1A75B

Whiting parvalbumin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
108
structure length
108
Chain Sequence
AFAGILADADCAAAVKACEAADSFSYKAFFAKCGLSGKSADDIKKAFVFIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWVALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
publication title Tertiary Structure of a Trp-Containing Parvalbumin from Whiting (Merlangius Merlangus). Description of the Hydrophobic Core
rcsb
total genus 39
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1a75B00
1WRLA 3PM8A 2KAVA 3KEVA 4PE4A 2JXCA 4PE0A 2CCMA 1KK8B 1RTP1 2JULA 3PN7B 4BY4A 1QASA 2D8NA 1CM4A 3VROA 3KPXA 4PHJA 4NDCA 1KK7Y 1N65A 5CSNA 1J7OA 1KFUL 4L9MA 4GFTA 4YI8A 3SG7A 1S6CA 4QJ4B 1SYMA 3CR4X 3DVMA 2ZRTA 3VRRA 1XFXO 2OTGC 1SKTA 2BL0B 1XFWO 2MLFC 1M46A 1WRZA 1IJ5A 2K8MB 1BR4B 3PATA 4ORAB 1NX3A 5F6TA 1V1FA 1WDCB 3I5HC 1CMFA 1RJVA 2JXLA 4DRWA 3BOWA 2LMVA 1B8LA 1JBAA 1PULA 4Q04A 1KSMA 1AJ4A 2E30A 3E3RA 1IKUA 3NSKA 1NYAA 1DJIA 1G33A 3AKAA 1JSAA 1A4PA 3BUMB 4ORCB 3EKJA 3JVTC 2KI4B 1PRWA 3O78A 1G4YR 1L2OC 2NCOA 2BBNA 3EK4A 1WY9A 2M29A 1XK4A 1S3PA 1CDPA 4OVNF 2A4JA 1OMDA 2LP2A 3CZTX 1RECA 5DKNA 1K94A 4U8DA 1DJYA 3LK0A 3SIBA 1DVIA 4JWQA 5KU1A 2FCDA 1BU3A 5D69A 1KCYA 2F8PA 1J55A 3WHUB 2K7OA 3DVKA 2SCPA 4PHKA 1K2HA 3M0WA 2ZNEA 1XVJA 3OB1B 5D7FA 5AFPA 1S5GZ 3CWGA 4DCKA 3D10A 5DKQA 1EG3A 4I5NB 3SIAA 1IRJA 1BLQA 2QACA 1BR1B 1B47A 1U5IA 1QVIZ 2KGBC 1KWOC 4I5LB 2KGRA 1FW4A 1SCVA 1AUIB 2I18A 3I5IC 2I94A 2JOJA 2LCPA 2M9GA 4CPVA 1AJ5A 1GGZA 1RK9A 1K9KA 1WLMA 2KYCA 3LK1A 2F2PA 1UHIA 4ZCUA 1B8CA 1M31A 2HQWA 2K7CA 3NSIA 5I2LA 2MHHA 1J1EA 1KK7Z 1ODBA 2BECA 3C1VA 5HKZA 1C7VA 2JWWA 2FCEA 1NIWA 1PSBA 5KTYA 3I5FC 2MAZA 4N5XA 1L2OB 2EC6C 1UHHA 