 3CR2A 4GGFA 1NUBA 4HREE 1AP4A 2WC8A 3DVMA 4WQ3A 2K2FA 1QLKA 4IL1A 4M2PA 1NX1A 5D69A 4OCIA 3JTDB 1PRWA 1AVSA 1RROA 1KK8B 3DVJA 1KQMC 1EG4A 1M63B 3ICBA 1AK8A 1HT9A 4MN0A 3BOWB 4N5XA 5K89A 5CSIA 1WY9A 1F71A 2PMYA 1L7ZA 1TTXA 2LHIA 4ORBB 1JF0A 4C0LA 1F55A 2F2OA 3SG2A 2L98A 2ZNDA 1RECA 2ZN8A 3NSOA 3VROA 2H2KA 1DJIA 2A4JA 3HCMA 3PATA 2NCOA 3CTNA 1RWYA 5KSZA 5HKZA 4CPVA 1OMDA 1SL7A 4HSZA 2G2BA 4MZJA 3DF0B 3BQ3A 2KBMA 3KF9A 4DRWA 1X02A 3ZNIA 1CKKA 3I5IC 1IJ5A 5I2OA 3VRNA 2LP2A 2LHLA 3SJSA 1Y6WA 5HYDA 1SR6B 1XFXO 1C7VA 1J7QA 2QACA 2KQYA 1SL9A 2OS8B 3CGAA 1S6JA 2MHHA 1DTLA 1SBJA 2LUXA 2Y1MA 2O5GA 1B1GA 1K2HA 1TIZA 2LMTA 1SKTA 3C1VA 2HPSA 1QJTA 3TS5C 1K8UA 1G33A 2HF5A 2NLNA 1CLBA 3PN7B 3TUYB 1KK7Y 1TCOB 2WOSA 1KK8C 2CBLA 2LCPA 4YGCB 4FTGA 1M46A 2LANA 2MBXA 2KAXA 2JT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H61 C;  2KQ6 A;  4OV2 A;  3EK7 A;  1IJ6 A;  1K94 A;  1B9A A;  2K7B A;  4DS7 A;  5D7F A;  3D10 A;  3VRQ A;  1MR8 A;  1QVI Z;  2IS9 A;  1F4Q A;  2JT3 A;  5AXI A;  5DKN A;  4A4C A;  1S1E A;  4JPZ B;  5AFP A;  1NCY A;  1DJW A;  3CR4 X;  3EKH A;  3O2P A;  2L51 A;  2BCA A;  3O6B A;  3IF7 A;  2KFF A;  4YBH B;  2EHB A;  3OHM B;  1CFF A;  1UHN A;  1Q80 A;  3PFV A;  2BEC A;  4GGF C;  1K93 D;  2L5X B;  2ZN9 A;  3BUX B;  1SY9 A;  1XFW O;  1H8B A;  1CFD A;  1MXL C;  1YX8 A;  1ALW A;  2M1K B;  1LIN A;  1CM1 A;  2PAL A;  1B8L A;  3MSE B;  1QS7 A;  1N0Y A;  1IWQ A;  1F4O A;  3LK0 A;  3BUW B;  4ICB A;  3LCP C;  3PN7 C;  2KSP A;  1SMG A;  2L0P A;  2K7C A;  1DVI A;  4MLW A;  1EJ3 A;  3I5F C;  3TDU A;  4ETO A;  3FS7 A;  4YGD B;  3PM8 A;  3WHU B;  4GUK A;  4PE0 A;  1K95 A;  2KFH A;  3OX5 A;  1QX7 A;  2MLE C;  2Y5I A;  1YRT B;  3SIB A;  1S5G Z;  2L4I A;  5CPV A;  1KQM B;  3A8R A;  1ZUZ A;  1AUI B;  4GNK B;  3CLN A;  1GGZ A;  2KYF A;  1E8A A;  1W7I B;  4QJ5 B;  1TNQ A;  3EK8 A;  1NX2 A;  1TNW A;  2HQW A;  2FCD A;  3WNX B;  2AUC A;  4PHM A;  2BL0 C;  1OZO A;  2M29 A;  2ISD A;  3RLZ A;  1PVB A;  1CNP A;  1S5G Y;  3NSK A;  2H61 A;  1UHI A;  2SCP A;  1YRU B;  5KU1 A;  1R2U A;  1BF5 A;  3JVT C;  1CLL A;  1Y1U A;  1J7P A;  1SNL A;  2CT9 A;  1MHO A;  2NCP A;  2PVB A;  3K21 A;  3CR5 X;  4ZCV A;  1UHH A;  3I5I B;  3IQQ A;  4QJ3 B;  1LA3 A;  3VRP A;  4MSP A;  5PAL A;  3SG6 A;  1WLM A;  2M0R A;  1ZFS A;  2WCE A;  4PHJ A;  2WCB A;  1QAT A;  1DF0 A;  2KI6 C;  2CXJ A;  2LM5 A;  3CWG A;  4BY4 A;  1CMF A;  1XO5 A;  3NSI A;  1IQ5 A;  1OQP A;  4MRX A;  4M2Q A;  4MBE A;  4YRU A;  3DVK A;  1K9P A;  3GK4 X;  1M31 A;  2LLS A;  1BU3 A;  2K2A A;  3TS5 B;  4AQJ A;  1NIW A;  5B8I B;  4CID A;  2WND A;  1FPW A;  4OKH A;  2JQ6 A;  1F70 A;  1F8H A;  1CB1 A;  1JC2 A;  1YTZ C;  3OX6 A;  2PRU A;  2AMI A;  2BCX A;  2F3Y A;  4NDD A;  1EG3 A;  1YVH A;  3NSL A;  1EXR A;  1TNX A;  4A4B A;  2ZRT A;  5CSN A;  1S26 D;  1SRA A;  2TN4 A;  3FWB A;  2JOJ A;  1LXF C;  1Y1X A;  1QX5 B;  1KFU L;  2PAS A;  1PAL A;  3OB2 B;  2FJU B;  3GK1 A;  1CFC A;  1XA5 A;  2L50 A;  3QRX A;  1QIW A;  1GQM A;  4HRH A;  1OSA A;  3RM1 A;  4ORA B;  4MZK A;  2JWW A;  1DF0 B;  2LAP A;  4NDC A;  3SG4 A;  3CS1 A;  2ZRS A;  1JUO A;  4WRI A;  1KK7 Z;  1YR5 A;  2M97 A;  2F2P A;  2JPT A;  3KHE A;  1WRL A;  5AER A;  4CFQ A;  2KI6 D;  2KAV A;  2BCB A;  1YX7 A;  3SG3 A;  2LUC A;  