2M97A

Optimized ratiometric calcium sensors for functional in vivo imaging of neurons and t-lymphocytes
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
b'SEEELSECFRIFDKDGNGFIDREEFGDIIRLTGEQLTDEDVDEIFGDSDTDKNGRIDFDEFLKMMENVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Optimized Ratiometric Calcium Sensor
publication title Optimized ratiometric calcium sensors for functional in vivo imaging of neurons and T lymphocytes.
pubmed doi rcsb
source organism Opsanus tau
molecule tags Metal binding protein
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2m97A00
1QIVA 1CTRA 1Y1XA 2WCFA 3BOWB 4XJKB 1SPYA 3NXAA 2DOQA 1J7RA 1SR6B 1UHHA 1XFYO 2JU0A 2BE6A 5I8NA 3CGAA 2LCPA 3I5FC 3VRNA 2LANA 1RWYA 1DJXA 1AK8A 1OZOA 1NX0A 5CSJA 1PSBA 1AP4A 4PCWA 2KI6C 1F70A 1RROA 2D8NA 2O60A 1SCVA 1YRTB 2PASA 4MRYA 1OQPA 2M49B 4CFRA 2LVJA 3VGOA 1X02A 1DJWA 4IL1A 3OP0A 3MSEB 4DRWA 3SJSA 1N0YA 3DD4A 3I5IB 1A2XA 2TN4A 3BOWA 2ZFDA 4XJKA 1E8AA 4C0LA 2L5XB 2K2FA 1FI5A 5J3XA 1DJIA 2KBMA 2CCMA 3PFVA 1SMGA 1DF0A 1JC2A 1KFXS 1BT6A 3DVMA 3PATA 4A4CA 4FQOA 1G33A 1UWOA 1EJ3A 2E30A 2I18A 4JQ0D 2EC6C 1S6CA 2NZ0A 2ZKMX 2PSRA 2MAZA 3CR2A 4WRIA 1SCMC 3BUWB 2LVKA 2OTGB 4MN0A 4P5OE 1M45A 1CDPA 3F45A 3OX5A 1W7IB 3TDZA 1NCYA 1S5GZ 1UHIA 2CT9A 1YR5A 1BOCA 2BCAA 2GV5A 2V53A 2ZNDA 1CM4A 1WDCC 3H4SE 3PLFB 2SASA 1JSAA 2JXLA 1IRJA 2O5GA 1SYMA 1QS7A 3HX4A 4USLA 1K95A 1GGZA 2MA2A 3SG6A 2LNKA 3OB1B 3EK4A 1A75A 2ZRTA 1DJGA 1KWOB 1XVJA 2KBIA 1XK4A 5HLOA 3WHUB 4GGFA 5CSNA 1MWNA 3OX6A 3BUMB 1KSMA 4CPVA 2KNEA 1NSHA 1V1GA 2EHBA 2F3YA 4GAOA 4CIDA 2KAXA 2KYFA 3TZ1A 2KFFA 4HREE 1LXFC 4DIRA 4YI9A 3SG7A 1KK8B 1WY9A 3K21A 4P2YB 1QASA 3ICBA 3OHMB 1K8UA 2B1UA 2K7DA 2BKIB 2LE9B 1QATA 5CPVA 4C0JA 2KGRA 5I2QA 2BKHB 3EKJA 4HSZA 1C07A 3CS1A 5IBWA 1DGUA 1UP5A 4F0ZB 1DMOA 2KI4C 1SL9A 1ZMZA 1K2HA 3BYAA 5HKYA 4C0KA 1XA5A 2CNPA 4PHMA 4ICBA 4ZCVA 1YX7A 1SNLA 1DJYA 1K94A 3JTDC 4M2PA 4N1GA 2LP2A 1B8CA 1TNQA 1SW8A 1K9KA 3D0YB 1YRUB 4MRXA 4ORCB 3A4UB 4ETOA 2KI6D 1CLLA 4BY4A 5HYDA 1J7PA 1FI6A 1W7JB 4ZCUA 3VRPA 2WCEA 3LK0A 2ZNEA 2COLB 1PULA 1GJYA 3KHEA 3AAJA 4M2OA 3LLEA 2BE4A 1OMVA 1KFUL 1TCOB 3I5HC 1GQMA 2HPSA 1KK7Z 4N1FA 4MVFA 3DVKA 1J55A 4OVNF 1Y0VH 2QPTA 2LMTA 1DVIA 3EVVA 4AOMA 2F2OA 2ZN8A 1M63B 1L2OC 2JPTA 4N5XA 4E68A 1BR4B 1K90D 3AKAA 3GK1A 4YGCB 3BUNB 1A03A 2KAVA 1MUXA 2I94A 2LMVA 3CTNA 5KTYA 1J7OA 2EGDA 1OMRA 3JVTC 3EVUA 1NWDA 2JRFA 1F4QA 2L4HA 1YVHA 1XYDA 1BR1B 2F8PA 4WQ2A 1CMGA 1NCXA 2HQWA 5FYXA 3IF7A 4I5JA 2BCXA 4YRUA 1PVAA 5HLVA 2R2IA 2RGIA 4YGBB 2QACA 3C1VA 1LKJA 1B1GA 4MLWA 1MR8A 1BJFA 2EC6B 1BU3A 1DTLA 1SCMB 2JT8A 1B9AA 1YUSA 2Y1MA 2LHLA 5AANA 1B8LA 1QX2A 3WXAA 1Q80A 1KQMC 2JWWA 4L9MA 4NDCA 3DF0B 1LVCD 3CWGA 1WDCB 4A4BA 3KF9A 2ZRSA 1AUIB 1RTP1 1PRWA 1K9UA 2AUCA 2GGMA 2KYCA 1S36A 2M29A 2K7CA 2Q4UA 2KFHA 2L4IA 2P6BB 1IGVA 3I5GC 4WQ3A 3BQ3A 4YBHB 4BY5A 1F55A 1UHNA 2K2AA 3GK2A 3NSLA 3WHTB 1TNPA 3NSIA 3FWBA 2LP3A 1KCYA 1IKUA 1QX5B 1SL7A 2JT0A 3ZWHA 4NQGA 1M31A 1OZSA 4MZJA 4YI8A 4OV2A 2OPOA 4MEWA 1CDLA 1MXEA 3FWCA 2JOJA 2HF5A 2KGBC 1A4PA 3BUOB 1QVIZ 2FOTA 1JFJA 1PK0D 1TOPA 2KOTA 5DKRA 4FTGA 2WC8A 1M39A 2Y5IA 1SY9A 2KI4B 2HQ8A 2LHIA 5AERA 1BF5A 1NX3A 1UHKA 1LA3A 5D69A 5HKZA 4NDBA 1S3PA 1ODBA 2BBMA 3JTDB 3EK7A 1K96A 3IQQA 3TDIA 2L0PA 3PN7C 3SG3A 3D10A 1S6IA 2L98A 2M9GA 4Q04A 1IQ5A 2JNFA 1B47A 2K7BA 2MRDA 1ALWA 1YUUA 4M2QA 1IJ5A 3TS5C 3PALA 3CLNA 3I5HB 2MLEC 1JF0A 3RM1A 3BXKA 2JNXA 5BPJA 1H4BA 4I5NB 1EL4A 1OSAA 3FIAA 4GBAA 1L2OB 3LCPC 1WLZA 3LK1A 1CFFA 3JVTB 5JJGA 4GGFC 1WRLA 1DJHA 4AQJA 1IQ3A 1J7QA 1K9PA 4PE0A 3RLZA 2LMUA 4YGDB 3E3RA 4MZKA 2OS8B 4OKHA 2LM5A 3VROA 2FCDA 2WNDA 2G9BA 2KAYA 2MBXA 3WNXB 1DJZA 1KFXL 2M97A 2JT3A 4I5LB 4NDDA 3GK4X 1S5GY 4OCIA 1AJ4A 3EVRA 2SCPA 1SKTA 3LL8B 4DCKA 2NXQA 3NSOA 3SG4A 1R2UA 1NX1A 1B7TZ 2LLSA 4GUKA 2M8UA 2M3WA 2CTNA 2Y1NA 3SIAA 1UURA 4PHNA 2L51A 2PMYA 1H8BA 3CR4X 1KQMB 3O78A 5CSIA 3O6BA 1J1EA 3AKBA 3D0YA 4MZLA 1F8HA 1RJVA 2F2PA 2H61C 3KEVA 3O2PA 1PVBA 3I5GB 1YX8A 4TNCA 2K8MB 4I5KA 1DT7B 1JBAA 1K93D 1PALA 2OS8C 3KO0A 2NLNA 5JOLA 3BUXB 1C7WA 1R6PA 5I2LA 5DKNA 1S26D 4PHJA 1TNWA 4PHKA 5B8IB 4ORBB 1EH2A 4PALA 1ZACA 2JC2A 1LINA 5KU1A 1YVLA 2PVBA 1JUOA 1QV1A 1NPQA 1JWDA 3CR5X 2KDHA 2M0RA 1KSOA 1UUSA 2NCPA 4PE1A 1C7VA 2AMIA 1NIWA 1S1EA 3KPXA 2I7AA 3PSRA 4CFQA 5ER4X 1BLQA 1XFUO 3SIBA 1PSRA 2BECA 3NSKA 5ER5A 4D1EA 1WLMA 4PDZA 3PM8A 1OE9B 1CFPA 1RFJA 2JULA 1WRZA 3TDUA 1DF0B 1CM1A 1ZUZA 1UHJA 1TIZA 4YGEB 5AEQA 3PN7B 2CXJA 1KK7Y 1L7ZA 3OB2B 2L2EA 1NP8A 4YGAA 1F71A 1B7TY 1BODA 1AVSA 2E6WA 1G4YR 2BL0C 2A4JA 2IS9A 2KQYA 1OMDA 2LLTA 5K89A 1MF8B 3DF0A 3SG2A 5PALA 2CBLA 2ISDA 1M46A 4DS7A 3TS5B 4PE7A 5D7FA 1Y1AA 2NCOA 1QV0A 2JTZA 2G2BA 1A29A 2KQ6A 5KSZA 1GGWA 4GPLB 2AAOA 2JZIA 1A75B 2BCBA 1WRKA 5DKQA 1TRFA 1CLBA 1SR6C 1QXPA 1TTXA 1RECA 1B8RA 3SG5A 1KFUS 2I2RE 1AJ5A 1V1FA 4U8DA 1CFDA 1QLSA 1XFXO 2LUXA 4JWQA 3GOFA 1BG1A 4MSPA 4XYNA 1QLKA 5HKWA 1CMFA 1JFKA 1DGVA 2WOSA 1SRAA 1FBVA 1FW4A 2VRGA 5GQQC 2LUCA 1EG3A 1VRKA 1FPWA 2GGZA 1U5IB 2JTTA 4OR9B 1D1OA 1EXRA 1ZFSA 1TNXA 2LC5A 4GNKB 2LAPA 2Q91A 4MBEA 3I5IC 1IG5A 1MHOA 2MJWB 1JF2A 2BBNA 3HCMA 1N65A 3DVEA 1QX7A 2M7NA 2KHNA 1IH0A 1CDMA 1N2DA 1XO5A 2LVVA 5G08A 1OOJA 2KSPA 5CSFA 1XK4C 5AFPA 1F54A 4HRHA 2L50A 1B4CA 2OTGC 1BMOA 1TN4A 1AHRA 1NCZA 2K0JA 5AXIA 1CB1A 3M0WA 1U5IA 4PE4A 2KFGA 2FJUB 3ZNIA 1MXLC 2MLFC 5TNCA 3TUYB 1NUBA 1QVIY 1YTZC 4QJ3B 4DUQA 2K61A 4GGNA 2JQ6A 1CNPA 1RK9A 3CZTX 3O4YA 2FCEA 1QTXA 2LVIA 4HRGA 1KWOC 3FS7A 2M1KB 2Y4QA 1KQVA 1YUTA 1Y6WA 1XFWO 1CDNA 1EG4A 1QIWA 2WCBA 4R1EA 3A8RA 2JXCA 2H61A 3AAKA 2HETA 1HQVA 1MQ1A 1S6JA 1Y1UA 4QJ4B 1TCFA 3DVJA 1J1DA 1SL8A 1KK8C 2WORA 2ZN9A 1NX2A 1XFVO 5I2OA 4GFTA 1QJTA 1CLMA 2H2KA 3VRRA 1IJ6A 1IWQA 3EK8A 2LV7A 4AQIA 1CKKA 3EKHA 1YURA 3I5FB 3QRXA 5F6TA 2M1UA 4UPGA 1HT9A 3TUYC 1NYAA 2PALA 1SK6D 2M7LA 1LA0A 2PRUA 4ORAB 4QJ5B 1CFCA 2LLUA 2BL0B 2MHHA 1SBJA 2F3ZA 4JPZB 1FF1A 3IQOA 1XFZO 1F4OA 1ZOTB 1ALVA 2K7OA 3VRQA 2F33A 1G8IA 4CLNA
