1A75B

Whiting parvalbumin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
b'AFAGILADADCAAAVKACEAADSFSYKAFFAKCGLSGKSADDIKKAFVFIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWVALVKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Tertiary Structure of a Trp-Containing Parvalbumin from Whiting (Merlangius Merlangus). Description of the Hydrophobic Core
rcsb
molecule tags Calcium binding protein
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1a75B00
4WRIA 4OR9B 1CDLA 2BE6A 3DD4A 4OKHA 4YI8A 1M46A 3TUYC 2ZNDA 1QX2A 2JULA 3AAJA 2QPTA 2WCEA 1NSHA 3VRQA 1PSBA 1WDCC 4I5LB 2KFGA 1YUTA 5D69A 2I94A 3CWGA 2LLUA 3OB2B 4QJ3B 3DVMA 5AXIA 1RTP1 1TNPA 1OZOA 2M7LA 1KFXS 1XO5A 2PRUA 1WRKA 2WNDA 3KF9A 1WLZA 2LVKA 2FCDA 2M7NA 3ICBA 4GUKA 5ER4X 4DRWA 2JT8A 3AAKA 3I5HB 2LE9B 1A03A 1K9UA 1NX1A 4YRUA 2TN4A 1UHIA 1JWDA 3OB1B 2K7DA 4NDDA 2GV5A 3AKBA 1CM4A 2FJUB 1G33A 2K2FA 1S3PA 2M97A 4ORAB 1SCMB 1KFUL 3SG2A 1B8RA 1SBJA 1Y6WA 2COLB 1Y1UA 1JUOA 3IQQA 1KQVA 1WRZA 4Q04A 1KSMA 4N5XA 1SY9A 1YVLA 4UPGA 1CLMA 3BUMB 1CFDA 1Q80A 4PALA 3VRPA 3EK4A 1BR1B 3BOWB 2LLTA 3HX4A 3JTDC 5CSIA 4FTGA 2D8NA 1TRFA 4PHKA 1SR6B 3EVVA 1MF8B 3D0YA 2KGRA 2EHBA 1RK9A 2O60A 2CTNA 1DF0A 1V1GA 2KAYA 1KFXL 4GAOA 2ZN8A 1NCXA 1NPQA 1PK0D 3VRNA 5DKRA 2B1UA 5DKQA 2BCBA 3TUYB 2JQ6A 1QXPA 2M1KB 1B47A 2BCXA 1KCYA 1YUUA 2L50A 3SG4A 2F3ZA 2F33A 1OOJA 1WDCB 3AKAA 4PE4A 4U8DA 1XK4A 1IJ6A 4PHNA 4AQJA 4GGNA 2AUCA 2K7BA 1OQPA 2KI4B 1K94A 4MSPA 1AP4A 2L51A 1F8HA 3VROA 1B8LA 3I5GC 1TOPA 1S5GY 2L0PA 2LLSA 1CDMA 5FYXA 1FF1A 2KOTA 2BKIB 3EK8A 2JC2A 4F0ZB 1L7ZA 1IKUA 4HREE 4CIDA 1FW4A 3FWCA 4DS7A 1XVJA 2WORA 4PCWA 1UHJA 1W7JB 2EGDA 2CXJA 1N65A 3WHUB 2ZRTA 2BBMA 1PRWA 1S36A 1KWOC 2MA2A 1K93D 1QTXA 5IBWA 4HRHA 1LXFC 2LV7A 2OTGC 2L98A 2F8PA 5AFPA 3SG5A 3QRXA 4A4BA 1CMFA 2CNPA 1S1EA 3HCMA 3LK1A 1XK4C 3BUOB 1F4QA 1A75A 2KNEA 4XJKA 1JBAA 2L4HA 5HLOA 4C0KA 2JXCA 3MSEB 1RECA 1DJYA 4YI9A 1NCYA 1LA0A 1CTRA 1KK8C 1QIWA 1KK7Y 2WC8A 4WQ2A 1EXRA 1QX7A 1MQ1A 2JOJA 3KHEA 2O5GA 4M2PA 4MRYA 2LMUA 3ZNIA 4BY4A 1X02A 3I5IC 4I5JA 2NCOA 1B9AA 4TNCA 4NQGA 3CLNA 2LVVA 1U5IB 1EG3A 2NCPA 3D10A 4ZCUA 2M0RA 2P6BB 2BE4A 1ALWA 4GGFA 2E30A 1UHHA 1SNLA 2ZNEA 1CFFA 4USLA 1S6IA 3TDZA 4MZLA 4CLNA 3I5GB 1KQMC 1N0YA 1J7OA 2JNXA 2JWWA 1IQ3A 1RJVA 2L2EA 1YVHA 1BT6A 1J1EA 2K61A 1MR8A 1XA5A 1EH2A 3PFVA 1DJHA 1XFVO 4ORCB 2KQYA 4GNKB 1IJ5A 1XFYO 1S6CA 1BR4B 3KEVA 5AEQA 2M9GA 5CSNA 1CLLA 1S6JA 1KWOB 1DF0B 1QATA 1TNQA 4XYNA 1F55A 1D1OA 1YUSA 1J7PA 3SJSA 2OTGB 1H4BA 1B4CA 3PALA 3EKJA 2MLFC 4P5OE 2MHHA 3BXKA 5CSJA 2LNKA 2ZRSA 1EJ3A 1KSOA 2Q91A 1NX3A 1W7IB 1OE9B 3RM1A 2OPOA 3SG3A 4MRXA 1K96A 1RWYA 2EC6C 2DOQA 2M3WA 5I8NA 4GGFC 1ZACA 1JFJA 1NIWA 4PHMA 3TDIA 2JTTA 3M0WA 1PVAA 4NDCA 5BPJA 1TN4A 2H61A 2JRFA 2G2BA 3TDUA 1CNPA 2OS8C 1GQMA 4N1GA 5AANA 1JFKA 1B7TZ 1YRUB 3I5IB 1G8IA 3ZWHA 1LVCD 3FIAA 4YGEB 1YX7A 5D7FA 2FOTA 5HLVA 4DCKA 1K8UA 1FPWA 3I5FC 1JF0A 4HRGA 1E8AA 1DJZA 2BECA 2H2KA 1KQMB 2HF5A 2FCEA 3WNXB 4CPVA 1CMGA 2LMTA 1QJTA 2PSRA 3JVTC 1TCFA 1WLMA 3KO0A 1CM1A 3CS1A 3CR2A 3SG7A 5G08A 4MLWA 1AJ5A 3SIBA 2KI6D 1ZUZA 2LANA 2LP3A 1A75B 2KSPA 2KQ6A 5K89A 1SPYA 2PALA 1K2HA 1AJ4A 4A4CA 2GGZA 2H61C 5HKZA 3A4UB 4MZKA 2KFHA 3KPXA 1QIVA 2GGMA 3LL8B 4DUQA 3DF0B 4AQIA 1CFPA 4ETOA 2M8UA 1MHOA 1NYAA 1K9PA 1DMOA 1AHRA 1YRTB 1R2UA 2EC6B 2KFFA 1QLSA 5AERA 2K0JA 2MBXA 1QV1A 2LCPA 2ZKMX 1LINA 3E3RA 4ZCVA 1BMOA 1MXEA 1A29A 2OS8B 3TZ1A 2G9BA 2M49B 2LVIA 1ZFSA 1SL8A 2CT9A 4OCIA 2LC5A 1K95A 1QS7A 1QVIZ 3JTDB 5I2LA 1QX5B 2LUXA 2F2PA 1F4OA 2CCMA 1GGZA 5KTYA 1LKJA 1BU3A 1BJFA 3NSKA 1Y0VH 2LHIA 1NCZA 4GPLB 3BQ3A 5TNCA 3PM8A 3PN7C 5DKNA 1K90D 2K2AA 2AMIA 3O4YA 3JVTB 1OMVA 1YURA 2HQ8A 1UUSA 2BCAA 4PE7A 5CPVA 2BKHB 3VRRA 2LAPA 2KDHA 2IS9A 1PALA 1Y1XA 1ODBA 4WQ3A 4QJ5B 2K8MB 5ER5A 1CFCA 1K9KA 2Y4QA 2JZIA 3WHTB 1SCVA 2LMVA 2M1UA 1FI6A 3GK4X 1AK8A 3OX5A 3GK2A 3LK0A 1LA3A 2I2RE 3NSOA 2KAXA 1AUIB 1KFUS 1J7QA 1MXLC 5I2OA 3DVEA 1FBVA 2LP2A 3FWBA 1BLQA 3NXAA 1UP5A 1JC2A 1N2DA 4M2QA 1SR6C 2WCBA 3D0YB 3PLFB 4PDZA 4P2YB 1G4YR 2BBNA 4YGBB 1GJYA 1C7WA 4L9MA 1S26D 3CTNA 1WRLA 4CFRA 2BL0C 4MEWA 4ORBB 1B1GA 1R6PA 1PULA 2HPSA 2KI6C 2MAZA 1J1DA 1A2XA 1UURA 1IGVA 2JU0A 5GQQC 5KU1A 3H4SE 2ISDA 1IG5A 1SRAA 2KI4C 2PMYA 2JT3A 3NSLA 1J55A 1XFWO 2SASA 5J3XA 5JOLA 3IF7A 2LUCA 1QV0A 1KK8B 1MWNA 2MRDA 1GGWA 3PN7B 1QLKA 3FS7A 1YTZC 2CBLA 2Y5IA 2NXQA 3GOFA 1SL7A 2HQWA 5HKYA 4M2OA 1FI5A 1U5IA 2AAOA 1J7RA 4I5NB 4PE0A 1S5GZ 4YGCB 1OMDA 2KHNA 3EK7A 1BOCA 1UWOA 1HT9A 4FQOA 1SYMA 4GFTA 2Q4UA 3OX6A 1TTXA 1NX0A 4R1EA 1IWQA 1OSAA 3CZTX 1EL4A 4CFQA 2Y1MA 1ZOTB 4MVFA 5CSFA 2SCPA 1B8CA 4YGAA 3A8RA 1F71A 3BUWB 3TS5C 1TNXA 3WXAA 1QASA 1HQVA 1M45A 3O6BA 3VGOA 2V53A 2PASA 1C7VA 1DJXA 3C1VA 4XJKB 1DJGA 1VRKA 3EVUA 1BODA 2JTZA 2Y1NA 1XFUO 1IQ5A 4GBAA 1SMGA 2PVBA 4NDBA 1CDPA 1XFXO 3SIAA 4N1FA 1TCOB 4HSZA 2LHLA 3DVJA 3LLEA 2JNFA 2LVJA 1NP8A 2BL0B 4C0JA 3DVKA 2JT0A 1V1FA 1KK7Z 1DGVA 3OHMB 1SW8A 1DJIA 1UHKA 2WOSA 3BUNB 1L2OC 1DTLA 2MJWB 1MUXA 1H8BA 1B7TY 1TNWA 2JXLA 4MN0A 1BF5A 2KBMA 1RFJA 2KYFA 3SG6A 3CR5X 4C0LA 4AOMA 4BY5A 1DT7B 1UHNA 3BUXB 2E6WA 1PSRA 3IQOA 4DIRA 2L5XB 2KYCA 2F2OA 2KBIA 1SK6D 3EKHA 1Y1AA 2LM5A 3BOWA 3O78A 1IH0A 1A4PA 1SKTA 1XYDA 4PHJA 5I2QA 2L4IA 5PALA 3F45A 1PVBA 3I5FB 3EVRA 4OVNF 1CLBA 1NX2A 1EG4A 2HETA 3RLZA 2WCFA 2K7CA 4D1EA 3I5HC 3PATA 3PSRA 1CB1A 3OP0A 1DVIA 2KGBC 5F6TA 5HKWA 4ICBA 1SL9A 2A4JA 2JPTA 4QJ4B 4JWQA 1JF2A 2M29A 2QACA 3TS5B 3O2PA 1NWDA 3LCPC 1JSAA 2KAVA 2K7OA 1IRJA 1SCMC 3CR4X 3GK1A 4YGDB 2R2IA 1WY9A 1RROA 3NSIA 4E68A 1F54A 1DJWA 1CDNA 1CKKA 1ALVA 5HYDA 1TIZA 3BYAA 1F70A 1OZSA 1YX8A 5B8IB 1OMRA 2ZN9A 4JQ0D 1M63B 3CGAA 4I5KA 3DF0A 1NUBA 2I7AA 4JPZB 4OV2A 2VRGA 4MBEA 2I18A 1AVSA 4YBHB 4IL1A 2NLNA 5KSZA 5JJGA 1C07A 1M39A 1DGUA 1YR5A 1ZMZA 4PE1A 4MZJA 2RGIA 2ZFDA 3K21A 2NZ0A 1L2OB 1BG1A 1XFZO 2F3YA 1QVIY 1M31A 2MLEC
