2M97A

Optimized ratiometric calcium sensors for functional in vivo imaging of neurons and t-lymphocytes
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
SEEELSECFRIFDKDGNGFIDREEFGDIIRLTGEQLTDEDVDEIFGDSDTDKNGRIDFDEFLKMMENVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Optimized Ratiometric Calcium Sensor
publication title Optimized ratiometric calcium sensors for functional in vivo imaging of neurons and T lymphocytes.
pubmed doi rcsb
source organism Opsanus tau
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m97A00
5CSNA 1PRWA 1XFXO 1OOJA 1UHHA 3WHUB 2KDHA 4DRWA 1CDMA 1B7TY 4L9MA 4JWQA 3NSIA 5F6TA 4QJ5B 5AFPA 1B8CA 1CB1A 1BU3A 5IBWA 5DKRA 5D69A 1HQVA 1MWNA 1TIZA 2AMIA 1S6CA 3CR2A 1LA3A 2H2KA 1GGZA 1MQ1A 5CSIA 1YVLA 1DTLA 4OCIA 5GQQC 5HYDA 1N2DA 3AKBA 2GGZA 4N5XA 3GK1A 3PLFB 4GGFC 1DMOA 1KQVA 1DF0A 2CXJA 5DKNA 2NCOA 4GUKA 1QXPA 2O5GA 3LLEA 2PMYA 4GGFA 1KCYA 1A75B 2NXQA 1RJVA 3D10A 1SK6D 2KFGA 4AQJA 3IQQA 3SG3A 2KI4B 1H8BA 4C0JA 4PHJA 4AOMA 1A75A 1RK9A 1PVBA 2JOJA 3H4SE 2F33A 1K94A 2WOSA 1K95A 1V1GA 1SMGA 1QVIZ 1ZFSA 2K7OA 3HCMA 4WQ2A 4PHMA 1PSBA 1DVIA 1DJWA 1YURA 1AHRA 1LINA 2G9BA 3FIAA 4GFTA 4D1EA 2LP2A 1XO5A 1J7RA 1KFXL 2KQYA 1CLBA 1JWDA 1UWOA 1KSOA 4ZCUA 1CDPA 1QV0A 1XK4A 1NCZA 2Q91A 1CDLA 3OP0A 2LLSA 5AXIA 3VRNA 4NDCA 3ZNIA 4CFQA 3DF0B 1CKKA 1SR6C 1KK8C 1B7TZ 1B8LA 1K8UA 1S5GZ 2K7BA 2M0RA 1JUOA 1BF5A 3FWCA 3DVEA 2COLB 2H61C 2OS8B 3DF0A 1L7ZA 3K21A 1SPYA 1SL7A 1FF1A 3EVVA 1XA5A 1WRLA 4YGCB 5G08A 5HLVA 2KFHA 2JZIA 1J1DA 1M39A 4NDDA 2F3ZA 2LAPA 1YX8A 1SCMC 3O6BA 4MZLA 4WQ3A 3RLZA 1JF2A 1WDCB 3PSRA 4C0KA 1AP4A 2B1UA 4MLWA 3I5GC 4TNCA 2PVBA 5KTYA 2KGBC 5AERA 3AAKA 1J1EA 4PE0A 1WLZA 2F2PA 1MXLC 2ZKMX 1KK7Y 3O78A 3OB1B 2L5XB 3WHTB 2Y4QA 2KYCA 1LKJA 3OHMB 3O2PA 3CS1A 5BPJA 1NCXA 1AJ5A 4M2OA 2JTZA 4NDBA 1SBJA 4M2QA 4R1EA 2LC5A 1UHIA 4PE4A 1W7IB 2BBMA 2LE9B 3I5FC 4MSPA 1QX2A 1SNLA 5I2LA 1D1OA 1YX7A 4HRGA 1BR1B 1ZACA 3CWGA 1QS7A 2BE4A 3CR5X 4M2PA 1QLSA 2JT3A 4C0LA 1CFFA 4DUQA 1N65A 1L2OB 1F4QA 2LLTA 1K2HA 1MUXA 1CNPA 1UUSA 2HF5A 2A4JA 1OZSA 2ZN8A 3BUXB 2CT9A 3SG5A 3PN7B 4E68A 2PSRA 1IKUA 3JVTB 4FTGA 3FWBA 3TDIA 2JQ6A 4HRHA 1UP5A 2NCPA 2K2AA 5HKYA 3OX5A 1CLLA 3F45A 1F54A 2EC6C 1TNXA 2K7DA 4I5NB 2M7LA 4PALA 1JF0A 2KI6C 3I5HB 2I7AA 1YRTB 1HT9A 1TNQA 2M97A 1BLQA 1KK7Z 4YI8A 1S5GY 1DGUA 1IWQA 1G33A 1GQMA 4AQIA 1YRUB 2CCMA 2KI6D 3IF7A 1VRKA 4WRIA 1FPWA 3BUOB 2FCDA 1QIVA 2L4HA 1BG1A 4YI9A 5J3XA 2MBXA 1S26D 2E30A 2LVIA 2Y5IA 3VRPA 1KFXS 2K8MB 1KWOB 3SJSA 2MA2A 1TCFA 1KQMC 2M3WA 1NCYA 3A4UB 2LANA 2LM5A 3TDZA 4YGDB 2JC2A 3PATA 2MHHA 4OV2A 2M1UA 2DOQA 5JOLA 1XFWO 1AUIB 1B9AA 2HQWA 3BQ3A 2KI4C 5ER5A 3TDUA 2LMUA 1OMRA 4PHKA 2K0JA 2PALA 2Y1MA 1CMGA 3TS5B 1IG5A 2JRFA 4PHNA 1CFCA 1A2XA 1CDNA 1RECA 2KAXA 5B8IB 4MRXA 1EG4A 2ISDA 2LMTA 3GOFA 3WXAA 2M49B 1K90D 1SKTA 3LCPC 1XK4C 1S36A 1QASA 1F71A 5I2QA 1NSHA 3FS7A 3EKJA 4YRUA 4XYNA 3BUWB 1DJHA 1CMFA 1S6JA 3OB2B 5KU1A 1CLMA 1EXRA 3OX6A 1J7OA 4GBAA 2K7CA 1R6PA 1AVSA 4A4BA 4DCKA 4N1FA 1IJ6A 4Q04A 3LK1A 2FCEA 2OTGB 2F3YA 3SG7A 1PK0D 1QTXA 1U5IB 1XFYO 2OS8C 2PASA 4BY4A 3AAJA 4GPLB 1Q80A 1A29A 1LA0A 1S1EA 3I5IC 1RTP1 2BL0B 4PE1A 1JFKA 2LMVA 2ZRTA 3NXAA 4IL1A 1YVHA 1WDCC 5CSJA 1A4PA 2GV5A 5AEQA 2WNDA 2ZNEA 2EGDA 1B4CA 4DS7A 2I18A 4USLA 4YGBB 5I8NA 1A03A 2CNPA 2ZNDA 4XJKB 2FJUB 4MVFA 5JJGA 3CR4X 1SCMB 1FI5A 1K9KA 1M63B 1W7JB 3NSLA 2FOTA 1MF8B 4OR9B 1DJXA 3TUYC 2EHBA 2MLFC 1CM1A 3E3RA 5HLOA 1KSMA 1WRKA 2I94A 2LUXA 3BXKA 1YUUA 2L4IA 1G4YR 2KHNA 1OE9B 1J55A 2NZ0A 3PALA 4P5OE 3KO0A 1DJIA 2QACA 4ZCVA 2WCBA 2JULA 1SL8A 3EK4A 2LHLA 1LXFC 4I5JA 1XFUO 1B8RA 4HSZA 3EVRA 5KSZA 2RGIA 2MLEC 2KAYA 3JTDB 4CFRA 3MSEB 2KFFA 1G8IA 3DVJA 1YTZC 1CFPA 2F8PA 1WY9A 1OSAA 2QPTA 2I2RE 4ORAB 2V53A 2M7NA 2M29A 3KF9A 1QV1A 1NX3A 1DJGA 3PN7C 1YUSA 3BUNB 2AUCA 3JVTC 5CPVA 4PDZA 1MXEA 1TNPA 3C1VA 3NSOA 2JT8A 2LVKA 2SASA 3KPXA 5ER4X 4A4CA 2LUCA 2KBMA 2ZRSA 1PSRA 1N0YA 1IRJA 1UHNA 4P2YB 2R2IA 1TNWA 4YGAA 2P6BB 1M45A 1F70A 3TZ1A 2CBLA 4MEWA 3I5HC 4BY5A 1UURA 3IQOA 1ODBA 5AANA 1X02A 1CTRA 2JXLA 2L2EA 2LVJA 1YR5A 1Y1XA 2SCPA 1V1FA 1JFJA 2LV7A 1OZOA 2BBNA 1JBAA 1Y6WA 1QJTA 1XVJA 2Q4UA 1F55A 2JXCA 3CZTX 2PRUA 3EK8A 4YBHB 1BJFA 4CLNA 1Y1UA 4ORCB 2IS9A 3GK2A 3VRRA 1SRAA 1PULA 5D7FA 2OPOA 1KWOC 3CTNA 1DGVA 1BR4B 2WCFA 1NYAA 2JNFA 3VRQA 2F2OA 2KGRA 1UHJA 1QX5B 1SY9A 2BECA 3BUMB 3SG6A 1LVCD 4ETOA 3DD4A 1IJ5A 2BCBA 2ZN9A 1BMOA 1FBVA 1K9UA 2E6WA 3RM1A 2O60A 3SG4A 1IH0A 3EVUA 2GGMA 1DF0B 4MZKA 2LLUA 3NSKA 2NLNA 3TS5C 1KQMB 3CLNA 3EK7A 4MN0A 1TTXA 2KSPA 2MRDA 2G2BA 4OKHA 1ZOTB 1PALA 1KFUS 3A8RA 2BKHB 1NPQA 1E8AA 1NWDA 2AAOA 3DVMA 1F4OA 1J7PA 1OMVA 4QJ4B 1S6IA 2CTNA 1PVAA 3SIBA 2HETA 1WLMA 1TCOB 2JNXA 1NUBA 1DT7B 1Y0VH 2VRGA 2KNEA 2OTGC 4HREE 1K96A 1SL9A 1CFDA 2K2FA 1UHKA 1NIWA 2M1KB 4MRYA 1NX0A 2JU0A 1U5IA 1FI6A 1QATA 1TOPA 3WNXB 4DIRA 1SR6B 2KBIA 1EL4A 1KK8B 1KFUL 2BL0C 3KEVA 3M0WA 4ORBB 1GGWA 1YUTA 3BOWB 1Y1AA 3SIAA 4PE7A 3DVKA 1IQ3A 1M46A 1AJ4A 3O4YA 1AK8A 4JPZB 2WCEA 3BOWA 2M9GA 2L50A 4MZJA 2K61A 2KAVA 1RFJA 1ZMZA 2M8UA 4PCWA 2H61A 4OVNF 1H4BA 1SYMA 3AKAA 1B1GA 3I5IB 4CIDA 2BCXA 4XJKA 1FW4A 1K93D 2JPTA 1NX2A 3I5GB 1SCVA 3HX4A 2L98A 5CSFA 5HKWA 3VGOA 1C07A 1OMDA 1WRZA 2L0PA 4GAOA 3GK4X 3BYAA 1C7WA 5I2OA 4GGNA 2KOTA 4ICBA 1QX7A 1J7QA 2Y1NA 5FYXA 1EH2A 1RROA 1OQPA 1TRFA 1JC2A 1QLKA 2BCAA 1EG3A 3D0YB 2LVVA 1IGVA 4JQ0D 1BT6A 3EKHA 1MHOA 2MJWB 1ALWA 1B47A 2KYFA 4N1GA 3D0YA 4QJ3B 3KHEA 1BODA 3PM8A 3TUYB 2KQ6A 4F0ZB 5PALA 3ZWHA 1SW8A 1ZUZA 2MAZA 1IQ5A 1L2OC 2L51A 3JTDC 3I5FB 2LP3A 4MBEA 2JTTA 3LL8B 1F8HA 2WORA 4U8DA 4UPGA 1JSAA 1S3PA 1NP8A 2BKIB 5DKQA 1XFZO 1R2UA 5HKZA 2JWWA 2WC8A 1K9PA 1GJYA 2LHIA 3CGAA 3ICBA 5TNCA 3PFVA 1EJ3A 3SG2A 1DJZA 4FQOA 2LCPA 3QRXA 1QIWA 2ZFDA 1CM4A 1DJYA 3LK0A 1TN4A 1QVIY 1M31A 2BE6A 2HPSA 2JT0A 4GNKB 1NX1A 2D8NA 4CPVA 1RWYA 5K89A 4I5KA 2EC6B 4I5LB 2LNKA 1BOCA 2HQ8A 3VROA 4NQGA 2TN4A 1ALVA 1XYDA 4YGEB 1XFVO 1MR8A 1C7VA