chains in the Genus database with same CATH superfamily
1QIVA 1CTRA 1Y1XA 2WCFA 3BOWB 4XJKB 1SPYA 3NXAA 2DOQA 1J7RA 4JKTA 1SR6B 1UHHA 3SS5A 1XFYO 2JU0A 2BE6A 5I8NA 2L2CA 2LCPA 3CGAA 2QDIA 3I5FC 3VRNA 2LANA 1RWYA 1DJXA 2WCMA 1AK8A 1OZOA 1NX0A 3RZSA 5CSJA 1PSBA 1AP4A 4PCWA 2KI6C 1F70A 1RROA 2D8NA 2O60A 1SCVA 1YRTB 2PASA 4MRYA 1OQPA 4KYNA 2M49B 4CFRA 2LVJA 3VGOA 1X02A 1DJWA 4IL1A 3OP0A 3MSEB 4DRWA 3SJSA 1N0YA 2WCKA 3DD4A 3I5IB 1A2XA 2TN4A 3BOWA 3D74A 2ZFDA 4XJKA 4INWA 1E8AA 3S0EA 4C0LA 2L5XB 2K2FA 3DZTA 5J3XA 1FI5A 1DJIA 2KBMA 2CCMA 3PFVA 1SMGA 1DF0A 1JC2A 1KFXS 1BT6A 3DVMA 3PATA 4A4CA 4FQOA 1G33A 1UWOA 1EJ3A 5HL1A 2E30A 2I18A 4JQ0D 2EC6C 1S6CA 2NZ0A 2ZKMX 2PSRA 2MAZA 3CR2A 4WRIA 1SCMC 3BUWB 2LVKA 2OTGB 4MN0A 4P5OE 1M45A 1CDPA 3F45A 3OX5A 1W7IB 3TDZA 1NCYA 1S5GZ 1UHIA 2CT9A 3BFHA 1YR5A 3R72A 1BOCA 2BCAA 2GV5A 2V53A 2ZNDA 1CM4A 1WDCC 3H4SE 3PLFB 2SASA 4IJ7A 1JSAA 2JXLA 1IRJA 2O5GA 1OOHA 1SYMA 2KPHA 1QS7A 3HX4A 4USLA 1K95A 1GGZA 2MA2A 3SG6A 2LNKA 3OB1B 3EK4A 1A75A 2ZRTA 1DJGA 1KWOB 1XVJA 2KBIA 1ORGA 1XK4A 3PJIA 5HLOA 3WHUB 4GGFA 4OZDA 5CSNA 1MWNA 3OX6A 3BUMB 1KSMA 4CPVA 2KNEA 1NSHA 1V1GA 2EHBA 2F3YA 4GAOA 4CIDA 2KAXA 2KYFA 3TZ1A 2KFFA 4HREE 1LXFC 3DY9A 4DIRA 4YI9A 3SG7A 1KK8B 1WY9A 3K21A 4P2YB 1QASA 3CZ2A 3ICBA 3OHMB 1K8UA 2B1UA 2K7DA 2BKIB 2LE9B 1QATA 5CPVA 4C0JA 2KGRA 5I2QA 2BKHB 3EKJA 4HSZA 1C07A 3CS1A 5IBWA 1DGUA 1UP5A 3K1EA 4F0ZB 1DMOA 2KI4C 2P70A 1SL9A 1ZMZA 3FE8A 1K2HA 3BYAA 1DELA 5HKYA 4C0KA 3D77A 1XA5A 2CNPA 4PHMA 4ICBA 4ZCVA 1YX7A 1SNLA 4JD9A 1DJYA 1K94A 3JTDC 4M2PA 4N1GA 1OW4A 2LP2A 1B8CA 1TNQA 1SW8A 1K9KA 3D0YB 1YRUB 4MRXA 4ORCB 3A4UB 4ETOA 2KI6D 1CLLA 4BY4A 5HYDA 1J7PA 1FI6A 1W7JB 4ZCUA 3VRPA 2WCEA 3LK0A 2ZNEA 2COLB 1PULA 2QEHA 1GJYA 3CDNA 3KHEA 3AAJA 4M2OA 3LLEA 2BE4A 1OMVA 1KFUL 1TCOB 4E68A 3I5HC 1GQMA 2HPSA 1KK7Z 3D76A 4N1FA 3D78A 1J55A 3DVKA 4MVFA 2H8VA 4OVNF 1Y0VH 2QPTA 2LMTA 1XFRA 1TUJA 1TWOA 1DVIA 3EVVA 2WCJA 4AOMA 2F2OA 2ZN8A 1M63B 1L2OC 2JPTA 2WCHA 3FE6A 1BR4B 4N5XA 1K90D 3AKAA 3GK1A 4YGCB 3BUNB 1A03A 2KAVA 1MUXA 2I94A 2LMVA 3CTNA 5KTYA 1J7OA 2EGDA 1OMRA 3JVTC 3EVUA 1NWDA 2JRFA 3BFBA 3B7AA 1F4QA 2L4HA 3L4AA 1YVHA 1XYDA 1BR1B 2F8PA 2PYQA 4WQ2A 1CMGA 1NCXA 2HQWA 5FYXA 3IF7A 4I5JA 2BCXA 3B86A 1PVAA 5HLVA 2R2IA 2RGIA 4YRUA 4YGBB 2QACA 3C1VA 1LKJA 1B1GA 3CYZA 4MLWA 1MR8A 1BJFA 2EC6B 4INXA 1Z4HA 1BU3A 1DTLA 1SCMB 2JT8A 1B9AA 1YUSA 2Y1MA 2LHLA 2ERBA 1B8LA 5AANA 1QX2A 3WXAA 1Q80A 1KQMC 2JWWA 4L9MA 4NDCA 3DF0B 1LVCD 2JPOA 2PQLA 3CWGA 1WDCB 1SSEB 3BFAA 3KF9A 2ZRSA 4A4BA 1AUIB 1RTP1 1PRWA 1K9UA 2AUCA 2GGMA 2KYCA 1S36A 2M29A 2K7CA 2Q4UA 2KFHA 2L4IA 2P6BB 1IGVA 3I5GC 4WQ3A 3BQ3A 4YBHB 4BY5A 1F55A 1UHNA 2K2AA 3GK2A 3NSLA 3WHTB 1TNPA 3NSIA 3UO9A 3FWBA 2LP3A 1KCYA 1IKUA 1QX5B 1T14A 1SL7A 2JT0A 5FI2A 3ZWHA 4NQGA 1M31A 1OZSA 4MZJA 4YI8A 1QWVA 3IVTA 2QEOA 4OV2A 2OPOA 4MEWA 1CDLA 1MXEA 1OOGA 3FWCA 2JOJA 2WCLA 3PM2A 2HF5A 2KGBC 1A4PA 3BUOB 1QVIZ 2FOTA 3S0BA 1JFJA 1PK0D 1TOPA 2KOTA 2GTEA 5DKRA 4FTGA 2WC8A 1M39A 2Y5IA 1SY9A 2YGUA 2KI4B 2HQ8A 2LHIA 5AERA 1IIOA 1DQEA 1BF5A 1NX3A 1UHKA 1LA3A 5D69A 5HKZA 4NDBA 1S3PA 1ODBA 2BBMA 3JTDB 3EK7A 1K96A 3IQQA 3TDIA 2L0PA 3PN7C 3SG3A 1GM0A 3D10A 1S6IA 2L98A 2M9GA 4Q04A 1IQ5A 2JNFA 2P71A 1B47A 2K7BA 2MRDA 1ALWA 1YUUA 4M2QA 1IJ5A 3TS5C 3PALA 3CLNA 3I5HB 2MLEC 1JF0A 3CZ1A 3RM1A 3BXKA 3CABA 1TUZA 2JNXA 5BPJA 1H4BA 4I5NB 1EL4A 1OSAA 3FIAA 3O4XA 4GBAA 1L2OB 1C3ZA 3LCPC 1WLZA 3LK1A 1CFFA 3JVTB 5JJGA 4GGFC 1WRLA 1DJHA 4AQJA 1IQ3A 1J7QA 1K9PA 4PE0A 3RLZA 2LMUA 4YGDB 3E3RA 4MZKA 2OS8B 4OKHA 2LM5A 3VROA 2FCDA 3VB1A 2WNDA 2G9BA 2KAYA 2MBXA 3WNXB 1DJZA 3B6XA 1KFXL 2M97A 2JT3A 3Q8IA 3OGNA 3R1PA 4I5LB 4NDDA 3GK4X 3S0DA 1S5GY 4OCIA 1AJ4A 3EVRA 2SCPA 1SKTA 3BJHA 3LL8B 2NXQA 4DCKA 3NSOA 3SG4A 1R2UA 1NX1A 1B7TZ 2LLSA 2WC6A 4GUKA 2WC5A 2M8UA 3B88A 2M3WA 2CTNA 2Y1NA 3SIAA 1UURA 4PHNA 2L51A 2PMYA 1H8BA 3CR4X 1KQMB 3O78A 5CSIA 3O6BA 1J1EA 3AKBA 3D0YA 4MZLA 3UNWA 1RJVA 1F8HA 2F2PA 2H61C 3KEVA 1P28A 3O2PA 1PVBA 3I5GB 1YX8A 4TNCA 2K8MB 4I5KA 1DT7B 1JBAA 1K93D 1PALA 2OS8C 3KO0A 2NLNA 5JOLA 3BUXB 1C7WA 1R6PA 3B87A 5DICA 5I2LA 5DKNA 1S26D 4PHJA 5EL2A 1TNWA 4PHKA 5B8IB 4ORBB 1EH2A 4PALA 1ZACA 2JC2A 1LINA 5KU1A 1YVLA 4F7FA 2PVBA 1JUOA 1QV1A 1NPQA 1JWDA 3CR5X 2KDHA 2M0RA 1KSOA 1UUSA 2QEVA 2NCPA 4PE1A 3S0GA 1C7VA 2AMIA 1NIWA 1S1EA 3KPXA 2I7AA 3PSRA 4CFQA 5ER4X 1BLQA 1XFUO 3SIBA 1PSRA 2BECA 2FJYA 2KLDA 3NSKA 5ER5A 4D1EA 1WLMA 4PDZA 3PM8A 1OE9B 1CFPA 1RFJA 2JULA 1WRZA 3TDUA 1DF0B 1CM1A 1ZUZA 1UHJA 1TIZA 4YGEB 5AEQA 3PN7B 1C3YA 2CXJA 1KK7Y 1L7ZA 1LS8A 3OB2B 2L2EA 1NP8A 3S0AA 4YGAA 1F71A 1B7TY 3SS3A 1AVSA 1BODA 2E6WA 1G4YR 2BL0C 2A4JA 2IS9A 2KQYA 1OMDA 2LLTA 5K89A 1MF8B 5D3OA 3DF0A 3SG2A 5PALA 2CBLA 2ISDA 1M46A 4DS7A 3TS5B 4PE7A 5D7FA 1Y1AA 5FI6A 3DYEA 2NCOA 1QV0A 2JTZA 2G2BA 1A29A 3R1OA 2KQ6A 5KSZA 1GGWA 4GPLB 2AAOA 2JZIA 1A75B 2BCBA 