chains in the Genus database with same CATH superfamily
4WRIA 4OR9B 1CDLA 2BE6A 3DD4A 4OKHA 4YI8A 1M46A 3TUYC 2ZNDA 1QX2A 2JULA 3AAJA 2QPTA 2WCEA 1NSHA 3VRQA 1PSBA 1WDCC 4I5LB 2KFGA 1YUTA 5D69A 2I94A 3CWGA 2LLUA 3OB2B 4QJ3B 3DVMA 5AXIA 1RTP1 1TNPA 1OZOA 2M7LA 1KFXS 1XO5A 2PRUA 1WRKA 2WNDA 3KF9A 1WLZA 2LVKA 2FCDA 2M7NA 3ICBA 3BFHA 4GUKA 5ER4X 4DRWA 2JT8A 3AAKA 5I94A 3CABA 3I5HB 2LE9B 1A03A 1K9UA 1NX1A 4YRUA 2TN4A 1UHIA 1JWDA 3CDNA 2K60A 3OB1B 2K7DA 4NDDA 2GV5A 3D76A 1OW4A 3AKBA 4OZDA 1CM4A 2FJUB 1G33A 2K2FA 1S3PA 2M97A 4ORAB 1SCMB 1KFUL 3SG2A 1B8RA 1SBJA 1Y6WA 2COLB 1Y1UA 3DYEA 1TWOA 1JUOA 3IQQA 1KQVA 1WRZA 4Q04A 1KSMA 4N5XA 1SY9A 1YVLA 3CYZA 4UPGA 1CLMA 3BUMB 1CFDA 1Q80A 3R1PA 4PALA 3VRPA 3EK4A 1BR1B 3SS3A 3BOWB 2LLTA 3HX4A 3JTDC 5CSIA 4FTGA 2D8NA 1TRFA 4PHKA 1SR6B 3EVVA 1MF8B 3D0YA 2KGRA 2EHBA 1RK9A 2O60A 2CTNA 1DF0A 1V1GA 2KAYA 1KFXL 4GAOA 2ZN8A 1NCXA 3BJHA 1NPQA 1PK0D 3VRNA 3CZ1A 5DKRA 3SS4A 2B1UA 5DKQA 2BCBA 3TUYB 2JQ6A 1QXPA 2M1KB 1B47A 2BCXA 1KCYA 1YUUA 2L50A 3RZSA 3SG4A 2F3ZA 2F33A 1OOJA 1WDCB 3AKAA 4PE4A 4U8DA 1XK4A 1IJ6A 4PHNA 2QDIA 4AQJA 2P71A 3DY9A 4GGNA 2AUCA 2K7BA 1OQPA 2KI4B 1K94A 3CZ0A 4MSPA 1AP4A 2L51A 1F8HA 3VROA 1B8LA 3I5GC 1DELA 1TOPA 1S5GY 2L0PA 2LLSA 1CDMA 5FYXA 1FF1A 2WCHA 2KOTA 2BKIB 3EK8A 2JC2A 4F0ZB 1L7ZA 1IKUA 4HREE 4CIDA 5HL1A 1FW4A 3FWCA 1DQEA 4DS7A 1XVJA 2WORA 4PCWA 1UHJA 1W7JB 2EGDA 1T14A 1N65A 2CXJA 2ZRTA 3WHUB 1OOHA 2BBMA 1C3YA 1PRWA 1S36A 1KWOC 2MA2A 2QEHA 1K93D 1QTXA 2ERBA 4HRHA 3S0BA 1LXFC 2LV7A 2OTGC 2L98A 5IBWA 2F8PA 5AFPA 3SG5A 3QRXA 4A4BA 1CMFA 2CNPA 1S1EA 3HCMA 3LK1A 1XK4C 3BUOB 1F4QA 1A75A 2KNEA 4XJKA 1JBAA 2L4HA 5HLOA 4C0KA 1C3ZA 2JXCA 3MSEB 1RECA 1DJYA 4YI9A 1NCYA 1LA0A 1CTRA 1KK8C 1QIWA 1KK7Y 2WC8A 4WQ2A 1EXRA 1QX7A 3B6XA 1MQ1A 2JOJA 3KHEA 2O5GA 2BAPA 4M2PA 2LMUA 4MRYA 3ZNIA 1X02A 3I5IC 4BY4A 4I5JA 2NCOA 1B9AA 4TNCA 4NQGA 3CLNA 2LVVA 1U5IB 1EG3A 2NCPA 3D10A 4ZCUA 2M0RA 2P6BB 2BE4A 1ALWA 4GGFA 2E30A 1UHHA 1SNLA 1Z4HA 3QMEA 2ZNEA 1CFFA 4USLA 1S6IA 3R1OA 3TDZA 4MZLA 4CLNA 3I5GB 1KQMC 1N0YA 1J7OA 2JNXA 2JWWA 1IQ3A 1RJVA 2L2EA 2YGUA 1YVHA 1BT6A 1J1EA 2K61A 1MR8A 1XA5A 2KPHA 1EH2A 2WC5A 3PFVA 1DJHA 1XFVO 4ORCB 2KQYA 2PQLA 4GNKB 1IJ5A 1XFYO 1S6CA 1BR4B 3KEVA 5AEQA 2M9GA 5CSNA 1CLLA 1S6JA 1KWOB 1DF0B 1QATA 1TNQA 4XYNA 1F55A 1D1OA 1YUSA 3D77A 1J7PA 3SJSA 2OTGB 1H4BA 1B4CA 3PALA 3EKJA 2MLFC 4P5OE 2MHHA 3BXKA 5CSJA 2LNKA 2ZRSA 1EJ3A 1KSOA 2Q91A 1DEKA 1NX3A 1OE9B 1W7IB 2OPOA 3B87A 3RM1A 3SG3A 1TUZA 4MRXA 2QEOA 1K96A 1RWYA 2EC6C 2DOQA 2M3WA 3NHIA 4GGFC 5I8NA 1ZACA 1JFJA 1NIWA 4PHMA 3TDIA 2JTTA 3M0WA 3SIBA 1PVAA 4NDCA 5BPJA 1TN4A 2H61A 2JRFA 2G2BA 3TDUA 1CNPA 2OS8C 1GQMA 4N1GA 1TUJA 5AANA 1JFKA 1B7TZ 1YRUB 3I5IB 1G8IA 3ZWHA 1LVCD 3FIAA 4YGEB 1YX7A 2WCLA 5D7FA 2FOTA 2QEBA 5HLVA 4DCKA 3L47A 1K8UA 1FPWA 3I5FC 3L4AA 1JF0A 4HRGA 1E8AA 3B86A 1DJZA 2BECA 2H2KA 1Z2CB 1KQMB 2HF5A 2FCEA 3WNXB 4CPVA 1CMGA 4PT1A 2LMTA 1QJTA 2PSRA 3JVTC 1TCFA 1WLMA 3KO0A 1CM1A 3CS1A 3CR2A 2WCKA 3SG7A 3O4XA 1QWVA 4MLWA 1AJ5A 3OBVA 2KI6D 1ZUZA 2LANA 2LP3A 3FE8A 5G08A 1A75B 3VB1A 2KSPA 2KQ6A 5K89A 1SPYA 2PALA 1K2HA 1AJ4A 1OOIX 4A4CA 2GGZA 2H61C 5HKZA 2H8VA 3A4UB 2KFHA 3KPXA 4MZKA 1QIVA 2GGMA 1DC1A 3S0DA 3LL8B 4DUQA 3DF0B 2L5YA 4AQIA 1CFPA 4ETOA 3Q8IA 2M8UA 1MHOA 1NYAA 3UNWA 1K9PA 1DMOA 1AHRA 1YRTB 1R2UA 2EC6B 2GTEA 2KFFA 1QLSA 5AERA 2K0JA 2MBXA 1QV1A 2LCPA 2ZKMX 1LINA 3E3RA 4ZCVA 1BMOA 1MXEA 1A29A 2OS8B 3TZ1A 3S0FA 2G9BA 2M49B 2LVIA 1ZFSA 1SL8A 2CT9A 4OCIA 3S0GA 2LC5A 1K95A 1QS7A 1QVIZ 3JTDB 5I2LA 1QX5B 2LUXA 2F2PA 1F4OA 2CCMA 1GM0A 1GGZA 5KTYA 3EG5B 1LKJA 1BU3A 1BJFA 3NSKA 3R1VA 1Y0VH 3CZ2A 2JPOA 1NCZA 2LHIA 4GPLB 3BQ3A 5TNCA 2QEVA 3PM8A 3PN7C 1K90D 5DKNA 2K2AA 2AMIA 3O4YA 3JVTB 3OGNA 1OMVA 1YURA 2HQ8A 1UUSA 2BCAA 4PE7A 5CPVA 2BKHB 3VRRA 3S0EA 2LAPA 2KDHA 2IS9A 1LS8A 1PALA 1Y1XA 1ODBA 2WCMA 4WQ3A 4QJ5B 4JD9A 2K8MB 5ER5A 1CFCA 1K9KA 2Y4QA 3PJIA 2JZIA 3WHTB 1SCVA 2FJYA 2LMVA 2M1UA 1FI6A 3GK4X 1AK8A 5D3OA 3OX5A 3R72A 3GK2A 3LK0A 1LA3A 2I2RE 3NSOA 2KAXA 4FQTA 1AUIB 1KFUS 1J7QA 1MXLC 5I2OA 3DVEA 1FBVA 2LP2A 3FWBA 1BLQA 3NXAA 1UP5A 1JC2A 1N2DA 3V2LA 1SSEB 4JKTA 4M2QA 1SR6C 2WCBA 3D0YB 3PLFB 4PDZA 4P2YB 1G4YR 4IJ7A 2BBNA 4YGBB 1GJYA 1C7WA 4L9MA 1S26D 3CTNA 1WRLA 4CFRA 3FE9A 2BL0C 4MEWA 4ORBB 1B1GA 1R6PA 1PULA 2HPSA 2KI6C 4F7FA 2MAZA 1J1DA 1A2XA 1UURA 1IGVA 2JU0A 5GQQC 5KU1A 1OOGA 3H4SE 2ISDA 3DXLA 1IG5A 1SRAA 2KI4C 2PMYA 2JT3A 3NSLA 1J55A 1XFWO 2SASA 5J3XA 5JOLA 5FI6A 3IF7A 2LUCA 1QV0A 3NGVA 1KK8B 1MWNA 2MRDA 1GGWA 3PN7B 3UO9A 1QLKA 3FS7A 1YTZC 2CBLA 2Y5IA 3DZTA 2NXQA 3GOFA 1SL7A 2HQWA 5HKYA 4M2OA 1FI5A 1U5IA 2AAOA 1J7RA 4I5NB 4PE0A 1S5GZ 4YGCB 1OMDA 2KHNA 3EK7A 1BOCA 1UWOA 1HT9A 4FQOA 1SYMA 4GFTA 2KLDA 2Q4UA 2P70A 3OX6A 2WC6A 1TTXA 1NX0A 4R1EA 1OOFA 1IWQA 1OSAA 3CZTX 1EL4A 3PM2A 3K1EA 4CFQA 2Y1MA 1ZOTB 4MVFA 5CSFA 2SCPA 1B8CA 4YGAA 3A8RA 1F71A 3BUWB 3TS5C 1TNXA 3WXAA 1QASA 1HQVA 1M45A 3O6BA 3SS5A 3VGOA 2V53A 1IIOA 