2M97A

Optimized ratiometric calcium sensors for functional in vivo imaging of neurons and t-lymphocytes
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
SEEELSECFRIFDKDGNGFIDREEFGDIIRLTGEQLTDEDVDEIFGDSDTDKNGRIDFDEFLKMMENVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Optimized Ratiometric Calcium Sensor
publication title Optimized ratiometric calcium sensors for functional in vivo imaging of neurons and T lymphocytes.
pubmed doi rcsb
source organism Opsanus tau
molecule tags Metal binding protein
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m97A00
1NCYA 4CFRA 2MLFC 4I5NB 5I2LA 2F2OA 2I2RE 1F8HA 4MZJA 2K0JA 2Y4QA 3KF9A 1RJVA 3ICBA 1UUSA 1M46A 1KSOA 5I2QA 1KQMC 1Y6WA 3KEVA 1EL4A 2L51A 1OMDA 1SNLA 2LLSA 4QJ4B 1Q80A 1NIWA 4YRUA 4YGDB 1QLKA 1RFJA 1OZOA 2KNEA 3PM8A 3BOWB 4XJKA 3JTDB 1IRJA 3CTNA 3DVMA 4Q04A 1DT7B 1K9UA 3A4UB 2KQ6A 1CM4A 1LA0A 1S26D 2QPTA 2M8UA 1KK8B 1EG3A 2F3ZA 1BOCA 2LE9B 2OTGB 4MRYA 2JT3A 1BG1A 1PVBA 1RWYA 1DF0B 1QXPA 1X02A 3FWCA 4GAOA 3EK8A 2LLUA 1Y1AA 2NLNA 4MZKA 3I5HC 2LCPA 2K7OA 2L4IA 2CTNA 3H4SE 4GGNA 4PDZA 5KSZA 1XK4A 1W7IB 5D69A 3OB2B 1G4YR 4PCWA 1SCVA 4WRIA 2ISDA 4FTGA 2Y1MA 2ZNEA 1KSMA 1KK7Y 1QX5B 3D10A 2MA2A 3BUXB 1NPQA 1UHJA 1CFDA 1K96A 1B8LA 1SR6C 4F0ZB 1DJGA 4YBHB 4I5LB 2BBNA 1K9KA 1S5GY 4FQOA 5HLOA 1H4BA 3CR4X 1UP5A 1WDCB 2JTZA 2ZN8A 5IBWA 1QV1A 3CR2A 1XO5A 1AHRA 2MRDA 3O6BA 4MVFA 1V1FA 2L5XB 4L9MA 1N65A 4M2OA 4PE0A 1F71A 1DVIA 3AAJA 4N5XA 4UPGA 3PN7C 1LA3A 2G9BA 1BMOA 1TRFA 4C0LA 3TUYB 4CPVA 2K7DA 2ZRSA 2LVIA 3BUOB 3WHTB 3NSKA 3OX5A 1IQ3A 1QVIZ 2KI6D 1DGUA 1EJ3A 3SG7A 1CMFA 1TNXA 1D1OA 1PK0D 1AJ4A 1C7VA 1KFUL 2K61A 3FWBA 2KGRA 1ZFSA 2JULA 1SPYA 3IQQA 4I5KA 1HQVA 3CZTX 4ZCVA 4OR9B 4E68A 1QTXA 4N1GA 1YX8A 1GJYA 1TOPA 3SG3A 3D0YB 2AUCA 2LANA 3QRXA 1VRKA 3VRRA 1BU3A 1UHNA 2MJWB 5J3XA 1F55A 1QV0A 2SASA 2FJUB 1L2OC 5CSFA 5JOLA 4DCKA 1A4PA 3NSIA 5AXIA 3VRPA 1JF2A 1M63B 3SG4A 2MAZA 3OHMB 2B1UA 2QACA 1NX2A 1JBAA 4MN0A 2JNXA 3I5IC 3GOFA 3BUNB 1DF0A 5AERA 2H61C 3BUWB 4C0JA 1YUSA 1JUOA 1LXFC 2KQYA 5PALA 3EVVA 1K93D 2JOJA 1NCXA 1CFCA 2JTTA 1NX1A 2L2EA 2LUCA 1A75B 2D8NA 2M1UA 3JVTB 2FCDA 4USLA 2BL0C 1R6PA 4P2YB 2DOQA 3EKHA 1TNQA 1YURA 1QASA 5GQQC 4OCIA 1KK7Z 1UHIA 4ZCUA 4PHKA 1LKJA 1WRLA 5FYXA 1SCMB 3KO0A 1GGZA 1S5GZ 5HKWA 2KI6C 1WRZA 3TDZA 1AK8A 3OX6A 3VRNA 4NQGA 1Y1UA 1DGVA 1L7ZA 4MLWA 2JXLA 2LNKA 1BODA 2KSPA 2V53A 1KFXL 1M45A 2F2PA 1IH0A 4AQJA 3I5GC 1J7PA 3O78A 1MF8B 1TCFA 2PMYA 1KWOC 2G2BA 2M9GA 1CKKA 3TS5C 1EG4A 1CDMA 2KBIA 2KGBC 1MWNA 2O60A 1J1DA 2AMIA 2MHHA 4GPLB 2K7BA 1UHKA 1K90D 4MZLA 1PVAA 2LM5A 2EC6B 1C7WA 2CXJA 3O4YA 2IS9A 3KHEA 1OSAA 2JZIA 2M0RA 3M0WA 2PASA 2PRUA 1W7JB 3D0YA 1ALVA 2K2AA 4ETOA 1CLBA 2E30A 1YRTB 2H61A 1NYAA 3OP0A 3VROA 1DJHA 2ZKMX 1QIWA 2O5GA 4M2PA 1NSHA 2CCMA 1AVSA 2NXQA 3LCPC 2CBLA 3JTDC 4JPZB 4D1EA 1SL9A 1WY9A 5I2OA 2KDHA 3LK0A 1WLZA 4YGBB 5DKRA 3GK1A 3SIAA 2LP2A 1KK8C 2JQ6A 1QX7A 2OTGC 1RECA 2BCXA 1A03A 1SMGA 2HQ8A 2K2FA 1F4QA 3EVUA 1LINA 5CPVA 2M7NA 5CSNA 2JT8A 1XYDA 1YUTA 1Y1XA 1DJXA 3EKJA 2WCBA 4YI9A 1CDLA 2NZ0A 1GQMA 5HLVA 3WXAA 4NDDA 4R1EA 4QJ3B 4AOMA 1YX7A 2LP3A 1F54A 3GK2A 5CSIA 2I7AA 4CIDA 4DRWA 1B8CA 1B1GA 1BLQA 2LVKA 4GBAA 4PE1A 1J7OA 2LVJA 1JFJA 3FS7A 3O2PA 2ZN9A 4YGAA 1NX0A 5ER4X 3TDIA 1ZUZA 1U5IB 1IJ6A 2BCAA 2KHNA 2ZFDA 2EGDA 1WDCC 1J7QA 2TN4A 3EK7A 1G8IA 1YRUB 1RK9A 4PALA 3TDUA 3DVEA 2BE6A 1DMOA 1R2UA 1SBJA 3WNXB 2KFHA 2VRGA 2COLB 1EH2A 3TUYC 1BF5A 1PRWA 2KYCA 4ICBA 1IKUA 5D7FA 3BOWA 1N0YA 2Y1NA 3CS1A 3NSLA 3TZ1A 3DVJA 1XFXO 3NSOA 1LVCD 2JPTA 2FCEA 1DJZA 1XFYO 1K94A 1RTP1 3F45A 4HSZA 4WQ3A 1OMRA 2WOSA 2OS8B 2M3WA 4OV2A 1QATA 2LHIA 1TNWA 2GGZA 1K2HA 1BT6A 2KAXA 1FI5A 4QJ5B 1FI6A 1NUBA 1JF0A 3CWGA 1KCYA 4GNKB 1ALWA 2F3YA 1UWOA 1YTZC 2KI4B 1J1EA 1CDNA 1FF1A 4XYNA 4NDBA 4HRHA 2LMVA 4GFTA 3E3RA 4JQ0D 1XVJA 1IQ5A 2ZRTA 3I5FB 1CFPA 1IGVA 1SW8A 1YR5A 2LV7A 1DJWA 4AQIA 3BYAA 4MSPA 1GGWA 1FPWA 2NCPA 1NP8A 5KU1A 1TTXA 1ZACA 1TCOB 3SG6A 2K8MB 3SG2A 2MBXA 3BUMB 3JVTC 1MQ1A 1OMVA 3LK1A 2KOTA 1OOJA 3RM1A 1KQMB 1BJFA 2H2KA 1BR1B 5TNCA 1S3PA 1CNPA 2CT9A 3SG5A 5G08A 1N2DA 3GK4X 1TNPA 1PALA 1M31A 2PSRA 4CLNA 4CFQA 1CB1A 2ZNDA 4PHNA 1SCMC 2Q4UA 1K9PA 3PFVA 1SL8A 2JRFA 4IL1A 1G33A 1U5IA 2JNFA 5HYDA 1CM1A 1PSRA 1B4CA 2BECA 4P5OE 2LHLA 1JFKA 5F6TA 3PSRA 1S1EA 4HREE 2Q91A 1SKTA 1YVLA 3WHUB 2EHBA 3LLEA 5HKYA 3PALA 1WLMA 2LAPA 1B7TY 2JXCA 1IJ5A 3I5HB 2F33A 1CFFA 3KPXA 2L4HA 1S6IA 1NWDA 1NX3A 3VRQA 3IF7A 3AKBA 4TNCA 1IWQA 2JWWA 3K21A 3MSEB 2WCFA 4YGCB 1J7RA 4N1FA 1F70A 4DUQA 2EC6C 2R2IA 1AP4A 1DJIA 1SR6B 1C07A 1SK6D 2Y5IA 5AFPA 1B9AA 1SYMA 3HCMA 3HX4A 3AKAA 1XFVO 2LMUA 4MBEA 1OE9B 2KBMA 2M49B 1SRAA 4JWQA 4I5JA 2LLTA 1XFZO 3DF0B 2M97A 1J55A 4GGFA 3SIBA 1A2XA 5AANA 1A75A 2WORA 4GUKA 2HQWA 3CGAA 5CSJA 1QLSA 3CR5X 3PN7B 4ORCB 4PHJA 1KFUS 2LMTA 2KAYA 2LVVA 4YGEB 1XFWO 1IG5A 3RLZA 3OB1B 5BPJA 1QJTA 2WC8A 2BE4A 3SJSA 2PALA 1H8BA 1TN4A 2KFGA 3AAKA 1K8UA 3FIAA 2M29A 1OZSA 1CLMA 3VGOA 1TIZA 4MEWA 1F4OA 2HF5A 4OVNF 1BR4B 2JT0A 2WNDA 1M39A 1QIVA 3NXAA 3BQ3A 2M1KB 4HRGA 3DVKA 1CTRA 3PLFB 1WRKA 4XJKB 1QX2A 2I94A 1MXLC 2K7CA 4C0KA 5JJGA 5AEQA 1S36A 2E6WA 3TS5B 1L2OB 1XFUO 1CLLA 1V1GA 1FW4A 1PULA 2WCEA 2M7LA 1AJ5A 1B8RA 1MUXA 1XA5A 4A4BA 4PE7A 5B8IB 1YVHA 2OPOA 3C1VA 1KQVA 3CLNA 1MXEA 4ORBB 3I5IB 2GGMA 2L0PA 2L50A 4BY4A 1B7TZ 1YUUA 2BCBA 2AAOA 1NCZA 1RROA 3DD4A 1JC2A 2A4JA 1EXRA 2LC5A 5DKNA 4A4CA 1HT9A 1MHOA 1UURA 4PHMA 2HPSA 2SCPA 1K95A 2BBMA 1E8AA 2BKHB 2F8PA 5I8NA 1CMGA 1Y0VH 1UHHA 2PVBA 2BL0B 1OQPA 2MLEC 1MR8A 4DIRA 4DS7A 4MRXA 2KAVA 1CDPA 4NDCA 2BKIB 4YI8A 2I18A 3PATA 5HKZA 2FOTA 1AUIB 1B47A 3A8RA 2OS8C 4U8DA 1KFXS 2NCOA 5ER5A 1JWDA 1JSAA 3IQOA 1PSBA 4WQ2A 5KTYA 1XK4C 4PE4A 2CNPA 5K89A 1S6CA 2P6BB 2HETA 4GGFC 2L98A 4M2QA 2KFFA 3DF0A 4BY5A 5DKQA 3EK4A 2KI4C 4ORAB 2LUXA 1ZMZA 4OKHA 3ZNIA 1SY9A 2KYFA 3I5GB 3ZWHA 3EVRA 1ODBA 1S6JA 2JU0A 3I5FC 1QVIY 1FBVA 1A29A 1DTLA 2JC2A 1KWOB 2GV5A 1DJYA 2RGIA 3BXKA 1QS7A 3LL8B 1ZOTB 1SL7A
