2WCFA

Calcium-free (apo) s100a12
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN S100-A12
publication title The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wcfA00
1WY9A 4HSZA 1IJ5A 2KI6D 3GK4X 5JJGA 1OMRA 2JU0A 1YURA 2QPTA 4DIRA 1IQ3A 4PHJA 1QS7A 1ZFSA 4MLWA 1NCYA 1YR5A 1UURA 5KU1A 2F33A 1X02A 1MF8B 1YX8A 4C0KA 3OP0A 1Y1AA 1F71A 1KFUS 4JPZB 1NCZA 1KQVA 1JUOA 1Y0VH 1CDMA 4YGAA 1CFCA 2AUCA 3NSIA 1SY9A 1QLSA 1K96A 1UUSA 4I5LB 2G2BA 1TNPA 2IS9A 1RK9A 4U8DA 4A4BA 5KSZA 2HQ8A 2OTGB 1YUTA 2PALA 1IWQA 1DVIA 1XFXO 1A75B 1E8AA 1A75A 1OOJA 1XVJA 3D10A 1J7RA 1YVLA 3I5HC 1IJ6A 3I5FB 3SG2A 1XFYO 3JTDC 4PE4A 4BY4A 1FI6A 3SG6A 3IF7A 1CDLA 1K9KA 3EK4A 4MEWA 3LK1A 3AKAA 2KFGA 1KSMA 3KEVA 4WQ2A 3EKJA 2MBXA 2CBLA 4PDZA 1TCFA 2MLEC 3BUMB 1DT7B 1UWOA 3PFVA 4NQGA 2NLNA 1FPWA 2WCFA 5AERA 1IG5A 3GK1A 5FYXA 5I2LA 1WRZA 1MQ1A 1KWOB 1SMGA 1ZACA 3SG7A 1WLMA 5BPJA 2JT0A 3GOFA 4ORAB 1NUBA 1HT9A 4F0ZB 4IL1A 2F8PA 4FTGA 3F45A 1SYMA 2CNPA 1WRLA 5K89A 1CFFA 1ALWA 2PASA 4AOMA 2LANA 1BT6A 3CZTX 3NXAA 4YGCB 1IQ5A 1CNPA 1BJFA 2BCXA 3LL8B 1G4YR 2O60A 1V1FA 2RGIA 2V53A 2M7NA 1LA3A 2BCAA 1H4BA 1TCOB 1L2OB 1UHIA 3DF0A 3TS5B 2L4HA 1YX7A 1M31A 1QIVA 1RWYA 1CKKA 1S6JA 4DRWA 4PE7A 3CGAA 4GUKA 5DKNA 2QACA 3RM1A 1WRKA 2H61A 4I5NB 4D1EA 3TZ1A 3FWCA 5D7FA 3TDZA 2HQWA 2LVKA 2WOSA 4GBAA 5CSFA 1YUSA 4CLNA 4DS7A 2FCEA 4ZCVA 1QXPA 2BBNA 2ZFDA 2JNXA 3LK0A 2KQYA 4MN0A 1KFXL 2JT8A 2WC8A 2Q91A 1AJ5A 3DD4A 1J7OA 2PRUA 2LP3A 4MBEA 3CR5X 1Y6WA 2LC5A 2LNKA 2WNDA 4ZCUA 3BUOB 5ER5A 1EH2A 2JT3A 3EVUA 1GGWA 5I2QA 2KGBC 1SL7A 4PALA 1RROA 2MAZA 1XFZO 5PALA 4MSPA 3SIAA 1NIWA 1MWNA 1K90D 1OSAA 1SNLA 2OS8B 3FWBA 4PE1A 5AFPA 5AEQA 2OTGC 2H2KA 4TNCA 1SL8A 2JZIA 1TIZA 2BKIB 4YI8A 4CFRA 1ODBA 1J7PA 3I5FC 4MVFA 1F55A 2L4IA 3DVMA 3PLFB 1HQVA 3KF9A 1G8IA 1SCMB 1M45A 1RJVA 1SRAA 2O5GA 2LHIA 3BOWB 2LCPA 3D0YA 2F3ZA 3D0YB 3K21A 1JC2A 3NSKA 2JULA 3AAJA 4NDCA 4PHKA 4CPVA 3FIAA 3CWGA 4JQ0D 2GGMA 4M2QA 4PHNA 1DMOA 4MZKA 4OKHA 1WDCB 2JQ6A 3EK7A 2LUXA 1KWOC 3CR2A 1MXEA 1FI5A 3WHTB 3PN7B 1AK8A 2F2OA 2WCBA 1JF0A 1SR6B 1YRTB 3BUNB 1NWDA 4UPGA 4Q04A 2LUCA 1BODA 1XA5A 1KSOA 2JTTA 2K8MB 1DJGA 1B7TY 5CSJA 1IGVA 1CTRA 2OPOA 2K7DA 2CCMA 3BXKA 5HKZA 1B8CA 3AKBA 2K7OA 1QLKA 5TNCA 1KQMC 2KBMA 4GGNA 3TUYC 2HF5A 3O4YA 1EG3A 1BOCA 4L9MA 5D69A 3DVKA 1J55A 1LINA 2LMTA 1L2OC 3NSOA 1QX5B 4QJ5B 2BL0B 1CLLA 2M0RA 2HETA 2VRGA 4HRHA 1JWDA 1PALA 3SG5A 1DJHA 1QVIY 1KK8B 4PE0A 2M97A 2EC6B 5I8NA 2L50A 5AXIA 4R1EA 1FF1A 2H61C 2PMYA 4HREE 3I5IB 2LHLA 4M2OA 1B8RA 2KSPA 2M1UA 4YGEB 2LMVA 2EGDA 1NP8A 1YVHA 1NSHA 1S6IA 1A2XA 1BU3A 4GFTA 4XYNA 1RECA 2DOQA 2GV5A 1PSBA 3WHUB 1CMGA 1GGZA 2K7BA 3I5GB 2I7AA 4YBHB 1SW8A 4I5JA 4QJ4B 1S5GZ 1B1GA 1KFUL 1RTP1 1AVSA 1F4OA 2COLB 2M29A 4YRUA 4GGFA 4ICBA 4CIDA 1UHJA 1EL4A 1K9PA 4ORBB 2M49B 1NX3A 3OHMB 4E68A 2OS8C 1TNXA 3EVVA 3OB2B 3VGOA 2M8UA 5J3XA 1KFXS 2CT9A 2BECA 3C1VA 2FCDA 2Y1MA 3SG3A 1NCXA 3O6BA 2L98A 1LVCD 2BE6A 1QJTA 2EHBA 2LMUA 1SCMC 1A4PA 1Y1XA 2SCPA 1XYDA 5CSNA 1J7QA 1JFKA 1UP5A 1EXRA 1M39A 3ZNIA 3IQQA 1QX7A 3O78A 1K95A 2WORA 1S1EA 5DKQA 1ZOTB 1WDCC 3WXAA 3I5HB 4GNKB 1OZOA 5HLVA 1B9AA 3JTDB 2L5XB 2Y5IA 4C0LA 1DF0B 5GQQC 2WCEA 4XJKB 5DKRA 1YUUA 4XJKA 1SK6D 1XO5A 2AMIA 4MRYA 4OV2A 2JOJA 1CDPA 1NX1A 2GGZA 1GQMA 2LVIA 4OVNF 4OR9B 1U5IB 3HCMA 2KYCA 4WQ3A 2KAXA 3KO0A 1D1OA 2LAPA 1C7WA 2NXQA 2E6WA 1AP4A 1K8UA 3BQ3A 2KFFA 4JWQA 1C07A 5I2OA 4YI9A 1QTXA 3CS1A 5HLOA 1JFJA 1TRFA 1CDNA 1A03A 3VRQA 1SPYA 1AUIB 1VRKA 3BOWA 4YGBB 2LVJA 1IH0A 1DJYA 1UHHA 2ZNEA 3JVTB 1R2UA 3DVJA 2HPSA 3O2PA 1TN4A 4AQJA 4C0JA 2B1UA 2K0JA 3EKHA 1XFWO 3A8RA 1GJYA 1TNWA 2KBIA 3I5GC 1S5GY 3MSEB 1W7JB 1J1DA 1M63B 1NYAA 1BR4B 1XFVO 3LLEA 3PSRA 1OQPA 1DJXA 1CFPA 4GGFC 2K61A 3A4UB 3PM8A 1TTXA 1BG1A 1CB1A 4QJ3B 1J1EA 2MJWB 2NZ0A 3PALA 1R6PA 3CLNA 3PATA 3ZWHA 1DJZA 2TN4A 1SBJA 1XK4A 1N0YA 2JWWA 4HRGA 1SCVA 3CR4X 2ZRSA 4PHMA 3TS5C 1KK7Z 2LP2A 1AJ4A 1OZSA 2PVBA 1EJ3A 1K9UA 2KAVA 1FBVA 1OE9B 1QV0A 1S26D 3QRXA 5G08A 1UHKA 1IRJA 5CSIA 1DJIA 1S3PA 2I18A 1CM1A 2LE9B 3ICBA 2BKHB 3VRNA 5CPVA 2I94A 3VRPA 2KNEA 2I2RE 3WNXB 1QATA 5B8IB 2LLTA 1BR1B 1ZMZA 2FOTA 3SIBA 3TDIA 3AAKA 2KOTA 2M1KB 2KYFA 2KI4B 4GPLB 2JTZA 1WLZA 3BUWB 3KHEA 3OB1B 4OCIA 2D8NA 2LM5A 2ZNDA 1M46A 2ZN9A 1AHRA 1K93D 3KPXA 1B8LA 1SKTA 4MZLA 4PCWA 5JOLA 2L51A 4AQIA 1JBAA 1RFJA 1QV1A 1PK0D 1PVBA 2BBMA 2FJUB 3M0WA 3SG4A 2LLUA 1F54A 2P6BB 1S36A 1W7IB 3LCPC 4MRXA 2MRDA 2MLFC 1CM4A 2KQ6A 1CMFA 3DVEA 1Q80A 4FQOA 1S6CA 1F70A 1CLBA 2JXCA 1B47A 5HKWA 1NX2A 4P5OE 1IKUA 1B7TZ 1KQMB 1LXFC 1F8HA 2F3YA 3OX6A 4BY5A 1BLQA 2LV7A 1YRUB 3TUYB 4CFQA 1CFDA 2BE4A 2CTNA 3JVTC 1V1GA 2A4JA 2Y1NA 2R2IA 4NDBA 1LA0A 1N65A 1DJWA 5KTYA 2ISDA 1ALVA 4ETOA 2JPTA 2K7CA 4ORCB 2NCPA 3DF0B 3PN7C 4MZJA 1G33A 3NSLA 1SR6C 2JXLA 5F6TA 2G9BA 1DF0A 2PSRA 3IQOA 3BUXB 3VROA 1L7ZA 1OMDA 1EG4A 2CXJA 3RLZA 2L0PA 3BYAA 2JC2A 4N1FA 1QVIZ 1PULA 1C7VA 1KCYA 1PSRA 3CTNA 1MHOA 3SJSA 5HYDA 1LKJA 1FW4A 2F2PA 3GK2A 4N1GA 1NPQA 1BF5A 1U5IA 2K2AA 2Y4QA 1BMOA 2ZN8A 2MA2A 2M9GA 2JNFA 2Q4UA 4DCKA 1JSAA 4NDDA 1A29A 3EK8A 3H4SE 3TDUA 1CLMA 1XK4C 1MR8A 1F4QA 1KK7Y 2LLSA 1H8BA 4M2PA 1B4CA 1ZUZA 1DGUA 2BL0C 3OX5A 1NX0A 2KFHA 1Y1UA 5HKYA 1SL9A 2ZKMX 2KI6C 1KK8C 2BCBA 2KAYA 2K2FA 1DTLA 2EC6C 2SASA 1QASA 2KDHA 5AANA 4P2YB 3I5IC 2KGRA 1MXLC 1TNQA 1UHNA 4DUQA 2MHHA 2ZRTA 3HX4A 1PRWA 2KI4C 1MUXA 1QX2A 1K94A 4WRIA 3FS7A 1XFUO 1QIWA 1N2DA 1K2HA 1DGVA 4USLA 2NCOA 5ER4X 4A4CA 4YGDB 2L2EA 2KHNA 4N5XA 3E3RA 1PVAA 2AAOA 1YTZC 1JF2A 4GAOA 2M7LA 2LVVA 1OMVA 3VRRA 2M3WA 5IBWA 1TOPA 3EVRA 2JRFA 2E30A 4I5KA