2PASA 1C7VA 1DJXA 3C1VA 4XJKB 1DJGA 1VRKA 3EVUA 1BODA 2JTZA 2Y1NA 2KLEA 1XFUO 4INWA 1IQ5A 4GBAA 1SMGA 2PVBA 4NDBA 1CDPA 1XFXO 3S0AA 3SIAA 4N1FA 1TCOB 3BFAA 4HSZA 2LHLA 3DVJA 3LLEA 2L2CA 2JNFA 2LVJA 1NP8A 3D73A 3D74A 2BL0B 4C0JA 3DVKA 2JT0A 1V1FA 1KK7Z 3BFBA 1DGVA 3OHMB 1SW8A 1DJIA 1UHKA 2WOSA 3BUNB 3FE6A 1L2OC 1DTLA 2MJWB 1MUXA 1H8BA 1B7TY 1TNWA 2JXLA 2PYQA 3B88A 4MN0A 1BF5A 2KBMA 1RFJA 2KYFA 4INXA 3CR5X 3SG6A 4AOMA 4BY5A 4C0LA 1DT7B 1UHNA 5DICA 3BUXB 2E6WA 1PSRA 3IQOA 4DIRA 5FI7A 2L5XB 2KYCA 2F2OA 2KBIA 3L4LA 1SK6D 3EKHA 1Y1AA 2LM5A 3BOWA 3O78A 1IH0A 1A4PA 1SKTA 1XYDA 4PHJA 5I2QA 2L4IA 5PALA 3F45A 3NHTA 1PVBA 3I5FB 3EVRA 4OVNF 1CLBA 1NX2A 1EG4A 2HETA 3RLZA 2WCFA 1W9ZA 2K7CA 4D1EA 3I5HC 3PATA 3PSRA 1CB1A 3OP0A 1DVIA 2KGBC 5F6TA 5HKWA 3IVTA 4ICBA 1SL9A 2A4JA 2JPTA 4QJ4B 4JWQA 1JF2A 2M29A 2QACA 3TS5B 3O2PA 1NWDA 3LCPC 1JSAA 2KAVA 2K7OA 1IRJA 1SCMC 1XFRA 3CR4X 3GK1A 4YGDB 2R2IA 1WY9A 3D78A 1RROA 3D75A 1P28A 3NSIA 3N7HA 4E68A 1F54A 1DJWA 1CDNA 1CKKA 1ALVA 5HYDA 1TIZA 2WCJA 3BYAA 5EL2A 1F70A 1OZSA 1YX8A 5B8IB 1OMRA 2ZN9A 4JQ0D 1M63B 3CGAA 4I5KA 3DF0A 1NUBA 2I7AA 4JPZB 4OV2A 2VRGA 4MBEA 2I18A 1AVSA 4YBHB 4IL1A 2NLNA 5KSZA 5JJGA 1ORGA 1M39A 1DGUA 1YR5A 1ZMZA 4PE1A 4MZJA 1C07A 2RGIA 5FI2A 2ZFDA 3K21A 2NZ0A 1L2OB 1BG1A 1XFZO 4KYNA 2F3YA 1QVIY 1M31A 2MLEC 3B7AA 2BNXA
chains in the Genus database with same CATH topology
4WRIA 4OR9B 1CDLA 2BE6A 3DD4A 4OKHA 4YI8A 1M46A 3TUYC 2ZNDA 1QX2A 2JULA 3AAJA 2QPTA 2WCEA 1NSHA 3VRQA 1PSBA 1WDCC 4I5LB 2KFGA 1YUTA 5D69A 2I94A 3CWGA 2LLUA 3OB2B 4QJ3B 3DVMA 5AXIA 1RTP1 1TNPA 1OZOA 2M7LA 1KFXS 1XO5A 2PRUA 1WRKA 2WNDA 3KF9A 1WLZA 2LVKA 2FCDA 2M7NA 3ICBA 4GUKA 5ER4X 4DRWA 2JT8A 3AAKA 3I5HB 2LE9B 1A03A 1K9UA 1NX1A 4YRUA 2TN4A 1UHIA 1JWDA 3OB1B 2K7DA 4NDDA 2GV5A 3AKBA 1CM4A 2FJUB 1G33A 2K2FA 1S3PA 2M97A 4ORAB 1SCMB 1KFUL 3SG2A 1B8RA 1SBJA 1Y6WA 2COLB 1Y1UA 1JUOA 3IQQA 1KQVA 1WRZA 4Q04A 1KSMA 4N5XA 1SY9A 1YVLA 4UPGA 1CLMA 3BUMB 1CFDA 1Q80A 4PALA 3VRPA 3EK4A 1BR1B 3BOWB 2LLTA 3HX4A 3JTDC 5CSIA 4FTGA 2D8NA 1TRFA 4PHKA 1SR6B 3EVVA 1MF8B 3D0YA 2KGRA 2EHBA 1RK9A 2O60A 2CTNA 1DF0A 1V1GA 2KAYA 1KFXL 4GAOA 2ZN8A 1NCXA 1NPQA 1PK0D 3VRNA 5DKRA 2B1UA 5DKQA 2BCBA 3TUYB 2JQ6A 1QXPA 2M1KB 1B47A 2BCXA 1KCYA 1YUUA 2L50A 3SG4A 2F3ZA 2F33A 1OOJA 1WDCB 3AKAA 4PE4A 4U8DA 1XK4A 1IJ6A 4PHNA 4AQJA 4GGNA 2AUCA 2K7BA 1OQPA 2KI4B 1K94A 4MSPA 1AP4A 2L51A 1F8HA 3VROA 1B8LA 3I5GC 1TOPA 1S5GY 2L0PA 2LLSA 1CDMA 5FYXA 1FF1A 2KOTA 2BKIB 3EK8A 2JC2A 4F0ZB 1L7ZA 1IKUA 4HREE 4CIDA 1FW4A 3FWCA 4DS7A 1XVJA 2WORA 4PCWA 1UHJA 1W7JB 2EGDA 2CXJA 1N65A 3WHUB 2ZRTA 2BBMA 1PRWA 1S36A 1KWOC 2MA2A 1K93D 1QTXA 5IBWA 4HRHA 1LXFC 2LV7A 2OTGC 2L98A 2F8PA 5AFPA 3SG5A 3QRXA 4A4BA 1CMFA 2CNPA 1S1EA 3HCMA 3LK1A 1XK4C 3BUOB 1F4QA 1A75A 2KNEA 4XJKA 1JBAA 2L4HA 5HLOA 4C0KA 2JXCA 3MSEB 1RECA 1DJYA 4YI9A 1NCYA 1LA0A 1CTRA 1KK8C 1QIWA 1KK7Y 2WC8A 4WQ2A 1EXRA 1QX7A 1MQ1A 2JOJA 3KHEA 2O5GA 4M2PA 4MRYA 2LMUA 3ZNIA 4BY4A 1X02A 3I5IC 4I5JA 2NCOA 1B9AA 4TNCA 4NQGA 3CLNA 2LVVA 1U5IB 1EG3A 2NCPA 3D10A 4ZCUA 2M0RA 2P6BB 2BE4A 1ALWA 4GGFA 2E30A 1UHHA 1SNLA 2ZNEA 1CFFA 4USLA 1S6IA 3TDZA 4MZLA 4CLNA 3I5GB 1KQMC 1N0YA 1J7OA 2JNXA 2JWWA 1IQ3A 1RJVA 2L2EA 1YVHA 1BT6A 1J1EA 2K61A 1MR8A 1XA5A 1EH2A 3PFVA 1DJHA 1XFVO 4ORCB 2KQYA 4GNKB 1IJ5A 1XFYO 1S6CA 1BR4B 3KEVA 5AEQA 2M9GA 5CSNA 1CLLA 1S6JA 1KWOB 1DF0B 1QATA 1TNQA 4XYNA 1F55A 1D1OA 1YUSA 1J7PA 3SJSA 2OTGB 1H4BA 1B4CA 3PALA 3EKJA 2MLFC 4P5OE 2MHHA 3BXKA 5CSJA 2LNKA 2ZRSA 1EJ3A 1KSOA 2Q91A 1NX3A 1W7IB 1OE9B 3RM1A 2OPOA 3SG3A 4MRXA 1K96A 1RWYA 2EC6C 2DOQA 2M3WA 5I8NA 4GGFC 1ZACA 1JFJA 1NIWA 4PHMA 3TDIA 2JTTA 3M0WA 1PVAA 4NDCA 5BPJA 1TN4A 2H61A 2JRFA 2G2BA 3TDUA 1CNPA 2OS8C 1GQMA 4N1GA 5AANA 1JFKA 1B7TZ 1YRUB 3I5IB 1G8IA 3ZWHA 1LVCD 3FIAA 4YGEB 1YX7A 5D7FA 2FOTA 5HLVA 4DCKA 1K8UA 1FPWA 3I5FC 1JF0A 4HRGA 1E8AA 1DJZA 2BECA 2H2KA 1KQMB 2HF5A 2FCEA 3WNXB 4CPVA 1CMGA 2LMTA 1QJTA 2PSRA 3JVTC 1TCFA 1WLMA 3KO0A 1CM1A 3CS1A 3CR2A 3SG7A 5G08A 4MLWA 1AJ5A 3SIBA 2KI6D 1ZUZA 2LANA 2LP3A 1A75B 2KSPA 2KQ6A 5K89A 1SPYA 2PALA 1K2HA 1AJ4A 4A4CA 2GGZA 2H61C 5HKZA 3A4UB 4MZKA 2KFHA 3KPXA 1QIVA 2GGMA 3LL8B 4DUQA 3DF0B 4AQIA 1CFPA 4ETOA 2M8UA 1MHOA 1NYAA 1K9PA 1DMOA 1AHRA 1YRTB 1R2UA 2EC6B 2KFFA 1QLSA 5AERA 2K0JA 2MBXA 1QV1A 2LCPA 2ZKMX 1LINA 3E3RA 4ZCVA 1BMOA 1MXEA 1A29A 2OS8B 3TZ1A 2G9BA 2M49B 2LVIA 1ZFSA 1SL8A 2CT9A 4OCIA 2LC5A 1K95A 1QS7A 1QVIZ 3JTDB 5I2LA 1QX5B 2LUXA 2F2PA 1F4OA 2CCMA 1GGZA 5KTYA 1LKJA 1BU3A 1BJFA 3NSKA 1Y0VH 2LHIA 1NCZA 4GPLB 3BQ3A 5TNCA 3PM8A 3PN7C 5DKNA 1K90D 2K2AA 2AMIA 3O4YA 3JVTB 1OMVA 1YURA 2HQ8A 1UUSA 2BCAA 4PE7A 5CPVA 2BKHB 3VRRA 2LAPA 2KDHA 2IS9A 1PALA 1Y1XA 1ODBA 4WQ3A 4QJ5B 2K8MB 5ER5A 1CFCA 1K9KA 2Y4QA 2JZIA 3WHTB 1SCVA 2LMVA 2M1UA 1FI6A 3GK4X 1AK8A 3OX5A 3GK2A 3LK0A 1LA3A 2I2RE 3NSOA 2KAXA 1AUIB 1KFUS 1J7QA 1MXLC 5I2OA 3DVEA 1FBVA 2LP2A 3FWBA 1BLQA 3NXAA 1UP5A 1JC2A 1N2DA 4M2QA 1SR6C 2WCBA 3D0YB 3PLFB 4PDZA 4P2YB 1G4YR 2BBNA 4YGBB 1GJYA 1C7WA 4L9MA 1S26D 3CTNA 1WRLA 4CFRA 2BL0C 4MEWA 4ORBB 1B1GA 1R6PA 1PULA 2HPSA 2KI6C 2MAZA 1J1DA 1A2XA 1UURA 1IGVA 2JU0A 5GQQC 5KU1A 3H4SE 2ISDA 1IG5A 1SRAA 2KI4C 2PMYA 2JT3A 3NSLA 1J55A 1XFWO 2SASA 5J3XA 5JOLA 3IF7A 2LUCA 1QV0A 1KK8B 1MWNA 2MRDA 1GGWA 3PN7B 1QLKA 3FS7A 1YTZC 2CBLA 2Y5IA 2NXQA 3GOFA 1SL7A 2HQWA 5HKYA 4M2OA 1FI5A 1U5IA 2AAOA 1J7RA 4I5NB 4PE0A 1S5GZ 4YGCB 1OMDA 2KHNA 3EK7A 1BOCA 1UWOA 1HT9A 