chains in the Genus database with same CATH superfamily
1NCYA 4CFRA 3O4XA 2MLFC 4I5NB 5I2LA 2F2OA 2I2RE 1F8HA 4MZJA 2K0JA 2Y4QA 3KF9A 1RJVA 3ICBA 1UUSA 1M46A 1KSOA 5I2QA 2JPOA 1KQMC 1Y6WA 3KEVA 1EL4A 3S0GA 2L51A 1OMDA 1SNLA 2LLSA 4QJ4B 2WCKA 1Q80A 3BFAA 3FE6A 1NIWA 5DICA 4YRUA 4YGDB 1QLKA 1RFJA 1OZOA 2KNEA 3PM8A 3BOWB 4XJKA 3JTDB 1IRJA 3CTNA 3DVMA 4Q04A 1DT7B 1K9UA 3A4UB 2KQ6A 1CM4A 1LA0A 1S26D 2QPTA 2M8UA 1KK8B 1EG3A 2F3ZA 3BJHA 2LE9B 1BOCA 2OTGB 4MRYA 2K60A 2JT3A 1BG1A 1PVBA 1RWYA 1DF0B 1QXPA 1X02A 3FWCA 3DZTA 4GAOA 3EK8A 3OBVA 2LLUA 1Y1AA 2NLNA 4MZKA 3I5HC 2LCPA 2K7OA 2L4IA 2CTNA 3H4SE 4GGNA 4PDZA 5KSZA 2PQLA 1XK4A 1W7IB 5D69A 3D77A 3OB2B 2QEHA 1G4YR 1DEKA 4PCWA 1SCVA 2H8VA 4WRIA 4FTGA 2ISDA 2Y1MA 2ZNEA 1KSMA 1KK7Y 1QX5B 3D10A 2MA2A 3BUXB 1NPQA 1UHJA 1CFDA 1K96A 1B8LA 1SR6C 4F0ZB 1DJGA 4YBHB 3D75A 4I5LB 2BBNA 1K9KA 1S5GY 4FQOA 5HLOA 1H4BA 2QEOA 3CR4X 5HL1A 1UP5A 1WDCB 2JTZA 2ZN8A 5IBWA 1QV1A 3CR2A 1XO5A 1AHRA 2MRDA 3CYZA 3O6BA 1V1FA 4MVFA 4F7FA 2L5XB 4L9MA 1N65A 4M2OA 4PE0A 1F71A 1DVIA 3AAJA 4N5XA 4UPGA 3PN7C 2FJYA 1LA3A 2G9BA 1BMOA 1TRFA 4C0LA 3TUYB 4CPVA 2K7DA 2ZRSA 2LVIA 3BUOB 3WHTB 3NSKA 3OX5A 3S0AA 1QVIZ 2KI6D 3K1EA 1IQ3A 1DGUA 3B87A 1EJ3A 3SG7A 1CMFA 1TNXA 1D1OA 1PK0D 1AJ4A 3Q8IA 1C7VA 1KFUL 2K61A 1DC1A 3FWBA 2KGRA 1ZFSA 2JULA 1SPYA 3IQQA 4I5KA 1HQVA 3CZTX 4ZCVA 4OR9B 3CZ0A 4E68A 1QTXA 4N1GA 1YX8A 1GJYA 1TOPA 3SG3A 3D0YB 2AUCA 2LANA 3QRXA 1VRKA 3VRRA 1BU3A 1UHNA 2MJWB 5J3XA 1F55A 1OOHA 1QV0A 2SASA 2FJUB 1L2OC 5CSFA 5JOLA 4DCKA 1A4PA 3NSIA 5AXIA 3VRPA 1JF2A 1M63B 3SG4A 2MAZA 3OHMB 2B1UA 2QACA 3PM2A 1NX2A 1JBAA 4MN0A 2JNXA 3I5IC 3GOFA 3BUNB 1DF0A 5AERA 2H61C 3BUWB 4C0JA 1YUSA 1JUOA 1LXFC 2KQYA 5PALA 3EVVA 1K93D 2JOJA 1NCXA 1CFCA 2JTTA 1NX1A 2L2EA 2LUCA 1A75B 2D8NA 2M1UA 3JVTB 2FCDA 2L2CA 3R1PA 4USLA 2BL0C 1R6PA 4P2YB 2DOQA 3EKHA 1TNQA 1YURA 1QASA 5GQQC 4OCIA 1KK7Z 4KYNA 1UHIA 4ZCUA 4PHKA 1LKJA 1WRLA 5FYXA 1SCMB 3KO0A 1GGZA 3CZ1A 3IVTA 1S5GZ 5HKWA 2KI6C 1WRZA 3TDZA 3RZSA 3S0EA 1AK8A 3OX6A 3VRNA 3D74A 4NQGA 4INWA 1Y1UA 1DGVA 1L7ZA 4MLWA 3CZ2A 2JXLA 2LNKA 1BODA 2KSPA 2V53A 3V2LA 1KFXL 1M45A 2F2PA 2KLDA 3EG5B 1IH0A 4AQJA 3I5GC 1J7PA 3O78A 1MF8B 1TCFA 2PMYA 1KWOC 2G2BA 2M9GA 1CKKA 3TS5C 1EG4A 1CDMA 2KBIA 2KGBC 1C3ZA 1MWNA 1J1DA 2AMIA 2MHHA 2O60A 4GPLB 2K7BA 1UHKA 1K90D 4MZLA 1PVAA 2LM5A 2EC6B 1C7WA 2CXJA 3O4YA 2IS9A 3KHEA 1OSAA 2JZIA 2M0RA 3M0WA 2PASA 2PRUA 1W7JB 3D0YA 1ALVA 2K2AA 4ETOA 1CLBA 2E30A 1TUZA 1YRTB 1OOFA 1NYAA 2H61A 3OP0A 3SS3A 1DJHA 3VROA 2ZKMX 1QIWA 5I8NA 2O5GA 4M2PA 1NSHA 2CCMA 1AVSA 2NXQA 3LCPC 2CBLA 3JTDC 4JPZB 4D1EA 1SL9A 1WY9A 5I2OA 2KDHA 3LK0A 1WLZA 2WC5A 4YGBB 5DKRA 3GK1A 3SIAA 2LP2A 1KK8C 2JQ6A 1QX7A 2OTGC 1RECA 2BCXA 1A03A 1SMGA 1IIOA 2HQ8A 2K2FA 2WCJA 1F4QA 3EVUA 5FI7A 1LINA 5CPVA 2M7NA 5CSNA 2JT8A 1XYDA 1YUTA 2L5YA 2QDIA 1Y1XA 3B88A 1DJXA 3EKJA 2WCBA 4YI9A 3NGVA 1CDLA 2NZ0A 1GQMA 2WCMA 3NHIA 5HLVA 3WXAA 4NDDA 4R1EA 4QJ3B 4AOMA 1YX7A 2LP3A 1F54A 3GK2A 5CSIA 2I7AA 4CIDA 1OOGA 1B8CA 4DRWA 2BNXA 1B1GA 1BLQA 4INXA 2LVKA 2QEVA 5D3OA 4GBAA 4PE1A 1J7OA 2BAPA 2LVJA 1JFJA 3FS7A 3O2PA 2ZN9A 4YGAA 1NX0A 5ER4X 3TDIA 1ZUZA 1U5IB 1IJ6A 2BCAA 2KHNA 2ZFDA 2EGDA 1WDCC 1J7QA 2TN4A 3EK7A 1G8IA 1YRUB 1RK9A 4PALA 3R1VA 3TDUA 3DVEA 2BE6A 1DMOA 1R2UA 1SBJA 2ERBA 3WNXB 2KFHA 3BFBA 1C3YA 2VRGA 2COLB 3D73A 3OGNA 3S0DA 1EH2A 3TUYC 1BF5A 1PRWA 3FE9A 2KYCA 4ICBA 1IKUA 2KPHA 1DQEA 1ORGA 5D7FA 3S0BA 1OOIX 1W9ZA 3UNWA 3BOWA 3R1OA 1N0YA 2Y1NA 3CS1A 4PT1A 3NSLA 3TZ1A 3DVJA 1XFXO 3NSOA 1LVCD 2JPTA 2FCEA 1DJZA 1XFYO 1K94A 1RTP1 3F45A 4HSZA 4WQ3A 1GM0A 1OMRA 5EL2A 2WOSA 2OS8B 2M3WA 4OV2A 1QATA 2LHIA 1TNWA 2GGZA 1K2HA 1BT6A 2KAXA 1FI5A 4QJ5B 1FI6A 1NUBA 1JF0A 3CWGA 1KCYA 4GNKB 1ALWA 2F3YA 1UWOA 1YTZC 2KI4B 1J1EA 5JJGA 1CDNA 1FF1A 4XYNA 4NDBA 4HRHA 2LMVA 4GFTA 3E3RA 4JQ0D 1XVJA 1IQ5A 2ZRTA 3I5FB 1CFPA 1IGVA 3VB1A 1SW8A 1YR5A 2LV7A 1DJWA 4AQIA 3BYAA 4MSPA 4JD9A 1GGWA 1FPWA 2NCPA 1NP8A 5KU1A 1TTXA 1ZACA 1TCOB 3SG6A 2K8MB 3SG2A 2MBXA 3BUMB 3JVTC 1MQ1A 1OMVA 3LK1A 2KOTA 1OOJA 3RM1A 1KQMB 1BJFA 2H2KA 1BR1B 5TNCA 1S3PA 1CNPA 2WC6A 2CT9A 3SG5A 5G08A 1N2DA 1DELA 3GK4X 1TNPA 1PALA 1M31A 2PSRA 4CLNA 4CFQA 1CB1A 2ZNDA 2P71A 3D78A 4PHNA 1SCMC 5I94A 3CDNA 3SS5A 2Q4UA 1K9PA 3PFVA 1SL8A 2JRFA 4IL1A 1G33A 1U5IA 2JNFA 5HYDA 1CM1A 1PSRA 1B4CA 2BECA 4P5OE 2LHLA 2KLEA 1JFKA 5F6TA 3PSRA 1S1EA 4HREE 3N7HA 2Q91A 1SKTA 1YVLA 3WHUB 2EHBA 3LLEA 5HKYA 3PALA 1WLMA 2LAPA 1B7TY 3SS4A 2JXCA 3S0FA 3NHTA 1IJ5A 3I5HB 2F33A 1CFFA 3KPXA 2L4HA 1TUJA 1S6IA 1NWDA 3L4LA 1NX3A 3VRQA 3IF7A 3AKBA 4TNCA 1IWQA 3DYEA 2JWWA 3PJIA 3K21A 3MSEB 2WCFA 3B6XA 1J7RA 4YGCB 4N1FA 3D76A 4DUQA 1F70A 2EC6C 2R2IA 4JKTA 1AP4A 1DJIA 1SR6B 1C07A 1SK6D 2Y5IA 5AFPA 1B9AA 1SYMA 3HCMA 3HX4A 3AKAA 1XFVO 2LMUA 4MBEA 1OE9B 1LS8A 2KBMA 3B7AA 2M49B 2YGUA 1SRAA 4JWQA 4I5JA 2LLTA 1XFZO 3DF0B 2M97A 1J55A 4GGFA 3SIBA 1A2XA 