chains in the Genus database with same CATH superfamily
1WY9A 4HSZA 1IJ5A 2KI6D 3GK4X 5JJGA 1OMRA 2JU0A 1YURA 2QPTA 4DIRA 1IQ3A 4PHJA 1QS7A 1ZFSA 4MLWA 1NCYA 1YR5A 1UURA 5KU1A 2F33A 1X02A 1MF8B 1YX8A 4C0KA 3OP0A 1Y1AA 1F71A 1KFUS 4JPZB 1NCZA 1KQVA 1JUOA 1Y0VH 1CDMA 4YGAA 1CFCA 2AUCA 3NSIA 1SY9A 1QLSA 1K96A 1UUSA 4I5LB 2G2BA 1TNPA 2IS9A 1RK9A 2WCKA 4U8DA 1OOFA 1TWOA 4A4BA 5KSZA 2HQ8A 2OTGB 1YUTA 2PALA 1IWQA 1DVIA 1XFXO 1A75B 1E8AA 1A75A 1OOJA 1XVJA 3D10A 3Q8IA 1J7RA 1YVLA 2QEBA 3I5HC 1DQEA 1IJ6A 3I5FB 3D74A 1XFYO 3FE8A 3JTDC 2L5YA 4PE4A 3SG2A 3SG6A 4BY4A 3IF7A 1CDLA 1K9KA 3S0AA 3EK4A 4MEWA 3LK1A 3AKAA 3FE6A 1XFRA 3DYEA 2KFGA 1KSMA 3KEVA 4WQ2A 3EKJA 1C3YA 3BFHA 3CABA 2MBXA 2CBLA 4PDZA 1TCFA 4FQTA 2MLEC 3SS3A 3BUMB 1DT7B 1UWOA 3PFVA 4NQGA 2NLNA 2QDIA 1FPWA 2WCFA 5AERA 1IG5A 3GK1A 5FYXA 5I2LA 1WRZA 1MQ1A 1KWOB 1SMGA 1ZACA 3SG7A 3K1EA 1WLMA 5BPJA 2JT0A 3GOFA 4ORAB 1NUBA 1HT9A 3UNWA 4F0ZB 4IL1A 2F8PA 5FI7A 4FTGA 3F45A 1SYMA 2CNPA 3R1PA 1WRLA 5K89A 1CFFA 1ALWA 2PASA 3V2LA 4AOMA 2LANA 1BT6A 3CZTX 3NXAA 4YGCB 1IQ5A 1CNPA 1BJFA 4OZDA 2BCXA 3LL8B 1G4YR 2O60A 1V1FA 2RGIA 2V53A 2M7NA 1LA3A 2BCAA 3D75A 3R72A 1H4BA 1TCOB 1L2OB 1UHIA 2PQLA 3DF0A 2BAPA 3OGNA 3TS5B 2L4HA 3DZTA 1YX7A 1M31A 1QIVA 1RWYA 1CKKA 1S6JA 4DRWA 4PE7A 3CGAA 4GUKA 5DKNA 2QACA 3RM1A 1WRKA 3UO9A 2H61A 4I5NB 4D1EA 3TZ1A 3B88A 3FWCA 5D7FA 3TDZA 3CZ1A 2HQWA 2LVKA 2WOSA 4GBAA 5CSFA 1YUSA 4CLNA 4DS7A 3RZSA 1FI6A 1T14A 2FCEA 4ZCVA 1QXPA 2BBNA 2P71A 2JNXA 2ZFDA 3LK0A 2KQYA 4MN0A 1KFXL 2JT8A 4IJ7A 2WC8A 2Q91A 1AJ5A 3DD4A 1J7OA 2PRUA 2LP3A 4MBEA 3CR5X 1Y6WA 2LC5A 2LNKA 2WNDA 4ZCUA 3B7AA 3BUOB 5ER5A 1EH2A 2JT3A 2WC5A 3EVUA 5EL2A 2KGBC 1SL7A 2H8VA 4PALA 1RROA 5I2QA 1GGWA 2MAZA 1XFZO 5PALA 4MSPA 3SIAA 3D73A 1NIWA 1MWNA 1K90D 1OSAA 1SNLA 2OS8B 3FWBA 4PE1A 5AFPA 5AEQA 2OTGC 2H2KA 4JD9A 4TNCA 1SL8A 2JZIA 1TIZA 2BKIB 4YI8A 4CFRA 1ODBA 1J7PA 3I5FC 4MVFA 1F55A 2L4IA 3DVMA 3PLFB 1HQVA 1ORGA 1G8IA 3KF9A 1SCMB 1M45A 1RJVA 1SRAA 2O5GA 2LHIA 3BOWB 2LCPA 3D0YA 2F3ZA 3D0YB 3K21A 1JC2A 3NSKA 2JULA 3AAJA 4NDCA 4PHKA 4CPVA 3FIAA 3CWGA 4JQ0D 2GGMA 4M2QA 4PHNA 1DMOA 4MZKA 4OKHA 1WDCB 2JQ6A 3EK7A 2LUXA 1KWOC 3CR2A 1MXEA 1FI5A 3WHTB 3PN7B 1AK8A 2F2OA 2WCBA 1JF0A 1SR6B 1YRTB 3BUNB 1NWDA 4UPGA 1GM0A 4Q04A 2QEVA 2LUCA 2JPOA 1BODA 3L4AA 3B87A 1XA5A 1KSOA 2JTTA 2K8MB 1OOIX 1DJGA 1B7TY 5CSJA 1IGVA 1CTRA 2OPOA 2K7DA 2CCMA 3BXKA 5HKZA 1B8CA 3AKBA 2K7OA 3N7HA 1QLKA 5TNCA 1KQMC 2KBMA 4GGNA 3BJHA 3TUYC 2HF5A 3O4YA 1EG3A 1BOCA 4L9MA 4JKTA 5D69A 3DVKA 1J55A 1LINA 2LMTA 1L2OC 3NSOA 1QX5B 4QJ5B 2BL0B 1CLLA 2M0RA 2HETA 2VRGA 4HRHA 1JWDA 1PALA 3SG5A 1DJHA 4KYNA 1QVIY 1KK8B 4PE0A 2M97A 2EC6B 3PM2A 5I8NA 2L50A 5AXIA 4R1EA 1FF1A 2H61C 2PMYA 4HREE 3I5IB 2LHLA 4M2OA 1B8RA 2KSPA 2M1UA 4YGEB 2LMVA 2EGDA 1NP8A 1YVHA 1NSHA 1S6IA 1A2XA 1BU3A 4GFTA 4XYNA 1RECA 2DOQA 2GV5A 1PSBA 3WHUB 1CMGA 1GGZA 2K7BA 3I5GB 2I7AA 4YBHB 1SW8A 4I5JA 4QJ4B 1S5GZ 1B1GA 1KFUL 1TUJA 1RTP1 1AVSA 1F4OA 2COLB 2M29A 4YRUA 4GGFA 4ICBA 3BFAA 3R1VA 4CIDA 1UHJA 1EL4A 1K9PA 4ORBB 2KLDA 2M49B 1NX3A 3OHMB 4E68A 2OS8C 1TNXA 3EVVA 3OB2B 3SS4A 3VGOA 2M8UA 3SS5A 5J3XA 1KFXS 2CT9A 2BECA 3C1VA 2FCDA 1IIOA 1OOHA 2Y1MA 1NCXA 3O6BA 3SG3A 1QWVA 3L4LA 2L98A 1LVCD 1QJTA 2BE6A 2EHBA 2LMUA 2QEHA 1SCMC 1A4PA 1Y1XA 5HL1A 2SCPA 1XYDA 5CSNA 1J7QA 1JFKA 1UP5A 1EXRA 1M39A 3ZNIA 3IQQA 1QX7A 3O78A 1K95A 2WORA 1S1EA 5DKQA 1ZOTB 1WDCC 3WXAA 3I5HB 4GNKB 1OZOA 2WCMA 5HLVA 1B9AA 3JTDB 2L2CA 2L5XB 2Y5IA 1C3ZA 4C0LA 1DF0B 5GQQC 2WCEA 4XJKB 5DKRA 1YUUA 4XJKA 1SK6D 1XO5A 2AMIA 4MRYA 4OV2A 2JOJA 1CDPA 1NX1A 2GGZA 1GQMA 2LVIA 4OVNF 4OR9B 1U5IB 3HCMA 2KYCA 4WQ3A 2KAXA 3KO0A 1D1OA 2LAPA 1C7WA 3VB1A 3CZ0A 2NXQA 2E6WA 1AP4A 1K8UA 3BQ3A 2KFFA 4JWQA 1C07A 5DICA 3CDNA 2ERBA 2KLEA 4YI9A 5I2OA 1QTXA 3CS1A 5HLOA 1JFJA 1TRFA 1CDNA 1A03A 3VRQA 1SPYA 1AUIB 1VRKA 3BOWA 4YGBB 2LVJA 1IH0A 1DJYA 1UHHA 2ZNEA 3JVTB 1R2UA 3DVJA 2HPSA 3O2PA 4INXA 1TN4A 4AQJA 4C0JA 2B1UA 2K0JA 3EKHA 1XFWO 3L47A 3A8RA 1GJYA 1TNWA 2KBIA 3BFBA 1S5GY 3I5GC 3MSEB 1W7JB 1J1DA 1M63B 1NYAA 1BR4B 1XFVO 3B86A 3OBVA 3R1OA 3LLEA 3S0EA 3PSRA 1OQPA 1DJXA 1CFPA 4GGFC 2K61A 3A4UB 3PM8A 3D77A 2YGUA 1TTXA 1BG1A 3CYZA 1CB1A 3O4XA 4QJ3B 1J1EA 3S0FA 2MJWB 2NZ0A 3PALA 1R6PA 3CLNA 3PATA 3ZWHA 1DJZA 2TN4A 3D78A 1SBJA 1XK4A 1N0YA 2JWWA 4HRGA 1SCVA 3DXLA 3CR4X 2ZRSA 3NHIA 4PHMA 3TS5C 1KK7Z 2LP2A 1AJ4A 1OZSA 2PVBA 1EJ3A 1K9UA 2KAVA 1FBVA 1OE9B 1QV0A 1S26D 3QRXA 5G08A 1UHKA 1IRJA 5CSIA 1DJIA 1S3PA 2I18A 1CM1A 2LE9B 3ICBA 1SSEB 2BKHB 3VRNA 5CPVA 2I94A 3VRPA 2KNEA 3S0BA 2I2RE 3WNXB 1QATA 5B8IB 2LLTA 1BR1B 1ZMZA 2FOTA 2FJYA 3SIBA 3TDIA 3AAKA 2KOTA 2M1KB 2KYFA 1LS8A 2KI4B 4GPLB 2JTZA 1WLZA 3BUWB 3KHEA 3OB1B 4OCIA 2D8NA 2LM5A 2ZNDA 1M46A 2ZN9A 3S0GA 3CZ2A 1AHRA 1K93D 2K60A 2QEOA 3KPXA 1B8LA 1SKTA 4MZLA 4PCWA 5JOLA 2L51A 4PT1A 4AQIA 1JBAA 1RFJA 1QV1A 1PK0D 1PVBA 2BBMA 2FJUB 1TUZA 3M0WA 3S0DA 3SG4A 2LLUA 1F54A 2P6BB 1S36A 1W7IB 3LCPC 4MRXA 2MRDA 2MLFC 1CM4A 2KQ6A 1CMFA 3DVEA 2WCLA 1Q80A 5D3OA 4FQOA 1S6CA 5I94A 1F70A 3FE9A 1CLBA 2JXCA 1B47A 5HKWA 1NX2A 1Z2CB 4P5OE 1IKUA 1B7TZ 1KQMB 1LXFC 1F8HA 2F3YA 3OX6A 4BY5A 1BLQA 2LV7A 1YRUB 3TUYB 4CFQA 1CFDA 2BE4A 2CTNA 3JVTC 1V1GA 2A4JA 2Y1NA 2R2IA 4NDBA 3NGVA 1LA0A 1N65A 1DJWA 2WC6A 2WCHA 2ISDA 5KTYA 1ALVA 4ETOA 2JPTA 2K7CA 3PJIA 4ORCB 1DEKA 2NCPA 3DF0B 3PN7C 2KPHA 4MZJA 1G33A 1OOGA 3NSLA 1SR6C 2JXLA 3QMEA 5F6TA 2G9BA 1DF0A 2PSRA 3IQOA 3BUXB 3VROA 1L7ZA 1OMDA 1EG4A 2CXJA 3EG5B 3RLZA 5FI6A 2L0PA 1W9ZA 2JC2A 3BYAA 3DY9A 1QVIZ 1PULA 4N1FA 1C7VA 1KCYA 1PSRA 3CTNA 1MHOA 3SJSA 5HYDA 1LKJA 1FW4A 2F2PA 2BNXA 3GK2A 4N1GA 1NPQA 1BF5A 1U5IA 2K2AA 2Y4QA 2PYQA 1BMOA 3B6XA 2ZN8A 2MA2A 2M9GA 2JNFA 2Q4UA 4DCKA 3D76A 4NDDA 1A29A 3EK8A 3H4SE 3TDUA 1JSAA 1CLMA 1XK4C 1MR8A 1F4QA 1KK7Y 2LLSA 1H8BA 4M2PA 1B4CA 1ZUZA 1DGUA 2BL0C 1OW4A 1NX0A 2KFHA 1Y1UA 2WCJA 3OX5A 5HKYA 1SL9A 2ZKMX 2KI6C 1P28A 1KK8C 2BCBA 2KAYA 2K2FA 1DTLA 2EC6C 2SASA 1QASA 2KDHA 5AANA 4P2YB 3I5IC 2KGRA 1MXLC 1TNQA 3NHTA 1DC1A 1Z4HA 1UHNA 4DUQA 2MHHA 2ZRTA 3HX4A 2GTEA 4F7FA 1PRWA 2KI4C 1MUXA 1QX2A 1K94A 2P70A 4WRIA 3FS7A 1XFUO 1QIWA 1N2DA 1K2HA 1DGVA 4USLA 2NCOA 5ER4X 4A4CA 4YGDB 2L2EA 2KHNA 4N5XA 3E3RA 1PVAA 2AAOA 1YTZC 4INWA 1JF2A 4GAOA 2M7LA 2LVVA 1OMVA 3VRRA 2M3WA 5IBWA 5FI2A 1TOPA 3EVRA 2JRFA 2E30A 4I5KA 1DELA 3IVTA
chains in the Genus database with same CATH topology
1WY9A 4HSZA 1IJ5A 2KI6D 3GK4X 5JJGA 1OMRA 2JU0A 1YURA 2QPTA 4DIRA 1IQ3A 4PHJA 1QS7A 1ZFSA 4MLWA 1NCYA 1YR5A 1UURA 5KU1A 2F33A 1X02A 1MF8B 1YX8A 4C0KA 3OP0A 1Y1AA 1F71A 1KFUS 4JPZB 1NCZA 1KQVA 1JUOA 1Y0VH 1CDMA 4YGAA 1CFCA 2AUCA 3NSIA 1SY9A 1QLSA 1K96A 1UUSA 4I5LB 2G2BA 1TNPA 2IS9A 1RK9A 4U8DA 4A4BA 5KSZA 2HQ8A 2OTGB 1YUTA 2PALA 1IWQA 1DVIA 1XFXO 1A75B 1E8AA 1A75A 1OOJA 1XVJA 3D10A 1J7RA 1YVLA 3I5HC 1IJ6A 3I5FB 3SG2A 1XFYO 3JTDC 4PE4A 4BY4A 1FI6A 3SG6A 3IF7A 1CDLA 1K9KA 3EK4A 4MEWA 3LK1A 3AKAA 2KFGA 1KSMA 3KEVA 4WQ2A 3EKJA 2MBXA 2CBLA 4PDZA 1TCFA 2MLEC 3BUMB 1DT7B 1UWOA 3PFVA 4NQGA 2NLNA 1FPWA 2WCFA 5AERA 1IG5A 3GK1A 5FYXA 5I2LA 1WRZA 1MQ1A 1KWOB 1SMGA 1ZACA 3SG7A 1WLMA 5BPJA 2JT0A 3GOFA 4ORAB 1NUBA 1HT9A 4F0ZB 4IL1A 2F8PA 4FTGA 3F45A 1SYMA 2CNPA 1WRLA 5K89A 1CFFA 1ALWA 2PASA 4AOMA 2LANA 1BT6A 3CZTX 3NXAA 4YGCB 1IQ5A 1CNPA 1BJFA 2BCXA 3LL8B 1G4YR 2O60A 1V1FA 2RGIA 2V53A 2M7NA 1LA3A 2BCAA 1H4BA 1TCOB 1L2OB 1UHIA 3DF0A 3TS5B 2L4HA 1YX7A 1M31A 1QIVA 1RWYA 1CKKA 1S6JA 4DRWA 4PE7A 3CGAA 4GUKA 5DKNA 2QACA 3RM1A 1WRKA 2H61A 4I5NB 4D1EA 3TZ1A 3FWCA 5D7FA 3TDZA 2HQWA 2LVKA 2WOSA 4GBAA 5CSFA 1YUSA 4CLNA 4DS7A 2FCEA 4ZCVA 1QXPA 2BBNA 2ZFDA 2JNXA 3LK0A 2KQYA 4MN0A 1KFXL 2JT8A 2WC8A 2Q91A 1AJ5A 3DD4A 1J7OA 2PRUA 2LP3A 4MBEA 3CR5X 1Y6WA 2LC5A 2LNKA 2WNDA 4ZCUA 3BUOB 5ER5A 1EH2A 2JT3A 3EVUA 1GGWA 5I2QA 2KGBC 1SL7A 4PALA 1RROA 2MAZA 1XFZO 5PALA 4MSPA 3SIAA 1NIWA 1MWNA 1K90D 1OSAA 1SNLA 2OS8B 3FWBA 4PE1A 5AFPA 5AEQA 2OTGC 2H2KA 4TNCA 1SL8A 2JZIA 1TIZA 2BKIB 4YI8A 4CFRA 1ODBA 1J7PA 3I5FC 4MVFA 1F55A 2L4IA 3DVMA 3PLFB 1HQVA 3KF9A 1G8IA 1SCMB 1M45A 1RJVA 1SRAA 2O5GA 2LHIA 3BOWB 2LCPA 3D0YA 2F3ZA 3D0YB 3K21A 1JC2A 3NSKA 2JULA 3AAJA 4NDCA 4PHKA 4CPVA 3FIAA 3CWGA 4JQ0D 2GGMA 4M2QA 4PHNA 1DMOA 4MZKA 4OKHA 1WDCB 2JQ6A 3EK7A 2LUXA 1KWOC 3CR2A 1MXEA 1FI5A 3WHTB 3PN7B 1AK8A 2F2OA 2WCBA 1JF0A 1SR6B 1YRTB 3BUNB 1NWDA 4UPGA 4Q04A 2LUCA 1BODA 1XA5A 1KSOA 2JTTA 2K8MB 1DJGA 1B7TY 5CSJA 1IGVA 1CTRA 2OPOA 2K7DA 2CCMA 3BXKA 5HKZA 1B8CA 3AKBA 2K7OA 1QLKA 5TNCA 1KQMC 2KBMA 4GGNA 3TUYC 2HF5A 3O4YA 1EG3A 1BOCA 4L9MA 5D69A 3DVKA 1J55A 1LINA 2LMTA 1L2OC 3NSOA 1QX5B 4QJ5B 2BL0B 1CLLA 2M0RA 2HETA 2VRGA 4HRHA 1JWDA 1PALA 3SG5A 1DJHA 1QVIY 1KK8B 4PE0A 2M97A 2EC6B 5I8NA 2L50A 5AXIA 4R1EA 1FF1A 2H61C 2PMYA 4HREE 3I5IB 2LHLA 4M2OA 1B8RA 2KSPA 2M1UA 4YGEB 2LMVA 2EGDA 1NP8A 1YVHA 1NSHA 1S6IA 1A2XA 1BU3A 4GFTA 4XYNA 1RECA 2DOQA 2GV5A 1PSBA 3WHUB 1CMGA 1GGZA 2K7BA 3I5GB 2I7AA 4YBHB 1SW8A 4I5JA 4QJ4B 1S5GZ 1B1GA 1KFUL 1RTP1 1AVSA 1F4OA 2COLB 2M29A 4YRUA 4GGFA 4ICBA 4CIDA 1UHJA 1EL4A 1K9PA 4ORBB 2M49B 1NX3A 3OHMB 4E68A 2OS8C 1TNXA 3EVVA 3OB2B 3VGOA 2M8UA 5J3XA 1KFXS 2CT9A 2BECA 3C1VA 2FCDA 2Y1MA 3SG3A 1NCXA 3O6BA 2L98A 1LVCD 2BE6A 1QJTA 2EHBA 2LMUA 1SCMC 1A4PA 1Y1XA 2SCPA 1XYDA 5CSNA 1J7QA 1JFKA 1UP5A 1EXRA 1M39A 3ZNIA 3IQQA 1QX7A 3O78A 1K95A 2WORA 1S1EA 5DKQA 1ZOTB 1WDCC 3WXAA 3I5HB 4GNKB 1OZOA 5HLVA 1B9AA 3JTDB 2L5XB 2Y5IA 4C0LA 1DF0B 5GQQC 2WCEA 4XJKB 5DKRA 1YUUA 4XJKA 1SK6D 1XO5A 2AMIA 4MRYA 4OV2A 2JOJA 1CDPA 1NX1A 2GGZA 1GQMA 2LVIA 4OVNF 4OR9B 1U5IB 3HCMA 2KYCA 4WQ3A 2KAXA 3KO0A 1D1OA 2LAPA 1C7WA 2NXQA 2E6WA 1AP4A 1K8UA 3BQ3A 2KFFA 4JWQA 1C07A 5I2OA 4YI9A 1QTXA 3CS1A 5HLOA 1JFJA 1TRFA 1CDNA 1A03A 3VRQA 1SPYA 1AUIB 1VRKA 3BOWA 4YGBB 2LVJA 1IH0A 1DJYA 1UHHA 2ZNEA 3JVTB 1R2UA 3DVJA 2HPSA 3O2PA 1TN4A 4AQJA 4C0JA 2B1UA 2K0JA 3EKHA 1XFWO 3A8RA 1GJYA 1TNWA 2KBIA 3I5GC 1S5GY 3MSEB 1W7JB 1J1DA 1M63B 1NYAA 1BR4B 1XFVO 3LLEA 3PSRA 1OQPA 1DJXA 1CFPA 4GGFC 2K61A 3A4UB 3PM8A 1TTXA 1BG1A 1CB1A 4QJ3B 1J1EA 2MJWB 2NZ0A 3PALA 1R6PA 3CLNA 3PATA 3ZWHA 1DJZA 2TN4A 1SBJA 1XK4A 1N0YA 2JWWA 4HRGA 1SCVA 3CR4X 2ZRSA 4PHMA 3TS5C 1KK7Z 2LP2A 1AJ4A 1OZSA 2PVBA 1EJ3A 1K9UA 2KAVA 1FBVA 1OE9B 1QV0A 1S26D 3QRXA 5G08A 1UHKA 1IRJA 5CSIA 1DJIA 1S3PA 2I18A 1CM1A 2LE9B 3ICBA 2BKHB 3VRNA 5CPVA 2I94A 3VRPA 2KNEA 2I2RE 3WNXB 1QATA 5B8IB 2LLTA 1BR1B 1ZMZA 2FOTA 3SIBA 3TDIA 3AAKA 2KOTA 2M1KB 2KYFA 2KI4B 4GPLB 2JTZA 1WLZA 3BUWB 3KHEA 3OB1B 4OCIA 2D8NA 2LM5A 2ZNDA 1M46A 2ZN9A 1AHRA 1K93D 3KPXA 1B8LA 1SKTA 4MZLA 4PCWA 5JOLA 2L51A 4AQIA 1JBAA 1RFJA 1QV1A 1PK0D 1PVBA 2BBMA 2FJUB 3M0WA 3SG4A 2LLUA 1F54A 2P6BB 