1WRKA 5DKQA 1TRFA 1CLBA 1SR6C 1QXPA 1TTXA 1RECA 1B8RA 3SG5A 1KFUS 2BAPA 1AJ5A 1V1FA 2I2RE 4U8DA 1CFDA 3SS4A 1QLSA 3NHIA 1XFXO 2LUXA 4JWQA 3GOFA 1BG1A 4MSPA 4XYNA 1QLKA 5HKWA 1CMFA 1JFKA 1DGVA 2WOSA 1SRAA 1FBVA 1FW4A 2VRGA 5GQQC 2LUCA 1EG3A 1VRKA 1FPWA 2GGZA 1U5IB 2JTTA 4OR9B 1D1OA 1EXRA 1ZFSA 1TNXA 2LC5A 4GNKB 3V2LA 2LAPA 2Q91A 4MBEA 3I5IC 1IG5A 1MHOA 2MJWB 1JF2A 2BBNA 3HCMA 1N65A 4PT1A 3DVEA 1DC1A 1QX7A 2M7NA 2KHNA 1IH0A 1W9ZA 1CDMA 1N2DA 1XO5A 3EG5B 2LVVA 5G08A 1OOJA 2KSPA 5CSFA 1XK4C 5AFPA 3NHTA 1F54A 4HRHA 2L50A 1B4CA 2OTGC 3S0FA 1BMOA 3L47A 1TN4A 1AHRA 1NCZA 2K0JA 5AXIA 2L5YA 1CB1A 3M0WA 1U5IA 4PE4A 2KFGA 2FJUB 3ZNIA 1MXLC 2MLFC 5TNCA 3TUYB 1DEKA 2BNXA 1NUBA 1QVIY 1YTZC 4QJ3B 4DUQA 2K61A 5FI7A 3NGVA 4GGNA 2JQ6A 1CNPA 1RK9A 3CZTX 3O4YA 2FCEA 1QTXA 3D75A 2K60A 2LVIA 4HRGA 1KWOC 1OOFA 3FS7A 2M1KB 2Y4QA 3L4LA 1KQVA 1YUTA 1Y6WA 1XFWO 1CDNA 1EG4A 1QIWA 2WCBA 4R1EA 3A8RA 2JXCA 5I94A 2H61A 3AAKA 2HETA 1HQVA 1MQ1A 1S6JA 3QMEA 1Y1UA 3FE9A 4QJ4B 1TCFA 3DVJA 1J1DA 1SL8A 1KK8C 2WORA 2ZN9A 1NX2A 1XFVO 5I2OA 3DXLA 1QJTA 1CLMA 2H2KA 4GFTA 3VRRA 1IJ6A 1IWQA 3EK8A 2KLEA 2LV7A 4AQIA 1CKKA 3EKHA 1YURA 3I5FB 3QRXA 5F6TA 2M1UA 4UPGA 1HT9A 3TUYC 1NYAA 2PALA 1SK6D 2M7LA 1LA0A 2PRUA 3D73A 3N7HA 4ORAB 4QJ5B 1CFCA 2LLUA 2BL0B 2MHHA 1SBJA 1Z2CB 2F3ZA 4JPZB 3CZ0A 3IQOA 1FF1A 1XFZO 4FQTA 3R1VA 1OOIX 1F4OA 1ZOTB 3OBVA 1ALVA 2K7OA 2QEBA 2F33A 1G8IA 3VRQA 4CLNA
chains in the Genus database with same CATH topology
1QIVA 1CTRA 1Y1XA 2WCFA 3BOWB 4XJKB 1SPYA 3NXAA 2DOQA 1J7RA 1SR6B 1UHHA 1XFYO 2JU0A 2BE6A 5I8NA 3CGAA 2LCPA 3I5FC 3VRNA 2LANA 1RWYA 1DJXA 1AK8A 1OZOA 1NX0A 5CSJA 1PSBA 1AP4A 4PCWA 2KI6C 1F70A 1RROA 2D8NA 2O60A 1SCVA 1YRTB 2PASA 4MRYA 1OQPA 2M49B 4CFRA 2LVJA 3VGOA 1X02A 1DJWA 4IL1A 3OP0A 3MSEB 4DRWA 3SJSA 1N0YA 3DD4A 3I5IB 1A2XA 2TN4A 3BOWA 2ZFDA 4XJKA 1E8AA 4C0LA 2L5XB 2K2FA 1FI5A 5J3XA 1DJIA 2KBMA 2CCMA 3PFVA 1SMGA 1DF0A 1JC2A 1KFXS 1BT6A 3DVMA 3PATA 4A4CA 4FQOA 1G33A 1UWOA 1EJ3A 2E30A 2I18A 4JQ0D 2EC6C 1S6CA 2NZ0A 2ZKMX 2PSRA 2MAZA 3CR2A 4WRIA 1SCMC 3BUWB 2LVKA 2OTGB 4MN0A 4P5OE 1M45A 1CDPA 3F45A 3OX5A 1W7IB 3TDZA 1NCYA 1S5GZ 1UHIA 2CT9A 1YR5A 1BOCA 2BCAA 2GV5A 2V53A 2ZNDA 1CM4A 1WDCC 3H4SE 3PLFB 2SASA 1JSAA 2JXLA 1IRJA 2O5GA 1SYMA 1QS7A 3HX4A 4USLA 1K95A 1GGZA 2MA2A 3SG6A 2LNKA 3OB1B 3EK4A 1A75A 2ZRTA 1DJGA 1KWOB 1XVJA 2KBIA 1XK4A 5HLOA 3WHUB 4GGFA 5CSNA 1MWNA 3OX6A 3BUMB 1KSMA 4CPVA 2KNEA 1NSHA 1V1GA 2EHBA 2F3YA 4GAOA 4CIDA 2KAXA 2KYFA 3TZ1A 2KFFA 4HREE 1LXFC 4DIRA 4YI9A 3SG7A 1KK8B 1WY9A 3K21A 4P2YB 1QASA 3ICBA 3OHMB 1K8UA 2B1UA 2K7DA 2BKIB 2LE9B 1QATA 5CPVA 4C0JA 2KGRA 5I2QA 2BKHB 3EKJA 4HSZA 1C07A 3CS1A 5IBWA 1DGUA 1UP5A 4F0ZB 1DMOA 2KI4C 1SL9A 1ZMZA 1K2HA 3BYAA 5HKYA 4C0KA 1XA5A 2CNPA 4PHMA 4ICBA 4ZCVA 1YX7A 1SNLA 1DJYA 1K94A 3JTDC 4M2PA 4N1GA 2LP2A 1B8CA 1TNQA 1SW8A 1K9KA 3D0YB 1YRUB 4MRXA 4ORCB 3A4UB 4ETOA 2KI6D 1CLLA 4BY4A 5HYDA 1J7PA 1FI6A 1W7JB 4ZCUA 3VRPA 2WCEA 3LK0A 2ZNEA 2COLB 1PULA 1GJYA 3KHEA 3AAJA 4M2OA 3LLEA 2BE4A 1OMVA 1KFUL 1TCOB 3I5HC 1GQMA 2HPSA 1KK7Z 4N1FA 4MVFA 3DVKA 1J55A 4OVNF 1Y0VH 2QPTA 2LMTA 1DVIA 3EVVA 4AOMA 2F2OA 2ZN8A 1M63B 1L2OC 2JPTA 4N5XA 4E68A 1BR4B 1K90D 3AKAA 3GK1A 4YGCB 3BUNB 1A03A 2KAVA 1MUXA 2I94A 2LMVA 3CTNA 5KTYA 1J7OA 2EGDA 1OMRA 3JVTC 3EVUA 1NWDA 2JRFA 1F4QA 2L4HA 1YVHA 1XYDA 1BR1B 2F8PA 4WQ2A 1CMGA 1NCXA 2HQWA 5FYXA 3IF7A 4I5JA 2BCXA 4YRUA 1PVAA 5HLVA 2R2IA 2RGIA 4YGBB 2QACA 3C1VA 1LKJA 1B1GA 4MLWA 1MR8A 1BJFA 2EC6B 1BU3A 1DTLA 1SCMB 2JT8A 1B9AA 1YUSA 2Y1MA 2LHLA 5AANA 1B8LA 1QX2A 3WXAA 1Q80A 1KQMC 2JWWA 4L9MA 4NDCA 3DF0B 1LVCD 3CWGA 1WDCB 4A4BA 3KF9A 2ZRSA 1AUIB 1RTP1 1PRWA 1K9UA 2AUCA 2GGMA 2KYCA 1S36A 2M29A 2K7CA 2Q4UA 2KFHA 2L4IA 2P6BB 1IGVA 3I5GC 4WQ3A 3BQ3A 4YBHB 4BY5A 1F55A 1UHNA 2K2AA 3GK2A 3NSLA 3WHTB 1TNPA 3NSIA 3FWBA 2LP3A 1KCYA 1IKUA 1QX5B 1SL7A 2JT0A 3ZWHA 4NQGA 1M31A 1OZSA 4MZJA 4YI8A 4OV2A 2OPOA 4MEWA 1CDLA 1MXEA 3FWCA 2JOJA 2HF5A 2KGBC 1A4PA 3BUOB 1QVIZ 2FOTA 1JFJA 1PK0D 1TOPA 2KOTA 5DKRA 4FTGA 2WC8A 1M39A 2Y5IA 1SY9A 2KI4B 2HQ8A 2LHIA 5AERA 1BF5A 1NX3A 1UHKA 1LA3A 5D69A 5HKZA 4NDBA 1S3PA 1ODBA 2BBMA 3JTDB 3EK7A 1K96A 3IQQA 3TDIA 2L0PA 3PN7C 3SG3A 3D10A 1S6IA 2L98A 2M9GA 4Q04A 1IQ5A 2JNFA 1B47A 2K7BA 2MRDA 1ALWA 1YUUA 4M2QA 1IJ5A 3TS5C 3PALA 3CLNA 3I5HB 2MLEC 1JF0A 3RM1A 3BXKA 2JNXA 5BPJA 1H4BA 4I5NB 1EL4A 1OSAA 3FIAA 4GBAA 1L2OB 3LCPC 1WLZA 3LK1A 1CFFA 3JVTB 5JJGA 4GGFC 1WRLA 1DJHA 4AQJA 1IQ3A 1J7QA 1K9PA 4PE0A 3RLZA 2LMUA 4YGDB 3E3RA 4MZKA 2OS8B 4OKHA 2LM5A 3VROA 2FCDA 2WNDA 2G9BA 2KAYA 2MBXA 3WNXB 1DJZA 1KFXL 2M97A 2JT3A 4I5LB 4NDDA 3GK4X 1S5GY 4OCIA 1AJ4A 3EVRA 2SCPA 1SKTA 3LL8B 4DCKA 2NXQA 3NSOA 3SG4A 1R2UA 1NX1A 1B7TZ 2LLSA 4GUKA 2M8UA 2M3WA 2CTNA 2Y1NA 3SIAA 1UURA 4PHNA 2L51A 2PMYA 1H8BA 3CR4X 1KQMB 3O78A 5CSIA 3O6BA 1J1EA 3AKBA 3D0YA 4MZLA 1F8HA 1RJVA 2F2PA 2H61C 3KEVA 3O2PA 1PVBA 3I5GB 1YX8A 4TNCA 2K8MB 4I5KA 1DT7B 1JBAA 1K93D 1PALA 2OS8C 3KO0A 2NLNA 5JOLA 3BUXB 1C7WA 1R6PA 5I2LA 5DKNA 1S26D 4PHJA 1TNWA 4PHKA 5B8IB 4ORBB 1EH2A 4PALA 1ZACA 2JC2A 1LINA 5KU1A 1YVLA 2PVBA 1JUOA 1QV1A 1NPQA 1JWDA 3CR5X 2KDHA 2M0RA 1KSOA 1UUSA 2NCPA 4PE1A 1C7VA 2AMIA 1NIWA 1S1EA 3KPXA 2I7AA 3PSRA 4CFQA 5ER4X 1BLQA 1XFUO 3SIBA 1PSRA 2BECA 3NSKA 5ER5A 4D1EA 1WLMA 4PDZA 3PM8A 1OE9B 1CFPA 1RFJA 2JULA 1WRZA 3TDUA 1DF0B 1CM1A 1ZUZA 1UHJA 1TIZA 4YGEB 5AEQA 3PN7B 2CXJA 1KK7Y 1L7ZA 3OB2B 2L2EA 1NP8A 4YGAA 1F71A 1B7TY 1BODA 1AVSA 