chains in the Genus database with same CATH superfamily
5CSNA 3R1PA 1PRWA 1XFXO 1OOJA 1UHHA 3WHUB 2KDHA 4DRWA 1CDMA 1B7TY 4L9MA 3R1OA 4JWQA 3NSIA 5FI7A 4F7FA 3FE8A 5F6TA 4QJ5B 5AFPA 1B8CA 1CB1A 1BU3A 5IBWA 5DKRA 5D69A 1HQVA 1MWNA 1TIZA 2AMIA 1S6CA 3CR2A 1LA3A 2H2KA 1GGZA 1MQ1A 5CSIA 1YVLA 1DTLA 4OCIA 5GQQC 5HYDA 1N2DA 3AKBA 2GGZA 2BNXA 4N5XA 3GK1A 3PLFB 4GGFC 1DMOA 1KQVA 1DF0A 2CXJA 5DKNA 2NCOA 4GUKA 1QXPA 2O5GA 3LLEA 2PMYA 2WC5A 4GGFA 1A75B 2NXQA 1RJVA 3D10A 1SK6D 2KFGA 4AQJA 3IQQA 3SG3A 2KI4B 1H8BA 3B88A 4C0JA 4PHJA 4AOMA 1A75A 1RK9A 1PVBA 2JOJA 3H4SE 2F33A 1K94A 2WOSA 3R1VA 1K95A 1V1GA 1SMGA 1QVIZ 1ZFSA 2K7OA 3CZ2A 2WCHA 3DZTA 3HCMA 4WQ2A 4PHMA 1PSBA 1DVIA 1DJWA 1YURA 1AHRA 1LINA 2G9BA 3FIAA 4GFTA 4D1EA 1DC1A 2LP2A 1XO5A 1J7RA 1KFXL 2KQYA 1CLBA 1JWDA 1UWOA 1KSOA 4ZCUA 1CDPA 1QV0A 3NHTA 1XK4A 1NCZA 2Q91A 1CDLA 3OP0A 2LLSA 5AXIA 3VRNA 1TUZA 1SSEB 2WCKA 4NDCA 3QMEA 3ZNIA 4CFQA 3DF0B 1CKKA 1SR6C 1KK8C 1B7TZ 1B8LA 2WC6A 1K8UA 1S5GZ 2K7BA 2M0RA 2P70A 1JUOA 2K60A 1BF5A 3FWCA 3DVEA 2COLB 2H61C 2OS8B 3DF0A 1L7ZA 3K21A 1SPYA 1OOIX 1DELA 1SL7A 3EVVA 1XA5A 1WRLA 4YGCB 5G08A 5HLVA 2KFHA 2JZIA 1J1DA 1M39A 4NDDA 2F3ZA 2LAPA 1YX8A 1SCMC 3O6BA 4MZLA 4WQ3A 3RLZA 3RZSA 1JF2A 1OOGA 1WDCB 3PSRA 3D76A 4C0KA 1AP4A 1W9ZA 2B1UA 4MLWA 3I5GC 4TNCA 2PVBA 5KTYA 2KGBC 3NHIA 1GM0A 5AERA 3AAKA 1J1EA 1Z2CB 1WLZA 2F2PA 4PE0A 1MXLC 3O4XA 2ZKMX 1KK7Y 3O78A 3OB1B 2L5XB 3WHTB 2Y4QA 3S0DA 2KYCA 1LKJA 3OHMB 3O2PA 3CS1A 5BPJA 1NCXA 1AJ5A 4M2OA 1KCYA 2JTZA 4NDBA 1SBJA 4M2QA 4R1EA 3CYZA 2LC5A 1UHIA 4PE4A 1W7IB 2BBMA 2LE9B 3I5FC 3S0EA 1DQEA 1QX2A 1XFRA 4MSPA 1SNLA 5I2LA 1D1OA 1YX7A 2KLEA 1BR1B 1ZACA 2ERBA 4HRGA 3CWGA 1QS7A 2BE4A 2QEVA 3CR5X 4M2PA 1QLSA 2JT3A 4C0LA 1CFFA 1P28A 1N65A 1L2OB 4DUQA 1F4QA 2LLTA 1K2HA 1MUXA 3L47A 1CNPA 1UUSA 3Q8IA 3D78A 2HF5A 2A4JA 1OZSA 2ZN8A 3BUXB 2CT9A 4FQTA 3SG5A 3PN7B 3UNWA 4E68A 2PSRA 1IKUA 3JVTB 4FTGA 3FWBA 3N7HA 2JQ6A 3B86A 3TDIA 4HRHA 1Z4HA 1UP5A 2NCPA 1LS8A 2H8VA 2K2AA 5HKYA 3OX5A 1CLLA 3F45A 1F54A 2EC6C 1TNXA 2K7DA 4I5NB 2M7LA 4PALA 1JF0A 2KI6C 3I5HB 3L4AA 2I7AA 1YRTB 1HT9A 1TNQA 2M97A 3B6XA 1KK7Z 1BLQA 4YI8A 1S5GY 1DGUA 1IWQA 1G33A 1GQMA 2GTEA 4AQIA 1YRUB 2CCMA 2KI6D 3IF7A 1VRKA 4WRIA 1FPWA 3BUOB 2FCDA 1QIVA 2FJYA 2L4HA 3FE6A 1BG1A 2QEHA 4YI9A 5J3XA 2MBXA 1S26D 2E30A 3BJHA 2LVIA 2Y5IA 3VRPA 1KFXS 2K8MB 1KWOB 3SJSA 2MA2A 1QWVA 1TCFA 1KQMC 2M3WA 1NCYA 3A4UB 2LANA 2LM5A 5FI6A 3TDZA 4YGDB 2JC2A 3PATA 2MHHA 4OV2A 2M1UA 2DOQA 5JOLA 1XFWO 1AUIB 1B9AA 2HQWA 3BQ3A 2KI4C 3S0GA 5ER5A 3TDUA 2LMUA 1OMRA 4PHKA 2K0JA 2PALA 2Y1MA 1CMGA 3TS5B 1IG5A 2JRFA 4PHNA 3B7AA 1CFCA 1A2XA 1CDNA 1RECA 2KAXA 5B8IB 4MRXA 1EG4A 1TUJA 2ISDA 2LMTA 3GOFA 3WXAA 2M49B 4KYNA 4INXA 1K90D 1SKTA 3LCPC 1XK4C 5I94A 1S36A 1QASA 3R72A 1F71A 5I2QA 1NSHA 3FS7A 3EKJA 4YRUA 4XYNA 3BUWB 1DJHA 1CMFA 1S6JA 1C3YA 3OB2B 5KU1A 1CLMA 1EXRA 3OX6A 1J7OA 4GBAA 2K7CA 1R6PA 1AVSA 4A4BA 4DCKA 4N1FA 1IJ6A 3PM2A 4Q04A 3LK1A 2FCEA 2WCLA 2OTGB 2F3YA 3UO9A 3SG7A 1PK0D 1QTXA 1U5IB 1XFYO 2OS8C 2PASA 5HL1A 4BY4A 3AAJA 1OOHA 4GPLB 1Q80A 1A29A 1LA0A 1S1EA 2L2CA 3I5IC 1RTP1 2BL0B 2WCMA 3B87A 1OW4A 4PE1A 1JFKA 2LMVA 2ZRTA 3NXAA 4IL1A 1WDCC 1YVHA 5CSJA 1C3ZA 1A4PA 2GV5A 5AEQA 2WNDA 1IIOA 2ZNEA 2EGDA 1B4CA 4DS7A 1DEKA 2I18A 4USLA 4YGBB 5I8NA 1A03A 2CNPA 2ZNDA 4XJKB 2FJUB 3DYEA 4MVFA 2YGUA 5JJGA 3CR4X 1SCMB 1FI5A 1K9KA 1M63B 1W7JB 4IJ7A 3NSLA 2FOTA 1MF8B 4OR9B 1DJXA 3TUYC 2EHBA 2MLFC 1CM1A 3E3RA 5HLOA 1FF1A 1KSMA 1WRKA 2I94A 2LUXA 3BXKA 5DICA 1YUUA 2L4IA 1G4YR 3D75A 2KHNA 1OE9B 1J55A 2NZ0A 3PALA 4P5OE 4JD9A 3KO0A 1DJIA 2QACA 4ZCVA 2WCBA 2JULA 1SL8A 3EK4A 2LHLA 3D77A 1LXFC 4I5JA 1XFUO 1B8RA 4HSZA 3EVRA 5KSZA 2RGIA 2MLEC 3SS5A 2KAYA 3JTDB 4CFRA 3MSEB 3CZ0A 2KFFA 1G8IA 3DVJA 1YTZC 1CFPA 2F8PA 1WY9A 1OSAA 3D74A 2QPTA 2I2RE 3L4LA 2V53A 2M7NA 2M29A 3KF9A 1QV1A 4ORAB 1NX3A 1DJGA 3PN7C 1YUSA 3BUNB 2AUCA 3JVTC 5CPVA 4PDZA 1MXEA 1TNPA 3C1VA 3NSOA 2JT8A 2LVKA 2SASA 3KPXA 5ER4X 4A4CA 2LUCA 2KBMA 2ZRSA 1PSRA 1N0YA 1IRJA 1UHNA 4P2YB 2R2IA 1TNWA 4YGAA 2P6BB 1M45A 1F70A 3TZ1A 2CBLA 3S0AA 4MEWA 3I5HC 4BY5A 1UURA 3IQOA 1ODBA 3BFBA 5AANA 1X02A 4OZDA 1CTRA 2JXLA 2L2EA 2LVJA 1YR5A 1Y1XA 2SCPA 1V1FA 1JFJA 2LV7A 1OZOA 2BBNA 2P71A 1JBAA 1Y6WA 1QJTA 3SS3A 1XVJA 2Q4UA 1F55A 2JXCA 3CZTX 2PRUA 3EK8A 4YBHB 1BJFA 4CLNA 1Y1UA 4ORCB 2IS9A 3GK2A 3VRRA 1SRAA 1PULA 5D7FA 2OPOA 1KWOC 3CTNA 1DGVA 1BR4B 1OOFA 1NYAA 2JNFA 2WCFA 3VRQA 2F2OA 2KGRA 1UHJA 4PT1A 1QX5B 1SY9A 2BECA 3BUMB 4JKTA 3SG6A 1LVCD 2PQLA 4ETOA 3DD4A 3VB1A 2WCJA 1IJ5A 2BCBA 2ZN9A 3D73A 1BMOA 1FBVA 1K9UA 3S0FA 2E6WA 3NGVA 3RM1A 2O60A 3SG4A 1IH0A 1T14A 3K1EA 3EVUA 3FE9A 2GGMA 1DF0B 4MZKA 2LLUA 3NSKA 2NLNA 3TS5C 1KQMB 3CLNA 3EK7A 4MN0A 1TTXA 2KSPA 2MRDA 2G2BA 4OKHA 1ZOTB 1PALA 1KFUS 3A8RA 2BKHB 1NPQA 1E8AA 1NWDA 2AAOA 3DVMA 1F4OA 1J7PA 1OMVA 4QJ4B 1S6IA 2CTNA 1PVAA 3SIBA 2QEBA 2HETA 1WLMA 1TCOB 2JNXA 1NUBA 1DT7B 