1OMV A;  5ER5 A;  2Y4Q A;  2GV5 A;  3D0Y A;  3DVE A;  2LMU A;  3BUM B;  1SPY A;  1MQ1 A;  1SCV A;  1TRF A;  1BOD A;  1OE9 B;  1RTP 1;  1UUS A;  4NQG A;  1JBA A;  3I5F B;  3EK4 A;  5IBW A;  4YGA A;  1CDL A;  2I94 A;  2LVK A;  2E30 A;  1JF2 A;  3I5H B;  1FI5 A;  3F45 A;  1BT6 A;  3GOF A;  1LKJ A;  1CFP A;  4MZL A;  2B1U A;  2JXC A;  1J55 A;  2D8N A;  4PHN A;  1BLQ A;  1IG5 A;  2MA2 A;  1QAS A;  2ZFD A;  1XK4 C;  1ZMZ A;  1G8I A;  1A75 A;  2JXL A;  4I5K A;  2WOR A;  2BL0 B;  1FI6 A;  4GBA A;  1PSR A;  5HLO A;  4DUQ A;  1VRK A;  2PSR A;  3JVT B;  3D0Y B;  1N2D A;  3WXA A;  3H4S E;  1KSO A;  3E3R A;  1MWN A;  4M2O A;  2JNX A;  5DKQ A;  1EH2 A;  1CDP A;  2MLF C;  2KBI A;  1DJZ A;  4PE1 A;  2LLT A;  5TNC A;  1TOP A;  3O78 A;  1NX0 A;  1NWD A;  1YVL A;  4USL A;  4QJ4 B;  3EVU A;  5I2Q A;  2OTG B;  1LA0 A;  1NCX A;  1S3P A;  5JJG A;  1KWO C;  1IQ3 A;  1A03 A;  1CDM A;  2BE6 A;  3I5G C;  3I5H C;  1A75 B;  2R2I A;  1G4Y R;  1XVJ A;  4YI8 A;  1UP5 A;  1YUT A;  3EVV A;  1CM4 A;  1K96 A;  4NDB A;  3KO0 A;  3LLE A;  1RFJ A;  1SW8 A;  3AAK A;  4PDZ A;  1K90 D;  1DJY A;  5DKR A;  1ODB A;  1KSM A;  4YGB B;  5I2L A;  4MRY A;  1NX3 A;  4BY5 A;  4XYN A;  1MUX A;  1YUR A;  1XFZ O;  1JFK A;  3LL8 B;  2QPT A;  4HRG A;  5J3X A;  1QX2 A;  5HKY A;  3EKJ A;  1HQV A;  2EGD A;  1AJ5 A;  4C0J A;  1SL8 A;  3OP0 A;  1XK4 A;  1Y1A A;  2LP3 A;  3TZ1 A;  4GAO A;  2Q4U A;  2I2R E;  4WQ2 A;  4FQO A;  2BKH B;  1KFX L;  1QIV A;  1XFU O;  2CCM A;  1M39 A;  4CLN A;  3BXK A;  1IKU A;  2OTG C;  3SG5 A;  4GFT A;  1AHR A;  2I18 A;  1B7T Y;  1OZS A;  2LLU A;  5F6T A;  2KOT A;  1CDN A;  2VRG A;  1V1F A;  4D1E A;  1GGW A;  5G08 A;  1KFX S;  1OOJ A;  2CTN A;  3FWC A;  1C07 A;  1CMG A;  2I7A A;  1KQV A;  1MF8 B;  2M8U A;  5HLV A;  1L2O B;  1F54 A;  1IRJ A;  1DGU A;  4I5J A;  2KFG A;  3TDI A;  1QTX A;  2EC6 C;  4GPL B;  4XJK A;  1BR4 B;  2LE9 B;  4I5L B;  2ZKM X;  3PSR A;  4JQ0 D;  4Q04 A;  3TDZ A;  4AOM A;  1J7O A;  1QV0 A;  2LVJ A;  1J1E A;  2P6B B;  1B47 A;  1DMO A;  4N1G A;  1NYA A;  1S6I A;  2MJW B;  1CTR A;  3EVR A;  1NSH A;  3ZWH A;  4DCK A;  3KPX A;  2M9G A;  4PHK A;  2JNF A;  1NP8 A;  2COL B;  4YGE B;  3VGO A;  4MVF A;  5CSJ A;  2BE4 A;  1XYD A;  1OMR A;  4TNC A;  1JWD A;  5AEQ A;  1JSA A;  2KYC A;  4I5N B;  2KHN A;  1KFU S;  4GGN A;  3SIA A;  3AKB A;  1FBV A;  5FYX A;  4N1F A;  2RGI A;  1RJV A;  2FCE A;  3HX4 A;  1A29 A;  5KTY A;  1YUU A;  2M3W A;  1PVA A;  1ZAC A;  1M45 A;  1JFJ A;  2DOQ A;  4XJK B;  2LV7 A;  2KDH A;  1L2O C;  1KWO B;  1PK0 D;  2GGZ A;  5AAN A;  4CFR A;  3I5G B;  1QV1 A;  3AKA A;  1XFY O;  1XFV O;  2F3Z A;  2G9B A;  1ZOT B;  2KAY A;  2NXQ A;  4DIR A;  2KGR A;  1TN4 A;  1ALV A;  2LMV A;  1C7W A;  1R6P A;  1BJF A;  1B8R A;  1DJX A;  2Q91 A;  2F33 A;  3BUN B;  2BBN A;  2L2E A;  2NZ0 A;  3JTD C;  2HET A;  2K7D A;  1DJH A;  3GK2 A;  1BR1 B;  2JZI A;  1V1G A;  2JU0 A;  2LC5 A;  2Y1N A;  4U8D A;  4UPG A;  2M49 B;  1SK6 D;  4JWQ A;  2HQ8 A;  2LVI A;  2ZNE A;  1S36 A;  2K7O A;  2LNK A;  2OPO A;  1WLZ A;  4ORC B;  4P5O E;  1LVC D;  1WDC B;  5GQQ C;  2JC2 A;  1IH0 A;  1YUS A;  4OR9 B;  2JTT A;  2BKI B;  1BOC A;  2JTZ A;  2LVV A;  1BG1 A;  2JT8 A;  1UHK A;  1W7J B;  2KI4 B;  1NCZ A;  1SCM B;  2JRF A;  1DGV A;  2O60 A;  