1S36A 1W7IB 3LCPC 4MRXA 2MRDA 2MLFC 1CM4A 2KQ6A 1CMFA 3DVEA 1Q80A 4FQOA 1S6CA 1F70A 1CLBA 2JXCA 1B47A 5HKWA 1NX2A 4P5OE 1IKUA 1B7TZ 1KQMB 1LXFC 1F8HA 2F3YA 3OX6A 4BY5A 1BLQA 2LV7A 1YRUB 3TUYB 4CFQA 1CFDA 2BE4A 2CTNA 3JVTC 1V1GA 2A4JA 2Y1NA 2R2IA 4NDBA 1LA0A 1N65A 1DJWA 5KTYA 2ISDA 1ALVA 4ETOA 2JPTA 2K7CA 4ORCB 2NCPA 3DF0B 3PN7C 4MZJA 1G33A 3NSLA 1SR6C 2JXLA 5F6TA 2G9BA 1DF0A 2PSRA 3IQOA 3BUXB 3VROA 1L7ZA 1OMDA 1EG4A 2CXJA 3RLZA 2L0PA 3BYAA 2JC2A 4N1FA 1QVIZ 1PULA 1C7VA 1KCYA 1PSRA 3CTNA 1MHOA 3SJSA 5HYDA 1LKJA 1FW4A 2F2PA 3GK2A 4N1GA 1NPQA 1BF5A 1U5IA 2K2AA 2Y4QA 1BMOA 2ZN8A 2MA2A 2M9GA 2JNFA 2Q4UA 4DCKA 1JSAA 4NDDA 1A29A 3EK8A 3H4SE 3TDUA 1CLMA 1XK4C 1MR8A 1F4QA 1KK7Y 2LLSA 1H8BA 4M2PA 1B4CA 1ZUZA 1DGUA 2BL0C 3OX5A 1NX0A 2KFHA 1Y1UA 5HKYA 1SL9A 2ZKMX 2KI6C 1KK8C 2BCBA 2KAYA 2K2FA 1DTLA 2EC6C 2SASA 1QASA 2KDHA 5AANA 4P2YB 3I5IC 2KGRA 1MXLC 1TNQA 1UHNA 4DUQA 2MHHA 2ZRTA 3HX4A 1PRWA 2KI4C 1MUXA 1QX2A 1K94A 4WRIA 3FS7A 1XFUO 1QIWA 1N2DA 1K2HA 1DGVA 4USLA 2NCOA 5ER4X 4A4CA 4YGDB 2L2EA 2KHNA 4N5XA 3E3RA 1PVAA 2AAOA 1YTZC 1JF2A 4GAOA 2M7LA 2LVVA 1OMVA 3VRRA 2M3WA 5IBWA 1TOPA 3EVRA 2JRFA 2E30A 4I5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY9 A;  4HSZ A;  1IJ5 A;  2KI6 D;  3GK4 X;  5JJG A;  1OMR A;  2JU0 A;  1YUR A;  2QPT A;  4DIR A;  1IQ3 A;  4PHJ A;  1QS7 A;  1ZFS A;  4MLW A;  1NCY A;  1YR5 A;  1UUR A;  5KU1 A;  2F33 A;  1X02 A;  1MF8 B;  1YX8 A;  4C0K A;  3OP0 A;  1Y1A A;  1F71 A;  1KFU S;  4JPZ B;  1NCZ A;  1KQV A;  1JUO A;  1Y0V H;  1CDM A;  4YGA A;  1CFC A;  2AUC A;  3NSI A;  1SY9 A;  1QLS A;  1K96 A;  1UUS A;  4I5L B;  2G2B A;  1TNP A;  2IS9 A;  1RK9 A;  4U8D A;  4A4B A;  5KSZ A;  2HQ8 A;  2OTG B;  1YUT A;  2PAL A;  1IWQ A;  1DVI A;  1XFX O;  1A75 B;  1E8A A;  1A75 A;  1OOJ A;  1XVJ A;  3D10 A;  1J7R A;  1YVL A;  3I5H C;  1IJ6 A;  3I5F B;  3SG2 A;  1XFY O;  3JTD C;  4PE4 A;  4BY4 A;  1FI6 A;  3SG6 A;  3IF7 A;  1CDL A;  1K9K A;  3EK4 A;  4MEW A;  3LK1 A;  3AKA A;  2KFG A;  1KSM A;  3KEV A;  4WQ2 A;  3EKJ A;  2MBX A;  2CBL A;  4PDZ A;  1TCF A;  2MLE C;  3BUM B;  1DT7 B;  1UWO A;  3PFV A;  4NQG A;  2NLN A;  1FPW A;  2WCF A;  5AER A;  1IG5 A;  3GK1 A;  5FYX A;  5I2L A;  1WRZ A;  1MQ1 A;  1KWO B;  1SMG A;  1ZAC A;  3SG7 A;  1WLM A;  5BPJ A;  2JT0 A;  3GOF A;  4ORA B;  1NUB A;  1HT9 A;  4F0Z B;  4IL1 A;  2F8P A;  4FTG A;  3F45 A;  1SYM A;  2CNP A;  1WRL A;  5K89 A;  1CFF A;  1ALW A;  2PAS A;  4AOM A;  2LAN A;  1BT6 A;  3CZT X;  3NXA A;  4YGC B;  1IQ5 A;  1CNP A;  1BJF A;  2BCX A;  3LL8 B;  1G4Y R;  2O60 A;  1V1F A;  2RGI A;  2V53 A;  2M7N A;  1LA3 A;  2BCA A;  1H4B A;  1TCO B;  1L2O B;  1UHI A;  3DF0 A;  3TS5 B;  2L4H A;  1YX7 A;  1M31 A;  1QIV A;  1RWY A;  1CKK A;  1S6J A;  4DRW A;  4PE7 A;  3CGA A;  4GUK A;  5DKN A;  2QAC A;  3RM1 A;  1WRK A;  2H61 A;  4I5N B;  4D1E A;  3TZ1 A;  3FWC A;  5D7F A;  3TDZ A;  2HQW A;  2LVK A;  2WOS A;  4GBA A;  5CSF A;  1YUS A;  4CLN A;  4DS7 A;  2FCE A;  4ZCV A;  1QXP A;  2BBN A;  2ZFD A;  2JNX A;  3LK0 A;  2KQY A;  4MN0 A;  1KFX L;  2JT8 A;  2WC8 A;  2Q91 A;  1AJ5 A;  3DD4 A;  1J7O A;  2PRU A;  2LP3 A;  4MBE A;  3CR5 X;  1Y6W A;  2LC5 A;  2LNK A;  2WND A;  4ZCU A;  3BUO B;  5ER5 A;  1EH2 A;  2JT3 A;  3EVU A;  1GGW A;  5I2Q A;  2KGB C;  1SL7 A;  4PAL A;  1RRO A;  2MAZ A;  1XFZ O;  5PAL A;  4MSP A;  3SIA A;  1NIW A;  1MWN A;  1K90 D;  1OSA A;  1SNL A;  2OS8 B;  3FWB A;  4PE1 A;  5AFP A;  5AEQ A;  2OTG C;  2H2K A;  4TNC A;  1SL8 A;  2JZI A;  1TIZ A;  2BKI B;  4YI8 A;  4CFR A;  1ODB A;  1J7P A;  3I5F C;  4MVF A;  1F55 A;  2L4I A;  3DVM A;  3PLF B;  1HQV A;  3KF9 A;  1G8I A;  1SCM B;  1M45 A;  1RJV A;  1SRA A;  2O5G A;  2LHI A;  3BOW B;  2LCP A;  3D0Y A;  2F3Z A;  3D0Y B;  3K21 A;  1JC2 A;  3NSK A;  2JUL A;  3AAJ A;  4NDC A;  4PHK A;  4CPV A;  3FIA A;  3CWG A;  4JQ0 D;  2GGM A;  4M2Q A;  4PHN A;  1DMO A;  4MZK A;  4OKH A;  1WDC B;  2JQ6 A;  3EK7 A;  2LUX A;  1KWO C;  3CR2 A;  1MXE A;  1FI5 A;  3WHT B;  3PN7 B;  1AK8 A;  2F2O A;  2WCB A;  1JF0 A;  1SR6 B;  1YRT B;  3BUN B;  1NWD A;  4UPG A;  4Q04 A;  2LUC A;  1BOD A;  1XA5 A;  1KSO A;  2JTT A;  2K8M B;  1DJG A;  1B7T Y;  5CSJ A;  1IGV A;  1CTR A;  2OPO A;  2K7D A;  2CCM A;  3BXK A;  5HKZ A;  1B8C A;  3AKB A;  2K7O A;  1QLK A;  5TNC A;  1KQM C;  2KBM A;  4GGN A;  3TUY C;  2HF5 A;  3O4Y A;  1EG3 A;  1BOC A;  4L9M A;  5D69 A;  3DVK A;  1J55 A;  1LIN A;  2LMT A;  1L2O C;  3NSO A;  1QX5 B;  4QJ5 B;  2BL0 B;  1CLL A;  2M0R A;  2HET A;  2VRG A;  4HRH A;  1JWD A;  1PAL A;  3SG5 A;  1DJH A;  1QVI Y;  1KK8 B;  4PE0 A;  2M97 A;  2EC6 B;  5I8N A;  2L50 A;  5AXI A;  4R1E A;  1FF1 A;  2H61 C;  2PMY A;  4HRE E;  3I5I B;  2LHL A;  4M2O A;  1B8R A;  2KSP A;  2M1U A;  4YGE B;  2LMV A;  2EGD A;  1NP8 A;  1YVH A;  1NSH A;  1S6I A;  1A2X A;  1BU3 A;  4GFT A;  4XYN A;  1REC A;  2DOQ A;  2GV5 A;  1PSB A;  3WHU B;  1CMG A;  1GGZ A;  2K7B A;  3I5G B;  2I7A A;  4YBH B;  1SW8 A;  4I5J A;  4QJ4 B;  1S5G Z;  1B1G A;  1KFU L;  1RTP 1;  1AVS A;  1F4O A;  2COL B;  2M29 A;  4YRU A;  4GGF A;  4ICB A;  4CID A;  1UHJ A;  1EL4 A;  1K9P A;  4ORB B;  2M49 B;  1NX3 A;  3OHM B;  4E68 A;  2OS8 C;  1TNX A;  3EVV A;  3OB2 B;  3VGO A;  2M8U A;  5J3X A;  1KFX S;  2CT9 A;  2BEC A;  3C1V A;  2FCD A;  2Y1M A;  3SG3 A;  1NCX A;  3O6B A;  2L98 A;  1LVC D;  2BE6 A;  1QJT