1Y0VH 2VRGA 2KNEA 2OTGC 4HREE 1K96A 1SL9A 1CFDA 2K2FA 1UHKA 1NIWA 2M1KB 4MRYA 1NX0A 3DY9A 1TWOA 2JU0A 1U5IA 1FI6A 1QATA 1TOPA 3WNXB 4DIRA 1SR6B 2KBIA 1EL4A 1KK8B 1KFUL 2BL0C 3KEVA 3M0WA 4ORBB 1GGWA 1YUTA 3BOWB 1Y1AA 3SIAA 4PE7A 3V2LA 3DVKA 1IQ3A 1M46A 1AJ4A 3DXLA 3O4YA 3CDNA 5D3OA 4JPZB 1AK8A 2WCEA 3BOWA 2M9GA 2L50A 4MZJA 2QDIA 2K61A 2KAVA 1RFJA 1ZMZA 2M8UA 4PCWA 2H61A 4OVNF 1H4BA 2KLDA 1SYMA 3AKAA 1B1GA 3I5IB 4CIDA 2BCXA 4XJKA 1FW4A 2QEOA 1K93D 2JPTA 1NX2A 3I5GB 1SCVA 3HX4A 2L98A 5CSFA 5HKWA 3VGOA 3CABA 1C07A 1OMDA 1WRZA 2L0PA 3EG5B 4GAOA 3SS4A 3GK4X 3BYAA 1C7WA 5I2OA 3BFHA 2KOTA 4GGNA 4ICBA 1QX7A 1J7QA 2Y1NA 5FYXA 1EH2A 1RROA 1OQPA 1TRFA 1JC2A 1QLKA 2BCAA 3OBVA 1EG3A 3D0YB 2LVVA 1IGVA 4JQ0D 1BT6A 3EKHA 1MHOA 2MJWB 3BFAA 1ALWA 1B47A 2KYFA 4N1GA 3D0YA 4QJ3B 3KHEA 5EL2A 3PM8A 1BODA 3TUYB 2KQ6A 3IVTA 4F0ZB 5PALA 3ZWHA 1SW8A 1ZUZA 4INWA 2MAZA 1IQ5A 1L2OC 2L51A 3JTDC 2L5YA 3I5FB 2LP3A 2PYQA 4MBEA 2JTTA 3OGNA 3LL8B 1F8HA 2WORA 3PJIA 4U8DA 3S0BA 4UPGA 1JSAA 1S3PA 5FI2A 1NP8A 2JPOA 2BKIB 5DKQA 1XFZO 1R2UA 5HKZA 2JWWA 2WC8A 1K9PA 1GJYA 2BAPA 2LHIA 3CGAA 3ICBA 5TNCA 3PFVA 1EJ3A 3SG2A 1DJZA 4FQOA 2LCPA 3QRXA 1QIWA 2ZFDA 1CM4A 1DJYA 3LK0A 1TN4A 1QVIY 2KPHA 1M31A 2BE6A 2HPSA 2JT0A 4GNKB 1NX1A 2D8NA 4CPVA 1RWYA 5K89A 4I5KA 2EC6B 4I5LB 1ORGA 2LNKA 1BOCA 2HQ8A 3VROA 4NQGA 2TN4A 1ALVA 1XYDA 4YGEB 3CZ1A 1XFVO 1MR8A 1C7VA
chains in the Genus database with same CATH topology
5CSNA 1PRWA 1XFXO 1OOJA 1UHHA 3WHUB 2KDHA 4DRWA 1CDMA 1B7TY 4L9MA 4JWQA 3NSIA 5F6TA 4QJ5B 5AFPA 1B8CA 1CB1A 1BU3A 5IBWA 5DKRA 5D69A 1HQVA 1MWNA 1TIZA 2AMIA 1S6CA 3CR2A 1LA3A 2H2KA 1GGZA 1MQ1A 5CSIA 1YVLA 1DTLA 4OCIA 5GQQC 5HYDA 1N2DA 3AKBA 2GGZA 4N5XA 3GK1A 3PLFB 4GGFC 1DMOA 1KQVA 1DF0A 2CXJA 5DKNA 2NCOA 4GUKA 1QXPA 2O5GA 3LLEA 2PMYA 4GGFA 1KCYA 1A75B 2NXQA 1RJVA 3D10A 1SK6D 2KFGA 4AQJA 3IQQA 3SG3A 2KI4B 1H8BA 4C0JA 4PHJA 4AOMA 1A75A 1RK9A 1PVBA 2JOJA 3H4SE 2F33A 1K94A 2WOSA 1K95A 1V1GA 1SMGA 1QVIZ 1ZFSA 2K7OA 3HCMA 4WQ2A 4PHMA 1PSBA 1DVIA 1DJWA 1YURA 1AHRA 1LINA 2G9BA 3FIAA 4GFTA 4D1EA 2LP2A 1XO5A 1J7RA 1KFXL 2KQYA 1CLBA 1JWDA 1UWOA 1KSOA 4ZCUA 1CDPA 1QV0A 1XK4A 1NCZA 2Q91A 1CDLA 3OP0A 2LLSA 5AXIA 3VRNA 4NDCA 3ZNIA 4CFQA 3DF0B 1CKKA 1SR6C 1KK8C 1B7TZ 1B8LA 1K8UA 1S5GZ 2K7BA 2M0RA 1JUOA 1BF5A 3FWCA 3DVEA 2COLB 2H61C 2OS8B 3DF0A 1L7ZA 3K21A 1SPYA 1SL7A 1FF1A 3EVVA 1XA5A 1WRLA 4YGCB 5G08A 5HLVA 2KFHA 2JZIA 1J1DA 1M39A 4NDDA 2F3ZA 2LAPA 1YX8A 1SCMC 3O6BA 4MZLA 4WQ3A 3RLZA 1JF2A 1WDCB 3PSRA 4C0KA 1AP4A 2B1UA 4MLWA 3I5GC 4TNCA 2PVBA 5KTYA 2KGBC 5AERA 3AAKA 1J1EA 4PE0A 1WLZA 2F2PA 1MXLC 2ZKMX 1KK7Y 3O78A 3OB1B 2L5XB 3WHTB 2Y4QA 2KYCA 1LKJA 3OHMB 3O2PA 3CS1A 5BPJA 1NCXA 1AJ5A 4M2OA 2JTZA 4NDBA 1SBJA 4M2QA 4R1EA 2LC5A 1UHIA 4PE4A 1W7IB 2BBMA 2LE9B 3I5FC 4MSPA 1QX2A 1SNLA 5I2LA 1D1OA 1YX7A 4HRGA 1BR1B 1ZACA 3CWGA 1QS7A 2BE4A 3CR5X 4M2PA 1QLSA 2JT3A 4C0LA 1CFFA 4DUQA 1N65A 1L2OB 1F4QA 2LLTA 1K2HA 1MUXA 1CNPA 1UUSA 2HF5A 2A4JA 1OZSA 2ZN8A 3BUXB 2CT9A 3SG5A 3PN7B 4E68A 2PSRA 1IKUA 3JVTB 4FTGA 3FWBA 3TDIA 2JQ6A 4HRHA 1UP5A 2NCPA 2K2AA 5HKYA 3OX5A 1CLLA 3F45A 1F54A 2EC6C 1TNXA 2K7DA 4I5NB 2M7LA 4PALA 1JF0A 2KI6C 3I5HB 2I7AA 1YRTB 1HT9A 1TNQA 2M97A 1BLQA 1KK7Z 4YI8A 1S5GY 1DGUA 1IWQA 1G33A 1GQMA 4AQIA 1YRUB 2CCMA 2KI6D 3IF7A 1VRKA 4WRIA 1FPWA 3BUOB 2FCDA 1QIVA 2L4HA 1BG1A 4YI9A 5J3XA 2MBXA 1S26D 2E30A 2LVIA 2Y5IA 3VRPA 1KFXS 2K8MB 1KWOB 3SJSA 2MA2A 1TCFA 1KQMC 2M3WA 1NCYA 3A4UB 2LANA 2LM5A 3TDZA 4YGDB 2JC2A 3PATA 2MHHA 4OV2A 2M1UA 2DOQA 5JOLA 1XFWO 1AUIB 1B9AA 2HQWA 3BQ3A 2KI4C 5ER5A 3TDUA 2LMUA 1OMRA 4PHKA 2K0JA 2PALA 2Y1MA 1CMGA 3TS5B 1IG5A 2JRFA 4PHNA 1CFCA 1A2XA 1CDNA 1RECA 2KAXA 5B8IB 4MRXA 1EG4A 2ISDA 2LMTA 3GOFA 3WXAA 2M49B 1K90D 1SKTA 3LCPC 1XK4C 1S36A 1QASA 1F71A 5I2QA 1NSHA 3FS7A 3EKJA 4YRUA 4XYNA 3BUWB 1DJHA 1CMFA 1S6JA 3OB2B 5KU1A 1CLMA 1EXRA 3OX6A 1J7OA 4GBAA 2K7CA 1R6PA 1AVSA 4A4BA 4DCKA 4N1FA 1IJ6A 4Q04A 3LK1A 2FCEA 2OTGB 2F3YA 3SG7A 1PK0D 1QTXA 1U5IB 1XFYO 2OS8C 2PASA 4BY4A 3AAJA 4GPLB 1Q80A 1A29A 1LA0A 1S1EA 3I5IC 1RTP1 2BL0B 4PE1A 1JFKA 2LMVA 2ZRTA 3NXAA 4IL1A 1YVHA 1WDCC 5CSJA 1A4PA 2GV5A 5AEQA 2WNDA 2ZNEA 2EGDA 1B4CA 4DS7A 2I18A 4USLA 4YGBB 5I8NA 1A03A 2CNPA 2ZNDA 4XJKB 2FJUB 4MVFA 5JJGA 3CR4X 1SCMB 1FI5A 1K9KA 1M63B 1W7JB 3NSLA 2FOTA 1MF8B 4OR9B 1DJXA 3TUYC 2EHBA 2MLFC 1CM1A 3E3RA 5HLOA 1KSMA 1WRKA 2I94A 2LUXA 3BXKA 1YUUA 2L4IA 1G4YR 2KHNA 1OE9B 1J55A 2NZ0A 3PALA 4P5OE 3KO0A 1DJIA 2QACA 4ZCVA 2WCBA 2JULA 1SL8A 3EK4A 2LHLA 1LXFC 4I5JA 1XFUO 1B8RA 4HSZA 3EVRA 5KSZA 2RGIA 2MLEC 2KAYA 3JTDB 4CFRA 3MSEB 2KFFA 1G8IA 3DVJA 1YTZC 1CFPA 2F8PA 1WY9A 1OSAA 2QPTA 2I2RE 4ORAB 2V53A 2M7NA 2M29A 3KF9A 1QV1A 1NX3A 1DJGA 3PN7C 1YUSA 3BUNB 2AUCA 3JVTC 5CPVA 4PDZA 1MXEA 1TNPA 3C1VA 3NSOA 2JT8A 2LVKA 2SASA 3KPXA 5ER4X 4A4CA 2LUCA 2KBMA 2ZRSA 1PSRA 1N0YA 1IRJA 1UHNA 4P2YB 2R2IA 1TNWA 4YGAA 2P6BB 1M45A 1F70A 3TZ1A 2CBLA 4MEWA 3I5HC 4BY5A 1UURA 3IQOA 1ODBA 5AANA 1X02A 1CTRA 2JXLA 2L2EA 2LVJA 1YR5A 1Y1XA 2SCPA 1V1FA 1JFJA 2LV7A 1OZOA 2BBNA 1JBAA 1Y6WA 1QJTA 1XVJA 2Q4UA 1F55A 2JXCA 3CZTX 2PRUA 3EK8A 4YBHB 1BJFA 4CLNA 1Y1UA 4ORCB 2IS9A 3GK2A 3VRRA 1SRAA 1PULA 5D7FA 2OPOA 1KWOC 3CTNA 1DGVA 1BR4B 2WCFA 1NYAA 2JNFA 3VRQA 2F2OA 2KGRA 1UHJA 1QX5B 1SY9A 2BECA 3BUMB 3SG6A 1LVCD 4ETOA 3DD4A 1IJ5A 2BCBA 2ZN9A 1BMOA 1FBVA 1K9UA 2E6WA 3RM1A 2O60A 3SG4A 1IH0A 3EVUA 2GGMA 1DF0B 4MZKA 2LLUA 3NSKA 2NLNA 3TS5C 1KQMB 3CLNA 3EK7A 