1AJ4 A;  2M7L A;  1SR6 C;  1J7R A;  1BMO A;  1QVI Y;  4PAL A;  1IGV A;  4E68 A;  4R1E A;  3AAJ A;  3CZT X;  4P2Y B;  2OS8 C;  1EL4 A;  3DD4 A;  1UHJ A;  2K0J A;  3OB1 B;  2E6W A;  3IQO A;  3NXA A;  3VRR A;  4OVN F;  1UUR A;  2EC6 B;  3TUY C;  1H4B A;  1K9U A;  1FF1 A;  1U5I A;  1PSB A;  1B8C A;  2AAO A;  3PAL A;  1S6C A;  4PCW A;  1NPQ A;  4PE4 A;  1DT7 B;  1FW4 A;  4F0Z B;  1UWO A;  3SG7 A;  1TCF A;  2GGM A;  1B7T Z;  1SYM A;  1WRK A;  1TNP A;  1WDC C;  2M7N A;  2F8P A;  5ER4 X;  1MXE A;  3PLF B;  5I8N A;  4ZCU A;  1A2X A;  1PUL A;  3A4U B;  4PE7 A;  2KI4 C;  5HKW A;  2K61 A;  4AQI A;  1GJY A;  1SCM C;  2FOT A;  3BOW A;  3O4Y A;  1DJG A;  1K9K A;  2K8M B;  1CLM A;  3BUO B;  2SAS A;  2CNP A;  1QLS A;  2MRD A;  3BYA A;  2V53 A;  1KCY A;  3M0W A;  5CSF A;  2M1U A;  1Y0V H;  2L4H A;  2MAZ A;  1N65 A;  1RK9 A;  5BPJ A;  1A4P A;  2JUL A;  2KGB C;  4L9M A;  1U5I B;  4MEW A;  1J1D A;  4YI9 A;  3FIA A;  3LK1 A;  3WHT B;  1D1O A;  2KNE A;  5JOL A;  3DF0 A;  3KEV A;  4C0K A;  1QXP A;  2BBM A;  1WRZ A;  1B4C A;  2WCF A;  3CR2 A;  4GGF A;  1NUB A;  4HRE E;  1AP4 A;  2WC8 A;  3DVM A;  4WQ3 A;  2K2F A;  1QLK A;  4IL1 A;  4M2P A;  1NX1 A;  5D69 A;  4OCI A;  3JTD B;  1PRW A;  1AVS A;  1RRO A;  1KK8 B;  3DVJ A;  1KQM C;  1EG4 A;  1M63 B;  3ICB A;  1AK8 A;  1HT9 A;  4MN0 A;  3BOW B;  4N5X A;  5K89 A;  5CSI A;  1WY9 A;  1F71 A;  2PMY A;  1L7Z A;  1TTX A;  2LHI A;  4ORB B;  1JF0 A;  4C0L A;  1F55 A;  2F2O A;  3SG2 A;  2L98 A;  2ZND A;  1REC A;  2ZN8 A;  3NSO A;  3VRO A;  2H2K A;  1DJI A;  2A4J A;  3HCM A;  3PAT A;  2NCO A;  3CTN A;  1RWY A;  5KSZ A;  5HKZ A;  4CPV A;  1OMD A;  1SL7 A;  4HSZ A;  2G2B A;  4MZJ A;  3DF0 B;  3BQ3 A;  2KBM A;  3KF9 A;  4DRW A;  1X02 A;  3ZNI A;  1CKK A;  3I5I C;  1IJ5 A;  5I2O A;  3VRN A;  2LP2 A;  2LHL A;  3SJS A;  1Y6W A;  5HYD A;  1SR6 B;  1XFX O;  1C7V A;  1J7Q A;  2QAC A;  2KQY A;  1SL9 A;  2OS8 B;  3CGA A;  1S6J A;  2MHH A;  1DTL A;  1SBJ A;  2LUX A;  2Y1M A;  2O5G A;  1B1G A;  1K2H A;  1TIZ A;  2LMT A;  1SKT A;  3C1V A;  2HPS A;  1QJT A;  3TS5 C;  1K8U A;  1G33 A;  2HF5 A;  2NLN A;  1CLB A;  3PN7 B;  3TUY B;  1KK7 Y;  1TCO B;  2WOS A;  1KK8 C;  2CBL A;  2LCP A;  4YGC B;  4FTG A;  1M46 A;  2LAN A;  2MBX A;  2KAX A;  2JT0 A; 
#chains in the Genus database with same CATH topology
 2H61 C;  2KQ6 A;  4OV2 A;  3EK7 A;  1IJ6 A;  1K94 A;  1B9A A;  2K7B A;  4DS7 A;  2KPH A;  3R1V A;  5D7F A;  3D10 A;  3VRQ A;  1MR8 A;  1QVI Z;  2IS9 A;  3CZ2 A;  1F4Q A;  2JT3 A;  5AXI A;  5DKN A;  4A4C A;  3S0G A;  1S1E A;  3NGV A;  4JPZ B;  5AFP A;  1NCY A;  1DJW A;  3CR4 X;  3D76 A;  3EKH A;  3S0F A;  3O2P A;  2L51 A;  2BCA A;  3O6B A;  3IF7 A;  2KFF A;  4YBH B;  2EHB A;  3OHM B;  3S0A A;  1CFF A;  1UHN A;  3CDN A;  3N7H A;  1Q80 A;  3PFV A;  2BEC A;  4GGF C;  1K93 D;  2QDI A;  3IVT A;  2L5X B;  2ZN9 A;  3BUX B;  1SY9 A;  1XFW O;  1H8B A;  1CFD A;  1MXL C;  1YX8 A;  1ALW A;  2M1K B;  1LIN A;  1CM1 A;  2JPO A;  2PAL A;  1B8L A;  3MSE B;  1QS7 A;  1N0Y A;  1IWQ A;  3EG5 B;  1F4O A;  1DQE A;  3LK0 A;  3BUW B;  4ICB A;  3LCP C;  3BJH A;  3PN7 C;  2KSP A;  1SMG A;  2L0P A;  2K7C A;  1DVI A;  4MLW A;  1EJ3 A;  3I5F C;  3TDU A;  4ETO A;  2GTE A;  3FS7 A;  4YGD B;  3PM8 A;  3WHU B;  4GUK A;  4PE0 A;  