A;  2EHB A;  2LMU A;  1SCM C;  1A4P A;  1Y1X A;  2SCP A;  1XYD A;  5CSN A;  1J7Q A;  1JFK A;  1UP5 A;  1EXR A;  1M39 A;  3ZNI A;  3IQQ A;  1QX7 A;  3O78 A;  1K95 A;  2WOR A;  1S1E A;  5DKQ A;  1ZOT B;  1WDC C;  3WXA A;  3I5H B;  4GNK B;  1OZO A;  5HLV A;  1B9A A;  3JTD B;  2L5X B;  2Y5I A;  4C0L A;  1DF0 B;  5GQQ C;  2WCE A;  4XJK B;  5DKR A;  1YUU A;  4XJK A;  1SK6 D;  1XO5 A;  2AMI A;  4MRY A;  4OV2 A;  2JOJ A;  1CDP A;  1NX1 A;  2GGZ A;  1GQM A;  2LVI A;  4OVN F;  4OR9 B;  1U5I B;  3HCM A;  2KYC A;  4WQ3 A;  2KAX A;  3KO0 A;  1D1O A;  2LAP A;  1C7W A;  2NXQ A;  2E6W A;  1AP4 A;  1K8U A;  3BQ3 A;  2KFF A;  4JWQ A;  1C07 A;  5I2O A;  4YI9 A;  1QTX A;  3CS1 A;  5HLO A;  1JFJ A;  1TRF A;  1CDN A;  1A03 A;  3VRQ A;  1SPY A;  1AUI B;  1VRK A;  3BOW A;  4YGB B;  2LVJ A;  1IH0 A;  1DJY A;  1UHH A;  2ZNE A;  3JVT B;  1R2U A;  3DVJ A;  2HPS A;  3O2P A;  1TN4 A;  4AQJ A;  4C0J A;  2B1U A;  2K0J A;  3EKH A;  1XFW O;  3A8R A;  1GJY A;  1TNW A;  2KBI A;  3I5G C;  1S5G Y;  3MSE B;  1W7J B;  1J1D A;  1M63 B;  1NYA A;  1BR4 B;  1XFV O;  3LLE A;  3PSR A;  1OQP A;  1DJX A;  1CFP A;  4GGF C;  2K61 A;  3A4U B;  3PM8 A;  1TTX A;  1BG1 A;  1CB1 A;  4QJ3 B;  1J1E A;  2MJW B;  2NZ0 A;  3PAL A;  1R6P A;  3CLN A;  3PAT A;  3ZWH A;  1DJZ A;  2TN4 A;  1SBJ A;  1XK4 A;  1N0Y A;  2JWW A;  4HRG A;  1SCV A;  3CR4 X;  2ZRS A;  4PHM A;  3TS5 C;  1KK7 Z;  2LP2 A;  1AJ4 A;  1OZS A;  2PVB A;  1EJ3 A;  1K9U A;  2KAV A;  1FBV A;  1OE9 B;  1QV0 A;  1S26 D;  3QRX A;  5G08 A;  1UHK A;  1IRJ A;  5CSI A;  1DJI A;  1S3P A;  2I18 A;  1CM1 A;  2LE9 B;  3ICB A;  2BKH B;  3VRN A;  5CPV A;  2I94 A;  3VRP A;  2KNE A;  2I2R E;  3WNX B;  1QAT A;  5B8I B;  2LLT A;  1BR1 B;  1ZMZ A;  2FOT A;  3SIB A;  3TDI A;  3AAK A;  2KOT A;  2M1K B;  2KYF A;  2KI4 B;  4GPL B;  2JTZ A;  1WLZ A;  3BUW B;  3KHE A;  3OB1 B;  4OCI A;  2D8N A;  2LM5 A;  2ZND A;  1M46 A;  2ZN9 A;  1AHR A;  1K93 D;  3KPX A;  1B8L A;  1SKT A;  4MZL A;  4PCW A;  5JOL A;  2L51 A;  4AQI A;  1JBA A;  1RFJ A;  1QV1 A;  1PK0 D;  1PVB A;  2BBM A;  2FJU B;  3M0W A;  3SG4 A;  2LLU A;  1F54 A;  2P6B B;  1S36 A;  1W7I B;  3LCP C;  4MRX A;  2MRD A;  2MLF C;  1CM4 A;  2KQ6 A;  1CMF A;  3DVE A;  1Q80 A;  4FQO A;  1S6C A;  1F70 A;  1CLB A;  2JXC A;  1B47 A;  5HKW A;  1NX2 A;  4P5O E;  1IKU A;  1B7T Z;  1KQM B;  1LXF C;  1F8H A;  2F3Y A;  3OX6 A;  4BY5 A;  1BLQ A;  2LV7 A;  1YRU B;  3TUY B;  4CFQ A;  1CFD A;  2BE4 A;  2CTN A;  3JVT C;  1V1G A;  2A4J A;  2Y1N A;  2R2I A;  4NDB A;  1LA0 A;  1N65 A;  1DJW A;  5KTY A;  2ISD A;  1ALV A;  4ETO A;  2JPT A;  2K7C A;  4ORC B;  2NCP A;  3DF0 B;  3PN7 C;  4MZJ A;  1G33 A;  3NSL A;  1SR6 C;  2JXL A;  5F6T A;  2G9B A;  1DF0 A;  2PSR A;  3IQO A;  3BUX B;  3VRO A;  1L7Z A;  1OMD A;  1EG4 A;  2CXJ A;  3RLZ A;  2L0P A;  3BYA A;  2JC2 A;  4N1F A;  1QVI Z;  1PUL A;  1C7V A;  1KCY A;  1PSR A;  3CTN A;  1MHO A;  3SJS A;  5HYD A;  1LKJ A;  1FW4 A;  2F2P A;  3GK2 A;  4N1G A;  1NPQ A;  1BF5 A;  1U5I A;  2K2A A;  2Y4Q A;  1BMO A;  2ZN8 A;  2MA2 A;  2M9G A;  2JNF A;  2Q4U A;  4DCK A;  1JSA A;  4NDD A;  1A29 A;  3EK8 A;  3H4S E;  3TDU A;  1CLM A;  1XK4 C;  1MR8 A;  1F4Q A;  1KK7 Y;  2LLS A;  1H8B A;  4M2P A;  1B4C A;  1ZUZ A;  1DGU A;  2BL0 C;  3OX5 A;  1NX0 A;  2KFH A;  1Y1U A;  5HKY A;  1SL9 A;  2ZKM X;  2KI6 C;  1KK8 C;  2BCB A;  2KAY A;  2K2F A;  1DTL A;  2EC6 C;  2SAS A;  1QAS A;  2KDH A;  5AAN A;  4P2Y B;  3I5I C;  2KGR A;  1MXL C;  1TNQ A;  1UHN A;  4DUQ A;  2MHH A;  2ZRT A;  3HX4 A;  1PRW A;  2KI4 C;  1MUX A;  1QX2 A;  1K94 A;  4WRI A;  3FS7 A;  1XFU O;  1QIW A;  1N2D A;  1K2H A;  1DGV A;  4USL A;  2NCO A;  5ER4 X;  4A4C A;  4YGD B;  2L2E A;  2KHN A;  4N5X A;  3E3R A;  1PVA A;  2AAO A;  1YTZ C;  1JF2 A;  4GAO A;  2M7L A;  2LVV A;  1OMV A;  3VRR A;  2M3W A;  5IBW A;  1TOP A;  3EVR A;  2JRF A;  2E30 A;  4I5K A; 
#chains in the Genus database with same CATH topology
 1WY9 A;  4HSZ A;  1IJ5 A;  2KI6 D;  3GK4 X;  5JJG A;  1OMR A;  2JU0 A;  1YUR A;  2QPT A;  4DIR A;  1IQ3 A;  4PHJ A;  1QS7 A;  1ZFS A;  4MLW A;  1NCY A;  1YR5 A;  1UUR A;  5KU1 A;  2F33 A;  1X02 A;  1MF8 B;  1YX8 A;  4C0K A;  3OP0 A;  1Y1A A;  1F71 A;  1KFU S;  4JPZ B;  1NCZ A;  1KQV A;  1JUO A;  1Y0V H;  1CDM A;  4YGA A;  1CFC A;  2AUC A;  3NSI A;  1SY9 A;  1QLS A;  1K96 A;  1UUS A;  4I5L B;  2G2B A;  1TNP A;  2IS9 A;  1RK9 A;  2WCK A;  4U8D A;  1OOF A;  1TWO A;  4A4B A;  5KSZ A;  2HQ8 A;  2OTG B;  1YUT A;  2PAL A;  1IWQ A;  1DVI A;  1XFX O;  1A75 B;  1E8A A;  1A75 A;  1OOJ A;  1XVJ A;  3D10 A;  3Q8I A;  1J7R A;  1YVL A;  2QEB A;  3I5H C;  1DQE A;  1IJ6 A;  3I5F B;  3D74 A;  1XFY O;  3FE8 A;  3JTD C;  2L5Y A;  4PE4 A;  3SG2 A;  3SG6 A;  4BY4 A;  3IF7 A;  1CDL A;  1K9K A;  3S0A A;  3EK4 A;  4MEW A;  3LK1 A;  3AKA A;  3FE6 A;  1XFR A;  3DYE A;  2KFG A;  1KSM A;  3KEV A;  4WQ2 A;  3EKJ A;  1C3Y A;  3BFH A;  3CAB A;  2MBX A;  2CBL A;  4PDZ A;  1TCF A;  4FQT A;  2MLE C;  3SS3 A;  3BUM B;  1DT7 B;  1UWO A;  3PFV A;  4NQG A;  2NLN A;  2QDI A;  1FPW A;  2WCF A;  5AER A;  1IG5 A;  3GK1 A;  5FYX A;  5I2L A;  1WRZ A;  1MQ1 A;  1KWO B;  1SMG A;  1ZAC A;  3SG7 A;  3K1E A;  1WLM A;  5BPJ A;  2JT0 A;  3GOF A;  4ORA B;  1NUB A;  1HT9 A;  3UNW A;  4F0Z B;  4IL1 A;  2F8P A;  5FI7 A;  4FTG A;  3F45 A;  1SYM A;  2CNP A;  3R1P A;  1WRL