2HF5A 2ZN8A 3F45A 3LLEA 1CTRA 1A03A 2JC2A 2BCXA 1UHJA 2ZN9A 2BCAA 1KFXS 2H61A 1BF5A 3TS5C 2L4IA 1DJXA 1CLLA 2L2EA 4OKHA 4D1EA 3LL8B 5CSIA 1MHOA 2R2IA 3BOWB 4PCWA 3TDIA 4CIDA 2PRUA 1HQVA 2KBIA 1TNWA 1JF2A 2M0RA 5I2OA 1NCYA 3O6BA 1WRKA 3FIAA 5IBWA 1QLKA 1SRAA 3KO0A 1KWOB 2Y1MA 3JTDC 2LMTA 2KYFA 1NP8A 1LINA 2BKHB 1LVCD 4YI9A 4MVFA 4PE7A 1S26D 2BBMA 2JT8A 2L0PA 1TNPA 3O4YA 1B1GA 4MZKA 1OOJA 1K9PA 4MRXA 4XJKA 4WQ2A 2CNPA 1S6IA 2H61C 4P2YB 1X02A 1V1GA 1LA0A 1XYDA 2KHNA 3I5FB 2I7AA 3KHEA 1F70A 3SG6A 3D0YB 3WNXB 5BPJA 2EC6B 2WC8A 3A4UB 4CFQA 3SG4A 4PHMA 2EGDA 3WXAA 3EVRA 3KF9A 2FOTA 1OMVA 2GV5A 2PALA 1IWQA 2KI6C 2OS8B 3BXKA 2B1UA 3OP0A 1CFDA 2HETA 2K2AA 1MF8B 4E68A 2KDHA 2KBMA 1AVSA 4CLNA 1U5IB 1VRKA 2MJWB 1M39A 1C7WA 1R6PA 3EK7A 3TS5B 4DS7A 2LANA 2M7NA 1DMOA 2LMUA 1DF0A 1PVAA 2Y4QA 1F55A 1OMRA 3ZWHA 1FF1A 1SPYA 2LHIA 4MSPA 2LUCA 2JT3A 4YRUA 1CFCA 2IS9A 3EKHA 1ALWA 2VRGA 3RM1A 3JTDB 4ORBB 1PVBA 4PE1A 1YVLA 4M2PA 3H4SE 4YGEB 1FI5A 4GGNA 1QV0A 2JNXA 3GOFA 3I5GB 2LVJA 2WCEA 2V53A 5I8NA 2TN4A 2K0JA 4I5JA 3RLZA 1M63B 2PSRA 4UPGA 1AP4A 3HX4A 1XFUO 1SL7A 1AHRA 1N0YA 1LA3A 1XO5A 5CSJA 3D0YA 1EJ3A 3LCPC 1TRFA 4USLA 1SL9A 2LNKA 1SBJA 3A8RA 3K21A 1QJTA 1MR8A 4YGBB 4QJ3B 1CFPA 2CTNA 1ZOTB 2I2RE 4MZLA 4DIRA 2HPSA 2M1KB 1Y0VH 3AAJA 1NX0A 1QTXA 2MBXA 2LVKA 4WQ3A 1MQ1A 1YRUB 1TTXA 1UUSA 1OSAA 1QIWA 1YX7A 5AXIA 5JOLA 3SG3A 1SK6D 3VRQA 4AQJA 1QX7A 2G9BA 2K2FA 3FS7A 1IQ3A 1JC2A 1K9UA 1KQMB 1CLMA 1Q80A 1XK4C 2ZFDA 3SG5A 2WORA 4GGFA 4NQGA 1QV1A 1JWDA 2Q4UA 2ZRSA 3TDZA 4XJKB 2K61A 3OB2B 1B7TY 4F0ZB 2H2KA 2P6BB 2JZIA 1TCOB 1FPWA 1XFYO 2E6WA 2L4HA 1OZSA 1PALA 3HCMA 4PALA 3ZNIA 1A2XA 1S6JA 2BE6A 1YTZC 2LVIA 2O5GA 3OHMB 5JJGA 1CDNA 1NUBA 4OR9B 