2E6WA 1G4YR 2BL0C 2A4JA 2IS9A 2KQYA 1OMDA 2LLTA 5K89A 1MF8B 3DF0A 3SG2A 5PALA 2CBLA 2ISDA 1M46A 4DS7A 3TS5B 4PE7A 5D7FA 1Y1AA 2NCOA 1QV0A 2JTZA 2G2BA 1A29A 2KQ6A 5KSZA 1GGWA 4GPLB 2AAOA 2JZIA 1A75B 2BCBA 1WRKA 5DKQA 1TRFA 1CLBA 1SR6C 1QXPA 1TTXA 1RECA 1B8RA 3SG5A 1KFUS 2I2RE 1AJ5A 1V1FA 4U8DA 1CFDA 1QLSA 1XFXO 2LUXA 4JWQA 3GOFA 1BG1A 4MSPA 4XYNA 1QLKA 5HKWA 1CMFA 1JFKA 1DGVA 2WOSA 1SRAA 1FBVA 1FW4A 2VRGA 5GQQC 2LUCA 1EG3A 1VRKA 1FPWA 2GGZA 1U5IB 2JTTA 4OR9B 1D1OA 1EXRA 1ZFSA 1TNXA 2LC5A 4GNKB 2LAPA 2Q91A 4MBEA 3I5IC 1IG5A 1MHOA 2MJWB 1JF2A 2BBNA 3HCMA 1N65A 3DVEA 1QX7A 2M7NA 2KHNA 1IH0A 1CDMA 1N2DA 1XO5A 2LVVA 5G08A 1OOJA 2KSPA 5CSFA 1XK4C 5AFPA 1F54A 4HRHA 2L50A 1B4CA 2OTGC 1BMOA 1TN4A 1AHRA 1NCZA 2K0JA 5AXIA 1CB1A 3M0WA 1U5IA 4PE4A 2KFGA 2FJUB 3ZNIA 1MXLC 2MLFC 5TNCA 3TUYB 1NUBA 1QVIY 1YTZC 4QJ3B 4DUQA 2K61A 4GGNA 2JQ6A 1CNPA 1RK9A 3CZTX 3O4YA 2FCEA 1QTXA 2LVIA 4HRGA 1KWOC 3FS7A 2M1KB 2Y4QA 1KQVA 1YUTA 1Y6WA 1XFWO 1CDNA 1EG4A 1QIWA 2WCBA 4R1EA 3A8RA 2JXCA 2H61A 3AAKA 2HETA 1HQVA 1MQ1A 1S6JA 1Y1UA 4QJ4B 1TCFA 3DVJA 1J1DA 1SL8A 1KK8C 2WORA 2ZN9A 1NX2A 1XFVO 5I2OA 4GFTA 1QJTA 1CLMA 2H2KA 3VRRA 1IJ6A 1IWQA 3EK8A 2LV7A 4AQIA 1CKKA 3EKHA 1YURA 3I5FB 3QRXA 5F6TA 2M1UA 4UPGA 1HT9A 3TUYC 1NYAA 2PALA 1SK6D 2M7LA 1LA0A 2PRUA 4ORAB 4QJ5B 1CFCA 2LLUA 2BL0B 2MHHA 1SBJA 2F3ZA 4JPZB 1FF1A 3IQOA 1XFZO 1F4OA 1ZOTB 1ALVA 2K7OA 3VRQA 2F33A 1G8IA 4CLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QIV A;  1CTR A;  1Y1X A;  2WCF A;  3BOW B;  4XJK B;  1SPY A;  3NXA A;  2DOQ A;  1J7R A;  1SR6 B;  1UHH A;  1XFY O;  2JU0 A;  2BE6 A;  5I8N A;  3CGA A;  2LCP A;  3I5F C;  3VRN A;  2LAN A;  1RWY A;  1DJX A;  1AK8 A;  1OZO A;  1NX0 A;  5CSJ A;  1PSB A;  1AP4 A;  4PCW A;  2KI6 C;  1F70 A;  1RRO A;  2D8N A;  2O60 A;  1SCV A;  1YRT B;  2PAS A;  4MRY A;  1OQP A;  2M49 B;  4CFR A;  2LVJ A;  3VGO A;  1X02 A;  1DJW A;  4IL1 A;  3OP0 A;  3MSE B;  4DRW A;  3SJS A;  1N0Y A;  3DD4 A;  3I5I B;  1A2X A;  2TN4 A;  3BOW A;  2ZFD A;  4XJK A;  1E8A A;  4C0L A;  2L5X B;  2K2F A;  1FI5 A;  5J3X A;  1DJI A;  2KBM A;  2CCM A;  3PFV A;  1SMG A;  1DF0 A;  1JC2 A;  1KFX S;  1BT6 A;  3DVM A;  3PAT A;  4A4C A;  4FQO A;  1G33 A;  1UWO A;  1EJ3 A;  2E30 A;  2I18 A;  4JQ0 D;  2EC6 C;  1S6C A;  2NZ0 A;  2ZKM X;  2PSR A;  2MAZ A;  3CR2 A;  4WRI A;  1SCM C;  3BUW B;  2LVK A;  2OTG B;  4MN0 A;  4P5O E;  1M45 A;  1CDP A;  3F45 A;  3OX5 A;  1W7I B;  3TDZ A;  1NCY A;  1S5G Z;  1UHI A;  2CT9 A;  1YR5 A;  1BOC A;  2BCA A;  2GV5 A;  2V53 A;  2ZND A;  1CM4 A;  1WDC C;  3H4S E;  3PLF B;  2SAS A;  1JSA A;  2JXL A;  1IRJ A;  2O5G A;  1SYM A;  1QS7 A;  3HX4 A;  4USL A;  1K95 A;  1GGZ A;  2MA2 A;  3SG6 A;  2LNK A;  3OB1 B;  3EK4 A;  1A75 A;  2ZRT A;  1DJG A;  1KWO B;  1XVJ A;  2KBI A;  1XK4 A;  5HLO A;  3WHU B;  4GGF A;  5CSN A;  1MWN A;  3OX6 A;  3BUM B;  1KSM A;  4CPV A;  2KNE A;  1NSH A;  1V1G A;  2EHB A;  2F3Y A;  4GAO A;  4CID A;  2KAX A;  2KYF A;  3TZ1 A;  2KFF A;  4HRE E;  1LXF C;  4DIR A;  4YI9 A;  3SG7 A;  1KK8 B;  1WY9 A;  3K21 A;  4P2Y B;  1QAS A;  3ICB A;  3OHM B;  1K8U A;  2B1U A;  2K7D A;  2BKI B;  2LE9 B;  1QAT A;  5CPV A;  4C0J A;  2KGR A;  5I2Q A;  2BKH B;  3EKJ A;  4HSZ A;  1C07 A;  3CS1 A;  5IBW A;  1DGU A;  1UP5 A;  4F0Z B;  1DMO A;  2KI4 C;  1SL9 A;  1ZMZ A;  1K2H A;  3BYA A;  5HKY A;  4C0K A;  1XA5 A;  2CNP A;  4PHM A;  4ICB A;  4ZCV A;  1YX7 A;  1SNL A;  1DJY A;  1K94 A;  3JTD C;  4M2P A;  4N1G A;  2LP2 A;  1B8C A;  1TNQ A;  1SW8 A;  1K9K A;  3D0Y B;  1YRU B;  4MRX A;  4ORC B;  3A4U B;  4ETO A;  2KI6 D;  1CLL A;  4BY4 A;  5HYD A;  1J7P A;  1FI6 A;  1W7J B;  4ZCU A;  3VRP A;  2WCE A;  3LK0 A;  2ZNE A;  2COL B;  1PUL A;  1GJY A;  3KHE A;  3AAJ A;  4M2O A;  3LLE A;  2BE4 A;  1OMV A;  1KFU L;  1TCO B;  3I5H C;  1GQM A;  2HPS A;  1KK7 Z;  4N1F A;  4MVF A;  3DVK A;  1J55 A;  4OVN F;  1Y0V H;  2QPT A;  2LMT A;  1DVI A;  3EVV A;  4AOM A;  2F2O A;  2ZN8 A;  1M63 B;  1L2O C;  2JPT A;  4N5X A;  4E68 A;  1BR4 B;  1K90 D;  3AKA A;  3GK1 A;  4YGC B;  3BUN B;  1A03 A;  2KAV A;  1MUX A;  2I94 A;  2LMV A;  3CTN A;  5KTY A;  1J7O A;  2EGD A;  1OMR A;  3JVT C;  3EVU A;  1NWD A;  2JRF A;  1F4Q A;  2L4H A;  1YVH A;  1XYD A;  1BR1 B;  2F8P A;  4WQ2 A;  1CMG A;  1NCX A;  2HQW A;  5FYX A;  3IF7 A;  4I5J A;  2BCX A;  4YRU A;  1PVA A;  5HLV A;  2R2I A;  2RGI A;  4YGB B;  2QAC A;  3C1V A;  1LKJ A;  1B1G A;  4MLW A;  1MR8 A;  1BJF A;  2EC6 B;  1BU3 A;  1DTL A;  1SCM B;  2JT8 A;  1B9A A;  1YUS A;  2Y1M A;  2LHL A;  5AAN A;  1B8L A;  1QX2 A;  3WXA A;  1Q80 A;  1KQM C;  2JWW A;  4L9M A;  4NDC A;  3DF0 B;  1LVC D;  3CWG A;  1WDC B;  4A4B A;  3KF9 A;  2ZRS A;  1AUI B;  1RTP 1;  1PRW A;  1K9U A;  2AUC A;  2GGM A;  2KYC A;  1S36 A;  2M29 A;  2K7C A;  2Q4U A;  2KFH A;  2L4I A;  2P6B B;  1IGV A;  3I5G C;  4WQ3 A;  3BQ3 A;  4YBH B;  4BY5 A;  1F55 A;  1UHN A;  2K2A A;  3GK2 A;  3NSL A;  3WHT B;  1TNP A;  3NSI A;  3FWB A;  2LP3 A;  1KCY A;  1IKU A;  1QX5 B;  1SL7 A;  2JT0 A;  3ZWH A;  4NQG A;  1M31 A;  1OZS A;  4MZJ A;  4YI8 A;  4OV2 A;  2OPO A;  4MEW A;  1CDL A;  1MXE A;  3FWC A;  2JOJ A;  2HF5 A;  2KGB C;  1A4P A;  3BUO B;  1QVI Z;  2FOT A;  1JFJ A;  1PK0 D;  1TOP A;  2KOT A;  5DKR A;  4FTG A;  2WC8 A;  1M39 A;  2Y5I A;  1SY9 A;  2KI4 B;  2HQ8 A;  2LHI A;  5AER A;  1BF5 A;  1NX3 A;  1UHK A;  1LA3 A;  5D69 A;  5HKZ A;  4NDB A;  1S3P