A;  5K89 A;  1CFF A;  1ALW A;  2PAS A;  3V2L A;  4AOM A;  2LAN A;  1BT6 A;  3CZT X;  3NXA A;  4YGC B;  1IQ5 A;  1CNP A;  1BJF A;  4OZD A;  2BCX A;  3LL8 B;  1G4Y R;  2O60 A;  1V1F A;  2RGI A;  2V53 A;  2M7N A;  1LA3 A;  2BCA A;  3D75 A;  3R72 A;  1H4B A;  1TCO B;  1L2O B;  1UHI A;  2PQL A;  3DF0 A;  2BAP A;  3OGN A;  3TS5 B;  2L4H A;  3DZT A;  1YX7 A;  1M31 A;  1QIV A;  1RWY A;  1CKK A;  1S6J A;  4DRW A;  4PE7 A;  3CGA A;  4GUK A;  5DKN A;  2QAC A;  3RM1 A;  1WRK A;  3UO9 A;  2H61 A;  4I5N B;  4D1E A;  3TZ1 A;  3B88 A;  3FWC A;  5D7F A;  3TDZ A;  3CZ1 A;  2HQW A;  2LVK A;  2WOS A;  4GBA A;  5CSF A;  1YUS A;  4CLN A;  4DS7 A;  3RZS A;  1FI6 A;  1T14 A;  2FCE A;  4ZCV A;  1QXP A;  2BBN A;  2P71 A;  2JNX A;  2ZFD A;  3LK0 A;  2KQY A;  4MN0 A;  1KFX L;  2JT8 A;  4IJ7 A;  2WC8 A;  2Q91 A;  1AJ5 A;  3DD4 A;  1J7O A;  2PRU A;  2LP3 A;  4MBE A;  3CR5 X;  1Y6W A;  2LC5 A;  2LNK A;  2WND A;  4ZCU A;  3B7A A;  3BUO B;  5ER5 A;  1EH2 A;  2JT3 A;  2WC5 A;  3EVU A;  5EL2 A;  2KGB C;  1SL7 A;  2H8V A;  4PAL A;  1RRO A;  5I2Q A;  1GGW A;  2MAZ A;  1XFZ O;  5PAL A;  4MSP A;  3SIA A;  3D73 A;  1NIW A;  1MWN A;  1K90 D;  1OSA A;  1SNL A;  2OS8 B;  3FWB A;  4PE1 A;  5AFP A;  5AEQ A;  2OTG C;  2H2K A;  4JD9 A;  4TNC A;  1SL8 A;  2JZI A;  1TIZ A;  2BKI B;  4YI8 A;  4CFR A;  1ODB A;  1J7P A;  3I5F C;  4MVF A;  1F55 A;  2L4I A;  3DVM A;  3PLF B;  1HQV A;  1ORG A;  1G8I A;  3KF9 A;  1SCM B;  1M45 A;  1RJV A;  1SRA A;  2O5G A;  2LHI A;  3BOW B;  2LCP A;  3D0Y A;  2F3Z A;  3D0Y B;  3K21 A;  1JC2 A;  3NSK A;  2JUL A;  3AAJ A;  4NDC A;  4PHK A;  4CPV A;  3FIA A;  3CWG A;  4JQ0 D;  2GGM A;  4M2Q A;  4PHN A;  1DMO A;  4MZK A;  4OKH A;  1WDC B;  2JQ6 A;  3EK7 A;  2LUX A;  1KWO C;  3CR2 A;  1MXE A;  1FI5 A;  3WHT B;  3PN7 B;  1AK8 A;  2F2O A;  2WCB A;  1JF0 A;  1SR6 B;  1YRT B;  3BUN B;  1NWD A;  4UPG A;  1GM0 A;  4Q04 A;  2QEV A;  2LUC A;  2JPO A;  1BOD A;  3L4A A;  3B87 A;  1XA5 A;  1KSO A;  2JTT A;  2K8M B;  1OOI X;  1DJG A;  1B7T Y;  5CSJ A;  1IGV A;  1CTR A;  2OPO A;  2K7D A;  2CCM A;  3BXK A;  5HKZ A;  1B8C A;  3AKB A;  2K7O A;  3N7H A;  1QLK A;  5TNC A;  1KQM C;  2KBM A;  4GGN A;  3BJH A;  3TUY C;  2HF5 A;  3O4Y A;  1EG3 A;  1BOC A;  4L9M A;  4JKT A;  5D69 A;  3DVK A;  1J55 A;  1LIN A;  2LMT A;  1L2O C;  3NSO A;  1QX5 B;  4QJ5 B;  2BL0 B;  1CLL A;  2M0R A;  2HET A;  2VRG A;  4HRH A;  1JWD A;  1PAL A;  3SG5 A;  1DJH A;  4KYN A;  1QVI Y;  1KK8 B;  4PE0 A;  2M97 A;  2EC6 B;  3PM2 A;  5I8N A;  2L50 A;  5AXI A;  4R1E A;  1FF1 A;  2H61 C;  2PMY A;  4HRE E;  3I5I B;  2LHL A;  4M2O A;  1B8R A;  2KSP A;  2M1U A;  4YGE B;  2LMV A;  2EGD A;  1NP8 A;  1YVH A;  1NSH A;  1S6I A;  1A2X A;  1BU3 A;  4GFT A;  4XYN A;  1REC A;  2DOQ A;  2GV5 A;  1PSB A;  3WHU B;  1CMG A;  1GGZ A;  2K7B A;  3I5G B;  2I7A A;  4YBH B;  1SW8 A;  4I5J A;  4QJ4 B;  1S5G Z;  1B1G A;  1KFU L;  1TUJ A;  1RTP 1;  1AVS A;  1F4O A;  2COL B;  2M29 A;  4YRU A;  4GGF A;  4ICB A;  3BFA A;  3R1V A;  4CID A;  1UHJ A;  1EL4 A;  1K9P A;  4ORB B;  2KLD A;  2M49 B;  1NX3 A;  3OHM B;  4E68 A;  2OS8 C;  1TNX A;  3EVV A;  3OB2 B;  3SS4 A;  3VGO A;  2M8U A;  3SS5 A;  5J3X A;  1KFX S;  2CT9 A;  2BEC A;  3C1V A;  2FCD A;  1IIO A;  1OOH A;  2Y1M A;  1NCX A;  3O6B A;  3SG3 A;  1QWV A;  3L4L A;  2L98 A;  1LVC D;  1QJT A;  2BE6 A;  2EHB A;  2LMU A;  2QEH A;  1SCM C;  1A4P A;  1Y1X A;  5HL1 A;  2SCP A;  1XYD A;  5CSN A;  1J7Q A;  1JFK A;  1UP5 A;  1EXR A;  1M39 A;  3ZNI A;  3IQQ A;  1QX7 A;  3O78 A;  1K95 A;  2WOR A;  1S1E A;  5DKQ A;  1ZOT B;  1WDC C;  3WXA A;  3I5H B;  4GNK B;  1OZO A;  2WCM A;  5HLV A;  1B9A A;  3JTD B;  2L2C A;  2L5X B;  2Y5I A;  1C3Z A;  4C0L A;  1DF0 B;  5GQQ C;  2WCE A;  4XJK B;  5DKR A;  1YUU A;  4XJK A;  1SK6 D;  1XO5 A;  2AMI A;  4MRY A;  4OV2 A;  2JOJ A;  1CDP A;  1NX1 A;  2GGZ A;  1GQM A;  2LVI A;  4OVN F;  4OR9 B;  1U5I B;  3HCM A;  2KYC A;  4WQ3 A;  2KAX A;  3KO0 A;  1D1O A;  2LAP A;  1C7W A;  3VB1 A;  3CZ0 A;  2NXQ A;  2E6W A;  1AP4 A;  1K8U A;  3BQ3 A;  2KFF A;  4JWQ A;  1C07 A;  5DIC A;  3CDN A;  2ERB A;  2KLE A;  4YI9 A;  5I2O A;  1QTX A;  3CS1 A;  5HLO A;  1JFJ A;  1TRF A;  1CDN A;  1A03 A;  3VRQ A;  1SPY A;  1AUI B;  1VRK A;  3BOW A;  4YGB B;  2LVJ A;  1IH0 A;  1DJY A;  1UHH A;  2ZNE A;  3JVT B;  1R2U A;  3DVJ A;  2HPS A;  3O2P A;  4INX A;  1TN4 A;  4AQJ A;  4C0J A;  2B1U A;  2K0J A;  3EKH A;  1XFW O;  3L47 A;  3A8R A;  1GJY A;  1TNW A;  2KBI A;  3BFB A;  1S5G Y;  3I5G C;  3MSE B;  1W7J B;  1J1D A;  1M63 B;  1NYA A;  1BR4 B;  1XFV O;  3B86 A;  3OBV A;  3R1O A;  3LLE A;  3S0E A;  3PSR A;  1OQP A;  1DJX A;  1CFP A;  4GGF C;  2K61 A;  3A4U B;  3PM8 A;  3D77 A;  2YGU A;  1TTX A;  1BG1 A;  3CYZ A;  1CB1 A;  3O4X A;  4QJ3 B;  1J1E A;  3S0F A;  2MJW B;  2NZ0 A;  3PAL A;  1R6P A;  3CLN A;  3PAT A;  3ZWH A;  1DJZ A;  2TN4 A;  3D78 A;  1SBJ A;  1XK4 A;  1N0Y A;  2JWW A;  4HRG A;  1SCV A;  3DXL A;  3CR4 X;  2ZRS A;  3NHI A;  4PHM A;  3TS5 C;  1KK7 Z;  2LP2 A;  1AJ4 A;  1OZS A;  2PVB A;  1EJ3 A;  1K9U A;  2KAV A;  1FBV A;  1OE9 B;  1QV0 A;  1S26 D;  3QRX A;  5G08 A;  1UHK A;  1IRJ A;  5CSI A;  1DJI A;  1S3P A;  2I18 A;  1CM1 A;  2LE9 B;  3ICB A;  1SSE B;  2BKH B;  3VRN A;  5CPV A;  2I94 A;  3VRP A;  2KNE A;  3S0B A;  2I2R E;  3WNX B;  1QAT A;  5B8I B;  2LLT A;  1BR1 