4FQOA 1SYMA 4GFTA 2Q4UA 3OX6A 1TTXA 1NX0A 4R1EA 1IWQA 1OSAA 3CZTX 1EL4A 4CFQA 2Y1MA 1ZOTB 4MVFA 5CSFA 2SCPA 1B8CA 4YGAA 3A8RA 1F71A 3BUWB 3TS5C 1TNXA 3WXAA 1QASA 1HQVA 1M45A 3O6BA 3VGOA 2V53A 2PASA 1C7VA 1DJXA 3C1VA 4XJKB 1DJGA 1VRKA 3EVUA 1BODA 2JTZA 2Y1NA 1XFUO 1IQ5A 4GBAA 1SMGA 2PVBA 4NDBA 1CDPA 1XFXO 3SIAA 4N1FA 1TCOB 4HSZA 2LHLA 3DVJA 3LLEA 2JNFA 2LVJA 1NP8A 2BL0B 4C0JA 3DVKA 2JT0A 1V1FA 1KK7Z 1DGVA 3OHMB 1SW8A 1DJIA 1UHKA 2WOSA 3BUNB 1L2OC 1DTLA 2MJWB 1MUXA 1H8BA 1B7TY 1TNWA 2JXLA 4MN0A 1BF5A 2KBMA 1RFJA 2KYFA 3SG6A 3CR5X 4C0LA 4AOMA 4BY5A 1DT7B 1UHNA 3BUXB 2E6WA 1PSRA 3IQOA 4DIRA 2L5XB 2KYCA 2F2OA 2KBIA 1SK6D 3EKHA 1Y1AA 2LM5A 3BOWA 3O78A 1IH0A 1A4PA 1SKTA 1XYDA 4PHJA 5I2QA 2L4IA 5PALA 3F45A 1PVBA 3I5FB 3EVRA 4OVNF 1CLBA 1NX2A 1EG4A 2HETA 3RLZA 2WCFA 2K7CA 4D1EA 3I5HC 3PATA 3PSRA 1CB1A 3OP0A 1DVIA 2KGBC 5F6TA 5HKWA 4ICBA 1SL9A 2A4JA 2JPTA 4QJ4B 4JWQA 1JF2A 2M29A 2QACA 3TS5B 3O2PA 1NWDA 3LCPC 1JSAA 2KAVA 2K7OA 1IRJA 1SCMC 3CR4X 3GK1A 4YGDB 2R2IA 1WY9A 1RROA 3NSIA 4E68A 1F54A 1DJWA 1CDNA 1CKKA 1ALVA 5HYDA 1TIZA 3BYAA 1F70A 1OZSA 1YX8A 5B8IB 1OMRA 2ZN9A 4JQ0D 1M63B 3CGAA 4I5KA 3DF0A 1NUBA 2I7AA 4JPZB 4OV2A 2VRGA 4MBEA 2I18A 1AVSA 4YBHB 4IL1A 2NLNA 5KSZA 5JJGA 1C07A 1M39A 1DGUA 1YR5A 1ZMZA 4PE1A 4MZJA 2RGIA 2ZFDA 3K21A 2NZ0A 1L2OB 1BG1A 1XFZO 2F3YA 1QVIY 1M31A 2MLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRI A;  4OR9 B;  1CDL A;  2BE6 A;  3DD4 A;  4OKH A;  4YI8 A;  1M46 A;  3TUY C;  2ZND A;  1QX2 A;  2JUL A;  3AAJ A;  2QPT A;  2WCE A;  1NSH A;  3VRQ A;  1PSB A;  1WDC C;  4I5L B;  2KFG A;  1YUT A;  5D69 A;  2I94 A;  3CWG A;  2LLU A;  3OB2 B;  4QJ3 B;  3DVM A;  5AXI A;  1RTP 1;  1TNP A;  1OZO A;  2M7L A;  1KFX S;  1XO5 A;  2PRU A;  1WRK A;  2WND A;  3KF9 A;  1WLZ A;  2LVK A;  2FCD A;  2M7N A;  3ICB A;  4GUK A;  5ER4 X;  4DRW A;  2JT8 A;  3AAK A;  3I5H B;  2LE9 B;  1A03 A;  1K9U A;  1NX1 A;  4YRU A;  2TN4 A;  1UHI A;  1JWD A;  3OB1 B;  2K7D A;  4NDD A;  2GV5 A;  3AKB A;  1CM4 A;  2FJU B;  1G33 A;  2K2F A;  1S3P A;  2M97 A;  4ORA B;  1SCM B;  1KFU L;  3SG2 A;  1B8R A;  1SBJ A;  1Y6W A;  2COL B;  1Y1U A;  1JUO A;  3IQQ A;  1KQV A;  1WRZ A;  4Q04 A;  1KSM A;  4N5X A;  1SY9 A;  1YVL A;  4UPG A;  1CLM A;  3BUM B;  1CFD A;  1Q80 A;  4PAL A;  3VRP A;  3EK4 A;  1BR1 B;  3BOW B;  2LLT A;  3HX4 A;  3JTD C;  5CSI A;  4FTG A;  2D8N A;  1TRF A;  4PHK A;  1SR6 B;  3EVV A;  1MF8 B;  3D0Y A;  2KGR A;  2EHB A;  1RK9 A;  2O60 A;  2CTN A;  1DF0 A;  1V1G A;  2KAY A;  1KFX L;  4GAO A;  2ZN8 A;  1NCX A;  1NPQ A;  1PK0 D;  3VRN A;  5DKR A;  2B1U A;  5DKQ A;  2BCB A;  3TUY B;  2JQ6 A;  1QXP A;  2M1K B;  1B47 A;  2BCX A;  1KCY A;  1YUU A;  2L50 A;  3SG4 A;  2F3Z A;  2F33 A;  1OOJ A;  1WDC B;  3AKA A;  4PE4 A;  4U8D A;  1XK4 A;  1IJ6 A;  4PHN A;  4AQJ A;  4GGN A;  2AUC A;  2K7B A;  1OQP A;  2KI4 B;  1K94 A;  4MSP A;  1AP4 A;  2L51 A;  1F8H A;  3VRO A;  1B8L A;  3I5G C;  1TOP A;  1S5G Y;  2L0P A;  2LLS A;  1CDM A;  5FYX A;  1FF1 A;  2KOT A;  2BKI B;  3EK8 A;  2JC2 A;  4F0Z B;  1L7Z A;  1IKU A;  4HRE E;  4CID A;  1FW4 A;  3FWC A;  4DS7 A;  1XVJ A;  2WOR A;  4PCW A;  1UHJ A;  1W7J B;  2EGD A;  2CXJ A;  1N65 A;  3WHU B;  2ZRT A;  2BBM A;  1PRW A;  1S36 A;  1KWO C;  2MA2 A;  1K93 D;  1QTX A;  5IBW A;  4HRH A;  1LXF C;  2LV7 A;  2OTG C;  2L98 A;  2F8P A;  5AFP A;  3SG5 A;  3QRX A;  4A4B A;  1CMF A;  2CNP A;  1S1E A;  3HCM A;  3LK1 A;  1XK4 C;  3BUO B;  1F4Q A;  1A75 A;  2KNE A;  4XJK A;  1JBA A;  2L4H A;  5HLO A;  4C0K A;  2JXC A;  3MSE B;  1REC A;  1DJY A;  4YI9 A;  1NCY A;  1LA0 A;  1CTR A;  1KK8 C;  1QIW A;  1KK7 Y;  2WC8 A;  4WQ2 A;  1EXR A;  1QX7 A;  1MQ1 A;  2JOJ A;  3KHE A;  2O5G A;  4M2P A;  4MRY A;  2LMU A;  3ZNI A;  4BY4 A;  1X02 A;  3I5I C;  4I5J A;  2NCO A;  1B9A A;  4TNC A;  4NQG A;  3CLN A;  2LVV A;  1U5I B;  1EG3 A;  2NCP A;  3D10 A;  4ZCU A;  2M0R A;  2P6B B;  2BE4 A;  1ALW A;  4GGF A;  2E30 A;  1UHH A;  1SNL A;  2ZNE A;  1CFF A;  4USL A;  1S6I A;  3TDZ A;  4MZL A;  4CLN A;  3I5G B;  1KQM C;  1N0Y A;  1J7O A;  2JNX A;  2JWW A;  1IQ3 A;  1RJV A;  2L2E A;  1YVH A;  1BT6 A;  1J1E A;  2K61 A;  1MR8 A;  1XA5 A;  1EH2 A;  3PFV A;  1DJH A;  1XFV O;  4ORC B;  2KQY A;  4GNK B;  1IJ5 A;  1XFY O;  1S6C A;  1BR4 B;  3KEV A;  5AEQ A;  2M9G A;  5CSN A;  1CLL A;  1S6J A;  1KWO B;  1DF0 B;  1QAT A;  1TNQ A;  4XYN A;  1F55 A;  1D1O A;  1YUS A;  1J7P A;  3SJS A;  2OTG B;  1H4B A;  1B4C A;  3PAL A;  3EKJ A;  2MLF C;  4P5O E;  2MHH A;  3BXK A;  5CSJ A;  2LNK A;  2ZRS A;  1EJ3 A;  1KSO A;  2Q91 A;  1NX3 A;  1W7I B;  1OE9 B;  3RM1 A;  2OPO A;  3SG3 A;  4MRX A;  1K96 A;  1RWY A;  2EC6 C;  2DOQ A;  2M3W A;  5I8N A;  4GGF C;  1ZAC A;  1JFJ A;  1NIW A;  4PHM A;  3TDI A;  2JTT A;  3M0W A;  1PVA A;  4NDC A;  5BPJ A;  1TN4 A;  2H61 A;  2JRF A;  2G2B A;  3TDU A;  1CNP A;  2OS8 C;  1GQM A;  4N1G A;  5AAN A;  1JFK A;  1B7T Z;  1YRU B;  3I5I B;  1G8I A;  3ZWH A;  1LVC D;  3FIA A;  4YGE B;  1YX7 A;  5D7F A;  2FOT A;  5HLV A;  4DCK A;  1K8U A;  1FPW A;  3I5F C;  1JF0 A;  4HRG A;  1E8A A;  1DJZ A;  2BEC A;  2H2K A;  1KQM B;  2HF5 A;  2FCE A;  3WNX B;  4CPV A;  1CMG A;  2LMT A;  1QJT A;  2PSR A;  3JVT C;  1TCF A;  1WLM A;  3KO0 A;  1CM1 A;  3CS1 A;  3CR2 A;  3SG7 A;  5G08 A;  4MLW A;  1AJ5 A;  3SIB A;  2KI6 D;  1ZUZ A;  2LAN A;  2LP3 A;  1A75 B;  2KSP A;  2KQ6 A;  5K89 A;  