3DXLA 5AANA 1A75A 2WORA 4GUKA 2HQWA 3CGAA 2P70A 5CSJA 1QLSA 3CR5X 3PN7B 4ORCB 4PHJA 1KFUS 2LMTA 2KAYA 2LVVA 4YGEB 1XFWO 1Z2CB 1IG5A 1P28A 3RLZA 3OB1B 5BPJA 1QJTA 2WC8A 4FQTA 5FI6A 4IJ7A 3FE8A 3L4AA 2BE4A 3SJSA 2PALA 1H8BA 1TN4A 2KFGA 3AAKA 3L47A 1K8UA 3FIAA 2M29A 1OW4A 1OZSA 1CLMA 3VGOA 1TIZA 4MEWA 1F4OA 1QWVA 2HF5A 4OVNF 1BR4B 2JT0A 2WNDA 1M39A 1QIVA 3NXAA 3BQ3A 2M1KB 4HRGA 1SSEB 3DVKA 1CTRA 3PLFB 1WRKA 4XJKB 1QX2A 2I94A 1MXLC 1Z4HA 2K7CA 4C0KA 5AEQA 1S36A 2E6WA 2WCHA 1L2OB 1XFUO 1CLLA 3TS5B 1V1GA 1FW4A 1PULA 2WCEA 2M7LA 1AJ5A 1B8RA 1MUXA 1XA5A 4A4BA 5FI2A 4PE7A 5B8IB 3QMEA 1YVHA 2OPOA 3C1VA 1KQVA 3CLNA 1MXEA 4ORBB 3I5IB 2GGMA 3UO9A 1T14A 2L0PA 2L50A 4BY4A 1B7TZ 1YUUA 2AAOA 2BCBA 1NCZA 1RROA 3DD4A 3CABA 2A4JA 2GTEA 1JC2A 1EXRA 2LC5A 5DKNA 4A4CA 1HT9A 1MHOA 3R72A 1UURA 4PHMA 2HPSA 2SCPA 1K95A 2BBMA 1E8AA 2BKHB 2F8PA 3B86A 1CMGA 1Y0VH 1UHHA 2PVBA 2BL0B 1OQPA 2MLEC 1MR8A 4DIRA 4DS7A 4MRXA 2KAVA 3BFHA 1CDPA 3DY9A 2BKIB 4NDCA 4YI8A 2I18A 3PATA 5HKZA 2FOTA 1AUIB 1B47A 3A8RA 2OS8C 4U8DA 1KFXS 2NCOA 5ER5A 1JWDA 1JSAA 3IQOA 1PSBA 4WQ2A 5KTYA 1XK4C 4PE4A 2CNPA 5K89A 1S6CA 2P6BB 2HETA 4GGFC 2WCLA 2L98A 4M2QA 2KFFA 3DF0A 4BY5A 5DKQA 3EK4A 2KI4C 4ORAB 1TWOA 2LUXA 2QEBA 1ZMZA 4OZDA 4OKHA 3ZNIA 1SY9A 2KYFA 2PYQA 3I5GB 3ZWHA 3EVRA 1ODBA 1S6JA 2JU0A 3I5FC 1QVIY 1FBVA 1A29A 1DTLA 2JC2A 1KWOB 2GV5A 1DJYA 2RGIA 3BXKA 1QS7A 3LL8B 1ZOTB 1XFRA 1SL7A
chains in the Genus database with same CATH topology
1NCYA 4CFRA 2MLFC 4I5NB 5I2LA 2F2OA 2I2RE 1F8HA 4MZJA 2K0JA 2Y4QA 3KF9A 1RJVA 3ICBA 1UUSA 1M46A 1KSOA 5I2QA 1KQMC 1Y6WA 3KEVA 1EL4A 2L51A 1OMDA 1SNLA 2LLSA 4QJ4B 1Q80A 1NIWA 4YRUA 4YGDB 1QLKA 1RFJA 1OZOA 2KNEA 3PM8A 3BOWB 4XJKA 3JTDB 1IRJA 3CTNA 3DVMA 4Q04A 1DT7B 1K9UA 3A4UB 2KQ6A 1CM4A 1LA0A 1S26D 2QPTA 2M8UA 1KK8B 1EG3A 2F3ZA 1BOCA 2LE9B 2OTGB 4MRYA 2JT3A 1BG1A 1PVBA 1RWYA 1DF0B 1QXPA 1X02A 3FWCA 4GAOA 3EK8A 2LLUA 1Y1AA 2NLNA 4MZKA 3I5HC 2LCPA 2K7OA 2L4IA 2CTNA 3H4SE 4GGNA 4PDZA 5KSZA 1XK4A 1W7IB 5D69A 3OB2B 1G4YR 4PCWA 1SCVA 4WRIA 2ISDA 4FTGA 2Y1MA 2ZNEA 1KSMA 1KK7Y 1QX5B 3D10A 2MA2A 3BUXB 1NPQA 1UHJA 1CFDA 1K96A 1B8LA 1SR6C 4F0ZB 1DJGA 4YBHB 4I5LB 2BBNA 1K9KA 1S5GY 4FQOA 5HLOA 1H4BA 3CR4X 1UP5A 1WDCB 2JTZA 2ZN8A 5IBWA 1QV1A 3CR2A 1XO5A 1AHRA 2MRDA 3O6BA 4MVFA 1V1FA 2L5XB 4L9MA 1N65A 4M2OA 4PE0A 1F71A 1DVIA 3AAJA 4N5XA 4UPGA 3PN7C 1LA3A 2G9BA 1BMOA 1TRFA 4C0LA 3TUYB 4CPVA 2K7DA 2ZRSA 2LVIA 3BUOB 3WHTB 3NSKA 3OX5A 1IQ3A 1QVIZ 2KI6D 1DGUA 1EJ3A 3SG7A 1CMFA 1TNXA 1D1OA 1PK0D 1AJ4A 1C7VA 1KFUL 2K61A 3FWBA 2KGRA 1ZFSA 2JULA 1SPYA 3IQQA 4I5KA 1HQVA 3CZTX 4ZCVA 4OR9B 4E68A 1QTXA 4N1GA 1YX8A 1GJYA 1TOPA 3SG3A 3D0YB 2AUCA 2LANA 3QRXA 1VRKA 3VRRA 1BU3A 1UHNA 2MJWB 5J3XA 1F55A 1QV0A 2SASA 2FJUB 1L2OC 5CSFA 5JOLA 4DCKA 1A4PA 3NSIA 5AXIA 3VRPA 1JF2A 1M63B 3SG4A 2MAZA 3OHMB 2B1UA 2QACA 1NX2A 1JBAA 4MN0A 2JNXA 3I5IC 3GOFA 3BUNB 1DF0A 5AERA 2H61C 3BUWB 4C0JA 1YUSA 1JUOA 1LXFC 2KQYA 5PALA 3EVVA 1K93D 2JOJA 1NCXA 1CFCA 2JTTA 1NX1A 2L2EA 2LUCA 1A75B 2D8NA 2M1UA 3JVTB 2FCDA 4USLA 2BL0C 1R6PA 4P2YB 2DOQA 3EKHA 1TNQA 1YURA 1QASA 5GQQC 4OCIA 1KK7Z 1UHIA 4ZCUA 4PHKA 1LKJA 1WRLA 5FYXA 1SCMB 3KO0A 1GGZA 1S5GZ 5HKWA 2KI6C 1WRZA 3TDZA 1AK8A 3OX6A 3VRNA 4NQGA 1Y1UA 1DGVA 1L7ZA 4MLWA 2JXLA 2LNKA 1BODA 2KSPA 2V53A 1KFXL 1M45A 2F2PA 1IH0A 4AQJA 3I5GC 1J7PA 3O78A 1MF8B 1TCFA 2PMYA 1KWOC 2G2BA 2M9GA 1CKKA 3TS5C 1EG4A 1CDMA 2KBIA 2KGBC 1MWNA 2O60A 1J1DA 2AMIA 2MHHA 4GPLB 2K7BA 1UHKA 1K90D 4MZLA 1PVAA 2LM5A 2EC6B 1C7WA 2CXJA 3O4YA 2IS9A 3KHEA 1OSAA 2JZIA 2M0RA 3M0WA 2PASA 2PRUA 1W7JB 3D0YA 1ALVA 2K2AA 4ETOA 1CLBA 2E30A 1YRTB 2H61A 1NYAA 3OP0A 3VROA 1DJHA 2ZKMX 1QIWA 2O5GA 4M2PA 1NSHA 2CCMA 1AVSA 2NXQA 3LCPC 2CBLA 3JTDC 4JPZB 4D1EA 1SL9A 1WY9A 5I2OA 2KDHA 3LK0A 1WLZA 4YGBB 5DKRA 3GK1A 3SIAA 2LP2A 1KK8C 2JQ6A 1QX7A 2OTGC 1RECA 2BCXA 1A03A 1SMGA 2HQ8A 2K2FA 1F4QA 3EVUA 1LINA 5CPVA 2M7NA 5CSNA 2JT8A 1XYDA 1YUTA 1Y1XA 1DJXA 3EKJA 2WCBA 4YI9A 1CDLA 2NZ0A 1GQMA 5HLVA 3WXAA 4NDDA 4R1EA 4QJ3B 4AOMA 1YX7A 2LP3A 1F54A 3GK2A 5CSIA 2I7AA 4CIDA 4DRWA 1B8CA 1B1GA 1BLQA 2LVKA 4GBAA 4PE1A 1J7OA 2LVJA 1JFJA 3FS7A 3O2PA 2ZN9A 4YGAA 1NX0A 5ER4X 3TDIA 1ZUZA 1U5IB 1IJ6A 2BCAA 2KHNA 2ZFDA 2EGDA 1WDCC 1J7QA 2TN4A 3EK7A 1G8IA 1YRUB 1RK9A 4PALA 3TDUA 3DVEA 2BE6A 1DMOA 1R2UA 1SBJA 3WNXB 2KFHA 2VRGA 2COLB 1EH2A 3TUYC 1BF5A 1PRWA 2KYCA 4ICBA 1IKUA 5D7FA 3BOWA 1N0YA 2Y1NA 3CS1A 3NSLA 3TZ1A 3DVJA 1XFXO 3NSOA 1LVCD 2JPTA 2FCEA 1DJZA 1XFYO 1K94A 1RTP1 3F45A 4HSZA 4WQ3A 1OMRA 2WOSA 2OS8B 2M3WA 4OV2A 1QATA 2LHIA 1TNWA 2GGZA 1K2HA 1BT6A 2KAXA 1FI5A 4QJ5B 1FI6A 1NUBA 1JF0A 3CWGA 1KCYA 4GNKB 1ALWA 2F3YA 1UWOA 1YTZC 2KI4B 1J1EA 1CDNA 1FF1A 4XYNA 4NDBA 4HRHA 2LMVA 4GFTA 3E3RA 4JQ0D 1XVJA 1IQ5A 2ZRTA 3I5FB 1CFPA 1IGVA 1SW8A 1YR5A 2LV7A 1DJWA 4AQIA 3BYAA 4MSPA 1GGWA 1FPWA 2NCPA 1NP8A 5KU1A 1TTXA 1ZACA 1TCOB 3SG6A 2K8MB 3SG2A 2MBXA 3BUMB 3JVTC 1MQ1A 1OMVA 3LK1A 2KOTA 1OOJA 3RM1A 1KQMB 1BJFA 2H2KA 1BR1B 5TNCA 1S3PA 1CNPA 2CT9A 3SG5A 5G08A 1N2DA 3GK4X 1TNPA 1PALA 1M31A 2PSRA 4CLNA 4CFQA 1CB1A 2ZNDA 4PHNA 1SCMC 2Q4UA 1K9PA 3PFVA 1SL8A 2JRFA 4IL1A 1G33A 1U5IA 2JNFA 5HYDA 1CM1A 1PSRA 1B4CA 2BECA 4P5OE 2LHLA 1JFKA 5F6TA 3PSRA 1S1EA 4HREE 2Q91A 1SKTA 1YVLA 3WHUB 2EHBA 3LLEA 5HKYA 3PALA 1WLMA 2LAPA 1B7TY 2JXCA 1IJ5A 3I5HB 2F33A 1CFFA 3KPXA 2L4HA 1S6IA 1NWDA 1NX3A 3VRQA 3IF7A 3AKBA 4TNCA 1IWQA 2JWWA 3K21A 3MSEB 2WCFA 4YGCB 1J7RA 4N1FA 1F70A 4DUQA 2EC6C 