B;  1ZMZ A;  2FOT A;  2FJY A;  3SIB A;  3TDI A;  3AAK A;  2KOT A;  2M1K B;  2KYF A;  1LS8 A;  2KI4 B;  4GPL B;  2JTZ A;  1WLZ A;  3BUW B;  3KHE A;  3OB1 B;  4OCI A;  2D8N A;  2LM5 A;  2ZND A;  1M46 A;  2ZN9 A;  3S0G A;  3CZ2 A;  1AHR A;  1K93 D;  2K60 A;  2QEO A;  3KPX A;  1B8L A;  1SKT A;  4MZL A;  4PCW A;  5JOL A;  2L51 A;  4PT1 A;  4AQI A;  1JBA A;  1RFJ A;  1QV1 A;  1PK0 D;  1PVB A;  2BBM A;  2FJU B;  1TUZ A;  3M0W A;  3S0D A;  3SG4 A;  2LLU A;  1F54 A;  2P6B B;  1S36 A;  1W7I B;  3LCP C;  4MRX A;  2MRD A;  2MLF C;  1CM4 A;  2KQ6 A;  1CMF A;  3DVE A;  2WCL A;  1Q80 A;  5D3O A;  4FQO A;  1S6C A;  5I94 A;  1F70 A;  3FE9 A;  1CLB A;  2JXC A;  1B47 A;  5HKW A;  1NX2 A;  1Z2C B;  4P5O E;  1IKU A;  1B7T Z;  1KQM B;  1LXF C;  1F8H A;  2F3Y A;  3OX6 A;  4BY5 A;  1BLQ A;  2LV7 A;  1YRU B;  3TUY B;  4CFQ A;  1CFD A;  2BE4 A;  2CTN A;  3JVT C;  1V1G A;  2A4J A;  2Y1N A;  2R2I A;  4NDB A;  3NGV A;  1LA0 A;  1N65 A;  1DJW A;  2WC6 A;  2WCH A;  2ISD A;  5KTY A;  1ALV A;  4ETO A;  2JPT A;  2K7C A;  3PJI A;  4ORC B;  1DEK A;  2NCP A;  3DF0 B;  3PN7 C;  2KPH A;  4MZJ A;  1G33 A;  1OOG A;  3NSL A;  1SR6 C;  2JXL A;  3QME A;  5F6T A;  2G9B A;  1DF0 A;  2PSR A;  3IQO A;  3BUX B;  3VRO A;  1L7Z A;  1OMD A;  1EG4 A;  2CXJ A;  3EG5 B;  3RLZ A;  5FI6 A;  2L0P A;  1W9Z A;  2JC2 A;  3BYA A;  3DY9 A;  1QVI Z;  1PUL A;  4N1F A;  1C7V A;  1KCY A;  1PSR A;  3CTN A;  1MHO A;  3SJS A;  5HYD A;  1LKJ A;  1FW4 A;  2F2P A;  2BNX A;  3GK2 A;  4N1G A;  1NPQ A;  1BF5 A;  1U5I A;  2K2A A;  2Y4Q A;  2PYQ A;  1BMO A;  3B6X A;  2ZN8 A;  2MA2 A;  2M9G A;  2JNF A;  2Q4U A;  4DCK A;  3D76 A;  4NDD A;  1A29 A;  3EK8 A;  3H4S E;  3TDU A;  1JSA A;  1CLM A;  1XK4 C;  1MR8 A;  1F4Q A;  1KK7 Y;  2LLS A;  1H8B A;  4M2P A;  1B4C A;  1ZUZ A;  1DGU A;  2BL0 C;  1OW4 A;  1NX0 A;  2KFH A;  1Y1U A;  2WCJ A;  3OX5 A;  5HKY A;  1SL9 A;  2ZKM X;  2KI6 C;  1P28 A;  1KK8 C;  2BCB A;  2KAY A;  2K2F A;  1DTL A;  2EC6 C;  2SAS A;  1QAS A;  2KDH A;  5AAN A;  4P2Y B;  3I5I C;  2KGR A;  1MXL C;  1TNQ A;  3NHT A;  1DC1 A;  1Z4H A;  1UHN A;  4DUQ A;  2MHH A;  2ZRT A;  3HX4 A;  2GTE A;  4F7F A;  1PRW A;  2KI4 C;  1MUX A;  1QX2 A;  1K94 A;  2P70 A;  4WRI A;  3FS7 A;  1XFU O;  1QIW A;  1N2D A;  1K2H A;  1DGV A;  4USL A;  2NCO A;  5ER4 X;  4A4C A;  4YGD B;  2L2E A;  2KHN A;  4N5X A;  3E3R A;  1PVA A;  2AAO A;  1YTZ C;  4INW A;  1JF2 A;  4GAO A;  2M7L A;  2LVV A;  1OMV A;  3VRR A;  2M3W A;  5IBW A;  5FI2 A;  1TOP A;  3EVR A;  2JRF A;  2E30 A;  4I5K A;  1DEL A;  3IVT A; 
#chains in the Genus database with same CATH homology
 1WY9 A;  4HSZ A;  1IJ5 A;  2KI6 D;  3GK4 X;  5JJG A;  1OMR A;  2JU0 A;  1YUR A;  2QPT A;  4DIR A;  1IQ3 A;  4PHJ A;  1QS7 A;  1ZFS A;  4MLW A;  1NCY A;  1YR5 A;  1UUR A;  5KU1 A;  2F33 A;  1X02 A;  1MF8 B;  1YX8 A;  4C0K A;  3OP0 A;  1Y1A A;  1F71 A;  1KFU S;  4JPZ B;  1NCZ A;  1KQV A;  1JUO A;  1Y0V H;  1CDM A;  4YGA A;  1CFC A;  2AUC A;  3NSI A;  1SY9 A;  1QLS A;  1K96 A;  1UUS A;  4I5L B;  2G2B A;  1TNP A;  2IS9 A;  1RK9 A;  4U8D A;  4A4B A;  5KSZ A;  2HQ8 A;  2OTG B;  1YUT A;  2PAL A;  1IWQ A;  1DVI A;  1XFX O;  1A75 B;  1E8A A;  1A75 A;  1OOJ A;  1XVJ A;  3D10 A;  1J7R A;  1YVL A;  3I5H C;  1IJ6 A;  3I5F B;  3SG2 A;  1XFY O;  3JTD C;  4PE4 A;  4BY4 A;  1FI6 A;  3SG6 A;  3IF7 A;  1CDL A;  1K9K A;  3EK4 A;  4MEW A;  3LK1 A;  3AKA A;  2KFG A;  1KSM A;  3KEV A;  4WQ2 A;  3EKJ A;  2MBX A;  2CBL A;  4PDZ A;  1TCF A;  2MLE C;  3BUM B;  1DT7 B;  1UWO A;  3PFV A;  4NQG A;  2NLN A;  1FPW A;  2WCF A;  5AER A;  1IG5 A;  3GK1 A;  5FYX A;  5I2L A;  1WRZ A;  1MQ1 A;  1KWO B;  1SMG A;  1ZAC A;  3SG7 A;  1WLM A;  5BPJ A;  2JT0 A;  3GOF A;  4ORA B;  1NUB A;  1HT9 A;  4F0Z B;  4IL1 A;  2F8P A;  4FTG A;  3F45 A;  1SYM A;  2CNP A;  1WRL A;  5K89 A;  1CFF A;  1ALW A;  2PAS A;  4AOM A;  2LAN A;  1BT6 A;  3CZT X;  3NXA A;  4YGC B;  1IQ5 A;  1CNP A;  1BJF A;  2BCX A;  3LL8 B;  1G4Y R;  2O60 A;  1V1F A;  2RGI A;  2V53 A;  2M7N A;  1LA3 A;  2BCA A;  1H4B A;  1TCO B;  1L2O B;  1UHI A;  3DF0 A;  3TS5 B;  2L4H A;  1YX7 A;  1M31 A;  1QIV A;  1RWY A;  1CKK A;  1S6J A;  4DRW A;  4PE7 A;  3CGA A;  4GUK A;  5DKN A;  2QAC A;  3RM1 A;  1WRK A;  2H61 A;  4I5N B;  4D1E A;  3TZ1 A;  3FWC A;  5D7F A;  3TDZ A;  2HQW A;  2LVK A;  2WOS A;  4GBA A;  5CSF A;  1YUS A;  4CLN A;  4DS7 A;  2FCE A;  4ZCV A;  1QXP A;  2BBN A;  2ZFD A;  2JNX A;  3LK0 A;  2KQY A;  4MN0 A;  1KFX L;  2JT8 A;  2WC8 A;  2Q91 A;  1AJ5 A;  3DD4 A;  1J7O A;  2PRU A;  2LP3 A;  4MBE A;  3CR5 X;  1Y6W A;  2LC5 A;  2LNK A;  2WND A;  4ZCU A;  3BUO B;  5ER5 A;  1EH2 A;  2JT3 A;  3EVU A;  1GGW A;  5I2Q A;  2KGB C;  1SL7 A;  4PAL A;  1RRO A;  2MAZ A;  1XFZ O;  5PAL A;  4MSP A;  3SIA A;  1NIW A;  1MWN A;  1K90 D;  1OSA A;  1SNL A;  2OS8 B;  3FWB A;  4PE1 A;  5AFP A;  5AEQ A;  2OTG C;  2H2K A;  4TNC A;  1SL8 A;  2JZI A;  1TIZ A;  2BKI B;  4YI8 A;  4CFR A;  1ODB A;  1J7P A;  3I5F C;  4MVF A;  1F55 A;  2L4I A;  3DVM A;  3PLF B;  1HQV A;  3KF9 A;  1G8I A;  1SCM B;  1M45 A;  1RJV A;  1SRA A;  2O5G A;  2LHI A;  3BOW B;  2LCP A;  3D0Y A;  2F3Z A;  3D0Y B;  3K21 A;  1JC2 A;  3NSK A;  2JUL A;  3AAJ A;  4NDC A;  4PHK A;  4CPV A;  3FIA A;  3CWG A;  4JQ0 D;  2GGM A;  4M2Q A;  4PHN A;  1DMO A;  4MZK A;  4OKH A;  1WDC B;  2JQ6 A;  3EK7 A;  2LUX