1BODA 1CKKA 4ICBA 1RFJA 2L98A 2QPTA 5AERA 1YX8A 2JU0A 1OZOA 4A4BA 5J3XA 2OS8C 3CTNA 2JQ6A 3EK8A 1JF0A 1NCXA 1TNXA 1HT9A 4I5KA 2HQ8A 2OPOA 1A29A 2KOTA 5CPVA 4ETOA 1NSHA 1S36A 1UP5A 4FTGA 4GNKB 4JPZB 5HLVA 4NDDA 1DF0B 4GUKA 4MLWA 3TUYC 4MN0A 2KI6D 4HSZA 4GGFC 1QATA 2KAXA 1EH2A 1QS7A 1NCZA 1YUTA 4FQOA 4PDZA 3TZ1A 4P5OE 3DVEA 1G8IA 5G08A 2KQYA 1KFXL 3FWCA 1DTLA 2MA2A 3VGOA 4M2OA 1BJFA 3VRPA 2JPTA 2L51A 3O2PA 3TDUA 1XFVO 1YVHA 1TOPA 1N2DA 1A75B 1UHNA 1R2UA 1C07A 3I5GC 3EVVA 1J7QA 1GQMA 4YBHB 5HKYA 3CGAA 1ALVA 4JQ0D 1UURA 1EXRA 4MBEA 1H8BA 2KNEA 2JT0A 4OCIA 2M1UA 1Y1XA 1F4OA 2LLTA 1BG1A 3OX5A 2NCPA 3AAKA 5DKRA 1SY9A 3NXAA 2PVBA 1RWYA 3ICBA 5ER5A 2K7BA 1CM1A 4CFRA 3GK1A 3OX6A 4ZCVA 2M7LA 1ZFSA 3CR2A 3GK4X 2F2OA 4C0LA 1OQPA 5HKWA 1DJGA 1KFUS 4YGDB 1Y1AA 1KSOA 1DT7B 2LV7A 1KQVA 1K93D 1K95A 4WRIA 1NX2A 2RGIA 3IQOA 1B7TZ 1FI6A 1DJZA 1NX1A 3TUYB 2CBLA 2LHLA 2LE9B 1KQMC 4MEWA 2F3YA 1GJYA 3BUXB 5ER4X 1MXLC 4GPLB 1QX5B 5AANA 5I2QA 1EG4A 4YGCB 2LVVA 1MWNA 1SR6B 1QX2A 2BE4A 2F33A 3IF7A 2LAPA 1YUUA 1NWDA 3GK2A 3BUWB 2M8UA 1NPQA 5HLOA 3NSOA 3WHTB 4HRHA 3PALA 1A75A 4HREE 4XYNA 2KAYA 3BQ3A 2LLUA 1XA5A 2JNFA 2BCBA 4GAOA 3DF0A 1J7RA 5GQQC 4QJ5B 3PLFB 1JFKA 1K90D 1CDMA 3BUOB 2AAOA 4YGAA 4AQIA 2COLB 2Y5IA 1PSRA 1ZMZA 2EHBA 5AEQA 1JFJA 2NLNA 1TIZA 2FJUB 2NXQA 1J7PA 1YURA 1WLZA 1CDLA 4N1FA 1SW8A 2L50A 4AOMA 4M2QA 1CNPA 4N1GA 4C0JA 1AK8A 1YRTB 2AMIA 3IQQA 1FBVA 3BYAA 1IJ6A 3EVUA 1ZACA 1GGWA 4HRGA 1YUSA 3FWBA 2G2BA 4MRYA 2WCFA 1CLBA 3DD4A 2LC5A 3VRNA 2O60A 2MLEC 1SNLA 1MXEA 3SJSA 4TNCA 2L5XB 2KFHA 5CSFA 2ISDA 1QIVA 1W7IB 2OTGB 1D1OA 1DJHA 1CFFA 3AKBA 1SCMC 4IL1A 1M45A 3I5HB 1DGUA 2Y1NA 1CB1A 2JTTA 2WCBA 2MRDA 1XFZO 2GGMA 2AUCA 2NZ0A 1F8HA 1LXFC 