A;  1ODB A;  2BBM A;  3JTD B;  3EK7 A;  1K96 A;  3IQQ A;  3TDI A;  2L0P A;  3PN7 C;  3SG3 A;  3D10 A;  1S6I A;  2L98 A;  2M9G A;  4Q04 A;  1IQ5 A;  2JNF A;  1B47 A;  2K7B A;  2MRD A;  1ALW A;  1YUU A;  4M2Q A;  1IJ5 A;  3TS5 C;  3PAL A;  3CLN A;  3I5H B;  2MLE C;  1JF0 A;  3RM1 A;  3BXK A;  2JNX A;  5BPJ A;  1H4B A;  4I5N B;  1EL4 A;  1OSA A;  3FIA A;  4GBA A;  1L2O B;  3LCP C;  1WLZ A;  3LK1 A;  1CFF A;  3JVT B;  5JJG A;  4GGF C;  1WRL A;  1DJH A;  4AQJ A;  1IQ3 A;  1J7Q A;  1K9P A;  4PE0 A;  3RLZ A;  2LMU A;  4YGD B;  3E3R A;  4MZK A;  2OS8 B;  4OKH A;  2LM5 A;  3VRO A;  2FCD A;  2WND A;  2G9B A;  2KAY A;  2MBX A;  3WNX B;  1DJZ A;  1KFX L;  2M97 A;  2JT3 A;  4I5L B;  4NDD A;  3GK4 X;  1S5G Y;  4OCI A;  1AJ4 A;  3EVR A;  2SCP A;  1SKT A;  3LL8 B;  4DCK A;  2NXQ A;  3NSO A;  3SG4 A;  1R2U A;  1NX1 A;  1B7T Z;  2LLS A;  4GUK A;  2M8U A;  2M3W A;  2CTN A;  2Y1N A;  3SIA A;  1UUR A;  4PHN A;  2L51 A;  2PMY A;  1H8B A;  3CR4 X;  1KQM B;  3O78 A;  5CSI A;  3O6B A;  1J1E A;  3AKB A;  3D0Y A;  4MZL A;  1F8H A;  1RJV A;  2F2P A;  2H61 C;  3KEV A;  3O2P A;  1PVB A;  3I5G B;  1YX8 A;  4TNC A;  2K8M B;  4I5K A;  1DT7 B;  1JBA A;  1K93 D;  1PAL A;  2OS8 C;  3KO0 A;  2NLN A;  5JOL A;  3BUX B;  1C7W A;  1R6P A;  5I2L A;  5DKN A;  1S26 D;  4PHJ A;  1TNW A;  4PHK A;  5B8I B;  4ORB B;  1EH2 A;  4PAL A;  1ZAC A;  2JC2 A;  1LIN A;  5KU1 A;  1YVL A;  2PVB A;  1JUO A;  1QV1 A;  1NPQ A;  1JWD A;  3CR5 X;  2KDH A;  2M0R A;  1KSO A;  1UUS A;  2NCP A;  4PE1 A;  1C7V A;  2AMI A;  1NIW A;  1S1E A;  3KPX A;  2I7A A;  3PSR A;  4CFQ A;  5ER4 X;  1BLQ A;  1XFU O;  3SIB A;  1PSR A;  2BEC A;  3NSK A;  5ER5 A;  4D1E A;  1WLM A;  4PDZ A;  3PM8 A;  1OE9 B;  1CFP A;  1RFJ A;  2JUL A;  1WRZ A;  3TDU A;  1DF0 B;  1CM1 A;  1ZUZ A;  1UHJ A;  1TIZ A;  4YGE B;  5AEQ A;  3PN7 B;  2CXJ A;  1KK7 Y;  1L7Z A;  3OB2 B;  2L2E A;  1NP8 A;  4YGA A;  1F71 A;  1B7T Y;  1BOD A;  1AVS A;  2E6W A;  1G4Y R;  2BL0 C;  2A4J A;  2IS9 A;  2KQY A;  1OMD A;  2LLT A;  5K89 A;  1MF8 B;  3DF0 A;  3SG2 A;  5PAL A;  2CBL A;  2ISD A;  1M46 A;  4DS7 A;  3TS5 B;  4PE7 A;  5D7F A;  1Y1A A;  2NCO A;  1QV0 A;  2JTZ A;  2G2B A;  1A29 A;  2KQ6 A;  5KSZ A;  1GGW A;  4GPL B;  2AAO A;  2JZI A;  1A75 B;  2BCB A;  1WRK A;  5DKQ A;  1TRF A;  1CLB A;  1SR6 C;  1QXP A;  1TTX A;  1REC A;  1B8R A;  3SG5 A;  1KFU S;  2I2R E;  1AJ5 A;  1V1F A;  4U8D A;  1CFD A;  1QLS A;  1XFX O;  2LUX A;  4JWQ A;  3GOF A;  1BG1 A;  4MSP A;  4XYN A;  1QLK A;  5HKW A;  1CMF A;  1JFK A;  1DGV A;  2WOS A;  1SRA A;  1FBV A;  1FW4 A;  2VRG A;  5GQQ C;  2LUC A;  1EG3 A;  1VRK A;  1FPW A;  2GGZ A;  1U5I B;  2JTT A;  4OR9 B;  1D1O A;  1EXR A;  1ZFS A;  1TNX A;  2LC5 A;  4GNK B;  2LAP A;  2Q91 A;  4MBE A;  3I5I C;  1IG5 A;  1MHO A;  2MJW B;  1JF2 A;  2BBN A;  3HCM A;  1N65 A;  3DVE A;  1QX7 A;  2M7N A;  2KHN A;  1IH0 A;  1CDM A;  1N2D A;  1XO5 A;  2LVV A;  5G08 A;  1OOJ A;  2KSP A;  5CSF A;  1XK4 C;  5AFP A;  1F54 A;  4HRH A;  2L50 A;  1B4C A;  2OTG C;  1BMO A;  1TN4 A;  1AHR A;  1NCZ A;  2K0J A;  5AXI A;  1CB1 A;  3M0W A;  1U5I A;  4PE4 A;  2KFG A;  2FJU B;  3ZNI A;  1MXL C;  2MLF C;  5TNC A;  3TUY B;  1NUB A;  1QVI Y;  1YTZ C;  4QJ3 B;  4DUQ A;  2K61 A;  4GGN A;  2JQ6 A;  1CNP A;  1RK9 A;  3CZT X;  3O4Y A;  2FCE A;  1QTX A;  2LVI A;  4HRG A;  1KWO C;  3FS7 A;  2M1K B;  2Y4Q A;  1KQV A;  1YUT A;  1Y6W A;  1XFW O;  1CDN A;  1EG4 A;  1QIW A;  2WCB A;  4R1E A;  3A8R A;  2JXC A;  2H61 A;  3AAK A;  2HET A;  1HQV A;  1MQ1 A;  1S6J A;  1Y1U A;  4QJ4 B;  1TCF A;  3DVJ A;  1J1D A;  1SL8 A;  1KK8 C;  2WOR A;  2ZN9 A;  1NX2 A;  1XFV O;  5I2O A;  4GFT A;  1QJT A;  1CLM A;  2H2K A;  3VRR A;  1IJ6 A;  1IWQ A;  3EK8 A;  2LV7 A;  4AQI A;  1CKK A;  3EKH A;  1YUR A;  3I5F B;  3QRX A;  5F6T A;  2M1U A;  4UPG A;  1HT9 A;  3TUY C;  1NYA A;  2PAL A;  1SK6 D;  2M7L A;  1LA0 A;  2PRU A;  4ORA B;  4QJ5 B;  1CFC A;  2LLU A;  2BL0 B;  2MHH A;  1SBJ A;  2F3Z A;  4JPZ B;  1FF1 A;  3IQO A;  1XFZ O;  1F4O A;  1ZOT B;  1ALV A;  2K7O A;  3VRQ A;  2F33 A;  1G8I A;  4CLN A; 
#chains in the Genus database with same CATH topology
 1QIV A;  1CTR A;  1Y1X A;  2WCF A;  3BOW B;  4XJK B;  1SPY A;  3NXA A;  2DOQ A;  1J7R A;  4JKT A;  1SR6 B;  1UHH A;  3SS5 A;  1XFY O;  2JU0 A;  2BE6 A;  5I8N A;  2L2C A;  2LCP A;  3CGA A;  2QDI A;  3I5F C;  3VRN A;  2LAN A;  1RWY A;  1DJX A;  2WCM A;  1AK8 A;  1OZO A;  1NX0 A;  3RZS A;  5CSJ A;  1PSB A;  1AP4 A;  4PCW A;  2KI6 C;  1F70 A;  1RRO A;  2D8N A;  2O60 A;  1SCV A;  1YRT B;  2PAS A;  4MRY A;  1OQP A;  4KYN A;  2M49 B;  4CFR A;  2LVJ A;  3VGO A;  1X02 A;  1DJW A;  4IL1 A;  3OP0 A;  3MSE B;  4DRW A;  3SJS A;  1N0Y A;  2WCK A;  3DD4 A;  3I5I B;  1A2X A;  2TN4 A;  3BOW A;  3D74 A;  2ZFD A;  4XJK A;  4INW A;  1E8A A;  3S0E A;  4C0L A;  2L5X B;  2K2F A;  3DZT A;  5J3X A;  1FI5 A;  1DJI A;  2KBM A;  2CCM A;  3PFV A;  1SMG A;  1DF0 A;  1JC2 A;  1KFX S;  1BT6 A;  3DVM A;  3PAT A;  4A4C A;  4FQO A;  1G33 A;  1UWO A;  1EJ3 A;  5HL1 A;  2E30 A;  2I18 A;  4JQ0 D;  2EC6 C;  1S6C A;  2NZ0 A;  2ZKM X;  2PSR A;  2MAZ A;  3CR2 A;  4WRI A;  1SCM C;  3BUW B;  2LVK A;  2OTG B;  4MN0 A;  4P5O E;  1M45 A;  1CDP A;  3F45 A;  3OX5 A;  1W7I B;  3TDZ A;  1NCY A;  1S5G Z;  1UHI A;  2CT9 A;  3BFH A;  1YR5 A;  3R72 A;  1BOC A;  2BCA A;  2GV5 A;  2V53 A;  2ZND A;  1CM4 A;  1WDC C;  3H4S E;  