4MN0A 1TTXA 2KSPA 2MRDA 2G2BA 4OKHA 1ZOTB 1PALA 1KFUS 3A8RA 2BKHB 1NPQA 1E8AA 1NWDA 2AAOA 3DVMA 1F4OA 1J7PA 1OMVA 4QJ4B 1S6IA 2CTNA 1PVAA 3SIBA 2HETA 1WLMA 1TCOB 2JNXA 1NUBA 1DT7B 1Y0VH 2VRGA 2KNEA 2OTGC 4HREE 1K96A 1SL9A 1CFDA 2K2FA 1UHKA 1NIWA 2M1KB 4MRYA 1NX0A 2JU0A 1U5IA 1FI6A 1QATA 1TOPA 3WNXB 4DIRA 1SR6B 2KBIA 1EL4A 1KK8B 1KFUL 2BL0C 3KEVA 3M0WA 4ORBB 1GGWA 1YUTA 3BOWB 1Y1AA 3SIAA 4PE7A 3DVKA 1IQ3A 1M46A 1AJ4A 3O4YA 1AK8A 4JPZB 2WCEA 3BOWA 2M9GA 2L50A 4MZJA 2K61A 2KAVA 1RFJA 1ZMZA 2M8UA 4PCWA 2H61A 4OVNF 1H4BA 1SYMA 3AKAA 1B1GA 3I5IB 4CIDA 2BCXA 4XJKA 1FW4A 1K93D 2JPTA 1NX2A 3I5GB 1SCVA 3HX4A 2L98A 5CSFA 5HKWA 3VGOA 1C07A 1OMDA 1WRZA 2L0PA 4GAOA 3GK4X 3BYAA 1C7WA 5I2OA 4GGNA 2KOTA 4ICBA 1QX7A 1J7QA 2Y1NA 5FYXA 1EH2A 1RROA 1OQPA 1TRFA 1JC2A 1QLKA 2BCAA 1EG3A 3D0YB 2LVVA 1IGVA 4JQ0D 1BT6A 3EKHA 1MHOA 2MJWB 1ALWA 1B47A 2KYFA 4N1GA 3D0YA 4QJ3B 3KHEA 1BODA 3PM8A 3TUYB 2KQ6A 4F0ZB 5PALA 3ZWHA 1SW8A 1ZUZA 2MAZA 1IQ5A 1L2OC 2L51A 3JTDC 3I5FB 2LP3A 4MBEA 2JTTA 3LL8B 1F8HA 2WORA 4U8DA 4UPGA 1JSAA 1S3PA 1NP8A 2BKIB 5DKQA 1XFZO 1R2UA 5HKZA 2JWWA 2WC8A 1K9PA 1GJYA 2LHIA 3CGAA 3ICBA 5TNCA 3PFVA 1EJ3A 3SG2A 1DJZA 4FQOA 2LCPA 3QRXA 1QIWA 2ZFDA 1CM4A 1DJYA 3LK0A 1TN4A 1QVIY 1M31A 2BE6A 2HPSA 2JT0A 4GNKB 1NX1A 2D8NA 4CPVA 1RWYA 5K89A 4I5KA 2EC6B 4I5LB 2LNKA 1BOCA 2HQ8A 3VROA 4NQGA 2TN4A 1ALVA 1XYDA 4YGEB 1XFVO 1MR8A 1C7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSN A;  1PRW A;  1XFX O;  1OOJ A;  1UHH A;  3WHU B;  2KDH A;  4DRW A;  1CDM A;  1B7T Y;  4L9M A;  4JWQ A;  3NSI A;  5F6T A;  4QJ5 B;  5AFP A;  1B8C A;  1CB1 A;  1BU3 A;  5IBW A;  5DKR A;  5D69 A;  1HQV A;  1MWN A;  1TIZ A;  2AMI A;  1S6C A;  3CR2 A;  1LA3 A;  2H2K A;  1GGZ A;  1MQ1 A;  5CSI A;  1YVL A;  1DTL A;  4OCI A;  5GQQ C;  5HYD A;  1N2D A;  3AKB A;  2GGZ A;  4N5X A;  3GK1 A;  3PLF B;  4GGF C;  1DMO A;  1KQV A;  1DF0 A;  2CXJ A;  5DKN A;  2NCO A;  4GUK A;  1QXP A;  2O5G A;  3LLE A;  2PMY A;  4GGF A;  1KCY A;  1A75 B;  2NXQ A;  1RJV A;  3D10 A;  1SK6 D;  2KFG A;  4AQJ A;  3IQQ A;  3SG3 A;  2KI4 B;  1H8B A;  4C0J A;  4PHJ A;  4AOM A;  1A75 A;  1RK9 A;  1PVB A;  2JOJ A;  3H4S E;  2F33 A;  1K94 A;  2WOS A;  1K95 A;  1V1G A;  1SMG A;  1QVI Z;  1ZFS A;  2K7O A;  3HCM A;  4WQ2 A;  4PHM A;  1PSB A;  1DVI A;  1DJW A;  1YUR A;  1AHR A;  1LIN A;  2G9B A;  3FIA A;  4GFT A;  4D1E A;  2LP2 A;  1XO5 A;  1J7R A;  1KFX L;  2KQY A;  1CLB A;  1JWD A;  1UWO A;  1KSO A;  4ZCU A;  1CDP A;  1QV0 A;  1XK4 A;  1NCZ A;  2Q91 A;  1CDL A;  3OP0 A;  2LLS A;  5AXI A;  3VRN A;  4NDC A;  3ZNI A;  4CFQ A;  3DF0 B;  1CKK A;  1SR6 C;  1KK8 C;  1B7T Z;  1B8L A;  1K8U A;  1S5G Z;  2K7B A;  2M0R A;  1JUO A;  1BF5 A;  3FWC A;  3DVE A;  2COL B;  2H61 C;  2OS8 B;  3DF0 A;  1L7Z A;  3K21 A;  1SPY A;  1SL7 A;  1FF1 A;  3EVV A;  1XA5 A;  1WRL A;  4YGC B;  5G08 A;  5HLV A;  2KFH A;  2JZI A;  1J1D A;  1M39 A;  4NDD A;  2F3Z A;  2LAP A;  1YX8 A;  1SCM C;  3O6B A;  4MZL A;  4WQ3 A;  3RLZ A;  1JF2 A;  1WDC B;  3PSR A;  4C0K A;  1AP4 A;  2B1U A;  4MLW A;  3I5G C;  4TNC A;  2PVB A;  5KTY A;  2KGB C;  5AER A;  3AAK A;  1J1E A;  4PE0 A;  1WLZ A;  2F2P A;  1MXL C;  2ZKM X;  1KK7 Y;  3O78 A;  3OB1 B;  2L5X B;  3WHT B;  2Y4Q A;  2KYC A;  1LKJ A;  3OHM B;  3O2P A;  3CS1 A;  5BPJ A;  1NCX A;  1AJ5 A;  4M2O A;  2JTZ A;  4NDB A;  1SBJ A;  4M2Q A;  4R1E A;  2LC5 A;  1UHI A;  4PE4 A;  1W7I B;  2BBM A;  2LE9 B;  3I5F C;  4MSP A;  1QX2 A;  1SNL A;  5I2L A;  1D1O A;  1YX7 A;  4HRG A;  1BR1 B;  1ZAC A;  3CWG A;  1QS7 A;  2BE4 A;  3CR5 X;  4M2P A;  1QLS A;  2JT3 A;  4C0L A;  1CFF A;  4DUQ A;  1N65 A;  1L2O B;  1F4Q A;  2LLT A;  1K2H A;  1MUX A;  1CNP A;  1UUS A;  2HF5 A;  2A4J A;  1OZS A;  2ZN8 A;  3BUX B;  2CT9 A;  3SG5 A;  3PN7 B;  4E68 A;  2PSR A;  1IKU A;  3JVT B;  4FTG A;  3FWB A;  3TDI A;  2JQ6 A;  4HRH A;  1UP5 A;  2NCP A;  2K2A A;  5HKY A;  3OX5 A;  1CLL A;  3F45 A;  1F54 A;  2EC6 C;  1TNX A;  2K7D A;  4I5N B;  2M7L A;  4PAL A;  1JF0 A;  2KI6 C;  3I5H B;  2I7A A;  1YRT B;  1HT9 A;  1TNQ A;  2M97 A;  1BLQ A;  1KK7 Z;  4YI8 A;  1S5G Y;  1DGU A;  1IWQ A;  1G33 A;  1GQM A;  4AQI A;  1YRU B;  2CCM A;  2KI6 D;  3IF7 A;  1VRK A;  4WRI A;  1FPW A;  3BUO B;  2FCD A;  1QIV A;  2L4H A;  1BG1 A;  4YI9 A;  5J3X A;  2MBX A;  1S26 D;  2E30 A;  2LVI A;  2Y5I A;  3VRP A;  1KFX S;  2K8M B;  1KWO B;  3SJS A;  2MA2 A;  1TCF A;  1KQM C;  2M3W A;  1NCY A;  3A4U B;  2LAN A;  2LM5 A;  3TDZ A;  4YGD B;  2JC2 A;  3PAT A;  2MHH A;  4OV2 A;  2M1U A;  2DOQ A;  5JOL A;  1XFW O;  1AUI B;  1B9A A;  2HQW A;  3BQ3 A;  2KI4 C;  5ER5 A;  3TDU A;  2LMU A;  1OMR A;  4PHK A;  2K0J A;  2PAL A;  2Y1M A;  1CMG A;  3TS5 B;  1IG5 A;  2JRF A;  4PHN A;  1CFC A;  1A2X A;  1CDN A;  1REC A;  2KAX A;  5B8I B;  4MRX A;  1EG4 A;  2ISD A;  2LMT A;  3GOF A;  3WXA A;  2M49 B;  1K90 D;  1SKT A;  3LCP C;  1XK4 C;  1S36 A;  1QAS A;  1F71 A;  5I2Q A;  1NSH A;  3FS7 A;  3EKJ A;  4YRU A;  4XYN A;  3BUW B;  1DJH A;  1CMF A;  1S6J A;  3OB2 B;  5KU1 A;  1CLM A;  1EXR A;  3OX6 A;  1J7O A;  4GBA A;  2K7C A;  1R6P A;  1AVS A;  4A4B A;  4DCK A;  4N1F A;  1IJ6 A;  4Q04 A;  3LK1 A;  2FCE A;  2OTG B;  2F3Y A;  3SG7 A;  1PK0 D;  1QTX A;  1U5I B;  1XFY O;  2OS8 C;  2PAS A;  4BY4 A;  3AAJ A;  4GPL B;  1Q80 A;  1A29 A;  1LA0 A;  1S1E A;  3I5I C;  1RTP 1;  2BL0 B;  4PE1 A;  1JFK A;  2LMV A;  2ZRT A;  3NXA A;  4IL1 