1SPY A;  2PAL A;  1K2H A;  1AJ4 A;  4A4C A;  2GGZ A;  2H61 C;  5HKZ A;  3A4U B;  4MZK A;  2KFH A;  3KPX A;  1QIV A;  2GGM A;  3LL8 B;  4DUQ A;  3DF0 B;  4AQI A;  1CFP A;  4ETO A;  2M8U A;  1MHO A;  1NYA A;  1K9P A;  1DMO A;  1AHR A;  1YRT B;  1R2U A;  2EC6 B;  2KFF A;  1QLS A;  5AER A;  2K0J A;  2MBX A;  1QV1 A;  2LCP A;  2ZKM X;  1LIN A;  3E3R A;  4ZCV A;  1BMO A;  1MXE A;  1A29 A;  2OS8 B;  3TZ1 A;  2G9B A;  2M49 B;  2LVI A;  1ZFS A;  1SL8 A;  2CT9 A;  4OCI A;  2LC5 A;  1K95 A;  1QS7 A;  1QVI Z;  3JTD B;  5I2L A;  1QX5 B;  2LUX A;  2F2P A;  1F4O A;  2CCM A;  1GGZ A;  5KTY A;  1LKJ A;  1BU3 A;  1BJF A;  3NSK A;  1Y0V H;  2LHI A;  1NCZ A;  4GPL B;  3BQ3 A;  5TNC A;  3PM8 A;  3PN7 C;  5DKN A;  1K90 D;  2K2A A;  2AMI A;  3O4Y A;  3JVT B;  1OMV A;  1YUR A;  2HQ8 A;  1UUS A;  2BCA A;  4PE7 A;  5CPV A;  2BKH B;  3VRR A;  2LAP A;  2KDH A;  2IS9 A;  1PAL A;  1Y1X A;  1ODB A;  4WQ3 A;  4QJ5 B;  2K8M B;  5ER5 A;  1CFC A;  1K9K A;  2Y4Q A;  2JZI A;  3WHT B;  1SCV A;  2LMV A;  2M1U A;  1FI6 A;  3GK4 X;  1AK8 A;  3OX5 A;  3GK2 A;  3LK0 A;  1LA3 A;  2I2R E;  3NSO A;  2KAX A;  1AUI B;  1KFU S;  1J7Q A;  1MXL C;  5I2O A;  3DVE A;  1FBV A;  2LP2 A;  3FWB A;  1BLQ A;  3NXA A;  1UP5 A;  1JC2 A;  1N2D A;  4M2Q A;  1SR6 C;  2WCB A;  3D0Y B;  3PLF B;  4PDZ A;  4P2Y B;  1G4Y R;  2BBN A;  4YGB B;  1GJY A;  1C7W A;  4L9M A;  1S26 D;  3CTN A;  1WRL A;  4CFR A;  2BL0 C;  4MEW A;  4ORB B;  1B1G A;  1R6P A;  1PUL A;  2HPS A;  2KI6 C;  2MAZ A;  1J1D A;  1A2X A;  1UUR A;  1IGV A;  2JU0 A;  5GQQ C;  5KU1 A;  3H4S E;  2ISD A;  1IG5 A;  1SRA A;  2KI4 C;  2PMY A;  2JT3 A;  3NSL A;  1J55 A;  1XFW O;  2SAS A;  5J3X A;  5JOL A;  3IF7 A;  2LUC A;  1QV0 A;  1KK8 B;  1MWN A;  2MRD A;  1GGW A;  3PN7 B;  1QLK A;  3FS7 A;  1YTZ C;  2CBL A;  2Y5I A;  2NXQ A;  3GOF A;  1SL7 A;  2HQW A;  5HKY A;  4M2O A;  1FI5 A;  1U5I A;  2AAO A;  1J7R A;  4I5N B;  4PE0 A;  1S5G Z;  4YGC B;  1OMD A;  2KHN A;  3EK7 A;  1BOC A;  1UWO A;  1HT9 A;  4FQO A;  1SYM A;  4GFT A;  2Q4U A;  3OX6 A;  1TTX A;  1NX0 A;  4R1E A;  1IWQ A;  1OSA A;  3CZT X;  1EL4 A;  4CFQ A;  2Y1M A;  1ZOT B;  4MVF A;  5CSF A;  2SCP A;  1B8C A;  4YGA A;  3A8R A;  1F71 A;  3BUW B;  3TS5 C;  1TNX A;  3WXA A;  1QAS A;  1HQV A;  1M45 A;  3O6B A;  3VGO A;  2V53 A;  2PAS A;  1C7V A;  1DJX A;  3C1V A;  4XJK B;  1DJG A;  1VRK A;  3EVU A;  1BOD A;  2JTZ A;  2Y1N A;  1XFU O;  1IQ5 A;  4GBA A;  1SMG A;  2PVB A;  4NDB A;  1CDP A;  1XFX O;  3SIA A;  4N1F A;  1TCO B;  4HSZ A;  2LHL A;  3DVJ A;  3LLE A;  2JNF A;  2LVJ A;  1NP8 A;  2BL0 B;  4C0J A;  3DVK A;  2JT0 A;  1V1F A;  1KK7 Z;  1DGV A;  3OHM B;  1SW8 A;  1DJI A;  1UHK A;  2WOS A;  3BUN B;  1L2O C;  1DTL A;  2MJW B;  1MUX A;  1H8B A;  1B7T Y;  1TNW A;  2JXL A;  4MN0 A;  1BF5 A;  2KBM A;  1RFJ A;  2KYF A;  3SG6 A;  3CR5 X;  4C0L A;  4AOM A;  4BY5 A;  1DT7 B;  1UHN A;  3BUX B;  2E6W A;  1PSR A;  3IQO A;  4DIR A;  2L5X B;  2KYC A;  2F2O A;  2KBI A;  1SK6 D;  3EKH A;  1Y1A A;  2LM5 A;  3BOW A;  3O78 A;  1IH0 A;  1A4P A;  1SKT A;  1XYD A;  4PHJ A;  5I2Q A;  2L4I A;  5PAL A;  3F45 A;  1PVB A;  3I5F B;  3EVR A;  4OVN F;  1CLB A;  1NX2 A;  1EG4 A;  2HET A;  3RLZ A;  2WCF A;  2K7C A;  4D1E A;  3I5H C;  3PAT A;  3PSR A;  1CB1 A;  3OP0 A;  1DVI A;  2KGB C;  5F6T A;  5HKW A;  4ICB A;  1SL9 A;  2A4J A;  2JPT A;  4QJ4 B;  4JWQ A;  1JF2 A;  2M29 A;  2QAC A;  3TS5 B;  3O2P A;  1NWD A;  3LCP C;  1JSA A;  2KAV A;  2K7O A;  1IRJ A;  1SCM C;  3CR4 X;  3GK1 A;  4YGD B;  2R2I A;  1WY9 A;  1RRO A;  3NSI A;  4E68 A;  1F54 A;  1DJW A;  1CDN A;  1CKK A;  1ALV A;  5HYD A;  1TIZ A;  3BYA A;  1F70 A;  1OZS A;  1YX8 A;  5B8I B;  1OMR A;  2ZN9 A;  4JQ0 D;  1M63 B;  3CGA A;  4I5K A;  3DF0 A;  1NUB A;  2I7A A;  4JPZ B;  4OV2 A;  2VRG A;  4MBE A;  2I18 A;  1AVS A;  4YBH B;  4IL1 A;  2NLN A;  5KSZ A;  5JJG A;  1C07 A;  1M39 A;  1DGU A;  1YR5 A;  1ZMZ A;  4PE1 A;  4MZJ A;  2RGI A;  2ZFD A;  3K21 A;  2NZ0 A;  1L2O B;  1BG1 A;  1XFZ O;  2F3Y A;  1QVI Y;  1M31 A;  2MLE C; 
#chains in the Genus database with same CATH topology
 4WRI A;  4OR9 B;  1CDL A;  2BE6 A;  3DD4 A;  4OKH A;  4YI8 A;  1M46 A;  3TUY C;  2ZND A;  1QX2 A;  2JUL A;  3AAJ A;  2QPT A;  2WCE A;  1NSH A;  3VRQ A;  1PSB A;  1WDC C;  4I5L B;  2KFG A;  1YUT A;  5D69 A;  2I94 A;  3CWG A;  2LLU A;  3OB2 B;  4QJ3 B;  3DVM A;  5AXI A;  1RTP 1;  1TNP A;  1OZO A;  2M7L A;  1KFX S;  1XO5 A;  2PRU A;  1WRK A;  2WND A;  3KF9 A;  1WLZ A;  2LVK A;  2FCD A;  2M7N A;  3ICB A;  3BFH A;  4GUK A;  5ER4 X;  4DRW A;  2JT8 A;  3AAK A;  5I94 A;  3CAB A;  3I5H B;  2LE9 B;  1A03 A;  1K9U A;  1NX1 A;  4YRU A;  2TN4 A;  1UHI A;  1JWD A;  3CDN A;  2K60 A;  3OB1 B;  2K7D A;  4NDD A;  2GV5 A;  3D76 A;  1OW4 A;  3AKB A;  4OZD A;  1CM4 A;  2FJU B;  1G33 A;  2K2F A;  1S3P A;  2M97 A;  4ORA B;  1SCM B;  1KFU L;  3SG2 A;  1B8R A;  1SBJ A;  1Y6W A;  2COL B;  1Y1U A;  3DYE A;  1TWO A;  1JUO A;  3IQQ A;  1KQV A;  1WRZ A;  4Q04 A;  1KSM A;  4N5X A;  1SY9 A;  1YVL A;  3CYZ A;  4UPG A;  1CLM A;  3BUM B;  1CFD A;  1Q80 A;  3R1P A;  4PAL A;  3VRP A;  3EK4 A;  1BR1 B;  3SS3 A;  3BOW B;  2LLT A;  3HX4 A;  3JTD C;  5CSI A;  4FTG A;  2D8N A;  1TRF A;  4PHK A;  1SR6 B;  3EVV A;  1MF8 B;  3D0Y A;  2KGR A;  2EHB A;  1RK9 A;  2O60 A;  2CTN A;  1DF0 A;  1V1G A;  2KAY A;  1KFX L;  4GAO A;  2ZN8 A;  1NCX A;  3BJH A;  1NPQ A;  1PK0 D;  3VRN A;  3CZ1 A;  5DKR A;  3SS4 A;  2B1U A;  5DKQ A;  2BCB A;  3TUY B;  2JQ6 A;  1QXP A;  2M1K B;  1B47 A;  2BCX A;  1KCY A;  1YUU A;  2L50 A;  3RZS A;  3SG4 A;  2F3Z A;  2F33 A;  1OOJ A;  1WDC B;  3AKA A;  4PE4 A;  4U8D A;  1XK4 A;  1IJ6 A;  4PHN A;  2QDI A;  4AQJ A;  2P71 A;  3DY9 A;  4GGN A;  2AUC A;  2K7B A;  1OQP A;  2KI4 B;  1K94 A;  3CZ0 A;  4MSP A;  1AP4 A;  2L51 A;  1F8H A;  3VRO A;  1B8L A;  3I5G C;  1DEL A;  1TOP A;  1S5G Y;  2L0P A;  2LLS A;  1CDM A;  5FYX A;  1FF1 A;  2WCH A;  2KOT A;  2BKI B;  3EK8 A;  2JC2 A;  4F0Z B;  1L7Z A;  1IKU A;  4HRE E;  4CID A;  5HL1 A;  1FW4 A;  3FWC A;  1DQE A;  4DS7 A;  1XVJ A;  2WOR A;  4PCW A;  1UHJ A;  1W7J B;  2EGD A;  1T14 A;  1N65 A;  2CXJ A;  2ZRT A;  3WHU B;  1OOH A;  2BBM A;  1C3Y A;  1PRW A;  1S36 A;  1KWO C;  2MA2 A;  2QEH A;  1K93 D;  1QTX A;  2ERB A;  4HRH A;  3S0B A;  1LXF C;  2LV7 A;  2OTG C;  2L98 A;  5IBW A;  2F8P A;  5AFP A;  3SG5 A;  3QRX A;  4A4B A;  1CMF A;  2CNP A;  1S1E A;  3HCM A;  3LK1 A;  1XK4 C;  3BUO B;  1F4Q A;  1A75 A;  2KNE A;  4XJK A;  1JBA A;  2L4H A;  5HLO A;  4C0K A;  1C3Z A;  2JXC A;  3MSE B;  1REC A;  1DJY A;  4YI9 A;  1NCY A;  1LA0 A;  1CTR A;  1KK8 C;  1QIW A;  1KK7 Y;  2WC8 A;  4WQ2 A;  1EXR A;  1QX7 A;  3B6X A;  1MQ1 A;  2JOJ A;  3KHE A;  2O5G A;  2BAP A;  4M2P A;  2LMU A;  4MRY A;  3ZNI A;  1X02 A;  3I5I C;  4BY4 A;  4I5J A;  2NCO A;  1B9A A;  4TNC A;  4NQG A;  3CLN A;  2LVV A;  1U5I B;  1EG3 A;  2NCP A;  3D10 A;  4ZCU A;  2M0R A;  2P6B B;  2BE4 A;  1ALW A;  4GGF A;  2E30 A;  1UHH A;  1SNL A;  1Z4H A;  3QME A;  2ZNE A;  1CFF A;  4USL A;  1S6I A;  3R1O A;  3TDZ A;  4MZL A;  4CLN A;  3I5G B;  1KQM C;  1N0Y A;  1J7O A;  2JNX A;  2JWW A;  1IQ3 A;  1RJV A;  2L2E A;  2YGU A;  1YVH A;  1BT6 A;  1J1E A;  2K61 A;  1MR8 A;  1XA5 A;  2KPH A;  1EH2 A;  2WC5 A;  3PFV A;  1DJH A;  1XFV O;  4ORC B;  2KQY A;  2PQL A;  4GNK B;  1IJ5 A;  1XFY O;  1S6C A;  1BR4 B;  3KEV A;  5AEQ A;  2M9G A;  5CSN A;  1CLL A;  1S6J A;  1KWO B;  1DF0 B;  1QAT A;  1TNQ A;  4XYN A;  1F55 A;  1D1O A;  1YUS A;  3D77 A;  1J7P A;  3SJS A;  2OTG B;  1H4B A;  1B4C A;  3PAL A;  3EKJ A;  2MLF C;  4P5O E;  2MHH A;  3BXK A;  5CSJ A;  2LNK A;  2ZRS A;  1EJ3 A;  1KSO A;  2Q91 A;  1DEK A;  1NX3 A;  1OE9 B;  1W7I B;  2OPO A;  3B87 A;  3RM1 A;  3SG3 A;  1TUZ A;  4MRX A;  2QEO A;  1K96 A;  1RWY A;  2EC6 C;  2DOQ A;  2M3W A;  3NHI A;  4GGF C;  5I8N A;  1ZAC A;  1JFJ A;  1NIW A;  4PHM A;  3TDI A;  2JTT A;  3M0W A;  3SIB A;  1PVA A;  4NDC A;  5BPJ A;  1TN4 A;  2H61 A;  2JRF A;  2G2B A;  3TDU A;  1CNP A;  2OS8 C;  1GQM A;  4N1G A;  1TUJ A;  5AAN A;  1JFK A;  1B7T Z;  1YRU B;  3I5I B;  1G8I A;  3ZWH A;  1LVC D;  3FIA A;  4YGE B;  1YX7 A;  2WCL A;  5D7F A;  2FOT A;  2QEB A;  5HLV A;  4DCK A;  3L47 A;  1K8U A;  1FPW A;  3I5F C;  3L4A A;  1JF0 A;  4HRG A;  1E8A A;  3B86 A;  1DJZ A;  2BEC A;  2H2K A;  1Z2C B;  1KQM B;  2HF5 A;  2FCE A;  3WNX B;  4CPV A;  1CMG A;  4PT1 A;  2LMT A;  1QJT A;  2PSR A;  3JVT C;  1TCF A;  1WLM A;  3KO0 A;  1CM1 A;  3CS1 A;  3CR2 A;  2WCK A;  3SG7 A;  3O4X A;  1QWV A;  4MLW A;  1AJ5 A;  3OBV A;  2KI6 D;  1ZUZ A;  2LAN A;  2LP3 A;  3FE8 A;  5G08 A;  1A75 B;  3VB1 A;  2KSP A;  2KQ6 A;  5K89 A;  1SPY A;  2PAL A;  1K2H A;  1AJ4 A;  1OOI X;  4A4C A;  2GGZ A;  2H61 C;  5HKZ A;  2H8V A;  3A4U B;  2KFH A;  3KPX A;  4MZK A;  1QIV A;  2GGM A;  1DC1 A;  3S0D A;  3LL8 B;  4DUQ A;  3DF0 B;  2L5Y A;  4AQI A;  1CFP A;  4ETO A;  3Q8I A;  2M8U A;  1MHO A;  1NYA A;  3UNW A;  1K9P A;  1DMO A;  1AHR A;  1YRT B;  1R2U A;  2EC6 B;  2GTE A;  2KFF A;  1QLS A;  5AER A;  2K0J A;  2MBX A;  1QV1 A;  2LCP A;  2ZKM X;  1LIN A;  3E3R A;  4ZCV A;  1BMO A;  1MXE A;  1A29 A;  2OS8 B;  3TZ1 A;  3S0F A;  2G9B A;  2M49 B;  2LVI A;  1ZFS A;  1SL8 A;  2CT9 A;  4OCI A;  3S0G A;  2LC5 A;  1K95 A;  1QS7 A;  1QVI Z;  3JTD B;  5I2L A;  1QX5 B;  2LUX A;  2F2P A;  1F4O A;  2CCM A;  1GM0 A;  1GGZ A;  5KTY A;  3EG5 B;  1LKJ A;  1BU3 A;  1BJF A;  3NSK A;  3R1V A;  1Y0V H;  3CZ2 A;  2JPO A;  1NCZ A;  2LHI A;  4GPL B;  3BQ3 A;  5TNC A;  2QEV A;  3PM8 A;  3PN7 C;  1K90 D;  5DKN A;  2K2A A;  2AMI A;  3O4Y A;  3JVT B;  3OGN A;  1OMV A;  1YUR A;  2HQ8 A;  1UUS A;  2BCA A;  4PE7 A;  5CPV A;  2BKH B;  3VRR A;  3S0E A;  2LAP A;  2KDH A;  2IS9 A;  1LS8 A;  1PAL A;  1Y1X A;  1ODB A;  2WCM A;  4WQ3 A;  4QJ5 B;  4JD9 A;  2K8M B;  5ER5 A;  1CFC A;  1K9K A;  2Y4Q A;  3PJI A;  2JZI A;  3WHT B;  1SCV A;  2FJY A;  2LMV A;  2M1U A;  1FI6 A;  3GK4 X;  1AK8 A;  5D3O A;  3OX5 A;  3R72 A;  3GK2 A;  3LK0 A;  1LA3 A;  2I2R E;  3NSO A;  2KAX A;  4FQT A;  1AUI B;  1KFU S;  1J7Q A;  1MXL C;  5I2O A;  3DVE A;  1FBV A;  2LP2 A;  3FWB A;  1BLQ A;  3NXA A;  1UP5 A;  1JC2 A;  1N2D A;  3V2L A;  1SSE B;  4JKT A;  4M2Q A;  1SR6 C;  2WCB A;  3D0Y B;  3PLF B;  4PDZ A;  4P2Y B;  1G4Y R;  4IJ7 A;  2BBN A;  4YGB B;  1GJY A;  1C7W A;  4L9M A;  1S26 D;  3CTN A;  1WRL A;  4CFR A;  3FE9 A;  2BL0 C;  4MEW A;  4ORB B;  1B1G A;  1R6P A;  1PUL A;  2HPS A;  2KI6 C;  4F7F A;  2MAZ A;  1J1D A;  1A2X A;  1UUR A;  1IGV A;  2JU0 A;  5GQQ C;  5KU1 A;  1OOG A;  3H4S E;  2ISD A;  3DXL A;  1IG5 A;  1SRA A;  2KI4 C;  2PMY A;  2JT3 A;  3NSL A;  1J55 A;  1XFW O;  2SAS A;  5J3X A;  5JOL A;  5FI6 A;  3IF7 A;  2LUC A;  1QV0 A;  3NGV A;  1KK8 B;  1MWN A;  2MRD A;  1GGW A;  3PN7 B;  3UO9 