1K95 A;  2KFH A;  3OX5 A;  1QX7 A;  2MLE C;  2Y5I A;  1YRT B;  3SIB A;  1S5G Z;  2L4I A;  5CPV A;  1KQM B;  3A8R A;  1ZUZ A;  1AUI B;  2WC5 A;  4GNK B;  3CLN A;  1GGZ A;  2KYF A;  1E8A A;  1W7I B;  4QJ5 B;  1TNQ A;  3EK8 A;  1NX2 A;  1TNW A;  4OZD A;  2HQW A;  4INW A;  1DC1 A;  2FCD A;  3WNX B;  2AUC A;  4PHM A;  2BL0 C;  1OZO A;  2M29 A;  2ISD A;  3RLZ A;  1PVB A;  3UO9 A;  1S5G Y;  3NSK A;  1CNP A;  3B86 A;  2H61 A;  3R72 A;  1UHI A;  2SCP A;  3DY9 A;  1YRU B;  5KU1 A;  1R2U A;  3SS3 A;  1BF5 A;  3JVT C;  1CLL A;  1Y1U A;  1J7P A;  1SNL A;  2CT9 A;  1MHO A;  2NCP A;  2PVB A;  3K21 A;  3CR5 X;  4ZCV A;  1UHH A;  3I5I B;  3IQQ A;  4QJ3 B;  1LA3 A;  3VRP A;  4MSP A;  5PAL A;  1OW4 A;  2QEB A;  3SG6 A;  1WLM A;  2M0R A;  1ZFS A;  2WCE A;  4PHJ A;  3UNW A;  2WCB A;  1QAT A;  1DF0 A;  2KI6 C;  2CXJ A;  2LM5 A;  3CWG A;  4BY4 A;  1CMF A;  1XO5 A;  3NSI A;  1IQ5 A;  1OQP A;  4MRX A;  4M2Q A;  4MBE A;  4YRU A;  3DVK A;  5I94 A;  1K9P A;  3GK4 X;  1M31 A;  2LLS A;  1BU3 A;  2K2A A;  3TS5 B;  4AQJ A;  1NIW A;  5B8I B;  2QEO A;  4CID A;  3NHI A;  2BAP A;  2WND A;  1FPW A;  4OKH A;  2JQ6 A;  1F70 A;  1F8H A;  1CB1 A;  1JC2 A;  3L4L A;  1YTZ C;  3OX6 A;  2PRU A;  2AMI A;  2BCX A;  2F3Y A;  2WCH A;  3DYE A;  4NDD A;  1EG3 A;  1YVH A;  3NSL A;  1EXR A;  1TNX A;  4A4B A;  2ZRT A;  5CSN A;  1S26 D;  1SRA A;  2TN4 A;  3FWB A;  2JOJ A;  1LXF C;  1Y1X A;  1QX5 B;  1KFU L;  2PAS A;  1PAL A;  3OB2 B;  2FJU B;  3GK1 A;  1CFC A;  1XA5 A;  2L50 A;  3QRX A;  1QIW A;  1GQM A;  4HRH A;  1OSA A;  3RM1 A;  4ORA B;  4MZK A;  2JWW A;  1DF0 B;  2LAP A;  4NDC A;  3SG4 A;  3CS1 A;  2ZRS A;  1JUO A;  4WRI A;  1KK7 Z;  2YGU A;  1YR5 A;  2M97 A;  2F2P A;  2JPT A;  3R1P A;  3KHE A;  1WRL A;  5AER A;  4CFQ A;  2KI6 D;  2KAV A;  2BCB A;  1YX7 A;  3SG3 A;  2LUC A;  1OMV A;  5ER5 A;  1OOI X;  2Y4Q A;  1IIO A;  2GV5 A;  3D0Y A;  3DVE A;  2LMU A;  3BUM B;  2L2C A;  4JD9 A;  1SPY A;  1MQ1 A;  1SCV A;  3O4X A;  1TRF A;  1BOD A;  1OE9 B;  1RTP 1;  1UUS A;  4NQG A;  1JBA A;  3I5F B;  3EK4 A;  5IBW A;  4YGA A;  1CDL A;  2I94 A;  2LVK A;  2E30 A;  1JF2 A;  3I5H B;  1FI5 A;  3F45 A;  1BT6 A;  3GOF A;  1LKJ A;  1CFP A;  4MZL A;  2B1U A;  2JXC A;  1J55 A;  4KYN A;  2D8N A;  4PHN A;  1BLQ A;  1IG5 A;  2MA2 A;  1QAS A;  2ZFD A;  1XK4 C;  1GM0 A;  1ZMZ A;  1G8I A;  1A75 A;  2JXL A;  4I5K A;  3Q8I A;  2WOR A;  2BL0 B;  1FI6 A;  4GBA A;  1PSR A;  5HLO A;  4DUQ A;  3OBV A;  1VRK A;  2ERB A;  2PSR A;  3D0Y B;  3JVT B;  1N2D A;  3WXA A;  3H4S E;  1KSO A;  3E3R A;  1MWN A;  5FI2 A;  4M2O A;  2JNX A;  2QEH A;  5DKQ A;  1EH2 A;  1P28 A;  1CDP A;  2MLF C;  2KBI A;  1DJZ A;  4PE1 A;  2LLT A;  5TNC A;  1TOP A;  3DZT A;  3O78 A;  1NX0 A;  1NWD A;  1YVL A;  4USL A;  4QJ4 B;  3EVU A;  5D3O A;  2OTG B;  5I2Q A;  3FE8 A;  1LA0 A;  1NCX A;  1TUJ A;  1S3P A;  5JJG A;  1C3Z A;  1KWO C;  1IQ3 A;  1A03 A;  1CDM A;  2BE6 A;  3I5G C;  3I5H C;  1A75 B;  3S0E A;  2KLD A;  2R2I A;  1G4Y R;  1XVJ A;  4YI8 A;  3S0D A;  1UP5 A;  1YUT A;  3EVV A;  1CM4 A;  1K96 A;  4NDB A;  3FE6 A;  3KO0 A;  3LLE A;  1RFJ A;  1SW8 A;  3AAK A;  4PDZ A;  1K90 D;  1DJY A;  2QEV A;  5DKR A;  1ODB A;  1KSM A;  3CYZ A;  4YGB B;  5I2L A;  4MRY A;  4PT1 A;  1NX3 A;  4BY5 A;  4XYN A;  1MUX A;  1YUR A;  1XFZ O;  1JFK A;  3LL8 B;  2QPT A;  1XFR A;  4HRG A;  1QX2 A;  5J3X A;  5HKY A;  3EKJ A;  1HQV A;  2EGD A;  1AJ5 A;  4C0J A;  1SL8 A;  2WCL A;  3OP0 A;  1XK4 A;  1Y1A A;  2LP3 A;  5FI7 A;  3TZ1 A;  4GAO A;  2Q4U A;  2I2R E;  4WQ2 A;  4FQO A;  2BKH B;  1KFX L;  1QIV A;  1XFU O;  2CCM A;  1M39 A;  4CLN A;  3BXK A;  1IKU A;  2OTG C;  3SG5 A;  3NHT A;  4GFT A;  1AHR A;  2I18 A;  1B7T Y;  1OZS A;  2LLU A;  3K1E A;  5F6T A;  2KOT A;  1CDN A;  2VRG A;  1V1F A;  3V2L A;  4D1E A;  1GGW A;  5G08 A;  1KFX S;  1OOJ A;  2CTN A;  3FWC A;  1C07 A;  1W9Z A;  1CMG A;  2I7A A;  1KQV A;  1MF8 B;  2M8U A;  5HLV A;  1L2O B;  1F54 A;  1IRJ A;  1DGU A;  4I5J A;  2KFG A;  3TDI A;  3RZS A;  1QTX A;  2EC6 C;  4GPL B;  4XJK A;  1BR4 B;  2LE9 B;  3CAB A;  2ZKM X;  3PSR A;  4I5L B;  4JQ0 D;  4Q04 A;  3SS5 A;  3TDZ A;  4AOM A;  1J7O A;  2WCK A;  1QV0 A;  2LVJ A;  1TUZ A;  1J1E A;  2P6B B;  1B47 A;  1DMO A;  4N1G A;  1NYA A;  1S6I A;  2MJW B;  1CTR A;  3EVR A;  1NSH A;  3ZWH A;  4DCK A;  3KPX A;  2M9G A;  4PHK A;  5HL1 A;  2JNF A;  1NP8 A;  2COL B;  4YGE B;  3VGO A;  4MVF A;  5CSJ A;  3OGN A;  2BE4 A;  1XYD A;  1OMR A;  4TNC A;  1JWD A;  5AEQ A;  1JSA A;  2KYC A;  4I5N B;  2KHN A;  1KFU S;  4GGN A;  3SIA A;  3AKB A;  3CZ1 A;  1FBV A;  5FYX A;  4N1F A;  2RGI A;  1RJV A;  3B87 A;  1DEK A;  2FCE A;  3DXL A;  3HX4 A;  3D78 A;  1A29 A;  5KTY A;  1YUU A;  2M3W A;  2PQL A;  1PVA A;  1ZAC A;  1M45 A;  1JFJ A;  2DOQ A;  4XJK B;  2LV7 A;  2KDH A;  2P70 A;  2FJY A;  1L2O C;  1KWO B;  1PK0 D;  2GGZ A;  1T14 A;  2BNX A;  5AAN A;  4CFR A;  3I5G B;  1QV1 A;  3AKA A;  1XFY O;  1XFV O;  2F3Z A;  2G9B A;  1ZOT B;  2KAY A;  2NXQ A;  4DIR A;  2KGR A;  3PM2 A;  1TN4 A;  1ALV A;  2LMV A;  1C7W A;  1R6P A;  1BJF A;  1B8R A;  1DJX A;  2Q91 A;  2F33 A;  3BUN B;  2BBN A;  2L2E A;  2NZ0 A;  3JTD C;  2HET A;  2K7D A;  1DJH A;  3GK2 A;  1BR1 B;  2JZI A;  1V1G A;  2JU0 A;  2LC5 A;  2Y1N A;  4U8D A;  3SS4 A;  4UPG A;  2M49 B;  1SK6 D;  4JWQ A;  2HQ8 A;  2LVI A;  2ZNE A;  1S36 A;  5EL2 A;  2K7O A;  2LNK A;  2OPO A;  1WLZ A;  4ORC B;  4P5O E;  1LVC D;  1WDC B;  1Z2C B;  5GQQ C;  2JC2 A;  1IH0 A;  1YUS A;  4OR9 B;  2JTT A;  2BKI B;  1BOC A;  2JTZ A;  2LVV A;  1BG1 A;  2JT8 A;  1UHK A;  1W7J B;  2KI4 B;  1Z4H A;  3B6X A;  1NCZ A;  1SCM B;  2JRF A;  1DGV A;  1DEL A;  2O60 A;  1AJ4 A;  3QME A;  2M7L A;  1SR6 C;  5FI6 A;  1J7R A;  1BMO A;  1QVI Y;  4PAL A;  1IGV A;  4E68 A;  4R1E A;  4FQT A;  3AAJ A;  3CZT X;  4P2Y B;  2OS8 C;  1EL4 A;  1OOF A;  3B88 A;  3DD4 A;  1UHJ A;  2K0J A;  3OB1 B;  2E6W A;  3IQO A;  3NXA A;  3VRR A;  4OVN F;  1UUR A;  2EC6 B;  3TUY C;  1H4B A;  1K9U A;  1OOG A;  3L4A A;  1U5I A;  1PSB A;  1FF1 A;  1B8C A;  2AAO A;  3PAL A;  1C3Y A;  1S6C A;  4PCW A;  1NPQ A;  4PE4 A;  1DT7 B;  1FW4 A;  1OOH A;  1UWO A;  4F0Z B;  3SG7 A;  1TCF A;  2GGM A;  1B7T Z;  1SYM A;  1WRK A;  1TNP A;  1WDC C;  2M7N A;  2F8P A;  3S0B A;  1TWO A;  1MXE A;  5ER4 X;  3PLF B;  5I8N A;  4ZCU A;  1A2X A;  1PUL A;  3A4U B;  4PE7 A;  2KI4 C;  5HKW A;  2K61 A;  4AQI A;  2WCJ A;  1GJY A;  1SCM C;  2FOT A;  3BOW A;  3O4Y A;  1DJG A;  1K9K A;  2K8M B;  1CLM A;  3BUO B;  2SAS A;  2CNP A;  1QLS A;  2MRD A;  3BYA A;  3D74 A;  2V53 A;  1KCY A;  3M0W A;  5CSF A;  2M1U