A;  1KWO C;  3CR2 A;  1MXE A;  1FI5 A;  3WHT B;  3PN7 B;  1AK8 A;  2F2O A;  2WCB A;  1JF0 A;  1SR6 B;  1YRT B;  3BUN B;  1NWD A;  4UPG A;  4Q04 A;  2LUC A;  1BOD A;  1XA5 A;  1KSO A;  2JTT A;  2K8M B;  1DJG A;  1B7T Y;  5CSJ A;  1IGV A;  1CTR A;  2OPO A;  2K7D A;  2CCM A;  3BXK A;  5HKZ A;  1B8C A;  3AKB A;  2K7O A;  1QLK A;  5TNC A;  1KQM C;  2KBM A;  4GGN A;  3TUY C;  2HF5 A;  3O4Y A;  1EG3 A;  1BOC A;  4L9M A;  5D69 A;  3DVK A;  1J55 A;  1LIN A;  2LMT A;  1L2O C;  3NSO A;  1QX5 B;  4QJ5 B;  2BL0 B;  1CLL A;  2M0R A;  2HET A;  2VRG A;  4HRH A;  1JWD A;  1PAL A;  3SG5 A;  1DJH A;  1QVI Y;  1KK8 B;  4PE0 A;  2M97 A;  2EC6 B;  5I8N A;  2L50 A;  5AXI A;  4R1E A;  1FF1 A;  2H61 C;  2PMY A;  4HRE E;  3I5I B;  2LHL A;  4M2O A;  1B8R A;  2KSP A;  2M1U A;  4YGE B;  2LMV A;  2EGD A;  1NP8 A;  1YVH A;  1NSH A;  1S6I A;  1A2X A;  1BU3 A;  4GFT A;  4XYN A;  1REC A;  2DOQ A;  2GV5 A;  1PSB A;  3WHU B;  1CMG A;  1GGZ A;  2K7B A;  3I5G B;  2I7A A;  4YBH B;  1SW8 A;  4I5J A;  4QJ4 B;  1S5G Z;  1B1G A;  1KFU L;  1RTP 1;  1AVS A;  1F4O A;  2COL B;  2M29 A;  4YRU A;  4GGF A;  4ICB A;  4CID A;  1UHJ A;  1EL4 A;  1K9P A;  4ORB B;  2M49 B;  1NX3 A;  3OHM B;  4E68 A;  2OS8 C;  1TNX A;  3EVV A;  3OB2 B;  3VGO A;  2M8U A;  5J3X A;  1KFX S;  2CT9 A;  2BEC A;  3C1V A;  2FCD A;  2Y1M A;  3SG3 A;  1NCX A;  3O6B A;  2L98 A;  1LVC D;  2BE6 A;  1QJT A;  2EHB A;  2LMU A;  1SCM C;  1A4P A;  1Y1X A;  2SCP A;  1XYD A;  5CSN A;  1J7Q A;  1JFK A;  1UP5 A;  1EXR A;  1M39 A;  3ZNI A;  3IQQ A;  1QX7 A;  3O78 A;  1K95 A;  2WOR A;  1S1E A;  5DKQ A;  1ZOT B;  1WDC C;  3WXA A;  3I5H B;  4GNK B;  1OZO A;  5HLV A;  1B9A A;  3JTD B;  2L5X B;  2Y5I A;  4C0L A;  1DF0 B;  5GQQ C;  2WCE A;  4XJK B;  5DKR A;  1YUU A;  4XJK A;  1SK6 D;  1XO5 A;  2AMI A;  4MRY A;  4OV2 A;  2JOJ A;  1CDP A;  1NX1 A;  2GGZ A;  1GQM A;  2LVI A;  4OVN F;  4OR9 B;  1U5I B;  3HCM A;  2KYC A;  4WQ3 A;  2KAX A;  3KO0 A;  1D1O A;  2LAP A;  1C7W A;  2NXQ A;  2E6W A;  1AP4 A;  1K8U A;  3BQ3 A;  2KFF A;  4JWQ A;  1C07 A;  5I2O A;  4YI9 A;  1QTX A;  3CS1 A;  5HLO A;  1JFJ A;  1TRF A;  1CDN A;  1A03 A;  3VRQ A;  1SPY A;  1AUI B;  1VRK A;  3BOW A;  4YGB B;  2LVJ A;  1IH0 A;  1DJY A;  1UHH A;  2ZNE A;  3JVT B;  1R2U A;  3DVJ A;  2HPS A;  3O2P A;  1TN4 A;  4AQJ A;  4C0J A;  2B1U A;  2K0J A;  3EKH A;  1XFW O;  3A8R A;  1GJY A;  1TNW A;  2KBI A;  3I5G C;  1S5G Y;  3MSE B;  1W7J B;  1J1D A;  1M63 B;  1NYA A;  1BR4 B;  1XFV O;  3LLE A;  3PSR A;  1OQP A;  1DJX A;  1CFP A;  4GGF C;  2K61 A;  3A4U B;  3PM8 A;  1TTX A;  1BG1 A;  1CB1 A;  4QJ3 B;  1J1E A;  2MJW B;  2NZ0 A;  3PAL A;  1R6P A;  3CLN A;  3PAT A;  3ZWH A;  1DJZ A;  2TN4 A;  1SBJ A;  1XK4 A;  1N0Y A;  2JWW A;  4HRG A;  1SCV A;  3CR4 X;  2ZRS A;  4PHM A;  3TS5 C;  1KK7 Z;  2LP2 A;  1AJ4 A;  1OZS A;  2PVB A;  1EJ3 A;  1K9U A;  2KAV A;  1FBV A;  1OE9 B;  1QV0 A;  1S26 D;  3QRX A;  5G08 A;  1UHK A;  1IRJ A;  5CSI A;  1DJI A;  1S3P A;  2I18 A;  1CM1 A;  2LE9 B;  3ICB A;  2BKH B;  3VRN A;  5CPV A;  2I94 A;  3VRP A;  2KNE A;  2I2R E;  3WNX B;  1QAT A;  5B8I B;  2LLT A;  1BR1 B;  1ZMZ A;  2FOT A;  3SIB A;  3TDI A;  3AAK A;  2KOT A;  2M1K B;  2KYF A;  2KI4 B;  4GPL B;  2JTZ A;  1WLZ A;  3BUW B;  3KHE A;  3OB1 B;  4OCI A;  2D8N A;  2LM5 A;  2ZND A;  1M46 A;  2ZN9 A;  1AHR A;  1K93 D;  3KPX A;  1B8L A;  1SKT A;  4MZL A;  4PCW A;  5JOL A;  2L51 A;  4AQI A;  1JBA A;  1RFJ A;  1QV1 A;  1PK0 D;  1PVB A;  2BBM A;  2FJU B;  3M0W A;  3SG4 A;  2LLU A;  1F54 A;  2P6B B;  1S36 A;  1W7I B;  3LCP C;  4MRX A;  2MRD A;  2MLF C;  1CM4 A;  2KQ6 A;  1CMF A;  3DVE A;  1Q80 A;  4FQO A;  1S6C A;  1F70 A;  1CLB A;  2JXC A;  1B47 A;  5HKW A;  1NX2 A;  4P5O E;  1IKU A;  1B7T Z;  1KQM B;  1LXF C;  1F8H A;  2F3Y A;  3OX6 A;  4BY5 A;  1BLQ A;  2LV7 A;  1YRU B;  3TUY B;  4CFQ A;  1CFD A;  2BE4 A;  2CTN A;  3JVT C;  1V1G A;  2A4J A;  2Y1N A;  2R2I A;  4NDB A;  1LA0 A;  1N65 A;  1DJW A;  5KTY A;  2ISD A;  1ALV A;  4ETO A;  2JPT A;  2K7C A;  4ORC B;  2NCP A;  3DF0 B;  3PN7 C;  4MZJ A;  1G33 A;  3NSL A;  1SR6 C;  2JXL A;  5F6T A;  2G9B A;  1DF0 A;  2PSR A;  3IQO A;  3BUX B;  3VRO A;  1L7Z A;  1OMD A;  1EG4 A;  2CXJ A;  3RLZ A;  2L0P A;  3BYA A;  2JC2 A;  4N1F A;  1QVI Z;  1PUL A;  1C7V A;  1KCY A;  1PSR A;  3CTN A;  1MHO A;  3SJS A;  5HYD A;  1LKJ A;  1FW4 A;  2F2P A;  3GK2 A;  4N1G A;  1NPQ A;  1BF5 A;  1U5I A;  2K2A A;  2Y4Q A;  1BMO A;  2ZN8 A;  2MA2 A;  2M9G A;  2JNF A;  2Q4U A;  4DCK A;  1JSA A;  4NDD A;  1A29 A;  3EK8 A;  3H4S E;  3TDU A;  1CLM A;  1XK4 C;  1MR8 A;  1F4Q A;  1KK7 Y;  2LLS A;  1H8B A;  4M2P A;  1B4C A;  1ZUZ A;  1DGU A;  2BL0 C;  3OX5 A;  1NX0 A;  2KFH A;  1Y1U A;  5HKY A;  1SL9 A;  2ZKM X;  2KI6 C;  1KK8 C;  2BCB A;  2KAY A;  2K2F A;  1DTL A;  2EC6 C;  2SAS A;  1QAS A;  2KDH A;  5AAN A;  4P2Y B;  3I5I C;  2KGR A;  1MXL C;  1TNQ A;  1UHN A;  4DUQ A;  2MHH A;  2ZRT A;  3HX4 A;  1PRW A;  2KI4 C;  1MUX A;  1QX2 A;  1K94 A;  4WRI A;  3FS7 A;  1XFU O;  1QIW A;  1N2D A;  1K2H A;  1DGV A;  4USL A;  2NCO A;  5ER4 X;  4A4C A;  4YGD B;  2L2E A;  2KHN A;  4N5X A;  3E3R A;  1PVA A;  2AAO A;  1YTZ C;  1JF2 A;  4GAO A;  2M7L A;  2LVV A;  1OMV A;  3VRR A;  2M3W A;  5IBW A;  1TOP A;  3EVR A;  2JRF A;  2E30 A;  4I5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...