1IQ5A 1E8AA 3QRXA 5K89A 2F3ZA 1B4CA 4OV2A 1F54A 1DGVA 1IGVA 3JVTB 1ZUZA 1F4QA 4MZJA 4BY5A 1KK8C 1QXPA 3PN7C 4R1EA 1EL4A 2JRFA 3CR5X 1Y6WA 4NDBA 2WNDA 2KFFA 2M97A 3PFVA 1SR6C 2PMYA 2GGZA 1UWOA 1L7ZA 3SG2A 4DUQA 4A4CA 1DJWA 1B9AA 2Q91A 1K96A 2BL0C 4GBAA 2K7DA 3NSLA 5HYDA 2KFGA 1TCFA 1WDCC 5TNCA 1F71A 1RROA 3DF0B 4PHNA 2LM5A 1YR5A 2CT9A 1SMGA 2DOQA 2KSPA 1K8UA 2SASA 1JUOA 3BUNB 2PASA 1BOCA 1IG5A 1W7JB 3PSRA 1TN4A 1BT6A 5B8IB 5KSZA 1IH0A 3CS1A 1SL8A 1S1EA 2LUXA 1CMGA 3CLNA 1PK0D 1Y1UA 1SCMB 2KI4C 1H4BA 3I5IB 3MSEB 1QLSA 1S5GY 1J1DA 2KQ6A 2M49B 3DVJA 5PALA 2BKIB 4C0KA 5FYXA 1OE9B 2M3WA 1LKJA 1MUXA 2LP3A 2ZNDA 2LLSA 1QVIY 1TNQA 1B8RA 1BMOA 2ZKMX 1UHKA 2JTZA 2WOSA 2CXJA
chains in the Genus database with same CATH superfamily
1WRLA 3PM8A 2KAVA 3KEVA 4PE4A 2JXCA 4PE0A 2CCMA 1KK8B 1RTP1 2JULA 3PN7B 4F7FA 4BY4A 1OOHA 1QASA 2D8NA 1CM4A 3VROA 3V2LA 3KPXA 4PHJA 4NDCA 1ORGA 1KK7Y 1N65A 5CSNA 1J7OA 3CZ2A 1KFUL 4L9MA 4GFTA 4YI8A 3SG7A 1S6CA 4QJ4B 1SYMA 3CR4X 3DVMA 2ZRTA 3VRRA 1XFXO 2OTGC 1SKTA 1TUZA 1XFWO 2BL0B 1M46A 1WRZA 1IJ5A 2K8MB 1BR4B 2MLFC 3PATA 4ORAB 2QEHA 1NX3A 5F6TA 1V1FA 1WDCB 3I5HC 5FI6A 1CMFA 1RJVA 2JXLA 4DRWA 3BOWA 2LMVA 1B8LA 1JBAA 1PULA 3B7AA 4Q04A 1KSMA 1AJ4A 2E30A 1Z2CB 3E3RA 1IKUA 3NSKA 1NYAA 1DJIA 1G33A 3AKAA 1JSAA 1A4PA 3BUMB 4ORCB 3EKJA 3JVTC 3S0GA 2KI4B 1OW4A 1PRWA 3O78A 1G4YR 1L2OC 2NCOA 2BBNA 3EK4A 1WY9A 2M29A 1XK4A 1C3ZA 1S3PA 5D3OA 1CDPA 4OVNF 2A4JA 1OMDA 2LP2A 3SS4A 3CZTX 1RECA 5DKNA 1K94A 2WCMA 4U8DA 1DJYA 3LK0A 3SIBA 1DVIA 4JWQA 5KU1A 2FCDA 1BU3A 5D69A 1KCYA 2F8PA 1J55A 3WHUB 2K7OA 3DVKA 2SCPA 4PHKA 3SS5A 1K2HA 3M0WA 2ZNEA 1XVJA 3OB1B 3DXLA 5D7FA 5AFPA 1S5GZ 3CWGA 4DCKA 3D10A 5DKQA 1EG3A 3BFAA 4I5NB 3SIAA 1IRJA 1BLQA 2QACA 1BR1B 1B47A 1U5IA 1QVIZ 2KGBC 1KWOC 4I5LB 2KGRA 1FW4A 1SCVA 1AUIB 2I18A 3I5IC 3QMEA 4PT1A 2I94A 2JOJA 2LCPA 2M9GA 3O4XA 4CPVA 1AJ5A 1GGZA 1RK9A 1K9KA 1WLMA 2KYCA 3LK1A 2F2PA 1UHIA 4ZCUA 1B8CA 1M31A 2HQWA 2K7CA 3NSIA 5I2LA 2MHHA 1J1EA 1KK7Z 1ODBA 2BECA 2L5YA 2WC5A 3C1VA 2JWWA 5HKZA 2FCEA 1NIWA 1DC1A 1PSBA 5KTYA 3I5FC 1C7VA 2MAZA 4N5XA 1L2OB 2EC6C 1UHHA 2HF5A 4INXA 2ZN8A 3F45A 3LLEA 1CTRA 1P28A 2WCLA 1A03A 2JC2A 3S0FA 2BCXA 1UHJA 2ZN9A 3D74A 3CZ0A 2BCAA 1KFXS 2H61A 5HL1A 1BF5A 3TS5C 2L4IA 1DJXA 1CLLA 2L2EA 4OKHA 4D1EA 3LL8B 5CSIA 1MHOA 2R2IA 3BOWB 4PCWA 3R1VA 3IVTA 3TDIA 2QDIA 4CIDA 2PRUA 1HQVA 2KBIA 1TNWA 1JF2A 2M0RA 5I2OA 1NCYA 3O6BA 1WRKA 3FIAA 5IBWA 1QLKA 1SRAA 3KO0A 1KWOB 2Y1MA 3JTDC 2LMTA 2KYFA 1NP8A 1LINA 2BKHB 1LVCD 4JKTA 4YI9A 4MVFA 2QEBA 1S26D 2BBMA 2JT8A 2L0PA 3R1PA 4PE7A 1TNPA 3FE9A 3O4YA 1B1GA 4MZKA 1OOJA 1K9PA 4MRXA 4XJKA 3RZSA 4WQ2A 2CNPA 1S6IA 2H61C 4P2YB 1OOIX 3DZTA 2PQLA 3D73A 1X02A 1V1GA 1LA0A 1XYDA 2KHNA 3I5FB 2I7AA 3KHEA 1F70A 3SG6A 3D0YB 3WNXB 5BPJA 2EC6B 2WC8A 3A4UB 3D77A 4JD9A 4CFQA 3SG4A 4PHMA 2EGDA 3WXAA 1QWVA 3EVRA 3KF9A 2FOTA 5EL2A 1OMVA 2GV5A 2PALA 1IWQA 3D76A 2KI6C 3R1OA 2OS8B 3BXKA 2B1UA 3OP0A 1CFDA 2HETA 2K2AA 1MF8B 3NGVA 4E68A 2KDHA 2KBMA 1AVSA 4CLNA 1U5IB 1VRKA 2MJWB 1M39A 1C7WA 3S0BA 1R6PA 3EK7A 3L4AA 3TS5B 4DS7A 2LANA 2M7NA 1DMOA 2LMUA 1DF0A 3D75A 1PVAA 2Y4QA 1F55A 3BFBA 1OMRA 3ZWHA 1FF1A 1SPYA 2LHIA 4MSPA 2LUCA 2JPOA 2JT3A 4YRUA 1CFCA 2IS9A 3EKHA 1ALWA 2VRGA 3RM1A 3JTDB 4ORBB 1PVBA 1TUJA 1YVLA 4M2PA 3H4SE 4PE1A 4YGEB 1C3YA 1FI5A 4GGNA 1QV0A 2JNXA 3GOFA 3I5GB 2LVJA 2WCEA 2V53A 5I8NA 2TN4A 2K0JA 4I5JA 3RLZA 1M63B 2PSRA 4UPGA 1AP4A 3HX4A 1XFUO 1SL7A 1AHRA 