3PLF B;  2SAS A;  4IJ7 A;  1JSA A;  2JXL A;  1IRJ A;  2O5G A;  1OOH A;  1SYM A;  2KPH A;  1QS7 A;  3HX4 A;  4USL A;  1K95 A;  1GGZ A;  2MA2 A;  3SG6 A;  2LNK A;  3OB1 B;  3EK4 A;  1A75 A;  2ZRT A;  1DJG A;  1KWO B;  1XVJ A;  2KBI A;  1ORG A;  1XK4 A;  3PJI A;  5HLO A;  3WHU B;  4GGF A;  4OZD A;  5CSN A;  1MWN A;  3OX6 A;  3BUM B;  1KSM A;  4CPV A;  2KNE A;  1NSH A;  1V1G A;  2EHB A;  2F3Y A;  4GAO A;  4CID A;  2KAX A;  2KYF A;  3TZ1 A;  2KFF A;  4HRE E;  1LXF C;  3DY9 A;  4DIR A;  4YI9 A;  3SG7 A;  1KK8 B;  1WY9 A;  3K21 A;  4P2Y B;  1QAS A;  3CZ2 A;  3ICB A;  3OHM B;  1K8U A;  2B1U A;  2K7D A;  2BKI B;  2LE9 B;  1QAT A;  5CPV A;  4C0J A;  2KGR A;  5I2Q A;  2BKH B;  3EKJ A;  4HSZ A;  1C07 A;  3CS1 A;  5IBW A;  1DGU A;  1UP5 A;  3K1E A;  4F0Z B;  1DMO A;  2KI4 C;  2P70 A;  1SL9 A;  1ZMZ A;  3FE8 A;  1K2H A;  3BYA A;  1DEL A;  5HKY A;  4C0K A;  3D77 A;  1XA5 A;  2CNP A;  4PHM A;  4ICB A;  4ZCV A;  1YX7 A;  1SNL A;  4JD9 A;  1DJY A;  1K94 A;  3JTD C;  4M2P A;  4N1G A;  1OW4 A;  2LP2 A;  1B8C A;  1TNQ A;  1SW8 A;  1K9K A;  3D0Y B;  1YRU B;  4MRX A;  4ORC B;  3A4U B;  4ETO A;  2KI6 D;  1CLL A;  4BY4 A;  5HYD A;  1J7P A;  1FI6 A;  1W7J B;  4ZCU A;  3VRP A;  2WCE A;  3LK0 A;  2ZNE A;  2COL B;  1PUL A;  2QEH A;  1GJY A;  3CDN A;  3KHE A;  3AAJ A;  4M2O A;  3LLE A;  2BE4 A;  1OMV A;  1KFU L;  1TCO B;  4E68 A;  3I5H C;  1GQM A;  2HPS A;  1KK7 Z;  3D76 A;  4N1F A;  3D78 A;  1J55 A;  3DVK A;  4MVF A;  2H8V A;  4OVN F;  1Y0V H;  2QPT A;  2LMT A;  1XFR A;  1TUJ A;  1TWO A;  1DVI A;  3EVV A;  2WCJ A;  4AOM A;  2F2O A;  2ZN8 A;  1M63 B;  1L2O C;  2JPT A;  2WCH A;  3FE6 A;  1BR4 B;  4N5X A;  1K90 D;  3AKA A;  3GK1 A;  4YGC B;  3BUN B;  1A03 A;  2KAV A;  1MUX A;  2I94 A;  2LMV A;  3CTN A;  5KTY A;  1J7O A;  2EGD A;  1OMR A;  3JVT C;  3EVU A;  1NWD A;  2JRF A;  3BFB A;  3B7A A;  1F4Q A;  2L4H A;  3L4A A;  1YVH A;  1XYD A;  1BR1 B;  2F8P A;  2PYQ A;  4WQ2 A;  1CMG A;  1NCX A;  2HQW A;  5FYX A;  3IF7 A;  4I5J A;  2BCX A;  3B86 A;  1PVA A;  5HLV A;  2R2I A;  2RGI A;  4YRU A;  4YGB B;  2QAC A;  3C1V A;  1LKJ A;  1B1G A;  3CYZ A;  4MLW A;  1MR8 A;  1BJF A;  2EC6 B;  4INX A;  1Z4H A;  1BU3 A;  1DTL A;  1SCM B;  2JT8 A;  1B9A A;  1YUS A;  2Y1M A;  2LHL A;  2ERB A;  1B8L A;  5AAN A;  1QX2 A;  3WXA A;  1Q80 A;  1KQM C;  2JWW A;  4L9M A;  4NDC A;  3DF0 B;  1LVC D;  2JPO A;  2PQL A;  3CWG A;  1WDC B;  1SSE B;  3BFA A;  3KF9 A;  2ZRS A;  4A4B A;  1AUI B;  1RTP 1;  1PRW A;  1K9U A;  2AUC A;  2GGM A;  2KYC A;  1S36 A;  2M29 A;  2K7C A;  2Q4U A;  2KFH A;  2L4I A;  2P6B B;  1IGV A;  3I5G C;  4WQ3 A;  3BQ3 A;  4YBH B;  4BY5 A;  1F55 A;  1UHN A;  2K2A A;  3GK2 A;  3NSL A;  3WHT B;  1TNP A;  3NSI A;  3UO9 A;  3FWB A;  2LP3 A;  1KCY A;  1IKU A;  1QX5 B;  1T14 A;  1SL7 A;  2JT0 A;  5FI2 A;  3ZWH A;  4NQG A;  1M31 A;  1OZS A;  4MZJ A;  4YI8 A;  1QWV A;  3IVT A;  2QEO A;  4OV2 A;  2OPO A;  4MEW A;  1CDL A;  1MXE A;  1OOG A;  3FWC A;  2JOJ A;  2WCL A;  3PM2 A;  2HF5 A;  2KGB C;  1A4P A;  3BUO B;  1QVI Z;  2FOT A;  3S0B A;  1JFJ A;  1PK0 D;  1TOP A;  2KOT A;  2GTE A;  5DKR A;  4FTG A;  2WC8 A;  1M39 A;  2Y5I A;  1SY9 A;  2YGU A;  2KI4 B;  2HQ8 A;  2LHI A;  5AER A;  1IIO A;  1DQE A;  1BF5 A;  1NX3 A;  1UHK A;  1LA3 A;  5D69 A;  5HKZ A;  4NDB A;  1S3P A;  1ODB A;  2BBM A;  3JTD B;  3EK7 A;  1K96 A;  3IQQ A;  3TDI A;  2L0P A;  3PN7 C;  3SG3 A;  1GM0 A;  3D10 A;  1S6I A;  2L98 A;  2M9G A;  4Q04 A;  1IQ5 A;  2JNF A;  2P71 A;  1B47 A;  2K7B A;  2MRD A;  1ALW A;  1YUU A;  4M2Q A;  1IJ5 A;  3TS5 C;  3PAL A;  3CLN A;  3I5H B;  2MLE C;  1JF0 A;  3CZ1 A;  3RM1 A;  3BXK A;  3CAB A;  1TUZ A;  2JNX A;  5BPJ A;  1H4B A;  4I5N B;  1EL4 A;  1OSA A;  3FIA A;  3O4X A;  4GBA A;  1L2O B;  1C3Z A;  3LCP C;  1WLZ A;  3LK1 A;  1CFF A;  3JVT B;  5JJG A;  4GGF C;  1WRL A;  1DJH A;  4AQJ A;  1IQ3 A;  1J7Q A;  1K9P A;  4PE0 A;  3RLZ A;  2LMU A;  4YGD B;  3E3R A;  4MZK A;  2OS8 B;  4OKH A;  2LM5 A;  3VRO A;  2FCD A;  3VB1 A;  2WND A;  2G9B A;  2KAY A;  2MBX A;  3WNX B;  1DJZ A;  3B6X A;  1KFX L;  2M97 A;  2JT3 A;  3Q8I A;  3OGN A;  3R1P A;  4I5L B;  4NDD A;  3GK4 X;  3S0D A;  1S5G Y;  4OCI A;  1AJ4 A;  3EVR A;  2SCP A;  1SKT A;  3BJH A;  3LL8 B;  2NXQ A;  4DCK A;  3NSO A;  3SG4 A;  1R2U A;  1NX1 A;  1B7T Z;  2LLS A;  2WC6 A;  4GUK A;  2WC5 A;  2M8U A;  3B88 A;  2M3W A;  2CTN A;  2Y1N A;  3SIA A;  1UUR A;  4PHN A;  2L51 A;  2PMY A;  1H8B A;  3CR4 X;  1KQM B;  3O78 A;  5CSI A;  3O6B A;  1J1E A;  3AKB A;  3D0Y A;  4MZL A;  3UNW A;  1RJV A;  1F8H A;  2F2P A;  2H61 C;  3KEV A;  1P28 A;  3O2P A;  1PVB A;  3I5G B;  1YX8 A;  4TNC A;  2K8M B;  4I5K A;  1DT7 B;  1JBA A;  1K93 D;  1PAL A;  2OS8 C;  3KO0 A;  2NLN A;  5JOL A;  3BUX B;  1C7W A;  1R6P A;  3B87 A;  5DIC A;  5I2L A;  5DKN A;  1S26 D;  4PHJ A;  5EL2 A;  1TNW A;  4PHK A;  5B8I B;  4ORB B;  1EH2 A;  4PAL A;  1ZAC A;  2JC2 A;  1LIN A;  5KU1 A;  1YVL A;  4F7F A;  2PVB A;  1JUO A;  1QV1 A;  1NPQ A;  1JWD A;  3CR5 X;  2KDH A;  2M0R A;  1KSO A;  1UUS A;  2QEV A;  2NCP A;  4PE1 A;  3S0G A;  1C7V A;  2AMI A;  1NIW A;  1S1E A;  3KPX A;  2I7A A;  3PSR A;  4CFQ A;  5ER4 X;  1BLQ A;  1XFU O;  3SIB A;  1PSR A;  2BEC A;  2FJY A;  2KLD A;  3NSK A;  5ER5 A;  4D1E A;  1WLM A;  4PDZ A;  3PM8 A;  1OE9 B;  1CFP A;  1RFJ A;  2JUL A;  1WRZ A;  3TDU A;  1DF0 B;  1CM1 A;  1ZUZ A;  1UHJ A;  1TIZ A;  4YGE B;  5AEQ A;  3PN7 B;  1C3Y A;  2CXJ A;  1KK7 Y;  1L7Z A;  1LS8 A;  3OB2 B;  2L2E A;  1NP8 A;  3S0A A;  4YGA A;  1F71 A;  1B7T Y;  3SS3 A;  1AVS A;  1BOD A;  2E6W A;  1G4Y R;  2BL0 C;  2A4J A;  2IS9 A;  2KQY A;  1OMD A;  2LLT A;  5K89 A;  1MF8 B;  5D3O A;  3DF0 A;  3SG2 A;  5PAL A;  2CBL A;  2ISD A;  1M46 A;  4DS7 A;  3TS5 B;  4PE7 A;  5D7F A;  1Y1A A;  5FI6 A;  3DYE A;  2NCO A;  1QV0 A;  2JTZ A;  2G2B A;  1A29 A;  3R1O A;  2KQ6 A;  5KSZ A;  1GGW A;  4GPL B;  2AAO A;  2JZI A;  1A75 B;  2BCB A;  1WRK A;  5DKQ A;  1TRF A;  1CLB A;  1SR6 C;  1QXP A;  1TTX A;  1REC A;  1B8R A;  3SG5 A;  1KFU S;  2BAP A;  1AJ5 A;  1V1F A;  2I2R E;  4U8D A;  1CFD A;  3SS4 A;  1QLS A;  3NHI A;  1XFX O;  2LUX A;  4JWQ A;  3GOF A;  1BG1 A;  4MSP A;  4XYN A;  1QLK A;  5HKW A;  1CMF A;  1JFK A;  1DGV A;  2WOS A;  1SRA A;  1FBV A;  1FW4 A;  2VRG A;  5GQQ C;  2LUC A;  1EG3 A;  1VRK A;  1FPW A;  2GGZ A;  1U5I B;  2JTT A;  4OR9 B;  1D1O A;  1EXR A;  1ZFS A;  1TNX A;  2LC5 A;  4GNK B;  3V2L A;  2LAP A;  2Q91 A;  4MBE A;  3I5I C;  1IG5 A;  1MHO A;  2MJW B;  1JF2 A;  2BBN A;  3HCM A;  1N65 A;  4PT1 A;  3DVE A;  1DC1 A;  1QX7 A;  2M7N A;  2KHN A;  1IH0 A;  1W9Z A;  1CDM A;  1N2D A;  1XO5 A;  3EG5 B;  2LVV A;  5G08 A;  1OOJ A;  2KSP A;  5CSF A;  1XK4 C;  5AFP A;  3NHT A;  1F54 A;  4HRH A;  2L50 A;  1B4C A;  2OTG C;  3S0F A;  1BMO A;  3L47 A;  1TN4 A;  1AHR A;  1NCZ A;  2K0J A;  5AXI A;  2L5Y A;  1CB1 A;  3M0W A;  1U5I A;  4PE4 A;  2KFG A;  2FJU B;  3ZNI A;  1MXL C;  2MLF C;  5TNC A;  3TUY B;  1DEK A;  2BNX A;  1NUB A;  1QVI Y;  1YTZ C;  4QJ3 B;  4DUQ A;  2K61 A;  5FI7 A;  3NGV A;  4GGN A;  2JQ6 A;  1CNP A;  1RK9 A;  3CZT X;  3O4Y A;  2FCE A;  1QTX A;  3D75 A;  2K60 A;  2LVI A;  4HRG A;  1KWO C;  1OOF A;  3FS7 A;  2M1K B;  2Y4Q A;  3L4L A;  1KQV A;  1YUT A;  1Y6W A;  1XFW O;  1CDN A;  1EG4 A;  1QIW A;  2WCB A;  4R1E A;  3A8R A;  2JXC A;  5I94 A;  2H61 A;  3AAK A;  2HET A;  1HQV A;  1MQ1 A;  1S6J A;  3QME A;  1Y1U A;  3FE9 A;  4QJ4 B;  1TCF A;  3DVJ A;  1J1D A;  1SL8 A;  1KK8 C;  2WOR A;  2ZN9 A;  1NX2 A;  1XFV O;  5I2O A;  3DXL A;  1QJT A;  1CLM A;  2H2K A;  4GFT A;  3VRR A;  1IJ6 A;  1IWQ A;  3EK8 A;  2KLE A;  2LV7 A;  4AQI A;  1CKK A;  3EKH A;  1YUR A;  3I5F B;  3QRX A;  5F6T A;  2M1U A;  4UPG A;  1HT9 A;  3TUY C;  1NYA A;  2PAL A;  1SK6 D;  2M7L A;  1LA0 A;  2PRU A;  3D73 A;  3N7H A;  4ORA B;  4QJ5 B;  1CFC A;  2LLU A;  2BL0 B;  2MHH A;  1SBJ A;  1Z2C B;  2F3Z A;  4JPZ B;  3CZ0 A;  3IQO A;  1FF1 A;  1XFZ O;  4FQT A;  3R1V A;  1OOI X;  1F4O A;  1ZOT B;  3OBV A;  1ALV A;  2K7O A;  2QEB A;  2F33 A;  1G8I A;  3VRQ A;  4CLN A; 
#chains in the Genus database with same CATH homology
 1QIV A;  1CTR A;  1Y1X A;  2WCF A;  3BOW B;  4XJK B;  1SPY A;  3NXA A;  2DOQ A;  1J7R A;  1SR6 B;  1UHH A;  1XFY O;  2JU0 A;  2BE6 A;  5I8N A;  3CGA A;  2LCP A;  3I5F C;  3VRN A;  2LAN A;  1RWY A;  1DJX A;  1AK8 A;  1OZO A;  1NX0 A;  5CSJ A;  1PSB A;  1AP4 A;  4PCW A;  2KI6 C;  1F70 A;  1RRO A;  2D8N A;  2O60 A;  1SCV A;  1YRT B;  2PAS A;  4MRY A;  1OQP A;  2M49 B;  4CFR A;  2LVJ A;  3VGO A;  1X02 A;  1DJW A;  4IL1 A;  3OP0 A;  3MSE B;  4DRW A;  3SJS A;  1N0Y A;  3DD4 A;  3I5I B;  1A2X A;  2TN4 A;  3BOW A;  2ZFD A;  4XJK A;  1E8A A;  4C0L A;  2L5X B;  2K2F A;  1FI5 A;  5J3X A;  1DJI A;  2KBM A;  2CCM A;  3PFV A;  1SMG A;  1DF0 A;  1JC2 A;  1KFX S;  1BT6 A;  3DVM A;  3PAT A;  4A4C A;  4FQO A;  1G33 A;  1UWO A;  1EJ3 A;  2E30 A;  2I18 A;  4JQ0 D;  2EC6 C;  1S6C A;  2NZ0 A;  2ZKM X;  2PSR A;  2MAZ A;  3CR2 A;  4WRI A;  1SCM C;  3BUW B;  2LVK A;  2OTG B;  4MN0 A;  4P5O E;  1M45 A;  1CDP A;  3F45 A;  3OX5 A;  1W7I B;  3TDZ A;  1NCY A;  1S5G Z;  1UHI A;  2CT9 A;  1YR5 A;  1BOC A;  2BCA A;  2GV5 A;  2V53 A;  2ZND A;  1CM4 A;  1WDC C;  3H4S E;  3PLF B;  2SAS A;  1JSA A;  2JXL A;  1IRJ A;  2O5G A;  1SYM A;  1QS7 A;  3HX4 A;  4USL A;  1K95 A;  1GGZ A;  2MA2 A;  3SG6 A;  2LNK A;  3OB1 B;  3EK4 A;  1A75 A;  2ZRT A;  1DJG A;  1KWO B;  1XVJ A;  2KBI A;  1XK4 A;  5HLO A;  3WHU B;  4GGF A;  5CSN A;  1MWN A;  3OX6 A;  3BUM B;  1KSM A;  4CPV A;  2KNE A;  1NSH A;  1V1G A;  2EHB A;  2F3Y A;  4GAO A;  4CID A;  2KAX A;  2KYF A;  3TZ1 A;  2KFF A;  4HRE E;  1LXF C;  4DIR A;  4YI9 A;  3SG7 A;  1KK8 B;  1WY9 A;  3K21 A;  4P2Y B;  1QAS A;  3ICB A;  3OHM B;  1K8U A;  2B1U A;  2K7D A;  2BKI B;  2LE9 B;  1QAT A;  5CPV A;  4C0J A;  2KGR A;  5I2Q A;  2BKH B;  3EKJ A;  4HSZ A;  1C07 A;  3CS1 A;  5IBW A;  1DGU A;  1UP5 A;  4F0Z B;  1DMO A;  2KI4 C;  1SL9 A;  1ZMZ A;  1K2H A;  3BYA A;  5HKY A;  4C0K A;  1XA5 A;  2CNP A;  4PHM A;  4ICB A;  4ZCV A;  1YX7 A;  1SNL A;  1DJY A;  1K94 A;  3JTD C;  4M2P A;  4N1G A;  2LP2 A;  1B8C A;  1TNQ A;  1SW8 A;  1K9K A;  3D0Y B;  1YRU B;  4MRX A;  4ORC B;  3A4U B;  4ETO A;  2KI6 D;  1CLL A;  4BY4 A;  5HYD A;  1J7P A;  1FI6 A;  1W7J B;  4ZCU A;  3VRP A;  2WCE A;  3LK0 A;  2ZNE A;  2COL B;  1PUL A;  1GJY A;  3KHE A;  3AAJ A;  4M2O A;  3LLE A;  2BE4 A;  1OMV A;  1KFU L;  1TCO B;  3I5H C;  1GQM A;  2HPS A;  1KK7 Z;  4N1F A;  4MVF A;  3DVK A;  1J55 A;  4OVN F;  1Y0V H;  2QPT A;  2LMT A;  1DVI A;  3EVV A;  4AOM A;  2F2O A;  2ZN8 A;  1M63 B;  1L2O C;  2JPT A;  4N5X A;  4E68 A;  1BR4 B;  1K90 D;  3AKA A;  3GK1 A;  4YGC B;  3BUN B;  1A03 A;  2KAV A;  1MUX A;  2I94 A;  2LMV A;  3CTN A;  5KTY A;  1J7O A;  2EGD A;  