A;  1QLK A;  3FS7 A;  1YTZ C;  2CBL A;  2Y5I A;  3DZT A;  2NXQ A;  3GOF A;  1SL7 A;  2HQW A;  5HKY A;  4M2O A;  1FI5 A;  1U5I A;  2AAO A;  1J7R A;  4I5N B;  4PE0 A;  1S5G Z;  4YGC B;  1OMD A;  2KHN A;  3EK7 A;  1BOC A;  1UWO A;  1HT9 A;  4FQO A;  1SYM A;  4GFT A;  2KLD A;  2Q4U A;  2P70 A;  3OX6 A;  2WC6 A;  1TTX A;  1NX0 A;  4R1E A;  1OOF A;  1IWQ A;  1OSA A;  3CZT X;  1EL4 A;  3PM2 A;  3K1E A;  4CFQ A;  2Y1M A;  1ZOT B;  4MVF A;  5CSF A;  2SCP A;  1B8C A;  4YGA A;  3A8R A;  1F71 A;  3BUW B;  3TS5 C;  1TNX A;  3WXA A;  1QAS A;  1HQV A;  1M45 A;  3O6B A;  3SS5 A;  3VGO A;  2V53 A;  1IIO A;  2PAS A;  1C7V A;  1DJX A;  3C1V A;  4XJK B;  1DJG A;  1VRK A;  3EVU A;  1BOD A;  2JTZ A;  2Y1N A;  2KLE A;  1XFU O;  4INW A;  1IQ5 A;  4GBA A;  1SMG A;  2PVB A;  4NDB A;  1CDP A;  1XFX O;  3S0A A;  3SIA A;  4N1F A;  1TCO B;  3BFA A;  4HSZ A;  2LHL A;  3DVJ A;  3LLE A;  2L2C A;  2JNF A;  2LVJ A;  1NP8 A;  3D73 A;  3D74 A;  2BL0 B;  4C0J A;  3DVK A;  2JT0 A;  1V1F A;  1KK7 Z;  3BFB A;  1DGV A;  3OHM B;  1SW8 A;  1DJI A;  1UHK A;  2WOS A;  3BUN B;  3FE6 A;  1L2O C;  1DTL A;  2MJW B;  1MUX A;  1H8B A;  1B7T Y;  1TNW A;  2JXL A;  2PYQ A;  3B88 A;  4MN0 A;  1BF5 A;  2KBM A;  1RFJ A;  2KYF A;  4INX A;  3CR5 X;  3SG6 A;  4AOM A;  4BY5 A;  4C0L A;  1DT7 B;  1UHN A;  5DIC A;  3BUX B;  2E6W A;  1PSR A;  3IQO A;  4DIR A;  5FI7 A;  2L5X B;  2KYC A;  2F2O A;  2KBI A;  3L4L A;  1SK6 D;  3EKH A;  1Y1A A;  2LM5 A;  3BOW A;  3O78 A;  1IH0 A;  1A4P A;  1SKT A;  1XYD A;  4PHJ A;  5I2Q A;  2L4I A;  5PAL A;  3F45 A;  3NHT A;  1PVB A;  3I5F B;  3EVR A;  4OVN F;  1CLB A;  1NX2 A;  1EG4 A;  2HET A;  3RLZ A;  2WCF A;  1W9Z A;  2K7C A;  4D1E A;  3I5H C;  3PAT A;  3PSR A;  1CB1 A;  3OP0 A;  1DVI A;  2KGB C;  5F6T A;  5HKW A;  3IVT A;  4ICB A;  1SL9 A;  2A4J A;  2JPT A;  4QJ4 B;  4JWQ A;  1JF2 A;  2M29 A;  2QAC A;  3TS5 B;  3O2P A;  1NWD A;  3LCP C;  1JSA A;  2KAV A;  2K7O A;  1IRJ A;  1SCM C;  1XFR A;  3CR4 X;  3GK1 A;  4YGD B;  2R2I A;  1WY9 A;  3D78 A;  1RRO A;  3D75 A;  1P28 A;  3NSI A;  3N7H A;  4E68 A;  1F54 A;  1DJW A;  1CDN A;  1CKK A;  1ALV A;  5HYD A;  1TIZ A;  2WCJ A;  3BYA A;  5EL2 A;  1F70 A;  1OZS A;  1YX8 A;  5B8I B;  1OMR A;  2ZN9 A;  4JQ0 D;  1M63 B;  3CGA A;  4I5K A;  3DF0 A;  1NUB A;  2I7A A;  4JPZ B;  4OV2 A;  2VRG A;  4MBE A;  2I18 A;  1AVS A;  4YBH B;  4IL1 A;  2NLN A;  5KSZ A;  5JJG A;  1ORG A;  1M39 A;  1DGU A;  1YR5 A;  1ZMZ A;  4PE1 A;  4MZJ A;  1C07 A;  2RGI A;  5FI2 A;  2ZFD A;  3K21 A;  2NZ0 A;  1L2O B;  1BG1 A;  1XFZ O;  4KYN A;  2F3Y A;  1QVI Y;  1M31 A;  2MLE C;  3B7A A;  2BNX A; 
#chains in the Genus database with same CATH homology
 4WRI A;  4OR9 B;  1CDL A;  2BE6 A;  3DD4 A;  4OKH A;  4YI8 A;  1M46 A;  3TUY C;  2ZND A;  1QX2 A;  2JUL A;  3AAJ A;  2QPT A;  2WCE A;  1NSH A;  3VRQ A;  1PSB A;  1WDC C;  4I5L B;  2KFG A;  1YUT A;  5D69 A;  2I94 A;  3CWG A;  2LLU A;  3OB2 B;  4QJ3 B;  3DVM A;  5AXI A;  1RTP 1;  1TNP A;  1OZO A;  2M7L A;  1KFX S;  1XO5 A;  2PRU A;  1WRK A;  2WND A;  3KF9 A;  1WLZ A;  2LVK A;  2FCD A;  2M7N A;  3ICB A;  4GUK A;  5ER4 X;  4DRW A;  2JT8 A;  3AAK A;  3I5H B;  2LE9 B;  1A03 A;  1K9U A;  1NX1 A;  4YRU A;  2TN4 A;  1UHI A;  1JWD A;  3OB1 B;  2K7D A;  4NDD A;  2GV5 A;  3AKB A;  1CM4 A;  2FJU B;  1G33 A;  2K2F A;  1S3P A;  2M97 A;  4ORA B;  1SCM B;  1KFU L;  3SG2 A;  1B8R A;  1SBJ A;  1Y6W A;  2COL B;  1Y1U A;  1JUO A;  3IQQ A;  1KQV A;  1WRZ A;  4Q04 A;  1KSM A;  4N5X A;  1SY9 A;  1YVL A;  4UPG A;  1CLM A;  3BUM B;  1CFD A;  1Q80 A;  4PAL A;  3VRP A;  3EK4 A;  1BR1 B;  3BOW B;  2LLT A;  3HX4 A;  3JTD C;  5CSI A;  4FTG A;  2D8N A;  1TRF A;  4PHK A;  1SR6 B;  3EVV A;  1MF8 B;  3D0Y A;  2KGR A;  2EHB A;  1RK9 A;  2O60 A;  2CTN A;  1DF0 A;  1V1G A;  2KAY A;  1KFX L;  4GAO A;  2ZN8 A;  1NCX A;  1NPQ A;  1PK0 D;  3VRN A;  5DKR A;  2B1U A;  5DKQ A;  2BCB A;  3TUY B;  2JQ6 A;  1QXP A;  2M1K B;  1B47 A;  2BCX A;  1KCY A;  1YUU A;  2L50 A;  3SG4 A;  2F3Z A;  2F33 A;  1OOJ A;  1WDC B;  3AKA A;  4PE4 A;  4U8D A;  1XK4 A;  1IJ6 A;  4PHN A;  4AQJ A;  4GGN A;  2AUC A;  2K7B A;  1OQP A;  2KI4 B;  1K94 A;  4MSP A;  1AP4 A;  2L51 A;  1F8H A;  3VRO A;  1B8L A;  3I5G C;  1TOP A;  1S5G Y;  2L0P A;  2LLS A;  1CDM A;  5FYX A;  1FF1 A;  2KOT A;  2BKI B;  3EK8 A;  2JC2 A;  4F0Z B;  1L7Z A;  1IKU A;  4HRE E;  4CID A;  1FW4 A;  3FWC A;  4DS7 A;  1XVJ A;  2WOR A;  4PCW A;  1UHJ A;  1W7J B;  2EGD A;  2CXJ A;  1N65 A;  3WHU B;  2ZRT A;  2BBM A;  1PRW A;  1S36 A;  1KWO C;  2MA2 A;  1K93 D;  1QTX A;  5IBW A;  4HRH A;  1LXF C;  2LV7 A;  2OTG C;  2L98 A;  2F8P A;  5AFP A;  3SG5 A;  3QRX A;  4A4B A;  1CMF A;  2CNP A;  1S1E A;  3HCM A;  3LK1 A;  1XK4 C;  3BUO B;  1F4Q A;  1A75 A;  2KNE A;  4XJK A;  1JBA A;  2L4H A;  5HLO A;  4C0K A;  2JXC A;  3MSE B;  1REC A;  1DJY A;  4YI9 A;  1NCY A;  1LA0 A;  1CTR A;  1KK8 C;  1QIW A;  1KK7 Y;  2WC8 A;  4WQ2 A;  1EXR A;  1QX7 A;  1MQ1 A;  2JOJ A;  3KHE A;  2O5G A;  4M2P A;  4MRY A;  2LMU A;  3ZNI A;  4BY4 A;  1X02 A;  3I5I C;  4I5J A;  2NCO A;  1B9A A;  4TNC A;  4NQG A;  3CLN A;  2LVV A;  1U5I B;  1EG3 A;  2NCP A;  3D10 A;  4ZCU A;  2M0R A;  2P6B B;  2BE4 A;  1ALW A;  4GGF A;  2E30 A;  1UHH A;  1SNL A;  2ZNE A;  1CFF A;  4USL A;  1S6I A;  3TDZ A;  4MZL A;  4CLN A;  3I5G B;  1KQM C;  1N0Y A;  1J7O A;  2JNX A;  2JWW A;  1IQ3 A;  1RJV A;  2L2E A;  1YVH A;  1BT6 A;  1J1E A;  2K61 A;  1MR8 A;  1XA5 A;  1EH2 A;  3PFV A;  1DJH A;  1XFV O;  4ORC B;  2KQY A;  4GNK B;  1IJ5 A;  1XFY O;  1S6C A;  1BR4 B;  3KEV A;  5AEQ A;  2M9G A;  5CSN A;  1CLL A;  1S6J A;  1KWO B;  1DF0 B;  1QAT A;  1TNQ A;  4XYN A;  1F55 A;  1D1O A;  1YUS A;  1J7P A;  3SJS A;  2OTG B;  1H4B A;  1B4C A;  3PAL A;  3EKJ A;  2MLF C;  4P5O E;  2MHH A;  3BXK A;  5CSJ A;  2LNK A;  2ZRS A;  1EJ3 A;  1KSO A;  2Q91 A;  1NX3 A;  1W7I B;  1OE9 B;  3RM1 A;  2OPO A;  3SG3 A;  4MRX A;  1K96 A;  1RWY A;  2EC6 C;  2DOQ A;  2M3W A;  5I8N A;  4GGF C;  1ZAC A;  1JFJ A;  1NIW A;  4PHM A;  3TDI A;  2JTT A;  3M0W A;  1PVA A;  4NDC A;  5BPJ A;  1TN4 A;  2H61 A;  2JRF A;  2G2B A;  3TDU A;  1CNP A;  2OS8 C;  1GQM A;  4N1G A;  5AAN A;  1JFK A;  1B7T Z;  1YRU B;  3I5I B;  1G8I A;  3ZWH A;  1LVC D;  3FIA A;  4YGE B;  1YX7 A;  5D7F A;  2FOT A;  5HLV A;  4DCK A;  1K8U A;  1FPW A;  3I5F C;  1JF0 A;  4HRG A;  1E8A A;  1DJZ A;  2BEC A;  2H2K A;  1KQM B;  2HF5 A;  2FCE A;  3WNX B;  4CPV A;  1CMG A;  2LMT A;  1QJT A;  2PSR A;  3JVT C;  1TCF A;  1WLM A;  3KO0 A;  1CM1 A;  3CS1 A;  3CR2 A;  3SG7 A;  5G08 A;  4MLW A;  1AJ5 A;  3SIB A;  2KI6 D;  1ZUZ A;  2LAN A;  2LP3 A;  1A75 B;  2KSP A;  2KQ6 A;  5K89 A;  1SPY A;  2PAL A;  1K2H A;  1AJ4 A;  4A4C A;  2GGZ A;  2H61 C;  5HKZ A;  3A4U B;  4MZK A;  2KFH A;  3KPX A;  1QIV A;  2GGM A;  3LL8 B;  4DUQ A;  3DF0 B;  4AQI A;  1CFP A;  4ETO A;  2M8U A;  1MHO A;  1NYA A;  1K9P A;  1DMO A;  1AHR A;  1YRT B;  1R2U A;  2EC6 B;  2KFF A;  1QLS A;  5AER A;  2K0J A;  2MBX A;  1QV1 A;  2LCP A;  2ZKM X;  1LIN A;  3E3R A;  4ZCV A;  1BMO A;  1MXE A;  1A29 A;  2OS8 B;  3TZ1 A;  2G9B A;  2M49 B;  2LVI A;  1ZFS A;  1SL8 A;  2CT9 A;  4OCI A;  2LC5 A;  1K95 A;  1QS7 A;  1QVI Z;  3JTD B;  5I2L A;  1QX5 B;  2LUX A;  2F2P A;  1F4O A;  2CCM A;  1GGZ A;  5KTY A;  1LKJ A;  1BU3 A;  1BJF A;  3NSK A;  1Y0V H;  2LHI A;  1NCZ A;  4GPL B;  3BQ3 A;  5TNC A;  3PM8 A;  3PN7 C;  5DKN A;  1K90 D;  2K2A A;  2AMI A;  3O4Y A;  3JVT B;  1OMV A;  1YUR A;  2HQ8 A;  1UUS A;  2BCA A;  4PE7 A;  5CPV A;  2BKH B;  3VRR A;  2LAP A;  2KDH A;  2IS9 A;  1PAL A;  1Y1X A;  1ODB A;  4WQ3 A;  4QJ5 B;  2K8M B;  5ER5 A;  1CFC A;  1K9K A;  2Y4Q A;  2JZI A;  3WHT B;  1SCV A;  2LMV A;  2M1U A;  1FI6 A;  3GK4 X;  1AK8 A;  3OX5 A;  3GK2 A;  3LK0 A;  1LA3 A;  2I2R E;  3NSO A;  2KAX A;  1AUI B;  1KFU S;  1J7Q A;  1MXL C;  5I2O A;  3DVE A;  1FBV A;  2LP2 A;  3FWB A;  1BLQ A;  3NXA A;  1UP5 A;  1JC2 A;  1N2D A;  4M2Q A;  1SR6 C;  2WCB A;  3D0Y B;  3PLF B;  4PDZ A;  4P2Y B;  1G4Y R;  2BBN A;  4YGB B;  1GJY A;  1C7W A;  4L9M A;  1S26 D;  3CTN A;  1WRL A;  4CFR A;  2BL0 C;  4MEW A;  4ORB B;  1B1G A;  1R6P A;  1PUL A;  2HPS A;  2KI6 C;  2MAZ A;  1J1D A;  1A2X A;  1UUR A;  1IGV A;  2JU0 A;  5GQQ C;  5KU1 A;  3H4S E;  2ISD A;  1IG5 A;  1SRA A;  2KI4 C;  2PMY A;  2JT3 A;  3NSL A;  1J55 A;  1XFW O;  2SAS A;  5J3X A;  5JOL A;  3IF7 A;  2LUC A;  1QV0 A;  1KK8 B;  1MWN A;  2MRD A;  1GGW A;  3PN7 B;  1QLK A;  3FS7 A;  1YTZ C;  2CBL A;  2Y5I A;  2NXQ A;  3GOF A;  1SL7 A;  2HQW A;  5HKY A;  4M2O A;  1FI5 A;  1U5I A;  2AAO A;  1J7R A;  4I5N B;  4PE0 A;  1S5G Z;  4YGC B;  1OMD A;  2KHN A;  3EK7 A;  1BOC A;  1UWO A;  1HT9 A;  4FQO A;  1SYM A;  4GFT A;  2Q4U A;  3OX6 A;  1TTX A;  1NX0 A;  4R1E A;  1IWQ A;  1OSA A;  3CZT X;  1EL4 A;  4CFQ A;  2Y1M A;  1ZOT B;  4MVF A;  5CSF A;  2SCP A;  1B8C A;  4YGA A;  3A8R A;  1F71 A;  3BUW B;  3TS5 C;  1TNX A;  3WXA A;  1QAS A;  1HQV A;  1M45 A;  3O6B A;  3VGO A;  2V53 A;  2PAS A;  1C7V A;  1DJX A;  3C1V A;  4XJK B;  1DJG A;  1VRK A;  3EVU A;  1BOD A;  2JTZ A;  2Y1N A;  1XFU O;  1IQ5 A;  4GBA A;  1SMG A;  2PVB A;  4NDB A;  1CDP A;  1XFX O;  3SIA A;  4N1F A;  1TCO B;  4HSZ A;  2LHL A;  3DVJ A;  3LLE A;  2JNF A;  2LVJ A;  1NP8 A;  2BL0 B;  4C0J A;  3DVK A;  2JT0 A;  1V1F A;  1KK7 Z;  1DGV A;  3OHM B;  1SW8 A;  1DJI A;  1UHK A;  2WOS A;  3BUN B;  1L2O C;  1DTL A;  2MJW B;  1MUX A;  1H8B A;  1B7T Y;  1TNW A;  2JXL A;  4MN0 A;  1BF5 A;  2KBM A;  1RFJ A;  2KYF A;  3SG6 A;  3CR5 X;  4C0L A;  4AOM A;  4BY5 A;  1DT7 B;  1UHN A;  3BUX B;  2E6W A;  1PSR A;  3IQO A;  4DIR A;  2L5X B;  2KYC A;  2F2O A;  2KBI A;  1SK6 D;  3EKH A;  1Y1A A;  2LM5 A;  3BOW A;  3O78 A;  1IH0 A;  1A4P A;  1SKT A;  1XYD A;  4PHJ A;  5I2Q A;  2L4I A;  5PAL A;  3F45 A;  1PVB A;  3I5F B;  3EVR A;  4OVN F;  1CLB A;  1NX2 A;  1EG4 A;  2HET A;  3RLZ A;  2WCF A;  2K7C A;  4D1E A;  3I5H C;  3PAT A;  3PSR A;  1CB1 A;  3OP0 A;  1DVI A;  2KGB C;  5F6T A;  5HKW A;  4ICB A;  1SL9 A;  2A4J A;  2JPT A;  4QJ4 B;  4JWQ A;  1JF2 A;  2M29 A;  2QAC A;  3TS5 B;  3O2P A;  1NWD A;  3LCP C;  1JSA A;  2KAV A;  2K7O A;  1IRJ A;  1SCM C;  3CR4 X;  3GK1 A;  4YGD B;  2R2I A;  1WY9 A;  1RRO A;  3NSI A;  4E68 A;  1F54 A;  1DJW A;  1CDN A;  1CKK A;  1ALV A;  5HYD A;  1TIZ A;  3BYA A;  1F70 A;  1OZS A;  1YX8 A;  5B8I B;  1OMR A;  2ZN9 A;  4JQ0 D;  1M63 B;  3CGA A;  4I5K A;  3DF0 A;  1NUB A;  2I7A A;  4JPZ B;  4OV2 A;  2VRG A;  4MBE A;  2I18 A;  1AVS A;  4YBH B;  4IL1 A;  2NLN A;  5KSZ A;  5JJG A;  1C07 A;  1M39 A;  1DGU A;  1YR5 A;  1ZMZ A;  4PE1 A;  4MZJ A;  2RGI A;  2ZFD A;  3K21 A;  2NZ0 A;  1L2O B;  1BG1 A;  1XFZ O;  2F3Y A;  1QVI Y;  1M31 A;  2MLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...