A;  1YVH A;  1WDC C;  5CSJ A;  1A4P A;  2GV5 A;  5AEQ A;  2WND A;  2ZNE A;  2EGD A;  1B4C A;  4DS7 A;  2I18 A;  4USL A;  4YGB B;  5I8N A;  1A03 A;  2CNP A;  2ZND A;  4XJK B;  2FJU B;  4MVF A;  5JJG A;  3CR4 X;  1SCM B;  1FI5 A;  1K9K A;  1M63 B;  1W7J B;  3NSL A;  2FOT A;  1MF8 B;  4OR9 B;  1DJX A;  3TUY C;  2EHB A;  2MLF C;  1CM1 A;  3E3R A;  5HLO A;  1KSM A;  1WRK A;  2I94 A;  2LUX A;  3BXK A;  1YUU A;  2L4I A;  1G4Y R;  2KHN A;  1OE9 B;  1J55 A;  2NZ0 A;  3PAL A;  4P5O E;  3KO0 A;  1DJI A;  2QAC A;  4ZCV A;  2WCB A;  2JUL A;  1SL8 A;  3EK4 A;  2LHL A;  1LXF C;  4I5J A;  1XFU O;  1B8R A;  4HSZ A;  3EVR A;  5KSZ A;  2RGI A;  2MLE C;  2KAY A;  3JTD B;  4CFR A;  3MSE B;  2KFF A;  1G8I A;  3DVJ A;  1YTZ C;  1CFP A;  2F8P A;  1WY9 A;  1OSA A;  2QPT A;  2I2R E;  4ORA B;  2V53 A;  2M7N A;  2M29 A;  3KF9 A;  1QV1 A;  1NX3 A;  1DJG A;  3PN7 C;  1YUS A;  3BUN B;  2AUC A;  3JVT C;  5CPV A;  4PDZ A;  1MXE A;  1TNP A;  3C1V A;  3NSO A;  2JT8 A;  2LVK A;  2SAS A;  3KPX A;  5ER4 X;  4A4C A;  2LUC A;  2KBM A;  2ZRS A;  1PSR A;  1N0Y A;  1IRJ A;  1UHN A;  4P2Y B;  2R2I A;  1TNW A;  4YGA A;  2P6B B;  1M45 A;  1F70 A;  3TZ1 A;  2CBL A;  4MEW A;  3I5H C;  4BY5 A;  1UUR A;  3IQO A;  1ODB A;  5AAN A;  1X02 A;  1CTR A;  2JXL A;  2L2E A;  2LVJ A;  1YR5 A;  1Y1X A;  2SCP A;  1V1F A;  1JFJ A;  2LV7 A;  1OZO A;  2BBN A;  1JBA A;  1Y6W A;  1QJT A;  1XVJ A;  2Q4U A;  1F55 A;  2JXC A;  3CZT X;  2PRU A;  3EK8 A;  4YBH B;  1BJF A;  4CLN A;  1Y1U A;  4ORC B;  2IS9 A;  3GK2 A;  3VRR A;  1SRA A;  1PUL A;  5D7F A;  2OPO A;  1KWO C;  3CTN A;  1DGV A;  1BR4 B;  2WCF A;  1NYA A;  2JNF A;  3VRQ A;  2F2O A;  2KGR A;  1UHJ A;  1QX5 B;  1SY9 A;  2BEC A;  3BUM B;  3SG6 A;  1LVC D;  4ETO A;  3DD4 A;  1IJ5 A;  2BCB A;  2ZN9 A;  1BMO A;  1FBV A;  1K9U A;  2E6W A;  3RM1 A;  2O60 A;  3SG4 A;  1IH0 A;  3EVU A;  2GGM A;  1DF0 B;  4MZK A;  2LLU A;  3NSK A;  2NLN A;  3TS5 C;  1KQM B;  3CLN A;  3EK7 A;  4MN0 A;  1TTX A;  2KSP A;  2MRD A;  2G2B A;  4OKH A;  1ZOT B;  1PAL A;  1KFU S;  3A8R A;  2BKH B;  1NPQ A;  1E8A A;  1NWD A;  2AAO A;  3DVM A;  1F4O A;  1J7P A;  1OMV A;  4QJ4 B;  1S6I A;  2CTN A;  1PVA A;  3SIB A;  2HET A;  1WLM A;  1TCO B;  2JNX A;  1NUB A;  1DT7 B;  1Y0V H;  2VRG A;  2KNE A;  2OTG C;  4HRE E;  1K96 A;  1SL9 A;  1CFD A;  2K2F A;  1UHK A;  1NIW A;  2M1K B;  4MRY A;  1NX0 A;  2JU0 A;  1U5I A;  1FI6 A;  1QAT A;  1TOP A;  3WNX B;  4DIR A;  1SR6 B;  2KBI A;  1EL4 A;  1KK8 B;  1KFU L;  2BL0 C;  3KEV A;  3M0W A;  4ORB B;  1GGW A;  1YUT A;  3BOW B;  1Y1A A;  3SIA A;  4PE7 A;  3DVK A;  1IQ3 A;  1M46 A;  1AJ4 A;  3O4Y A;  1AK8 A;  4JPZ B;  2WCE A;  3BOW A;  2M9G A;  2L50 A;  4MZJ A;  2K61 A;  2KAV A;  1RFJ A;  1ZMZ A;  2M8U A;  4PCW A;  2H61 A;  4OVN F;  1H4B A;  1SYM A;  3AKA A;  1B1G A;  3I5I B;  4CID A;  2BCX A;  4XJK A;  1FW4 A;  1K93 D;  2JPT A;  1NX2 A;  3I5G B;  1SCV A;  3HX4 A;  2L98 A;  5CSF A;  5HKW A;  3VGO A;  1C07 A;  1OMD A;  1WRZ A;  2L0P A;  4GAO A;  3GK4 X;  3BYA A;  1C7W A;  5I2O A;  4GGN A;  2KOT A;  4ICB A;  1QX7 A;  1J7Q A;  2Y1N A;  5FYX A;  1EH2 A;  1RRO A;  1OQP A;  1TRF A;  1JC2 A;  1QLK A;  2BCA A;  1EG3 A;  3D0Y B;  2LVV A;  1IGV A;  4JQ0 D;  1BT6 A;  3EKH A;  1MHO A;  2MJW B;  1ALW A;  1B47 A;  2KYF A;  4N1G A;  3D0Y A;  4QJ3 B;  3KHE A;  1BOD A;  3PM8 A;  3TUY B;  2KQ6 A;  4F0Z B;  5PAL A;  3ZWH A;  1SW8 A;  1ZUZ A;  2MAZ A;  1IQ5 A;  1L2O C;  2L51 A;  3JTD C;  3I5F B;  2LP3 A;  4MBE A;  2JTT A;  3LL8 B;  1F8H A;  2WOR A;  4U8D A;  4UPG A;  1JSA A;  1S3P A;  1NP8 A;  2BKI B;  5DKQ A;  1XFZ O;  1R2U A;  5HKZ A;  2JWW A;  2WC8 A;  1K9P A;  1GJY A;  2LHI A;  3CGA A;  3ICB A;  5TNC A;  3PFV A;  1EJ3 A;  3SG2 A;  1DJZ A;  4FQO A;  2LCP A;  3QRX A;  1QIW A;  2ZFD A;  1CM4 A;  1DJY A;  3LK0 A;  1TN4 A;  1QVI Y;  1M31 A;  2BE6 A;  2HPS A;  2JT0 A;  4GNK B;  1NX1 A;  2D8N A;  4CPV A;  1RWY A;  5K89 A;  4I5K A;  2EC6 B;  4I5L B;  2LNK A;  1BOC A;  2HQ8 A;  3VRO A;  4NQG A;  2TN4 A;  1ALV A;  1XYD A;  4YGE B;  1XFV O;  1MR8 A;  1C7V A; 
#chains in the Genus database with same CATH topology
 5CSN A;  3R1P A;  1PRW A;  1XFX O;  1OOJ A;  1UHH A;  3WHU B;  2KDH A;  4DRW A;  1CDM A;  1B7T Y;  4L9M A;  3R1O A;  4JWQ A;  3NSI A;  5FI7 A;  4F7F A;  3FE8 A;  5F6T A;  4QJ5 B;  5AFP A;  1B8C A;  1CB1 A;  1BU3 A;  5IBW A;  5DKR A;  5D69 A;  1HQV A;  1MWN A;  1TIZ A;  2AMI A;  1S6C A;  3CR2 A;  1LA3 A;  2H2K A;  1GGZ A;  1MQ1 A;  5CSI A;  1YVL A;  1DTL A;  4OCI A;  5GQQ C;  5HYD A;  1N2D A;  3AKB A;  2GGZ A;  2BNX A;  4N5X A;  3GK1 A;  3PLF B;  4GGF C;  1DMO A;  1KQV A;  1DF0 A;  2CXJ A;  5DKN A;  2NCO A;  4GUK A;  1QXP A;  2O5G A;  3LLE A;  2PMY A;  2WC5 A;  4GGF A;  1A75 B;  2NXQ A;  1RJV A;  3D10 A;  1SK6 D;  2KFG A;  4AQJ A;  3IQQ A;  3SG3 A;  2KI4 B;  1H8B A;  3B88 A;  4C0J A;  4PHJ A;  4AOM A;  1A75 A;  1RK9 A;  1PVB A;  2JOJ A;  3H4S E;  2F33 A;  1K94 A;  2WOS A;  3R1V A;  1K95 A;  1V1G A;  1SMG A;  1QVI Z;  1ZFS A;  2K7O A;  3CZ2 A;  2WCH A;  3DZT A;  3HCM A;  4WQ2 A;  4PHM A;  1PSB A;  1DVI A;  1DJW A;  1YUR A;  1AHR A;  1LIN A;  2G9B A;  3FIA A;  4GFT A;  4D1E A;  1DC1 A;  2LP2 A;  1XO5 A;  1J7R A;  1KFX L;  2KQY A;  1CLB A;  1JWD A;  1UWO A;  1KSO A;  4ZCU A;  1CDP A;  1QV0 A;  3NHT A;  1XK4 A;  1NCZ A;  2Q91 A;  1CDL A;  3OP0 A;  2LLS A;  5AXI A;  3VRN A;  1TUZ A;  1SSE