A;  1Y0V H;  2L4H A;  2MAZ A;  3B7A A;  1N65 A;  1RK9 A;  5DIC A;  5BPJ A;  1A4P A;  1QWV A;  2JUL A;  2KGB C;  1U5I B;  4L9M A;  1J1D A;  3R1O A;  4MEW A;  4YI9 A;  3L47 A;  3FIA A;  3LK1 A;  3WHT B;  1D1O A;  2KNE A;  3BFH A;  4INX A;  5JOL A;  3DF0 A;  3KEV A;  4C0K A;  1QXP A;  2BBM A;  1WRZ A;  2K60 A;  3D75 A;  1B4C A;  1SSE B;  2WCF A;  3CR2 A;  4GGF A;  1NUB A;  4HRE E;  1AP4 A;  2WC8 A;  3DVM A;  4WQ3 A;  2K2F A;  1QLK A;  4IL1 A;  4M2P A;  1NX1 A;  5D69 A;  4OCI A;  3JTD B;  1PRW A;  1AVS A;  1RRO A;  1KK8 B;  3DVJ A;  1KQM C;  1EG4 A;  1M63 B;  3ICB A;  1AK8 A;  4JKT A;  1HT9 A;  4MN0 A;  3BOW B;  4N5X A;  5K89 A;  5CSI A;  1WY9 A;  4F7F A;  1F71 A;  2PMY A;  3CZ0 A;  1L7Z A;  1TTX A;  3BFB A;  3D73 A;  2LHI A;  4ORB B;  1JF0 A;  4C0L A;  1F55 A;  3D77 A;  2F2O A;  3SG2 A;  1LS8 A;  2L98 A;  2ZND A;  1REC A;  1ORG A;  2ZN8 A;  3NSO A;  3VRO A;  2H2K A;  1DJI A;  2A4J A;  3HCM A;  3PAT A;  2NCO A;  3CTN A;  1RWY A;  5KSZ A;  5HKZ A;  3BFA A;  3FE9 A;  4CPV A;  1OMD A;  1SL7 A;  4HSZ A;  2G2B A;  3PJI A;  3DF0 B;  3BQ3 A;  2KBM A;  2P71 A;  3KF9 A;  4MZJ A;  1X02 A;  3VB1 A;  3ZNI A;  4DRW A;  1CKK A;  3I5I C;  1IJ5 A;  5I2O A;  3VRN A;  2LP2 A;  2LHL A;  3SJS A;  1Y6W A;  5HYD A;  1SR6 B;  1XFX O;  1C7V A;  1J7Q A;  2WCM A;  2QAC A;  2KQY A;  1SL9 A;  2OS8 B;  3CGA A;  1S6J A;  2MHH A;  1DTL A;  1SBJ A;  2LUX A;  2WC6 A;  2O5G A;  2Y1M A;  1B1G A;  1K2H A;  1TIZ A;  2LMT A;  1SKT A;  3C1V A;  2HPS A;  1QJT A;  3TS5 C;  1K8U A;  1G33 A;  2HF5 A;  2NLN A;  1CLB A;  3PN7 B;  3TUY B;  1KK7 Y;  1TCO B;  2KLE A;  2WOS A;  1KK8 C;  2CBL A;  2L5Y A;  2LCP A;  4YGC B;  2PYQ A;  4FTG A;  1M46 A;  2H8V A;  2LAN A;  2MBX A;  4IJ7 A;  2KAX A;  2JT0 A; 
#chains in the Genus database with same CATH homology
 2H61 C;  2KQ6 A;  4OV2 A;  3EK7 A;  1IJ6 A;  1K94 A;  1B9A A;  2K7B A;  4DS7 A;  5D7F A;  3D10 A;  3VRQ A;  1MR8 A;  1QVI Z;  2IS9 A;  1F4Q A;  2JT3 A;  5AXI A;  5DKN A;  4A4C A;  1S1E A;  4JPZ B;  5AFP A;  1NCY A;  1DJW A;  3CR4 X;  3EKH A;  3O2P A;  2L51 A;  2BCA A;  3O6B A;  3IF7 A;  2KFF A;  4YBH B;  2EHB A;  3OHM B;  1CFF A;  1UHN A;  1Q80 A;  3PFV A;  2BEC A;  4GGF C;  1K93 D;  2L5X B;  2ZN9 A;  3BUX B;  1SY9 A;  1XFW O;  1H8B A;  1CFD A;  1MXL C;  1YX8 A;  1ALW A;  2M1K B;  1LIN A;  1CM1 A;  2PAL A;  1B8L A;  3MSE B;  1QS7 A;  1N0Y A;  1IWQ A;  1F4O A;  3LK0 A;  3BUW B;  4ICB A;  3LCP C;  3PN7 C;  2KSP A;  1SMG A;  2L0P A;  2K7C A;  1DVI A;  4MLW A;  1EJ3 A;  3I5F C;  3TDU A;  4ETO A;  3FS7 A;  4YGD B;  3PM8 A;  3WHU B;  4GUK A;  4PE0 A;  1K95 A;  2KFH A;  3OX5 A;  1QX7 A;  2MLE C;  2Y5I A;  1YRT B;  3SIB A;  1S5G Z;  2L4I A;  5CPV A;  1KQM B;  3A8R A;  1ZUZ A;  1AUI B;  4GNK B;  3CLN A;  1GGZ A;  2KYF A;  1E8A A;  1W7I B;  4QJ5 B;  1TNQ A;  3EK8 A;  1NX2 A;  1TNW A;  2HQW A;  2FCD A;  3WNX B;  2AUC A;  4PHM A;  2BL0 C;  1OZO A;  2M29 A;  2ISD A;  3RLZ A;  1PVB A;  1CNP A;  1S5G Y;  3NSK A;  2H61 A;  1UHI A;  2SCP A;  1YRU B;  5KU1 A;  1R2U A;  1BF5 A;  3JVT C;  1CLL A;  1Y1U A;  1J7P A;  1SNL A;  2CT9 A;  1MHO A;  2NCP A;  2PVB A;  3K21 A;  3CR5 X;  4ZCV A;  1UHH A;  3I5I B;  3IQQ A;  4QJ3 B;  1LA3 A;  3VRP A;  4MSP A;  5PAL A;  3SG6 A;  1WLM A;  2M0R A;  1ZFS A;  2WCE A;  4PHJ A;  2WCB A;  1QAT A;  1DF0 A;  2KI6 C;  2CXJ A;  2LM5 A;  3CWG A;  4BY4 A;  1CMF A;  1XO5 A;  3NSI A;  1IQ5 A;  1OQP A;  4MRX A;  4M2Q A;  4MBE A;  4YRU A;  3DVK A;  1K9P A;  3GK4 X;  1M31 A;  2LLS A;  1BU3 A;  2K2A A;  3TS5 B;  4AQJ A;  1NIW A;  5B8I B;  4CID A;  2WND A;  1FPW A;  4OKH A;  2JQ6 A;  1F70 A;  1F8H A;  1CB1 A;  1JC2 A;  1YTZ C;  3OX6 A;  2PRU A;  2AMI A;  2BCX A;  2F3Y A;  4NDD A;  1EG3 A;  1YVH A;  3NSL A;  1EXR A;  1TNX A;  4A4B A;  2ZRT A;  5CSN A;  1S26 D;  1SRA A;  2TN4 A;  3FWB A;  2JOJ A;  1LXF C;  1Y1X A;  1QX5 B;  1KFU L;  2PAS A;  1PAL A;  3OB2 B;  2FJU B;  3GK1 A;  1CFC A;  1XA5 A;  2L50 A;  3QRX A;  1QIW A;  1GQM A;  4HRH A;  1OSA A;  3RM1 A;  4ORA B;  4MZK A;  2JWW A;  1DF0 B;  2LAP A;  4NDC A;  3SG4 A;  3CS1 A;  2ZRS A;  1JUO A;  4WRI A;  1KK7 Z;  1YR5 A;  2M97 A;  2F2P A;  2JPT A;  3KHE A;  1WRL A;  5AER A;  4CFQ A;  2KI6 D;  2KAV A;  2BCB A;  1YX7 A;  3SG3 A;  2LUC A;  1OMV A;  5ER5 A;  2Y4Q A;  2GV5 A;  3D0Y A;  3DVE A;  2LMU A;  3BUM B;  1SPY A;  1MQ1 A;  1SCV A;  1TRF A;  1BOD A;  1OE9 B;  1RTP 1;  1UUS A;  4NQG A;  1JBA A;  3I5F B;  3EK4 A;  5IBW A;  4YGA A;  1CDL A;  2I94 A;  2LVK A;  2E30 A;  1JF2 A;  3I5H B;  1FI5 A;  3F45 A;  1BT6 A;  3GOF A;  1LKJ A;  1CFP A;  4MZL A;  2B1U A;  2JXC A;  1J55 A;  2D8N A;  4PHN A;  1BLQ A;  1IG5 A;  2MA2 A;  1QAS A;  2ZFD A;  1XK4 C;  1ZMZ A;  1G8I A;  1A75 A;  2JXL A;  4I5K A;  2WOR A;  2BL0 B;  1FI6 A;  4GBA A;  1PSR A;  5HLO A;  4DUQ A;  1VRK A;  2PSR A;  3JVT B;  3D0Y B;  1N2D A;  3WXA A;  3H4S E;  1KSO A;  3E3R A;  1MWN A;  4M2O A;  2JNX A;  5DKQ A;  1EH2 A;  1CDP A;  2MLF C;  2KBI A;  1DJZ A;  4PE1 A;  2LLT A;  5TNC A;  1TOP A;  3O78 A;  1NX0 A;  1NWD A;  1YVL A;  4USL A;  4QJ4 B;  3EVU A;  5I2Q A;  2OTG B;  1LA0 A;  1NCX A;  1S3P A;  5JJG A;  1KWO C;  1IQ3 A;  1A03 A;  1CDM A;  2BE6 A;  3I5G C;  3I5H C;  1A75 B;  2R2I A;  1G4Y R;  1XVJ A;  4YI8 A;  1UP5 A;  1YUT A;  3EVV A;  1CM4 A;  1K96 A;  4NDB A;  3KO0 A;  3LLE A;  1RFJ A;  1SW8 A;  3AAK A;  4PDZ A;  1K90 D;  1DJY A;  5DKR A;  1ODB A;  1KSM A;  4YGB B;  5I2L A;  4MRY A;  1NX3 A;  4BY5 A;  4XYN A;  1MUX A;  1YUR A;  1XFZ O;  1JFK A;  3LL8 B;  2QPT A;  4HRG A;  5J3X A;  1QX2 A;  5HKY A;  3EKJ A;  1HQV A;  2EGD A;  1AJ5 A;  4C0J A;  1SL8 A;  3OP0 A;  1XK4 A;  1Y1A A;  2LP3 A;  3TZ1 A;  4GAO A;  2Q4U A;  2I2R E;  4WQ2 A;  4FQO A;  2BKH B;  1KFX L;  1QIV A;  1XFU O;  2CCM A;  1M39 A;  4CLN A;  3BXK A;  1IKU A;  2OTG C;  3SG5 A;  4GFT A;  1AHR A;  2I18 A;  1B7T Y;  1OZS A;  2LLU A;  5F6T A;  2KOT A;  1CDN A;  2VRG A;  1V1F A;  4D1E A;  1GGW A;  5G08 A;  1KFX S;  1OOJ A;  2CTN A;  3FWC A;  1C07 A;  1CMG A;  2I7A A;  1KQV A;  1MF8 B;  2M8U A;  5HLV A;  1L2O B;  1F54 A;  1IRJ A;  1DGU A;  4I5J A;  2KFG A;  3TDI A;  1QTX A;  2EC6 C;  4GPL B;  4XJK A;  1BR4 B;  2LE9 B;  4I5L B;  2ZKM X;  3PSR A;  4JQ0 D;  4Q04 A;  3TDZ A;  4AOM A;  1J7O A;  1QV0 A;  2LVJ A;  1J1E A;  2P6B B;  1B47 A;  1DMO A;  4N1G A;  1NYA A;  1S6I A;  2MJW B;  1CTR A;  3EVR A;  1NSH A;  3ZWH A;  4DCK A;  3KPX A;  2M9G A;  4PHK A;  2JNF A;  1NP8 A;  2COL B;  4YGE B;  3VGO A;  4MVF A;  5CSJ A;  2BE4 A;  1XYD A;  1OMR A;  4TNC A;  1JWD A;  5AEQ A;  1JSA A;  2KYC A;  4I5N B;  2KHN A;  1KFU S;  4GGN A;  3SIA A;  3AKB A;  1FBV A;  5FYX A;  4N1F A;  2RGI A;  1RJV A;  2FCE A;  3HX4 A;  1A29 A;  5KTY A;  1YUU A;  2M3W A;  1PVA A;  1ZAC A;  1M45 A;  1JFJ A;  2DOQ A;  4XJK B;  2LV7 A;  2KDH A;  1L2O C;  1KWO B;  1PK0 D;  2GGZ A;  5AAN A;  4CFR A;  3I5G B;  1QV1 A;  3AKA A;  1XFY O;  1XFV O;  2F3Z A;  2G9B A;  1ZOT B;  2KAY A;  2NXQ A;  4DIR A;  2KGR A;  1TN4 A;  1ALV A;  2LMV A;  1C7W A;  1R6P A;  1BJF A;  1B8R A;  1DJX A;  2Q91 A;  2F33 A;  3BUN B;  2BBN A;  2L2E A;  2NZ0 A;  3JTD C;  2HET A;  2K7D A;  1DJH A;  3GK2 A;  1BR1 B;  2JZI A;  1V1G A;  2JU0 A;  2LC5 A;  2Y1N A;  4U8D A;  4UPG A;  2M49 B;  1SK6 D;  4JWQ A;  2HQ8 A;  2LVI A;  2ZNE A;  1S36 A;  2K7O A;  2LNK A;  2OPO A;  1WLZ A;  4ORC B;  4P5O E;  1LVC D;  1WDC B;  5GQQ C;  2JC2 A;  1IH0 A;  1YUS A;  4OR9 B;  2JTT A;  2BKI B;  1BOC A;  2JTZ A;  2LVV A;  1BG1 A;  2JT8 A;  1UHK A;  1W7J B;  2KI4 B;  1NCZ A;  1SCM B;  2JRF A;  1DGV A;  2O60 A;  1AJ4 A;  2M7L A;  1SR6 C;  1J7R A;  1BMO A;  1QVI Y;  4PAL A;  1IGV A;  4E68 A;  4R1E A;  3AAJ A;  3CZT X;  4P2Y B;  2OS8 C;  1EL4 A;  3DD4 A;  1UHJ A;  2K0J A;  3OB1 B;  2E6W A;  3IQO A;  3NXA A;  3VRR A;  4OVN F;  1UUR A;  2EC6 B;  3TUY C;  1H4B A;  1K9U A;  1FF1 A;  1U5I A;  1PSB A;  1B8C A;  2AAO A;  3PAL A;  1S6C A;  4PCW A;  1NPQ A;  4PE4 A;  1DT7 B;  1FW4 A;  4F0Z B;  1UWO A;  3SG7 A;  1TCF A;  2GGM A;  1B7T Z;  1SYM A;  1WRK A;  1TNP A;  1WDC C;  2M7N A;  2F8P A;  5ER4 X;  1MXE A;  3PLF B;  5I8N A;  4ZCU A;  1A2X A;  1PUL A;  3A4U B;  4PE7 A;  2KI4 C;  5HKW A;  2K61 A;  4AQI A;  1GJY A;  1SCM C;  2FOT A;  3BOW A;  3O4Y A;  1DJG A;  1K9K A;  2K8M B;  1CLM A;  3BUO B;  2SAS A;  2CNP A;  1QLS A;  2MRD A;  3BYA A;  2V53 A;  1KCY A;  3M0W A;  5CSF A;  2M1U A;  1Y0V H;  2L4H A;  2MAZ A;  1N65 A;  1RK9 A;  5BPJ A;  1A4P A;  2JUL A;  2KGB C;  4L9M A;  1U5I B;  4MEW A;  1J1D A;  4YI9 A;  3FIA A;  3LK1 A;  3WHT B;  1D1O A;  2KNE A;  5JOL A;  3DF0 A;  3KEV A;  4C0K A;  1QXP A;  2BBM A;  1WRZ A;  1B4C A;  2WCF A;  3CR2 A;  4GGF A;  1NUB A;  4HRE E;  1AP4 A;  2WC8 A;  3DVM A;  4WQ3 A;  2K2F A;  1QLK A;  4IL1 A;  4M2P A;  1NX1 A;  5D69 A;  4OCI A;  3JTD B;  1PRW A;  1AVS A;  1RRO A;  1KK8 B;  3DVJ A;  1KQM C;  1EG4 A;  1M63 B;  3ICB A;  1AK8 A;  1HT9 A;  4MN0 A;  3BOW B;  4N5X A;  5K89 A;  5CSI A;  1WY9 A;  1F71 A;  2PMY A;  1L7Z A;  1TTX A;  2LHI A;  4ORB B;  1JF0 A;  4C0L A;  1F55 A;  2F2O A;  3SG2 A;  2L98 A;  2ZND A;  1REC A;  2ZN8 A;  3NSO A;  3VRO A;  2H2K A;  1DJI A;  2A4J A;  3HCM A;  3PAT A;  2NCO A;  3CTN A;  1RWY A;  5KSZ A;  5HKZ A;  4CPV A;  1OMD A;  1SL7 A;  4HSZ A;  2G2B A;  4MZJ A;  3DF0 B;  3BQ3 A;  2KBM A;  3KF9 A;  4DRW A;  1X02 A;  3ZNI A;  1CKK A;  3I5I C;  1IJ5 A;  5I2O A;  3VRN A;  2LP2 A;  2LHL A;  3SJS A;  1Y6W A;  5HYD A;  1SR6 B;  1XFX O;  1C7V A;  1J7Q A;  2QAC A;  2KQY A;  1SL9 A;  2OS8 B;  3CGA A;  1S6J A;  2MHH A;  1DTL A;  1SBJ A;  2LUX A;  2Y1M A;  2O5G A;  1B1G A;  1K2H A;  1TIZ A;  2LMT A;  1SKT A;  3C1V A;  2HPS A;  1QJT A;  3TS5 C;  1K8U A;  1G33 A;  2HF5 A;  2NLN A;  1CLB A;  3PN7 B;  3TUY B;  1KK7 Y;  1TCO B;  2WOS A;  1KK8 C;  2CBL A;  2LCP A;  4YGC B;  4FTG A;  1M46 A;  2LAN A;  2MBX A;  2KAX A;  2JT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...