2R2IA 1AP4A 1DJIA 1SR6B 1C07A 1SK6D 2Y5IA 5AFPA 1B9AA 1SYMA 3HCMA 3HX4A 3AKAA 1XFVO 2LMUA 4MBEA 1OE9B 2KBMA 2M49B 1SRAA 4JWQA 4I5JA 2LLTA 1XFZO 3DF0B 2M97A 1J55A 4GGFA 3SIBA 1A2XA 5AANA 1A75A 2WORA 4GUKA 2HQWA 3CGAA 5CSJA 1QLSA 3CR5X 3PN7B 4ORCB 4PHJA 1KFUS 2LMTA 2KAYA 2LVVA 4YGEB 1XFWO 1IG5A 3RLZA 3OB1B 5BPJA 1QJTA 2WC8A 2BE4A 3SJSA 2PALA 1H8BA 1TN4A 2KFGA 3AAKA 1K8UA 3FIAA 2M29A 1OZSA 1CLMA 3VGOA 1TIZA 4MEWA 1F4OA 2HF5A 4OVNF 1BR4B 2JT0A 2WNDA 1M39A 1QIVA 3NXAA 3BQ3A 2M1KB 4HRGA 3DVKA 1CTRA 3PLFB 1WRKA 4XJKB 1QX2A 2I94A 1MXLC 2K7CA 4C0KA 5JJGA 5AEQA 1S36A 2E6WA 3TS5B 1L2OB 1XFUO 1CLLA 1V1GA 1FW4A 1PULA 2WCEA 2M7LA 1AJ5A 1B8RA 1MUXA 1XA5A 4A4BA 4PE7A 5B8IB 1YVHA 2OPOA 3C1VA 1KQVA 3CLNA 1MXEA 4ORBB 3I5IB 2GGMA 2L0PA 2L50A 4BY4A 1B7TZ 1YUUA 2BCBA 2AAOA 1NCZA 1RROA 3DD4A 1JC2A 2A4JA 1EXRA 2LC5A 5DKNA 4A4CA 1HT9A 1MHOA 1UURA 4PHMA 2HPSA 2SCPA 1K95A 2BBMA 1E8AA 2BKHB 2F8PA 5I8NA 1CMGA 1Y0VH 1UHHA 2PVBA 2BL0B 1OQPA 2MLEC 1MR8A 4DIRA 4DS7A 4MRXA 2KAVA 1CDPA 4NDCA 2BKIB 4YI8A 2I18A 3PATA 5HKZA 2FOTA 1AUIB 1B47A 3A8RA 2OS8C 4U8DA 1KFXS 2NCOA 5ER5A 1JWDA 1JSAA 3IQOA 1PSBA 4WQ2A 5KTYA 1XK4C 4PE4A 2CNPA 5K89A 1S6CA 2P6BB 2HETA 4GGFC 2L98A 4M2QA 2KFFA 3DF0A 4BY5A 5DKQA 3EK4A 2KI4C 4ORAB 2LUXA 1ZMZA 4OKHA 3ZNIA 1SY9A 2KYFA 3I5GB 3ZWHA 3EVRA 1ODBA 1S6JA 2JU0A 3I5FC 1QVIY 1FBVA 1A29A 1DTLA 2JC2A 1KWOB 2GV5A 1DJYA 2RGIA 3BXKA 1QS7A 3LL8B 1ZOTB 1SL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCY A;  4CFR A;  2MLF C;  4I5N B;  5I2L A;  2F2O A;  2I2R E;  1F8H A;  4MZJ A;  2K0J A;  2Y4Q A;  3KF9 A;  1RJV A;  3ICB A;  1UUS A;  1M46 A;  1KSO A;  5I2Q A;  1KQM C;  1Y6W A;  3KEV A;  1EL4 A;  2L51 A;  1OMD A;  1SNL A;  2LLS A;  4QJ4 B;  1Q80 A;  1NIW A;  4YRU A;  4YGD B;  1QLK A;  1RFJ A;  1OZO A;  2KNE A;  3PM8 A;  3BOW B;  4XJK A;  3JTD B;  1IRJ A;  3CTN A;  3DVM A;  4Q04 A;  1DT7 B;  1K9U A;  3A4U B;  2KQ6 A;  1CM4 A;  1LA0 A;  1S26 D;  2QPT A;  2M8U A;  1KK8 B;  1EG3 A;  2F3Z A;  1BOC A;  2LE9 B;  2OTG B;  4MRY A;  2JT3 A;  1BG1 A;  1PVB A;  1RWY A;  1DF0 B;  1QXP A;  1X02 A;  3FWC A;  4GAO A;  3EK8 A;  2LLU A;  1Y1A A;  2NLN A;  4MZK A;  3I5H C;  2LCP A;  2K7O A;  2L4I A;  2CTN A;  3H4S E;  4GGN A;  4PDZ A;  5KSZ A;  1XK4 A;  1W7I B;  5D69 A;  3OB2 B;  1G4Y R;  4PCW A;  1SCV A;  4WRI A;  2ISD A;  4FTG A;  2Y1M A;  2ZNE A;  1KSM A;  1KK7 Y;  1QX5 B;  3D10 A;  2MA2 A;  3BUX B;  1NPQ A;  1UHJ A;  1CFD A;  1K96 A;  1B8L A;  1SR6 C;  4F0Z B;  1DJG A;  4YBH B;  4I5L B;  2BBN A;  1K9K A;  1S5G Y;  4FQO A;  5HLO A;  1H4B A;  3CR4 X;  1UP5 A;  1WDC B;  2JTZ A;  2ZN8 A;  5IBW A;  1QV1 A;  3CR2 A;  1XO5 A;  1AHR A;  2MRD A;  3O6B A;  4MVF A;  1V1F A;  2L5X B;  4L9M A;  1N65 A;  4M2O A;  4PE0 A;  1F71 A;  1DVI A;  3AAJ A;  4N5X A;  4UPG A;  3PN7 C;  1LA3 A;  2G9B A;  1BMO A;  1TRF A;  4C0L A;  3TUY B;  4CPV A;  2K7D A;  2ZRS A;  2LVI A;  3BUO B;  3WHT B;  3NSK A;  3OX5 A;  1IQ3 A;  1QVI Z;  2KI6 D;  1DGU A;  1EJ3 A;  3SG7 A;  1CMF A;  1TNX A;  1D1O A;  1PK0 D;  1AJ4 A;  1C7V A;  1KFU L;  2K61 A;  3FWB A;  2KGR A;  1ZFS A;  2JUL A;  1SPY A;  3IQQ A;  4I5K A;  1HQV A;  3CZT X;  4ZCV A;  4OR9 B;  4E68 A;  1QTX A;  4N1G A;  1YX8 A;  1GJY A;  1TOP A;  3SG3 A;  3D0Y B;  2AUC A;  2LAN A;  3QRX A;  1VRK A;  3VRR A;  1BU3 A;  1UHN A;  2MJW B;  5J3X A;  1F55 A;  1QV0 A;  2SAS A;  2FJU B;  1L2O C;  5CSF A;  5JOL A;  4DCK A;  1A4P A;  3NSI A;  5AXI A;  3VRP A;  1JF2 A;  1M63 B;  3SG4 A;  2MAZ A;  3OHM B;  2B1U A;  2QAC A;  1NX2 A;  1JBA A;  4MN0 A;  2JNX A;  3I5I C;  3GOF A;  3BUN B;  1DF0 A;  5AER A;  2H61 C;  3BUW B;  4C0J A;  1YUS A;  1JUO A;  1LXF C;  2KQY A;  5PAL A;  3EVV A;  1K93 D;  2JOJ A;  1NCX A;  1CFC A;  2JTT A;  1NX1 A;  2L2E A;  2LUC A;  1A75 B;  2D8N A;  2M1U A;  3JVT B;  2FCD A;  4USL A;  2BL0 C;  1R6P A;  4P2Y B;  2DOQ A;  3EKH A;  1TNQ A;  1YUR A;  1QAS A;  5GQQ C;  4OCI A;  1KK7 Z;  1UHI A;  4ZCU A;  4PHK A;  1LKJ A;  1WRL A;  5FYX A;  1SCM B;  3KO0 A;  1GGZ A;  1S5G Z;  5HKW A;  2KI6 C;  1WRZ A;  3TDZ A;  1AK8 A;  3OX6 A;  3VRN A;  4NQG A;  1Y1U A;  1DGV A;  1L7Z A;  4MLW A;  2JXL A;  2LNK A;  1BOD A;  2KSP A;  2V53 A;  1KFX L;  1M45 A;  2F2P A;  1IH0 A;  4AQJ A;  3I5G C;  1J7P A;  3O78 A;  1MF8 B;  1TCF A;  2PMY A;  1KWO C;  2G2B A;  2M9G A;  1CKK A;  3TS5 C;  1EG4 A;  1CDM A;  2KBI A;  2KGB C;  1MWN A;  2O60 A;  1J1D A;  2AMI A;  2MHH A;  4GPL B;  2K7B A;  1UHK A;  1K90 D;  4MZL A;  1PVA A;  2LM5 A;  2EC6 B;  1C7W A;  2CXJ A;  3O4Y A;  2IS9 A;  3KHE A;  1OSA A;  2JZI A;  2M0R A;  3M0W A;  2PAS A;  2PRU A;  1W7J B;  3D0Y A;  1ALV A;  2K2A A;  4ETO A;  1CLB A;  2E30 A;  1YRT B;  2H61 A;  1NYA A;  3OP0 A;  3VRO A;  1DJH A;  2ZKM X;  1QIW A;  2O5G A;  4M2P A;  1NSH A;  2CCM A;  1AVS A;  2NXQ A;  3LCP C;  2CBL A;  3JTD C;  4JPZ B;  4D1E A;  1SL9 A;  1WY9 A;  5I2O A;  2KDH A;  3LK0 A;  1WLZ A;  4YGB B;  5DKR A;  3GK1 A;  3SIA A;  2LP2 A;  1KK8 C;  2JQ6 A;  1QX7 A;  2OTG C;  1REC A;  2BCX A;  1A03 A;  1SMG A;  2HQ8 A;  2K2F A;  1F4Q A;  3EVU A;  1LIN A;  5CPV A;  2M7N A;  5CSN A;  2JT8 A;  1XYD A;  1YUT A;  1Y1X A;  1DJX A;  3EKJ A;  2WCB A;  4YI9 A;  1CDL A;  2NZ0 A;  1GQM A;  5HLV A;  3WXA A;  4NDD A;  4R1E A;  4QJ3 B;  4AOM A;  1YX7 A;  2LP3 A;  1F54 A;  3GK2 A;  5CSI A;  2I7A A;  4CID A;  4DRW A;  1B8C A;  1B1G A;  1BLQ A;  2LVK A;  4GBA A;  4PE1 A;  1J7O A;  2LVJ A;  1JFJ A;  3FS7 A;  3O2P A;  2ZN9 A;  4YGA A;  1NX0 A;  5ER4 X;  3TDI A;  1ZUZ A;  1U5I B;  1IJ6 A;  2BCA A;  2KHN A;  2ZFD A;  2EGD A;  1WDC C;  1J7Q A;  2TN4 A;  3EK7 A;  1G8I A;  1YRU B;  1RK9 A;  4PAL A;  3TDU A;  3DVE A;  2BE6 A;  1DMO A;  1R2U A;  1SBJ A;  3WNX B;  2KFH A;  2VRG A;  2COL B;  1EH2 A;  3TUY C;  1BF5 A;  1PRW A;  2KYC A;  4ICB A;  1IKU A;  5D7F A;  3BOW A;  1N0Y A;  2Y1N A;  3CS1 A;  3NSL A;  3TZ1 A;  3DVJ A;  1XFX O;  3NSO A;  1LVC D;  2JPT A;  2FCE A;  1DJZ A;  1XFY O;  1K94 A;  1RTP 1;  3F45 A;  4HSZ A;  4WQ3 A;  1OMR A;  2WOS A;  2OS8 B;  2M3W A;  4OV2 A;  1QAT A;  2LHI A;  1TNW A;  2GGZ A;  1K2H A;  1BT6 A;  2KAX A;  1FI5 A;  4QJ5 B;  1FI6 A;  1NUB A;  1JF0 A;  3CWG A;  1KCY A;  4GNK B;  1ALW A;  2F3Y A;  1UWO A;  1YTZ C;  2KI4 B;  1J1E A;  1CDN A;  1FF1 A;  4XYN A;  4NDB A;  4HRH A;  2LMV A;  4GFT A;  3E3R A;  4JQ0 D;  1XVJ A;  1IQ5 A;  2ZRT A;  3I5F B;  1CFP A;  1IGV A;  1SW8 A;  1YR5 A;  2LV7 A;  1DJW A;  4AQI A;  3BYA A;  4MSP A;  1GGW A;  1FPW A;  2NCP A;  1NP8 A;  5KU1 A;  1TTX A;  1ZAC A;  1TCO B;  3SG6 A;  2K8M B;  3SG2 A;  2MBX A;  3BUM B;  3JVT C;  1MQ1 A;  1OMV A;  3LK1 A;  2KOT A;  1OOJ A;  3RM1 A;  1KQM B;  1BJF A;  2H2K A;  1BR1 B;  5TNC A;  1S3P A;  1CNP A;  2CT9 A;  3SG5 A;  5G08 A;  1N2D A;  3GK4 X;  1TNP A;  1PAL A;  1M31 A;  2PSR A;  4CLN A;  4CFQ A;  1CB1 A;  2ZND A;  4PHN A;  1SCM C;  2Q4U A;  1K9P A;  3PFV A;  1SL8 A;  2JRF A;  4IL1 A;  1G33 A;  1U5I A;  2JNF A;  5HYD A;  1CM1 A;  1PSR A;  1B4C A;  2BEC A;  4P5O E;  2LHL A;  1JFK A;  5F6T A;  3PSR A;  1S1E A;  4HRE E;  2Q91 A;  1SKT A;  1YVL A;  3WHU B;  2EHB A;  3LLE A;  5HKY A;  3PAL A;  1WLM A;  2LAP A;  1B7T Y;  2JXC A;  1IJ5 A;  3I5H B;  2F33 A;  1CFF A;  3KPX A;  2L4H A;  1S6I A;  1NWD A;  1NX3 A;  3VRQ A;  3IF7 A;  3AKB A;  4TNC A;  1IWQ A;  2JWW A;  3K21 A;  3MSE B;  2WCF A;  4YGC B;  1J7R A;  4N1F A;  1F70 A;  4DUQ A;  2EC6 C;  2R2I A;  1AP4 A;  1DJI A;  1SR6 B;  1C07 A;  1SK6 D;  2Y5I A;  5AFP A;  1B9A A;  1SYM A;  3HCM A;  3HX4 A;  3AKA A;  1XFV O;  2LMU A;  4MBE A;  1OE9 B;  2KBM A;  2M49 B;  1SRA A;  4JWQ A;  4I5J A;  2LLT A;  1XFZ O;  3DF0 B;  2M97 A;  1J55 A;  4GGF A;  3SIB A;  1A2X A;  5AAN A;  1A75 A;  2WOR A;  4GUK A;  2HQW A;  3CGA A;  5CSJ A;  1QLS A;  3CR5 X;  3PN7 B;  4ORC B;  4PHJ A;  1KFU S;  2LMT A;  2KAY A;  2LVV A;  4YGE B;  1XFW O;  1IG5 A;  3RLZ A;  3OB1 B;  5BPJ A;  1QJT A;  2WC8 A;  2BE4 A;  3SJS A;  2PAL A;  1H8B A;  1TN4 A;  2KFG A;  3AAK A;  1K8U A;  3FIA A;  2M29 A;  1OZS A;  1CLM A;  3VGO A;  1TIZ A;  4MEW A;  1F4O A;  2HF5 A;  4OVN F;  1BR4 B;  2JT0 A;  2WND A;  1M39 A;  1QIV A;  3NXA A;  3BQ3 A;  2M1K B;  4HRG A;  3DVK A;  1CTR A;  3PLF B;  1WRK A;  4XJK B;  1QX2 A;  2I94 A;  1MXL C;  2K7C A;  4C0K A;  5JJG A;  5AEQ A;  1S36 A;  2E6W A;  3TS5 B;  1L2O B;  1XFU O;  1CLL A;  1V1G A;  1FW4 A;  1PUL A;  2WCE A;  2M7L A;  1AJ5 A;  1B8R A;  1MUX A;  1XA5 A;  4A4B A;  4PE7 A;  5B8I B;  1YVH A;  2OPO A;  3C1V A;  1KQV A;  3CLN A;  1MXE A;  4ORB B;  3I5I B;  2GGM A;  2L0P A;  2L50 A;  4BY4 A;  1B7T Z;  1YUU A;  2BCB A;  2AAO A;  1NCZ A;  1RRO A;  3DD4 A;  1JC2 A;  2A4J A;  1EXR A;  2LC5 A;  5DKN A;  4A4C A;  1HT9 A;  1MHO A;  1UUR A;  4PHM A;  2HPS A;  2SCP A;  1K95 A;  2BBM A;  1E8A A;  2BKH B;  2F8P A;  5I8N A;  1CMG A;  1Y0V H;  1UHH A;  2PVB A;  2BL0 B;  1OQP A;  2MLE C;  1MR8 A;  4DIR A;  4DS7 A;  4MRX A;  2KAV A;  1CDP A;  4NDC A;  2BKI B;  4YI8 A;  2I18 A;  3PAT A;  5HKZ A;  2FOT A;  1AUI B;  1B47 A;  3A8R A;  2OS8 C;  4U8D A;  1KFX S;  2NCO A;  5ER5 A;  1JWD A;  1JSA A;  3IQO A;  1PSB A;  4WQ2 A;  5KTY A;  1XK4 C;  4PE4 A;  2CNP A;  5K89 A;  1S6C A;  2P6B B;  2HET A;  4GGF C;  2L98 A;  4M2Q A;  2KFF A;  3DF0 A;  4BY5 A;  5DKQ A;  3EK4 A;  2KI4 C;  4ORA B;  2LUX A;  1ZMZ A;  4OKH A;  3ZNI A;  1SY9 A;  2KYF A;  3I5G B;  3ZWH A;  3EVR A;  1ODB A;  1S6J A;  2JU0 A;  3I5F C;  1QVI Y;  1FBV A;  1A29 A;  1DTL A;  2JC2 A;  1KWO B;  2GV5 A;  1DJY A;  2RGI A;  3BXK A;  1QS7 A;  3LL8 B;  1ZOT B;  1SL7 A; 
#chains in the Genus database with same CATH topology
 1NCY A;  4CFR A;  3O4X A;  2MLF C;  4I5N B;  5I2L A;  2F2O A;  2I2R E;  1F8H A;  4MZJ A;  2K0J A;  2Y4Q A;  3KF9 A;  1RJV A;  3ICB A;  1UUS A;  1M46 A;  1KSO A;  5I2Q A;  2JPO A;  1KQM C;  1Y6W A;  3KEV A;  1EL4 A;  3S0G A;  2L51 A;  1OMD A;  1SNL A;  2LLS A;  4QJ4 B;  2WCK A;  1Q80 A;  3BFA A;  3FE6 A;  1NIW A;  5DIC A;  4YRU A;  4YGD B;  1QLK A;  1RFJ A;  1OZO A;  2KNE A;  3PM8 A;  3BOW B;  4XJK A;  3JTD B;  1IRJ A;  3CTN A;  3DVM A;  4Q04 A;  1DT7 B;  1K9U A;  3A4U B;  2KQ6 A;  1CM4 A;  1LA0 A;  1S26 D;  2QPT A;  2M8U A;  1KK8 B;  1EG3 A;  2F3Z A;  3BJH A;  2LE9 B;  1BOC A;  2OTG B;  4MRY A;  2K60 A;  2JT3 A;  1BG1 A;  1PVB A;  1RWY A;  1DF0 B;  1QXP A;  1X02 A;  3FWC A;  3DZT A;  4GAO A;  3EK8 A;  3OBV A;  2LLU A;  1Y1A A;  2NLN A;  4MZK A;  3I5H C;  2LCP A;  2K7O A;  2L4I A;  2CTN A;  3H4S E;  4GGN A;  4PDZ A;  5KSZ A;  2PQL A;  1XK4 A;  1W7I B;  5D69 A;  3D77 A;  3OB2 B;  2QEH A;  1G4Y R;  1DEK A;  4PCW A;  1SCV A;  2H8V A;  4WRI A;  4FTG A;  2ISD A;  2Y1M A;  2ZNE A;  1KSM A;  1KK7 Y;  1QX5 B;  3D10 A;  2MA2 A;  3BUX B;  1NPQ A;  1UHJ A;  1CFD A;  1K96 A;  1B8L A;  1SR6 C;  4F0Z B;  1DJG A;  4YBH B;  3D75 A;  4I5L B;  2BBN A;  1K9K A;  1S5G Y;  4FQO A;  5HLO A;  