1OMR A;  3JVT C;  3EVU A;  1NWD A;  2JRF A;  1F4Q A;  2L4H A;  1YVH A;  1XYD A;  1BR1 B;  2F8P A;  4WQ2 A;  1CMG A;  1NCX A;  2HQW A;  5FYX A;  3IF7 A;  4I5J A;  2BCX A;  4YRU A;  1PVA A;  5HLV A;  2R2I A;  2RGI A;  4YGB B;  2QAC A;  3C1V A;  1LKJ A;  1B1G A;  4MLW A;  1MR8 A;  1BJF A;  2EC6 B;  1BU3 A;  1DTL A;  1SCM B;  2JT8 A;  1B9A A;  1YUS A;  2Y1M A;  2LHL A;  5AAN A;  1B8L A;  1QX2 A;  3WXA A;  1Q80 A;  1KQM C;  2JWW A;  4L9M A;  4NDC A;  3DF0 B;  1LVC D;  3CWG A;  1WDC B;  4A4B A;  3KF9 A;  2ZRS A;  1AUI B;  1RTP 1;  1PRW A;  1K9U A;  2AUC A;  2GGM A;  2KYC A;  1S36 A;  2M29 A;  2K7C A;  2Q4U A;  2KFH A;  2L4I A;  2P6B B;  1IGV A;  3I5G C;  4WQ3 A;  3BQ3 A;  4YBH B;  4BY5 A;  1F55 A;  1UHN A;  2K2A A;  3GK2 A;  3NSL A;  3WHT B;  1TNP A;  3NSI A;  3FWB A;  2LP3 A;  1KCY A;  1IKU A;  1QX5 B;  1SL7 A;  2JT0 A;  3ZWH A;  4NQG A;  1M31 A;  1OZS A;  4MZJ A;  4YI8 A;  4OV2 A;  2OPO A;  4MEW A;  1CDL A;  1MXE A;  3FWC A;  2JOJ A;  2HF5 A;  2KGB C;  1A4P A;  3BUO B;  1QVI Z;  2FOT A;  1JFJ A;  1PK0 D;  1TOP A;  2KOT A;  5DKR A;  4FTG A;  2WC8 A;  1M39 A;  2Y5I A;  1SY9 A;  2KI4 B;  2HQ8 A;  2LHI A;  5AER A;  1BF5 A;  1NX3 A;  1UHK A;  1LA3 A;  5D69 A;  5HKZ A;  4NDB A;  1S3P A;  1ODB A;  2BBM A;  3JTD B;  3EK7 A;  1K96 A;  3IQQ A;  3TDI A;  2L0P A;  3PN7 C;  3SG3 A;  3D10 A;  1S6I A;  2L98 A;  2M9G A;  4Q04 A;  1IQ5 A;  2JNF A;  1B47 A;  2K7B A;  2MRD A;  1ALW A;  1YUU A;  4M2Q A;  1IJ5 A;  3TS5 C;  3PAL A;  3CLN A;  3I5H B;  2MLE C;  1JF0 A;  3RM1 A;  3BXK A;  2JNX A;  5BPJ A;  1H4B A;  4I5N B;  1EL4 A;  1OSA A;  3FIA A;  4GBA A;  1L2O B;  3LCP C;  1WLZ A;  3LK1 A;  1CFF A;  3JVT B;  5JJG A;  4GGF C;  1WRL A;  1DJH A;  4AQJ A;  1IQ3 A;  1J7Q A;  1K9P A;  4PE0 A;  3RLZ A;  2LMU A;  4YGD B;  3E3R A;  4MZK A;  2OS8 B;  4OKH A;  2LM5 A;  3VRO A;  2FCD A;  2WND A;  2G9B A;  2KAY A;  2MBX A;  3WNX B;  1DJZ A;  1KFX L;  2M97 A;  2JT3 A;  4I5L B;  4NDD A;  3GK4 X;  1S5G Y;  4OCI A;  1AJ4 A;  3EVR A;  2SCP A;  1SKT A;  3LL8 B;  4DCK A;  2NXQ A;  3NSO A;  3SG4 A;  1R2U A;  1NX1 A;  1B7T Z;  2LLS A;  4GUK A;  2M8U A;  2M3W A;  2CTN A;  2Y1N A;  3SIA A;  1UUR A;  4PHN A;  2L51 A;  2PMY A;  1H8B A;  3CR4 X;  1KQM B;  3O78 A;  5CSI A;  3O6B A;  1J1E A;  3AKB A;  3D0Y A;  4MZL A;  1F8H A;  1RJV A;  2F2P A;  2H61 C;  3KEV A;  3O2P A;  1PVB A;  3I5G B;  1YX8 A;  4TNC A;  2K8M B;  4I5K A;  1DT7 B;  1JBA A;  1K93 D;  1PAL A;  2OS8 C;  3KO0 A;  2NLN A;  5JOL A;  3BUX B;  1C7W A;  1R6P A;  5I2L A;  5DKN A;  1S26 D;  4PHJ A;  1TNW A;  4PHK A;  5B8I B;  4ORB B;  1EH2 A;  4PAL A;  1ZAC A;  2JC2 A;  1LIN A;  5KU1 A;  1YVL A;  2PVB A;  1JUO A;  1QV1 A;  1NPQ A;  1JWD A;  3CR5 X;  2KDH A;  2M0R A;  1KSO A;  1UUS A;  2NCP A;  4PE1 A;  1C7V A;  2AMI A;  1NIW A;  1S1E A;  3KPX A;  2I7A A;  3PSR A;  4CFQ A;  5ER4 X;  1BLQ A;  1XFU O;  3SIB A;  1PSR A;  2BEC A;  3NSK A;  5ER5 A;  4D1E A;  1WLM A;  4PDZ A;  3PM8 A;  1OE9 B;  1CFP A;  1RFJ A;  2JUL A;  1WRZ A;  3TDU A;  1DF0 B;  1CM1 A;  1ZUZ A;  1UHJ A;  1TIZ A;  4YGE B;  5AEQ A;  3PN7 B;  2CXJ A;  1KK7 Y;  1L7Z A;  3OB2 B;  2L2E A;  1NP8 A;  4YGA A;  1F71 A;  1B7T Y;  1BOD A;  1AVS A;  2E6W A;  1G4Y R;  2BL0 C;  2A4J A;  2IS9 A;  2KQY A;  1OMD A;  2LLT A;  5K89 A;  1MF8 B;  3DF0 A;  3SG2 A;  5PAL A;  2CBL A;  2ISD A;  1M46 A;  4DS7 A;  3TS5 B;  4PE7 A;  5D7F A;  1Y1A A;  2NCO A;  1QV0 A;  2JTZ A;  2G2B A;  1A29 A;  2KQ6 A;  5KSZ A;  1GGW A;  4GPL B;  2AAO A;  2JZI A;  1A75 B;  2BCB A;  1WRK A;  5DKQ A;  1TRF A;  1CLB A;  1SR6 C;  1QXP A;  1TTX A;  1REC A;  1B8R A;  3SG5 A;  1KFU S;  2I2R E;  1AJ5 A;  1V1F A;  4U8D A;  1CFD A;  1QLS A;  1XFX O;  2LUX A;  4JWQ A;  3GOF A;  1BG1 A;  4MSP A;  4XYN A;  1QLK A;  5HKW A;  1CMF A;  1JFK A;  1DGV A;  2WOS A;  1SRA A;  1FBV A;  1FW4 A;  2VRG A;  5GQQ C;  2LUC A;  1EG3 A;  1VRK A;  1FPW A;  2GGZ A;  1U5I B;  2JTT A;  4OR9 B;  1D1O A;  1EXR A;  1ZFS A;  1TNX A;  2LC5 A;  4GNK B;  2LAP A;  2Q91 A;  4MBE A;  3I5I C;  1IG5 A;  1MHO A;  2MJW B;  1JF2 A;  2BBN A;  3HCM A;  1N65 A;  3DVE A;  1QX7 A;  2M7N A;  2KHN A;  1IH0 A;  1CDM A;  1N2D A;  1XO5 A;  2LVV A;  5G08 A;  1OOJ A;  2KSP A;  5CSF A;  1XK4 C;  5AFP A;  1F54 A;  4HRH A;  2L50 A;  1B4C A;  2OTG C;  1BMO A;  1TN4 A;  1AHR A;  1NCZ A;  2K0J A;  5AXI A;  1CB1 A;  3M0W A;  1U5I A;  4PE4 A;  2KFG A;  2FJU B;  3ZNI A;  1MXL C;  2MLF C;  5TNC A;  3TUY B;  1NUB A;  1QVI Y;  1YTZ C;  4QJ3 B;  4DUQ A;  2K61 A;  4GGN A;  2JQ6 A;  1CNP A;  1RK9 A;  3CZT X;  3O4Y A;  2FCE A;  1QTX A;  2LVI A;  4HRG A;  1KWO C;  3FS7 A;  2M1K B;  2Y4Q A;  1KQV A;  1YUT A;  1Y6W A;  1XFW O;  1CDN A;  1EG4 A;  1QIW A;  2WCB A;  4R1E A;  3A8R A;  2JXC A;  2H61 A;  3AAK A;  2HET A;  1HQV A;  1MQ1 A;  1S6J A;  1Y1U A;  4QJ4 B;  1TCF A;  3DVJ A;  1J1D A;  1SL8 A;  1KK8 C;  2WOR A;  2ZN9 A;  1NX2 A;  1XFV O;  5I2O A;  4GFT A;  1QJT A;  1CLM A;  2H2K A;  3VRR A;  1IJ6 A;  1IWQ A;  3EK8 A;  2LV7 A;  4AQI A;  1CKK A;  3EKH A;  1YUR A;  3I5F B;  3QRX A;  5F6T A;  2M1U A;  4UPG A;  1HT9 A;  3TUY C;  1NYA A;  2PAL A;  1SK6 D;  2M7L A;  1LA0 A;  2PRU A;  4ORA B;  4QJ5 B;  1CFC A;  2LLU A;  2BL0 B;  2MHH A;  1SBJ A;  2F3Z A;  4JPZ B;  1FF1 A;  3IQO A;  1XFZ O;  1F4O A;  1ZOT B;  1ALV A;  2K7O A;  3VRQ A;  2F33 A;  1G8I A;  4CLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...