B;  2WCK A;  4NDC A;  3QME A;  3ZNI A;  4CFQ A;  3DF0 B;  1CKK A;  1SR6 C;  1KK8 C;  1B7T Z;  1B8L A;  2WC6 A;  1K8U A;  1S5G Z;  2K7B A;  2M0R A;  2P70 A;  1JUO A;  2K60 A;  1BF5 A;  3FWC A;  3DVE A;  2COL B;  2H61 C;  2OS8 B;  3DF0 A;  1L7Z A;  3K21 A;  1SPY A;  1OOI X;  1DEL A;  1SL7 A;  3EVV A;  1XA5 A;  1WRL A;  4YGC B;  5G08 A;  5HLV A;  2KFH A;  2JZI A;  1J1D A;  1M39 A;  4NDD A;  2F3Z A;  2LAP A;  1YX8 A;  1SCM C;  3O6B A;  4MZL A;  4WQ3 A;  3RLZ A;  3RZS A;  1JF2 A;  1OOG A;  1WDC B;  3PSR A;  3D76 A;  4C0K A;  1AP4 A;  1W9Z A;  2B1U A;  4MLW A;  3I5G C;  4TNC A;  2PVB A;  5KTY A;  2KGB C;  3NHI A;  1GM0 A;  5AER A;  3AAK A;  1J1E A;  1Z2C B;  1WLZ A;  2F2P A;  4PE0 A;  1MXL C;  3O4X A;  2ZKM X;  1KK7 Y;  3O78 A;  3OB1 B;  2L5X B;  3WHT B;  2Y4Q A;  3S0D A;  2KYC A;  1LKJ A;  3OHM B;  3O2P A;  3CS1 A;  5BPJ A;  1NCX A;  1AJ5 A;  4M2O A;  1KCY A;  2JTZ A;  4NDB A;  1SBJ A;  4M2Q A;  4R1E A;  3CYZ A;  2LC5 A;  1UHI A;  4PE4 A;  1W7I B;  2BBM A;  2LE9 B;  3I5F C;  3S0E A;  1DQE A;  1QX2 A;  1XFR A;  4MSP A;  1SNL A;  5I2L A;  1D1O A;  1YX7 A;  2KLE A;  1BR1 B;  1ZAC A;  2ERB A;  4HRG A;  3CWG A;  1QS7 A;  2BE4 A;  2QEV A;  3CR5 X;  4M2P A;  1QLS A;  2JT3 A;  4C0L A;  1CFF A;  1P28 A;  1N65 A;  1L2O B;  4DUQ A;  1F4Q A;  2LLT A;  1K2H A;  1MUX A;  3L47 A;  1CNP A;  1UUS A;  3Q8I A;  3D78 A;  2HF5 A;  2A4J A;  1OZS A;  2ZN8 A;  3BUX B;  2CT9 A;  4FQT A;  3SG5 A;  3PN7 B;  3UNW A;  4E68 A;  2PSR A;  1IKU A;  3JVT B;  4FTG A;  3FWB A;  3N7H A;  2JQ6 A;  3B86 A;  3TDI A;  4HRH A;  1Z4H A;  1UP5 A;  2NCP A;  1LS8 A;  2H8V A;  2K2A A;  5HKY A;  3OX5 A;  1CLL A;  3F45 A;  1F54 A;  2EC6 C;  1TNX A;  2K7D A;  4I5N B;  2M7L A;  4PAL A;  1JF0 A;  2KI6 C;  3I5H B;  3L4A A;  2I7A A;  1YRT B;  1HT9 A;  1TNQ A;  2M97 A;  3B6X A;  1KK7 Z;  1BLQ A;  4YI8 A;  1S5G Y;  1DGU A;  1IWQ A;  1G33 A;  1GQM A;  2GTE A;  4AQI A;  1YRU B;  2CCM A;  2KI6 D;  3IF7 A;  1VRK A;  4WRI A;  1FPW A;  3BUO B;  2FCD A;  1QIV A;  2FJY A;  2L4H A;  3FE6 A;  1BG1 A;  2QEH A;  4YI9 A;  5J3X A;  2MBX A;  1S26 D;  2E30 A;  3BJH A;  2LVI A;  2Y5I A;  3VRP A;  1KFX S;  2K8M B;  1KWO B;  3SJS A;  2MA2 A;  1QWV A;  1TCF A;  1KQM C;  2M3W A;  1NCY A;  3A4U B;  2LAN A;  2LM5 A;  5FI6 A;  3TDZ A;  4YGD B;  2JC2 A;  3PAT A;  2MHH A;  4OV2 A;  2M1U A;  2DOQ A;  5JOL A;  1XFW O;  1AUI B;  1B9A A;  2HQW A;  3BQ3 A;  2KI4 C;  3S0G A;  5ER5 A;  3TDU A;  2LMU A;  1OMR A;  4PHK A;  2K0J A;  2PAL A;  2Y1M A;  1CMG A;  3TS5 B;  1IG5 A;  2JRF A;  4PHN A;  3B7A A;  1CFC A;  1A2X A;  1CDN A;  1REC A;  2KAX A;  5B8I B;  4MRX A;  1EG4 A;  1TUJ A;  2ISD A;  2LMT A;  3GOF A;  3WXA A;  2M49 B;  4KYN A;  4INX A;  1K90 D;  1SKT A;  3LCP C;  1XK4 C;  5I94 A;  1S36 A;  1QAS A;  3R72 A;  1F71 A;  5I2Q A;  1NSH A;  3FS7 A;  3EKJ A;  4YRU A;  4XYN A;  3BUW B;  1DJH A;  1CMF A;  1S6J A;  1C3Y A;  3OB2 B;  5KU1 A;  1CLM A;  1EXR A;  3OX6 A;  1J7O A;  4GBA A;  2K7C A;  1R6P A;  1AVS A;  4A4B A;  4DCK A;  4N1F A;  1IJ6 A;  3PM2 A;  4Q04 A;  3LK1 A;  2FCE A;  2WCL A;  2OTG B;  2F3Y A;  3UO9 A;  3SG7 A;  1PK0 D;  1QTX A;  1U5I B;  1XFY O;  2OS8 C;  2PAS A;  5HL1 A;  4BY4 A;  3AAJ A;  1OOH A;  4GPL B;  1Q80 A;  1A29 A;  1LA0 A;  1S1E A;  2L2C A;  3I5I C;  1RTP 1;  2BL0 B;  2WCM A;  3B87 A;  1OW4 A;  4PE1 A;  1JFK A;  2LMV A;  2ZRT A;  3NXA A;  4IL1 A;  1WDC C;  1YVH A;  5CSJ A;  1C3Z A;  1A4P A;  2GV5 A;  5AEQ A;  2WND A;  1IIO A;  2ZNE A;  2EGD A;  1B4C A;  4DS7 A;  1DEK A;  2I18 A;  4USL A;  4YGB B;  5I8N A;  1A03 A;  2CNP A;  2ZND A;  4XJK B;  2FJU B;  3DYE A;  4MVF A;  2YGU A;  5JJG A;  3CR4 X;  1SCM B;  1FI5 A;  1K9K A;  1M63 B;  1W7J B;  4IJ7 A;  3NSL A;  2FOT A;  1MF8 B;  4OR9 B;  1DJX A;  3TUY C;  2EHB A;  2MLF C;  1CM1 A;  3E3R A;  5HLO A;  1FF1 A;  1KSM A;  1WRK A;  2I94 A;  2LUX A;  3BXK A;  5DIC A;  1YUU A;  2L4I A;  1G4Y R;  3D75 A;  2KHN A;  1OE9 B;  1J55 A;  2NZ0 A;  3PAL A;  4P5O E;  4JD9 A;  3KO0 A;  1DJI A;  2QAC A;  4ZCV A;  2WCB A;  2JUL A;  1SL8 A;  3EK4 A;  2LHL A;  3D77 A;  1LXF C;  4I5J A;  1XFU O;  1B8R A;  4HSZ A;  3EVR A;  5KSZ A;  2RGI A;  2MLE C;  3SS5 A;  2KAY A;  3JTD B;  4CFR A;  3MSE B;  3CZ0 A;  2KFF A;  1G8I A;  3DVJ A;  1YTZ C;  1CFP A;  2F8P A;  1WY9 A;  1OSA A;  3D74 A;  2QPT A;  2I2R E;  3L4L A;  2V53 A;  2M7N A;  2M29 A;  3KF9 A;  1QV1 A;  4ORA B;  1NX3 A;  1DJG A;  3PN7 C;  1YUS A;  3BUN B;  2AUC A;  3JVT C;  5CPV A;  4PDZ A;  1MXE A;  1TNP A;  3C1V A;  3NSO A;  2JT8 A;  2LVK A;  2SAS A;  3KPX A;  5ER4 X;  4A4C A;  2LUC A;  2KBM A;  2ZRS A;  1PSR A;  1N0Y A;  1IRJ A;  1UHN A;  4P2Y B;  2R2I A;  1TNW A;  4YGA A;  2P6B B;  1M45 A;  1F70 A;  3TZ1 A;  2CBL A;  3S0A A;  4MEW A;  3I5H C;  4BY5 A;  1UUR A;  3IQO A;  1ODB A;  3BFB A;  5AAN A;  1X02 A;  4OZD A;  1CTR A;  2JXL A;  2L2E A;  2LVJ A;  1YR5 A;  1Y1X A;  2SCP A;  1V1F A;  1JFJ A;  2LV7 A;  1OZO A;  2BBN A;  2P71 A;  1JBA A;  1Y6W A;  1QJT A;  3SS3 A;  1XVJ A;  2Q4U A;  1F55 A;  2JXC A;  3CZT X;  2PRU A;  3EK8 A;  4YBH B;  1BJF A;  4CLN A;  1Y1U A;  4ORC B;  2IS9 A;  3GK2 A;  3VRR A;  1SRA A;  1PUL A;  5D7F A;  2OPO A;  1KWO C;  3CTN A;  1DGV A;  1BR4 B;  1OOF A;  1NYA A;  2JNF A;  2WCF A;  3VRQ A;  2F2O A;  2KGR A;  1UHJ A;  4PT1 A;  1QX5 B;  1SY9 A;  2BEC A;  3BUM B;  4JKT A;  3SG6 A;  1LVC D;  2PQL A;  4ETO A;  3DD4 A;  3VB1 