1N0YA 1LA3A 1XO5A 5CSJA 3D0YA 1EJ3A 3LCPC 1TRFA 4USLA 1SL9A 2LNKA 1SBJA 3A8RA 1IIOA 3K21A 3OBVA 1QJTA 1MR8A 4YGBB 4QJ3B 1CFPA 2CTNA 1ZOTB 2I2RE 4MZLA 4DIRA 2HPSA 2M1KB 1Y0VH 3AAJA 1NX0A 1QTXA 3PM2A 2MBXA 3UNWA 3BFHA 3VB1A 2LVKA 4WQ3A 1MQ1A 1YRUB 1TTXA 1UUSA 1OSAA 1QIWA 1YX7A 5AXIA 5JOLA 3SG3A 1SK6D 3VRQA 4AQJA 1QX7A 2G9BA 2K2FA 3FS7A 1IQ3A 1JC2A 1K9UA 1KQMB 1CLMA 1Q80A 1XK4C 2ZFDA 3PJIA 2WORA 4GGFA 4NQGA 1QV1A 3SG5A 2Q4UA 2ZRSA 3TDZA 4XJKB 2K61A 3OB2B 1B7TY 4F0ZB 3L4LA 2H2KA 2P6BB 2JZIA 1TCOB 1FPWA 1XFYO 2E6WA 2L4HA 1OZSA 1PALA 2QEVA 3HCMA 4PALA 3ZNIA 1A2XA 1S6JA 2BE6A 1YTZC 2LVIA 2O5GA 3OHMB 5JJGA 3TUYC 1CDNA 1NUBA 4OR9B 3FE6A 1BODA 4INWA 1OOGA 1CKKA 4ICBA 1RFJA 2L98A 2QPTA 5AERA 1YX8A 2JU0A 1OZOA 4A4BA 5J3XA 2OS8C 3CTNA 2JQ6A 3EK8A 1JF0A 1NCXA 1TNXA 1HT9A 4I5KA 2HQ8A 2OPOA 1A29A 2KOTA 3SS3A 5CPVA 4ETOA 1NSHA 1S36A 1UP5A 4FTGA 4GNKB 4JPZB 5HLVA 4NDDA 1DF0B 4GUKA 4MLWA 5DICA 2FJYA 5FI2A 4MN0A 2KI6D 4HSZA 4GGFC 1QATA 4FQTA 2KAXA 1EH2A 1QS7A 1NCZA 1YUTA 4FQOA 4PDZA 3TZ1A 4P5OE 3DVEA 1G8IA 2QEOA 2KQYA 5G08A 1KFXL 3FWCA 1DTLA 2MA2A 3VGOA 4M2OA 3Q8IA 1BJFA 3VRPA 2JPTA 2L51A 3O2PA 3TDUA 1XFVO 1YVHA 1TOPA 1N2DA 1A75B 1UHNA 1R2UA 1C07A 3I5GC 3EVVA 1J7QA 1GQMA 4YBHB 5HKYA 3CGAA 1ALVA 4JQ0D 1UURA 1EXRA 4MBEA 1H8BA 3FE8A 2KNEA 2JT0A 4OCIA 2M1UA 1Y1XA 1F4OA 2LLTA 3B6XA 1BG1A 3OX5A 1XFRA 2NCPA 3AAKA 5DKRA 1SY9A 3NXAA 2PVBA 1RWYA 3D78A 3ICBA 5ER5A 2WCHA 2K7BA 1CM1A 4CFRA 3GK1A 3OX6A 4ZCVA 2M7LA 1ZFSA 3CR2A 3GK4X 2F2OA 3NHTA 4C0LA 1OQPA 5HKWA 1DJGA 1KFUS 4YGDB 1Y1AA 1KSOA 1DT7B 2LV7A 1KQVA 1K93D 1K95A 4WRIA 1NX2A 2RGIA 1OOFA 3IQOA 1B7TZ 1FI6A 1DJZA 4IJ7A 1NX1A 3TUYB 2CBLA 2LHLA 2LE9B 1KQMC 4MEWA 2F3YA 1W9ZA 2K60A 1GJYA 3BUXB 5ER4X 