1H4B A;  2QEO A;  3CR4 X;  5HL1 A;  1UP5 A;  1WDC B;  2JTZ A;  2ZN8 A;  5IBW A;  1QV1 A;  3CR2 A;  1XO5 A;  1AHR A;  2MRD A;  3CYZ A;  3O6B A;  1V1F A;  4MVF A;  4F7F A;  2L5X B;  4L9M A;  1N65 A;  4M2O A;  4PE0 A;  1F71 A;  1DVI A;  3AAJ A;  4N5X A;  4UPG A;  3PN7 C;  2FJY A;  1LA3 A;  2G9B A;  1BMO A;  1TRF A;  4C0L A;  3TUY B;  4CPV A;  2K7D A;  2ZRS A;  2LVI A;  3BUO B;  3WHT B;  3NSK A;  3OX5 A;  3S0A A;  1QVI Z;  2KI6 D;  3K1E A;  1IQ3 A;  1DGU A;  3B87 A;  1EJ3 A;  3SG7 A;  1CMF A;  1TNX A;  1D1O A;  1PK0 D;  1AJ4 A;  3Q8I A;  1C7V A;  1KFU L;  2K61 A;  1DC1 A;  3FWB A;  2KGR A;  1ZFS A;  2JUL A;  1SPY A;  3IQQ A;  4I5K A;  1HQV A;  3CZT X;  4ZCV A;  4OR9 B;  3CZ0 A;  4E68 A;  1QTX A;  4N1G A;  1YX8 A;  1GJY A;  1TOP A;  3SG3 A;  3D0Y B;  2AUC A;  2LAN A;  3QRX A;  1VRK A;  3VRR A;  1BU3 A;  1UHN A;  2MJW B;  5J3X A;  1F55 A;  1OOH A;  1QV0 A;  2SAS A;  2FJU B;  1L2O C;  5CSF A;  5JOL A;  4DCK A;  1A4P A;  3NSI A;  5AXI A;  3VRP A;  1JF2 A;  1M63 B;  3SG4 A;  2MAZ A;  3OHM B;  2B1U A;  2QAC A;  3PM2 A;  1NX2 A;  1JBA A;  4MN0 A;  2JNX A;  3I5I C;  3GOF A;  3BUN B;  1DF0 A;  5AER A;  2H61 C;  3BUW B;  4C0J A;  1YUS A;  1JUO A;  1LXF C;  2KQY A;  5PAL A;  3EVV A;  1K93 D;  2JOJ A;  1NCX A;  1CFC A;  2JTT A;  1NX1 A;  2L2E A;  2LUC A;  1A75 B;  2D8N A;  2M1U A;  3JVT B;  2FCD A;  2L2C A;  3R1P A;  4USL A;  2BL0 C;  1R6P A;  4P2Y B;  2DOQ A;  3EKH A;  1TNQ A;  1YUR A;  1QAS A;  5GQQ C;  4OCI A;  1KK7 Z;  4KYN A;  1UHI A;  4ZCU A;  4PHK A;  1LKJ A;  1WRL A;  5FYX A;  1SCM B;  3KO0 A;  1GGZ A;  3CZ1 A;  3IVT A;  1S5G Z;  5HKW A;  2KI6 C;  1WRZ A;  3TDZ A;  3RZS A;  3S0E A;  1AK8 A;  3OX6 A;  3VRN A;  3D74 A;  4NQG A;  4INW A;  1Y1U A;  1DGV A;  1L7Z A;  4MLW A;  3CZ2 A;  2JXL A;  2LNK A;  1BOD A;  2KSP A;  2V53 A;  3V2L A;  1KFX L;  1M45 A;  2F2P A;  2KLD A;  3EG5 B;  1IH0 A;  4AQJ A;  3I5G C;  1J7P A;  3O78 A;  1MF8 B;  1TCF A;  2PMY A;  1KWO C;  2G2B A;  2M9G A;  1CKK A;  3TS5 C;  1EG4 A;  1CDM A;  2KBI A;  2KGB C;  1C3Z A;  1MWN A;  1J1D A;  2AMI A;  2MHH A;  2O60 A;  4GPL B;  2K7B A;  1UHK A;  1K90 D;  4MZL A;  1PVA A;  2LM5 A;  2EC6 B;  1C7W A;  2CXJ A;  3O4Y A;  2IS9 A;  3KHE A;  1OSA A;  2JZI A;  2M0R A;  3M0W A;  2PAS A;  2PRU A;  1W7J B;  3D0Y A;  1ALV A;  2K2A A;  4ETO A;  1CLB A;  2E30 A;  1TUZ A;  1YRT B;  1OOF A;  1NYA A;  2H61 A;  3OP0 A;  3SS3 A;  1DJH A;  3VRO A;  2ZKM X;  1QIW A;  5I8N A;  2O5G A;  4M2P A;  1NSH A;  2CCM A;  1AVS A;  2NXQ A;  3LCP C;  2CBL A;  3JTD C;  4JPZ B;  4D1E A;  1SL9 A;  1WY9 A;  5I2O A;  2KDH A;  3LK0 A;  1WLZ A;  2WC5 A;  4YGB B;  5DKR A;  3GK1 A;  3SIA A;  2LP2 A;  1KK8 C;  2JQ6 A;  1QX7 A;  2OTG C;  1REC A;  2BCX A;  1A03 A;  1SMG A;  1IIO A;  2HQ8 A;  2K2F A;  2WCJ A;  1F4Q A;  3EVU A;  5FI7 A;  1LIN A;  5CPV A;  2M7N A;  5CSN A;  2JT8 A;  1XYD A;  1YUT A;  2L5Y A;  2QDI A;  1Y1X A;  3B88 A;  1DJX A;  3EKJ A;  2WCB A;  4YI9 A;  3NGV A;  1CDL A;  2NZ0 A;  1GQM A;  2WCM A;  3NHI A;  5HLV A;  3WXA A;  4NDD A;  4R1E A;  4QJ3 B;  4AOM A;  1YX7 A;  2LP3 A;  1F54 A;  3GK2 A;  5CSI A;  2I7A A;  4CID A;  1OOG A;  1B8C A;  4DRW A;  2BNX A;  1B1G A;  1BLQ A;  4INX A;  2LVK A;  2QEV A;  5D3O A;  4GBA A;  4PE1 A;  1J7O A;  2BAP A;  2LVJ A;  1JFJ A;  3FS7 A;  3O2P A;  2ZN9 A;  4YGA A;  1NX0 A;  5ER4 X;  3TDI A;  1ZUZ A;  1U5I B;  1IJ6 A;  2BCA A;  2KHN A;  2ZFD A;  2EGD A;  1WDC C;  1J7Q A;  2TN4 A;  3EK7 A;  1G8I A;  1YRU B;  1RK9 A;  4PAL A;  3R1V A;  3TDU A;  3DVE A;  2BE6 A;  1DMO A;  1R2U A;  1SBJ A;  2ERB A;  3WNX B;  2KFH A;  3BFB A;  1C3Y A;  2VRG A;  2COL B;  3D73 A;  3OGN A;  3S0D A;  1EH2 A;  3TUY C;  1BF5 A;  1PRW A;  3FE9 A;  2KYC A;  4ICB A;  1IKU A;  2KPH A;  1DQE A;  1ORG A;  5D7F A;  3S0B A;  1OOI X;  1W9Z A;  3UNW A;  3BOW A;  3R1O A;  1N0Y A;  2Y1N A;  3CS1 A;  4PT1 A;  3NSL A;  3TZ1 A;  3DVJ A;  1XFX O;  3NSO A;  1LVC D;  2JPT A;  2FCE A;  1DJZ A;  1XFY O;  1K94 A;  1RTP 1;  3F45 A;  4HSZ A;  4WQ3 A;  1GM0 A;  1OMR A;  5EL2 A;  2WOS A;  2OS8 B;  2M3W A;  4OV2 A;  1QAT A;  2LHI A;  1TNW A;  2GGZ A;  1K2H A;  1BT6 A;  2KAX A;  1FI5 A;  4QJ5 B;  1FI6 A;  1NUB A;  1JF0 A;  3CWG A;  1KCY A;  4GNK B;  1ALW A;  2F3Y A;  1UWO A;  1YTZ C;  2KI4 B;  1J1E A;  5JJG A;  1CDN A;  1FF1 A;  4XYN A;  4NDB A;  4HRH A;  2LMV A;  4GFT A;  3E3R A;  4JQ0 D;  1XVJ A;  1IQ5 A;  2ZRT A;  3I5F B;  1CFP A;  1IGV A;  3VB1 A;  1SW8 A;  1YR5 A;  2LV7 A;  1DJW A;  4AQI A;  3BYA A;  4MSP A;  4JD9 A;  1GGW A;  1FPW A;  2NCP A;  1NP8 A;  5KU1 A;  1TTX A;  1ZAC A;  1TCO B;  3SG6 A;  2K8M B;  3SG2 A;  2MBX A;  3BUM B;  3JVT C;  1MQ1 A;  1OMV A;  3LK1 A;  2KOT A;  1OOJ A;  3RM1 A;  1KQM B;  1BJF A;  2H2K A;  1BR1 B;  5TNC A;  1S3P A;  1CNP A;  2WC6 A;  2CT9 A;  3SG5 A;  5G08 A;  1N2D A;  1DEL A;  3GK4 X;  1TNP A;  1PAL A;  1M31 A;  2PSR A;  4CLN A;  4CFQ A;  1CB1 A;  2ZND A;  2P71 A;  3D78 A;  4PHN A;  1SCM C;  5I94 A;  3CDN A;  3SS5 A;  2Q4U A;  1K9P A;  3PFV A;  1SL8 A;  2JRF A;  4IL1 A;  1G33 A;  1U5I A;  2JNF A;  5HYD A;  1CM1 A;  1PSR A;  1B4C A;  2BEC A;  4P5O E;  2LHL A;  2KLE A;  1JFK A;  5F6T A;  3PSR A;  1S1E A;  4HRE E;  3N7H A;  2Q91 A;  1SKT A;  1YVL A;  3WHU B;  2EHB A;  3LLE A;  5HKY A;  3PAL A;  1WLM A;  2LAP A;  1B7T Y;  3SS4 A;  2JXC A;  3S0F A;  3NHT A;  1IJ5 A;  3I5H B;  2F33 A;  1CFF A;  3KPX A;  2L4H A;  1TUJ A;  1S6I A;  1NWD A;  3L4L A;  1NX3 A;  3VRQ A;  3IF7 A;  3AKB A;  4TNC A;  1IWQ A;  3DYE A;  2JWW A;  3PJI A;  3K21 A;  3MSE B;  2WCF A;  3B6X A;  1J7R A;  4YGC B;  4N1F A;  3D76 A;  4DUQ A;  1F70 A;  2EC6 C;  2R2I A;  4JKT A;  1AP4 A;  1DJI A;  1SR6 B;  1C07 A;  1SK6 D;  2Y5I A;  5AFP A;  1B9A A;  1SYM A;  3HCM A;  3HX4 A;  3AKA A;  1XFV O;  2LMU A;  4MBE A;  1OE9 B;  1LS8 A;  2KBM A;  3B7A A;  2M49 B;  2YGU A;  1SRA A;  4JWQ A;  4I5J A;  2LLT A;  1XFZ O;  3DF0 B;  2M97 A;  1J55 A;  4GGF A;  3SIB A;  1A2X A;  3DXL A;  5AAN A;  1A75 A;  2WOR A;  4GUK A;  2HQW A;  3CGA A;  2P70 A;  5CSJ A;  1QLS A;  3CR5 X;  3PN7 B;  4ORC B;  4PHJ A;  1KFU S;  2LMT A;  2KAY A;  2LVV A;  4YGE B;  1XFW O;  1Z2C B;  1IG5 A;  1P28 A;  3RLZ A;  3OB1 B;  5BPJ A;  1QJT A;  2WC8 A;  4FQT A;  5FI6 A;  4IJ7 A;  3FE8 A;  3L4A A;  2BE4 A;  3SJS A;  2PAL A;  1H8B A;  1TN4 A;  2KFG A;  3AAK A;  3L47 A;  1K8U A;  3FIA A;  2M29 A;  1OW4 A;  1OZS A;  1CLM A;  3VGO A;  1TIZ A;  4MEW A;  1F4O A;  1QWV A;  2HF5 A;  4OVN F;  1BR4 B;  2JT0 A;  2WND A;  1M39 A;  1QIV A;  3NXA A;  3BQ3 A;  2M1K B;  4HRG A;  1SSE B;  3DVK A;  1CTR A;  3PLF B;  1WRK A;  4XJK B;  1QX2 A;  2I94 A;  1MXL C;  1Z4H A;  2K7C A;  4C0K A;  5AEQ A;  1S36 A;  2E6W A;  2WCH A;  1L2O B;  1XFU O;  1CLL A;  3TS5 B;  1V1G A;  1FW4 A;  1PUL A;  2WCE A;  2M7L A;  1AJ5 A;  1B8R A;  1MUX A;  1XA5 A;  4A4B A;  5FI2 A;  4PE7 A;  5B8I B;  3QME A;  1YVH A;  2OPO A;  3C1V A;  1KQV A;  3CLN A;  1MXE A;  4ORB B;  3I5I B;  2GGM A;  3UO9 A;  1T14 A;  2L0P A;  2L50 A;  4BY4 A;  1B7T Z;  1YUU A;  2AAO A;  2BCB A;  1NCZ A;  1RRO A;  3DD4 A;  3CAB A;  2A4J A;  2GTE A;  1JC2 A;  1EXR A;  2LC5 A;  5DKN A;  4A4C A;  1HT9 A;  1MHO A;  3R72 A;  1UUR A;  4PHM A;  2HPS A;  2SCP A;  1K95 A;  2BBM A;  1E8A A;  2BKH B;  2F8P A;  3B86 A;  1CMG A;  1Y0V H;  1UHH A;  2PVB A;  2BL0 B;  1OQP A;  2MLE C;  1MR8 A;  4DIR A;  4DS7 A;  4MRX A;  2KAV A;  3BFH A;  1CDP A;  3DY9 A;  2BKI B;  4NDC A;  4YI8 A;  2I18 A;  3PAT A;  5HKZ A;  2FOT A;  1AUI B;  1B47 A;  3A8R A;  2OS8 C;  4U8D A;  1KFX S;  2NCO A;  5ER5 A;  1JWD A;  1JSA A;  3IQO A;  1PSB A;  4WQ2 A;  5KTY A;  1XK4 C;  4PE4 A;  2CNP A;  5K89 A;  1S6C A;  2P6B B;  2HET A;  4GGF C;  2WCL A;  2L98 A;  4M2Q A;  2KFF A;  3DF0 A;  4BY5 A;  5DKQ A;  3EK4 A;  2KI4 C;  4ORA B;  1TWO A;  2LUX A;  2QEB A;  1ZMZ A;  4OZD A;  4OKH A;  3ZNI A;  1SY9 A;  2KYF A;  2PYQ A;  3I5G B;  3ZWH A;  3EVR A;  1ODB A;  1S6J A;  2JU0 A;  3I5F C;  1QVI Y;  1FBV A;  1A29 A;  1DTL A;  2JC2 A;  1KWO B;  2GV5 A;  1DJY A;  2RGI A;  3BXK A;  1QS7 A;  3LL8 B;  1ZOT B;  1XFR A;  1SL7 A; 
#chains in the Genus database with same CATH homology
 1NCY A;  4CFR A;  2MLF C;  4I5N B;  5I2L A;  2F2O A;  2I2R E;  1F8H A;  4MZJ A;  2K0J A;  2Y4Q A;  3KF9 A;  1RJV A;  3ICB A;  1UUS A;  1M46 A;  1KSO A;  5I2Q A;  1KQM C;  1Y6W A;  3KEV A;  1EL4 A;  2L51 A;  1OMD A;  1SNL A;  2LLS A;  4QJ4 B;  1Q80 A;  1NIW A;  4YRU A;  4YGD B;  1QLK A;  1RFJ A;  1OZO A;  2KNE A;  3PM8 A;  3BOW B;  4XJK A;  3JTD B;  1IRJ A;  3CTN A;  3DVM A;  4Q04 A;  1DT7 B;  1K9U A;  3A4U B;  2KQ6 A;  1CM4 A;  1LA0 A;  1S26 D;  2QPT A;  2M8U A;  1KK8 B;  1EG3 A;  2F3Z A;  1BOC A;  2LE9 B;  2OTG B;  4MRY A;  2JT3 A;  1BG1 A;  1PVB A;  1RWY A;  1DF0 B;  1QXP A;  1X02 A;  3FWC A;  4GAO A;  3EK8 A;  2LLU A;  1Y1A A;  2NLN A;  4MZK A;  3I5H C;  2LCP A;  2K7O A;  2L4I A;  2CTN A;  3H4S E;  4GGN A;  4PDZ A;  5KSZ A;  1XK4 A;  1W7I B;  5D69 A;  3OB2 B;  1G4Y R;  4PCW A;  1SCV A;  4WRI A;  2ISD A;  4FTG A;  2Y1M A;  2ZNE A;  1KSM A;  1KK7 Y;  1QX5 B;  3D10 A;  2MA2 A;  3BUX B;  1NPQ A;  1UHJ A;  1CFD A;  1K96 A;  1B8L A;  1SR6 C;  4F0Z B;  1DJG A;  4YBH B;  4I5L B;  2BBN A;  1K9K A;  1S5G Y;  4FQO A;  5HLO A;  1H4B A;  3CR4 X;  1UP5 A;  1WDC B;  2JTZ A;  2ZN8 A;  5IBW A;  1QV1 A;  3CR2 A;  1XO5 A;  1AHR A;  2MRD A;  3O6B A;  4MVF A;  1V1F A;  2L5X B;  4L9M A;  1N65 A;  4M2O A;  4PE0 A;  1F71 A;  1DVI A;  3AAJ A;  4N5X A;  4UPG A;  3PN7 C;  1LA3 A;  2G9B A;  1BMO A;  1TRF A;  4C0L A;  3TUY B;  4CPV A;  2K7D A;  2ZRS A;  2LVI A;  3BUO B;  3WHT B;  3NSK A;  3OX5 A;  1IQ3 A;  1QVI Z;  2KI6 D;  1DGU A;  1EJ3 A;  3SG7 A;  1CMF A;  1TNX A;  1D1O A;  1PK0 D;  1AJ4 A;  1C7V A;  1KFU L;  2K61 A;  3FWB A;  2KGR A;  1ZFS A;  2JUL A;  1SPY A;  3IQQ A;  4I5K A;  1HQV A;  3CZT X;  4ZCV A;  4OR9 B;  4E68 A;  1QTX A;  4N1G A;  1YX8 A;  1GJY A;  1TOP A;  3SG3 A;  3D0Y B;  2AUC A;  2LAN A;  3QRX A;  1VRK A;  3VRR A;  1BU3 A;  1UHN A;  2MJW B;  5J3X A;  1F55 A;  1QV0 A;  2SAS A;  2FJU B;  1L2O C;  5CSF A;  5JOL A;  4DCK A;  1A4P A;  3NSI A;  5AXI A;  3VRP A;  1JF2 A;  1M63 B;  3SG4 A;  2MAZ A;  3OHM B;  2B1U A;  2QAC A;  1NX2 A;  1JBA A;  4MN0 A;  2JNX A;  3I5I C;  3GOF A;  3BUN B;  1DF0 A;  5AER A;  2H61 C;  3BUW B;  4C0J A;  1YUS A;  1JUO A;  1LXF C;  2KQY A;  5PAL A;  3EVV A;  1K93 D;  2JOJ A;  1NCX A;  1CFC A;  2JTT A;  1NX1 A;  2L2E A;  2LUC A;  1A75 B;  2D8N A;  2M1U A;  3JVT B;  2FCD A;  4USL A;  2BL0 C;  1R6P A;  4P2Y B;  2DOQ A;  3EKH A;  1TNQ A;  1YUR A;  1QAS A;  5GQQ C;  4OCI A;  1KK7 Z;  1UHI A;  4ZCU A;  4PHK A;  1LKJ A;  1WRL A;  5FYX A;  1SCM B;  3KO0 A;  1GGZ A;  1S5G Z;  5HKW A;  2KI6 C;  1WRZ A;  3TDZ A;  1AK8 A;  3OX6 A;  3VRN A;  4NQG A;  1Y1U A;  1DGV A;  1L7Z A;  4MLW A;  2JXL A;  2LNK A;  