A;  2WCJ A;  1IJ5 A;  2BCB A;  2ZN9 A;  3D73 A;  1BMO A;  1FBV A;  1K9U A;  3S0F A;  2E6W A;  3NGV A;  3RM1 A;  2O60 A;  3SG4 A;  1IH0 A;  1T14 A;  3K1E A;  3EVU A;  3FE9 A;  2GGM A;  1DF0 B;  4MZK A;  2LLU A;  3NSK A;  2NLN A;  3TS5 C;  1KQM B;  3CLN A;  3EK7 A;  4MN0 A;  1TTX A;  2KSP A;  2MRD A;  2G2B A;  4OKH A;  1ZOT B;  1PAL A;  1KFU S;  3A8R A;  2BKH B;  1NPQ A;  1E8A A;  1NWD A;  2AAO A;  3DVM A;  1F4O A;  1J7P A;  1OMV A;  4QJ4 B;  1S6I A;  2CTN A;  1PVA A;  3SIB A;  2QEB A;  2HET A;  1WLM A;  1TCO B;  2JNX A;  1NUB A;  1DT7 B;  1Y0V H;  2VRG A;  2KNE A;  2OTG C;  4HRE E;  1K96 A;  1SL9 A;  1CFD A;  2K2F A;  1UHK A;  1NIW A;  2M1K B;  4MRY A;  1NX0 A;  3DY9 A;  1TWO A;  2JU0 A;  1U5I A;  1FI6 A;  1QAT A;  1TOP A;  3WNX B;  4DIR A;  1SR6 B;  2KBI A;  1EL4 A;  1KK8 B;  1KFU L;  2BL0 C;  3KEV A;  3M0W A;  4ORB B;  1GGW A;  1YUT A;  3BOW B;  1Y1A A;  3SIA A;  4PE7 A;  3V2L A;  3DVK A;  1IQ3 A;  1M46 A;  1AJ4 A;  3DXL A;  3O4Y A;  3CDN A;  5D3O A;  4JPZ B;  1AK8 A;  2WCE A;  3BOW A;  2M9G A;  2L50 A;  4MZJ A;  2QDI A;  2K61 A;  2KAV A;  1RFJ A;  1ZMZ A;  2M8U A;  4PCW A;  2H61 A;  4OVN F;  1H4B A;  2KLD A;  1SYM A;  3AKA A;  1B1G A;  3I5I B;  4CID A;  2BCX A;  4XJK A;  1FW4 A;  2QEO A;  1K93 D;  2JPT A;  1NX2 A;  3I5G B;  1SCV A;  3HX4 A;  2L98 A;  5CSF A;  5HKW A;  3VGO A;  3CAB A;  1C07 A;  1OMD A;  1WRZ A;  2L0P A;  3EG5 B;  4GAO A;  3SS4 A;  3GK4 X;  3BYA A;  1C7W A;  5I2O A;  3BFH A;  2KOT A;  4GGN A;  4ICB A;  1QX7 A;  1J7Q A;  2Y1N A;  5FYX A;  1EH2 A;  1RRO A;  1OQP A;  1TRF A;  1JC2 A;  1QLK A;  2BCA A;  3OBV A;  1EG3 A;  3D0Y B;  2LVV A;  1IGV A;  4JQ0 D;  1BT6 A;  3EKH A;  1MHO A;  2MJW B;  3BFA A;  1ALW A;  1B47 A;  2KYF A;  4N1G A;  3D0Y A;  4QJ3 B;  3KHE A;  5EL2 A;  3PM8 A;  1BOD A;  3TUY B;  2KQ6 A;  3IVT A;  4F0Z B;  5PAL A;  3ZWH A;  1SW8 A;  1ZUZ A;  4INW A;  2MAZ A;  1IQ5 A;  1L2O C;  2L51 A;  3JTD C;  2L5Y A;  3I5F B;  2LP3 A;  2PYQ A;  4MBE A;  2JTT A;  3OGN A;  3LL8 B;  1F8H A;  2WOR A;  3PJI A;  4U8D A;  3S0B A;  4UPG A;  1JSA A;  1S3P A;  5FI2 A;  1NP8 A;  2JPO A;  2BKI B;  5DKQ A;  1XFZ O;  1R2U A;  5HKZ A;  2JWW A;  2WC8 A;  1K9P A;  1GJY A;  2BAP A;  2LHI A;  3CGA A;  3ICB A;  5TNC A;  3PFV A;  1EJ3 A;  3SG2 A;  1DJZ A;  4FQO A;  2LCP A;  3QRX A;  1QIW A;  2ZFD A;  1CM4 A;  1DJY A;  3LK0 A;  1TN4 A;  1QVI Y;  2KPH A;  1M31 A;  2BE6 A;  2HPS A;  2JT0 A;  4GNK B;  1NX1 A;  2D8N A;  4CPV A;  1RWY A;  5K89 A;  4I5K A;  2EC6 B;  4I5L B;  1ORG A;  2LNK A;  1BOC A;  2HQ8 A;  3VRO A;  4NQG A;  2TN4 A;  1ALV A;  1XYD A;  4YGE B;  3CZ1 A;  1XFV O;  1MR8 A;  1C7V A; 
#chains in the Genus database with same CATH homology
 5CSN A;  1PRW A;  1XFX O;  1OOJ A;  1UHH A;  3WHU B;  2KDH A;  4DRW A;  1CDM A;  1B7T Y;  4L9M A;  4JWQ A;  3NSI A;  5F6T A;  4QJ5 B;  5AFP A;  1B8C A;  1CB1 A;  1BU3 A;  5IBW A;  5DKR A;  5D69 A;  1HQV A;  1MWN A;  1TIZ A;  2AMI A;  1S6C A;  3CR2 A;  1LA3 A;  2H2K A;  1GGZ A;  1MQ1 A;  5CSI A;  1YVL A;  1DTL A;  4OCI A;  5GQQ C;  5HYD A;  1N2D A;  3AKB A;  2GGZ A;  4N5X A;  3GK1 A;  3PLF B;  4GGF C;  1DMO A;  1KQV A;  1DF0 A;  2CXJ A;  5DKN A;  2NCO A;  4GUK A;  1QXP A;  2O5G A;  3LLE A;  2PMY A;  4GGF A;  1KCY A;  1A75 B;  2NXQ A;  1RJV A;  3D10 A;  1SK6 D;  2KFG A;  4AQJ A;  3IQQ A;  3SG3 A;  2KI4 B;  1H8B A;  4C0J A;  4PHJ A;  4AOM A;  1A75 A;  1RK9 A;  1PVB A;  2JOJ A;  3H4S E;  2F33 A;  1K94 A;  2WOS A;  1K95 A;  1V1G A;  1SMG A;  1QVI Z;  1ZFS A;  2K7O A;  3HCM A;  4WQ2 A;  4PHM A;  1PSB A;  1DVI A;  1DJW A;  1YUR A;  1AHR A;  1LIN A;  2G9B A;  3FIA A;  4GFT A;  4D1E A;  2LP2 A;  1XO5 A;  1J7R A;  1KFX L;  2KQY A;  1CLB A;  1JWD A;  1UWO A;  1KSO A;  4ZCU A;  1CDP A;  1QV0 A;  1XK4 A;  1NCZ A;  2Q91 A;  1CDL A;  3OP0 A;  2LLS A;  5AXI A;  3VRN A;  4NDC A;  3ZNI A;  4CFQ A;  3DF0 B;  1CKK A;  1SR6 C;  1KK8 C;  1B7T Z;  1B8L A;  1K8U A;  1S5G Z;  2K7B A;  2M0R A;  1JUO A;  1BF5 A;  3FWC A;  3DVE A;  2COL B;  2H61 C;  2OS8 B;  3DF0 A;  1L7Z A;  3K21 A;  1SPY A;  1SL7 A;  1FF1 A;  3EVV A;  1XA5 A;  1WRL A;  4YGC B;  5G08 A;  5HLV A;  2KFH A;  2JZI A;  1J1D A;  1M39 A;  4NDD A;  2F3Z A;  2LAP A;  1YX8 A;  1SCM C;  3O6B A;  4MZL A;  4WQ3 A;  3RLZ A;  1JF2 A;  1WDC B;  3PSR A;  4C0K A;  1AP4 A;  2B1U A;  4MLW A;  3I5G C;  4TNC A;  2PVB A;  5KTY A;  2KGB C;  5AER A;  3AAK A;  1J1E A;  4PE0 A;  1WLZ A;  2F2P A;  1MXL C;  2ZKM X;  1KK7 Y;  3O78 A;  3OB1 B;  2L5X B;  3WHT B;  2Y4Q A;  2KYC A;  1LKJ A;  3OHM B;  3O2P A;  3CS1 A;  5BPJ A;  1NCX A;  1AJ5 A;  4M2O A;  2JTZ A;  4NDB A;  1SBJ A;  4M2Q A;  4R1E A;  2LC5 A;  1UHI A;  4PE4 A;  1W7I B;  2BBM A;  2LE9 B;  3I5F C;  4MSP A;  1QX2 A;  1SNL A;  5I2L A;  1D1O A;  1YX7 A;  4HRG A;  1BR1 B;  1ZAC A;  3CWG A;  1QS7 A;  2BE4 A;  3CR5 X;  4M2P A;  1QLS A;  2JT3 A;  4C0L A;  1CFF A;  4DUQ A;  1N65 A;  1L2O B;  1F4Q A;  2LLT A;  1K2H A;  1MUX A;  1CNP A;  1UUS A;  2HF5 A;  2A4J A;  1OZS A;  2ZN8 A;  3BUX B;  2CT9 A;  3SG5 A;  3PN7 B;  4E68 A;  2PSR A;  1IKU A;  3JVT B;  4FTG A;  3FWB A;  3TDI A;  2JQ6 A;  4HRH A;  1UP5 A;  2NCP A;  2K2A A;  5HKY A;  3OX5 A;  1CLL A;  3F45 A;  1F54 A;  2EC6 C;  1TNX A;  2K7D A;  4I5N B;  2M7L A;  4PAL A;  1JF0 A;  2KI6 C;  3I5H B;  2I7A A;  1YRT B;  1HT9 A;  1TNQ A;  2M97 A;  1BLQ A;  1KK7 Z;  4YI8 A;  1S5G Y;  1DGU A;  1IWQ A;  1G33 A;  1GQM A;  4AQI A;  1YRU B;  2CCM A;  2KI6 D;  3IF7 A;  1VRK A;  4WRI A;  1FPW A;  3BUO B;  2FCD A;  1QIV A;  2L4H A;  1BG1 A;  4YI9 A;  5J3X A;  2MBX A;  1S26 D;  2E30 A;  2LVI A;  2Y5I A;  3VRP A;  1KFX S;  2K8M B;  1KWO B;  3SJS A;  2MA2 A;  1TCF A;  1KQM C;  2M3W A;  1NCY A;  3A4U B;  2LAN A;  2LM5 A;  3TDZ A;  4YGD B;  2JC2 A;  3PAT A;  2MHH A;  4OV2 A;  2M1U A;  2DOQ A;  5JOL A;  1XFW O;  1AUI B;  1B9A A;  2HQW A;  3BQ3 A;  2KI4 C;  5ER5 A;  3TDU A;  2LMU A;  1OMR A;  4PHK A;  2K0J A;  2PAL A;  2Y1M A;  1CMG A;  3TS5 B;  1IG5 A;  2JRF A;  4PHN A;  1CFC A;  1A2X A;  1CDN A;  1REC A;  2KAX A;  5B8I B;  4MRX A;  1EG4 A;  2ISD A;  2LMT A;  3GOF A;  3WXA A;  2M49 B;  1K90 D;  1SKT A;  3LCP C;  1XK4 C;  1S36 A;  1QAS A;  1F71 A;  5I2Q A;  1NSH A;  3FS7 A;  3EKJ A;  4YRU A;  4XYN A;  3BUW B;  1DJH A;  1CMF A;  1S6J A;  3OB2 B;  5KU1 A;  1CLM A;  1EXR A;  3OX6 A;  1J7O A;  4GBA A;  2K7C A;  1R6P A;  1AVS A;  4A4B A;  4DCK A;  4N1F A;  1IJ6 A;  4Q04 A;  3LK1 A;  2FCE A;  2OTG B;  2F3Y A;  3SG7 A;  1PK0 D;  1QTX A;  1U5I B;  1XFY O;  2OS8 C;  2PAS A;  4BY4 A;  3AAJ A;  4GPL B;  1Q80 A;  1A29 A;  1LA0 A;  1S1E A;  3I5I C;  1RTP 1;  2BL0 B;  4PE1 A;  1JFK A;  2LMV A;  2ZRT A;  3NXA A;  4IL1 A;  1YVH A;  1WDC C;  5CSJ A;  1A4P A;  2GV5 A;  5AEQ A;  2WND A;  2ZNE A;  2EGD A;  1B4C A;  4DS7 A;  2I18 A;  4USL A;  4YGB B;  5I8N A;  1A03 A;  2CNP A;  2ZND A;  4XJK B;  2FJU B;  4MVF A;  5JJG A;  3CR4 X;  1SCM B;  1FI5 A;  1K9K A;  1M63 B;  1W7J B;  3NSL A;  2FOT A;  1MF8 B;  4OR9 B;  1DJX A;  3TUY C;  2EHB A;  2MLF C;  1CM1 A;  3E3R A;  5HLO A;  1KSM A;  1WRK A;  2I94 A;  2LUX A;  3BXK A;  1YUU A;  2L4I A;  1G4Y R;  2KHN A;  1OE9 B;  1J55 A;  2NZ0 A;  3PAL A;  4P5O E;  3KO0 A;  1DJI A;  2QAC A;  4ZCV A;  2WCB A;  2JUL A;  1SL8 A;  3EK4 A;  2LHL A;  1LXF C;  4I5J A;  1XFU O;  1B8R A;  4HSZ A;  3EVR A;  5KSZ A;  2RGI A;  2MLE C;  2KAY A;  3JTD B;  4CFR A;  3MSE B;  2KFF A;  1G8I A;  3DVJ A;  1YTZ C;  1CFP A;  2F8P A;  1WY9 A;  1OSA A;  2QPT A;  2I2R E;  4ORA B;  2V53 A;  2M7N A;  2M29 A;  3KF9 A;  1QV1 A;  1NX3 A;  1DJG A;  3PN7 C;  1YUS A;  3BUN B;  2AUC A;  3JVT C;  5CPV A;  4PDZ A;  1MXE A;  1TNP A;  3C1V A;  3NSO A;  2JT8 A;  2LVK A;  2SAS A;  3KPX A;  5ER4 X;  4A4C A;  2LUC A;  2KBM A;  2ZRS A;  1PSR A;  1N0Y A;  1IRJ A;  1UHN A;  4P2Y B;  2R2I A;  1TNW A;  4YGA A;  2P6B B;  1M45 A;  1F70 A;  3TZ1 A;  2CBL A;  4MEW A;  3I5H C;  4BY5 A;  1UUR A;  3IQO A;  1ODB A;  5AAN A;  1X02 A;  1CTR A;  2JXL A;  2L2E A;  2LVJ A;  1YR5 A;  1Y1X A;  2SCP A;  1V1F A;  1JFJ A;  2LV7 A;  1OZO A;  2BBN A;  1JBA A;  1Y6W A;  1QJT A;  1XVJ A;  2Q4U A;  1F55 A;  2JXC A;  3CZT X;  2PRU A;  3EK8 A;  4YBH B;  1BJF A;  4CLN A;  1Y1U A;  4ORC B;  2IS9 A;  3GK2 A;  3VRR A;  1SRA A;  1PUL A;  5D7F A;  2OPO A;  1KWO C;  3CTN A;  1DGV A;  1BR4 B;  2WCF A;  1NYA A;  2JNF A;  3VRQ A;  2F2O A;  2KGR A;  1UHJ A;  1QX5 B;  1SY9 A;  2BEC A;  3BUM B;  3SG6 A;  1LVC D;  4ETO A;  3DD4 A;  1IJ5 A;  2BCB A;  2ZN9 A;  1BMO A;  1FBV A;  1K9U A;  2E6W A;  3RM1 A;  2O60 A;  3SG4 A;  1IH0 A;  3EVU A;  2GGM A;  1DF0 B;  4MZK A;  2LLU A;  3NSK A;  2NLN A;  3TS5 C;  1KQM B;  3CLN A;  3EK7 A;  4MN0 A;  1TTX A;  2KSP A;  2MRD A;  2G2B A;  4OKH A;  1ZOT B;  1PAL A;  1KFU S;  3A8R A;  2BKH B;  1NPQ A;  1E8A A;  1NWD A;  2AAO A;  3DVM A;  1F4O A;  1J7P A;  1OMV A;  4QJ4 B;  1S6I A;  2CTN A;  1PVA A;  3SIB A;  2HET A;  1WLM A;  1TCO B;  2JNX A;  1NUB A;  1DT7 B;  1Y0V H;  2VRG A;  2KNE A;  2OTG C;  4HRE E;  1K96 A;  1SL9 A;  1CFD A;  2K2F A;  1UHK A;  1NIW A;  2M1K B;  4MRY A;  1NX0 A;  2JU0 A;  1U5I A;  1FI6 A;  1QAT A;  1TOP A;  3WNX B;  4DIR A;  1SR6 B;  2KBI A;  1EL4 A;  1KK8 B;  1KFU L;  2BL0 C;  3KEV A;  3M0W A;  4ORB B;  1GGW A;  1YUT A;  3BOW B;  1Y1A A;  3SIA A;  4PE7 A;  3DVK A;  1IQ3 A;  1M46 A;  1AJ4 A;  3O4Y A;  1AK8 A;  4JPZ B;  2WCE A;  3BOW A;  2M9G A;  2L50 A;  4MZJ A;  2K61 A;  2KAV A;  1RFJ A;  1ZMZ A;  2M8U A;  4PCW A;  2H61 A;  4OVN F;  1H4B A;  1SYM A;  3AKA A;  1B1G A;  3I5I B;  4CID A;  2BCX A;  4XJK A;  1FW4 A;  1K93 D;  2JPT A;  1NX2 A;  3I5G B;  1SCV A;  3HX4 A;  2L98 A;  5CSF A;  5HKW A;  3VGO A;  1C07 A;  1OMD A;  1WRZ A;  2L0P A;  4GAO A;  3GK4 X;  3BYA A;  1C7W A;  5I2O A;  4GGN A;  2KOT A;  4ICB A;  1QX7 A;  1J7Q A;  2Y1N A;  5FYX A;  1EH2 A;  1RRO A;  1OQP A;  1TRF A;  1JC2 A;  1QLK A;  2BCA A;  1EG3 A;  3D0Y B;  2LVV A;  1IGV A;  4JQ0 D;  1BT6 A;  3EKH A;  1MHO A;  2MJW B;  1ALW A;  1B47 A;  2KYF A;  4N1G A;  3D0Y A;  4QJ3 B;  3KHE A;  1BOD A;  3PM8 A;  3TUY B;  2KQ6 A;  4F0Z B;  5PAL A;  3ZWH A;  1SW8 A;  1ZUZ A;  2MAZ A;  1IQ5 A;  1L2O C;  2L51 A;  3JTD C;  3I5F B;  2LP3 A;  4MBE A;  2JTT A;  3LL8 B;  1F8H A;  2WOR A;  4U8D A;  4UPG A;  1JSA A;  1S3P A;  1NP8 A;  2BKI B;  5DKQ A;  1XFZ O;  1R2U A;  5HKZ A;  2JWW A;  2WC8 A;  1K9P A;  1GJY A;  2LHI A;  3CGA A;  3ICB A;  5TNC A;  3PFV A;  1EJ3 A;  3SG2 A;  1DJZ A;  4FQO A;  2LCP A;  3QRX A;  1QIW A;  2ZFD A;  1CM4 A;  1DJY A;  3LK0 A;  1TN4 A;  1QVI Y;  1M31 A;  2BE6 A;  2HPS A;  2JT0 A;  4GNK B;  1NX1 A;  2D8N A;  4CPV A;  1RWY A;  5K89 A;  4I5K A;  2EC6 B;  4I5L B;  2LNK A;  1BOC A;  2HQ8 A;  3VRO A;  4NQG A;  2TN4 A;  1ALV A;  1XYD A;  4YGE B;  1XFV O;  1MR8 A;  1C7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...