1BOD A;  2KSP A;  2V53 A;  1KFX L;  1M45 A;  2F2P A;  1IH0 A;  4AQJ A;  3I5G C;  1J7P A;  3O78 A;  1MF8 B;  1TCF A;  2PMY A;  1KWO C;  2G2B A;  2M9G A;  1CKK A;  3TS5 C;  1EG4 A;  1CDM A;  2KBI A;  2KGB C;  1MWN A;  2O60 A;  1J1D A;  2AMI A;  2MHH A;  4GPL B;  2K7B A;  1UHK A;  1K90 D;  4MZL A;  1PVA A;  2LM5 A;  2EC6 B;  1C7W A;  2CXJ A;  3O4Y A;  2IS9 A;  3KHE A;  1OSA A;  2JZI A;  2M0R A;  3M0W A;  2PAS A;  2PRU A;  1W7J B;  3D0Y A;  1ALV A;  2K2A A;  4ETO A;  1CLB A;  2E30 A;  1YRT B;  2H61 A;  1NYA A;  3OP0 A;  3VRO A;  1DJH A;  2ZKM X;  1QIW A;  2O5G A;  4M2P A;  1NSH A;  2CCM A;  1AVS A;  2NXQ A;  3LCP C;  2CBL A;  3JTD C;  4JPZ B;  4D1E A;  1SL9 A;  1WY9 A;  5I2O A;  2KDH A;  3LK0 A;  1WLZ A;  4YGB B;  5DKR A;  3GK1 A;  3SIA A;  2LP2 A;  1KK8 C;  2JQ6 A;  1QX7 A;  2OTG C;  1REC A;  2BCX A;  1A03 A;  1SMG A;  2HQ8 A;  2K2F A;  1F4Q A;  3EVU A;  1LIN A;  5CPV A;  2M7N A;  5CSN A;  2JT8 A;  1XYD A;  1YUT A;  1Y1X A;  1DJX A;  3EKJ A;  2WCB A;  4YI9 A;  1CDL A;  2NZ0 A;  1GQM A;  5HLV A;  3WXA A;  4NDD A;  4R1E A;  4QJ3 B;  4AOM A;  1YX7 A;  2LP3 A;  1F54 A;  3GK2 A;  5CSI A;  2I7A A;  4CID A;  4DRW A;  1B8C A;  1B1G A;  1BLQ A;  2LVK A;  4GBA A;  4PE1 A;  1J7O A;  2LVJ A;  1JFJ A;  3FS7 A;  3O2P A;  2ZN9 A;  4YGA A;  1NX0 A;  5ER4 X;  3TDI A;  1ZUZ A;  1U5I B;  1IJ6 A;  2BCA A;  2KHN A;  2ZFD A;  2EGD A;  1WDC C;  1J7Q A;  2TN4 A;  3EK7 A;  1G8I A;  1YRU B;  1RK9 A;  4PAL A;  3TDU A;  3DVE A;  2BE6 A;  1DMO A;  1R2U A;  1SBJ A;  3WNX B;  2KFH A;  2VRG A;  2COL B;  1EH2 A;  3TUY C;  1BF5 A;  1PRW A;  2KYC A;  4ICB A;  1IKU A;  5D7F A;  3BOW A;  1N0Y A;  2Y1N A;  3CS1 A;  3NSL A;  3TZ1 A;  3DVJ A;  1XFX O;  3NSO A;  1LVC D;  2JPT A;  2FCE A;  1DJZ A;  1XFY O;  1K94 A;  1RTP 1;  3F45 A;  4HSZ A;  4WQ3 A;  1OMR A;  2WOS A;  2OS8 B;  2M3W A;  4OV2 A;  1QAT A;  2LHI A;  1TNW A;  2GGZ A;  1K2H A;  1BT6 A;  2KAX A;  1FI5 A;  4QJ5 B;  1FI6 A;  1NUB A;  1JF0 A;  3CWG A;  1KCY A;  4GNK B;  1ALW A;  2F3Y A;  1UWO A;  1YTZ C;  2KI4 B;  1J1E A;  1CDN A;  1FF1 A;  4XYN A;  4NDB A;  4HRH A;  2LMV A;  4GFT A;  3E3R A;  4JQ0 D;  1XVJ A;  1IQ5 A;  2ZRT A;  3I5F B;  1CFP A;  1IGV A;  1SW8 A;  1YR5 A;  2LV7 A;  1DJW A;  4AQI A;  3BYA A;  4MSP A;  1GGW A;  1FPW A;  2NCP A;  1NP8 A;  5KU1 A;  1TTX A;  1ZAC A;  1TCO B;  3SG6 A;  2K8M B;  3SG2 A;  2MBX A;  3BUM B;  3JVT C;  1MQ1 A;  1OMV A;  3LK1 A;  2KOT A;  1OOJ A;  3RM1 A;  1KQM B;  1BJF A;  2H2K A;  1BR1 B;  5TNC A;  1S3P A;  1CNP A;  2CT9 A;  3SG5 A;  5G08 A;  1N2D A;  3GK4 X;  1TNP A;  1PAL A;  1M31 A;  2PSR A;  4CLN A;  4CFQ A;  1CB1 A;  2ZND A;  4PHN A;  1SCM C;  2Q4U A;  1K9P A;  3PFV A;  1SL8 A;  2JRF A;  4IL1 A;  1G33 A;  1U5I A;  2JNF A;  5HYD A;  1CM1 A;  1PSR A;  1B4C A;  2BEC A;  4P5O E;  2LHL A;  1JFK A;  5F6T A;  3PSR A;  1S1E A;  4HRE E;  2Q91 A;  1SKT A;  1YVL A;  3WHU B;  2EHB A;  3LLE A;  5HKY A;  3PAL A;  1WLM A;  2LAP A;  1B7T Y;  2JXC A;  1IJ5 A;  3I5H B;  2F33 A;  1CFF A;  3KPX A;  2L4H A;  1S6I A;  1NWD A;  1NX3 A;  3VRQ A;  3IF7 A;  3AKB A;  4TNC A;  1IWQ A;  2JWW A;  3K21 A;  3MSE B;  2WCF A;  4YGC B;  1J7R A;  4N1F A;  1F70 A;  4DUQ A;  2EC6 C;  2R2I A;  1AP4 A;  1DJI A;  1SR6 B;  1C07 A;  1SK6 D;  2Y5I A;  5AFP A;  1B9A A;  1SYM A;  3HCM A;  3HX4 A;  3AKA A;  1XFV O;  2LMU A;  4MBE A;  1OE9 B;  2KBM A;  2M49 B;  1SRA A;  4JWQ A;  4I5J A;  2LLT A;  1XFZ O;  3DF0 B;  2M97 A;  1J55 A;  4GGF A;  3SIB A;  1A2X A;  5AAN A;  1A75 A;  2WOR A;  4GUK A;  2HQW A;  3CGA A;  5CSJ A;  1QLS A;  3CR5 X;  3PN7 B;  4ORC B;  4PHJ A;  1KFU S;  2LMT A;  2KAY A;  2LVV A;  4YGE B;  1XFW O;  1IG5 A;  3RLZ A;  3OB1 B;  5BPJ A;  1QJT A;  2WC8 A;  2BE4 A;  3SJS A;  2PAL A;  1H8B A;  1TN4 A;  2KFG A;  3AAK A;  1K8U A;  3FIA A;  2M29 A;  1OZS A;  1CLM A;  3VGO A;  1TIZ A;  4MEW A;  1F4O A;  2HF5 A;  4OVN F;  1BR4 B;  2JT0 A;  2WND A;  1M39 A;  1QIV A;  3NXA A;  3BQ3 A;  2M1K B;  4HRG A;  3DVK A;  1CTR A;  3PLF B;  1WRK A;  4XJK B;  1QX2 A;  2I94 A;  1MXL C;  2K7C A;  4C0K A;  5JJG A;  5AEQ A;  1S36 A;  2E6W A;  3TS5 B;  1L2O B;  1XFU O;  1CLL A;  1V1G A;  1FW4 A;  1PUL A;  2WCE A;  2M7L A;  1AJ5 A;  1B8R A;  1MUX A;  1XA5 A;  4A4B A;  4PE7 A;  5B8I B;  1YVH A;  2OPO A;  3C1V A;  1KQV A;  3CLN A;  1MXE A;  4ORB B;  3I5I B;  2GGM A;  2L0P A;  2L50 A;  4BY4 A;  1B7T Z;  1YUU A;  2BCB A;  2AAO A;  1NCZ A;  1RRO A;  3DD4 A;  1JC2 A;  2A4J A;  1EXR A;  2LC5 A;  5DKN A;  4A4C A;  1HT9 A;  1MHO A;  1UUR A;  4PHM A;  2HPS A;  2SCP A;  1K95 A;  2BBM A;  1E8A A;  2BKH B;  2F8P A;  5I8N A;  1CMG A;  1Y0V H;  1UHH A;  2PVB A;  2BL0 B;  1OQP A;  2MLE C;  1MR8 A;  4DIR A;  4DS7 A;  4MRX A;  2KAV A;  1CDP A;  4NDC A;  2BKI B;  4YI8 A;  2I18 A;  3PAT A;  5HKZ A;  2FOT A;  1AUI B;  1B47 A;  3A8R A;  2OS8 C;  4U8D A;  1KFX S;  2NCO A;  5ER5 A;  1JWD A;  1JSA A;  3IQO A;  1PSB A;  4WQ2 A;  5KTY A;  1XK4 C;  4PE4 A;  2CNP A;  5K89 A;  1S6C A;  2P6B B;  2HET A;  4GGF C;  2L98 A;  4M2Q A;  2KFF A;  3DF0 A;  4BY5 A;  5DKQ A;  3EK4 A;  2KI4 C;  4ORA B;  2LUX A;  1ZMZ A;  4OKH A;  3ZNI A;  1SY9 A;  2KYF A;  3I5G B;  3ZWH A;  3EVR A;  1ODB A;  1S6J A;  2JU0 A;  3I5F C;  1QVI Y;  1FBV A;  1A29 A;  1DTL A;  2JC2 A;  1KWO B;  2GV5 A;  1DJY A;  2RGI A;  3BXK A;  1QS7 A;  3LL8 B;  1ZOT B;  1SL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...