1MXLC 4GPLB 1QX5B 2KLEA 5AANA 5I2QA 1EG4A 4YGCB 2LVVA 1MWNA 1SR6B 1QX2A 2BE4A 2F33A 3IF7A 2LAPA 1YUUA 1NWDA 3GK2A 3BUWB 2BAPA 2M8UA 1NPQA 5HLOA 1GM0A 3OGNA 3NSOA 3WHTB 4HRHA 3PALA 1A75A 4HREE 4XYNA 2KAYA 3BQ3A 2LLUA 1XA5A 2JNFA 2BCBA 4GAOA 3DF0A 1J7RA 5GQQC 4QJ5B 1JWDA 1SSEB 3PLFB 1JFKA 2KLDA 1K90D 1CDMA 2WCKA 3BUOB 2AAOA 4YGAA 4AQIA 2GTEA 2COLB 2Y5IA 1PSRA 3EG5B 2P70A 3N7HA 2WC6A 3R72A 1ZMZA 2EHBA 5AEQA 1JFJA 2NLNA 1TIZA 2FJUB 2NXQA 1DELA 2H8VA 1YURA 1WLZA 1J7PA 1CDLA 4N1FA 1SW8A 2L50A 4AOMA 2P71A 2PYQA 4M2QA 3CABA 1CNPA 4N1GA 4C0JA 1AK8A 1YRTB 2AMIA 3S0DA 3IQQA 1FBVA 3BYAA 1IJ6A 3EVUA 1ZACA 1GGWA 4HRGA 1YUSA 3FWBA 2G2BA 4MRYA 2WCFA 1CLBA 2WCJA 3DD4A 2LC5A 3VRNA 2O60A 2MLEC 1SNLA 1MXEA 2L2CA 3CDNA 3SJSA 4TNCA 2L5XB 2KFHA 5CSFA 3L47A 1QIVA 2ISDA 1W7IB 2OTGB 1D1OA 1DJHA 1CFFA 3AKBA 3B88A 1SCMC 4IL1A 1M45A 3I5HB 1DGUA 2Y1NA 1CB1A 2JTTA 2WCBA 2MRDA 1DQEA 1T14A 1XFZO 2GGMA 2AUCA 2NZ0A 1F8HA 1LXFC 1IQ5A 1E8AA 3DY9A 3QRXA 5K89A 2F3ZA 1B4CA 4OV2A 1F54A 1DGVA 1IGVA 3JVTB 5I94A 3S0AA 3B87A 1TWOA 1ZUZA 1F4QA 3UO9A 2BNXA 4MZJA 5FI7A 4BY5A 4KYNA 1KK8C 1QXPA 3PN7C 1LS8A 4R1EA 1EL4A 1Z4HA 2JRFA 3CR5X 1Y6WA 4NDBA 2WNDA 2KFFA 2M97A 3PFVA 1SR6C 2PMYA 2GGZA 1UWOA 2KPHA 1L7ZA 3SG2A 4DUQA 4A4CA 1DEKA 1DJWA 1B9AA 4OZDA 2Q91A 1K96A 2BL0C 3NHIA 4GBAA 2K7DA 3NSLA 5HYDA 2KFGA 3BJHA 1TCFA 1WDCC 5TNCA 1F71A 1RROA 3DF0B 4PHNA 2LM5A 1YR5A 1SMGA 2CT9A 2DOQA 2KSPA 1K8UA 2SASA 3CYZA 1JUOA 3BUNB 2PASA 1BOCA 1IG5A 1W7JB 3PSRA 1TN4A 1BT6A 2ERBA 5B8IB 5KSZA 1IH0A 3CS1A 1SL8A 1S1EA 2LUXA 1CMGA 3CLNA 1PK0D 1Y1UA 1SCMB 2KI4C 3DYEA 1H4BA 3I5IB 3CZ1A 1QLSA 1S5GY 1J1DA 2KQ6A 2M49B 2YGUA 3DVJA 2BKIB 3MSEB 5PALA 3S0EA 4C0KA 5FYXA 1OE9B 2M3WA 1LKJA 1MUXA 2LP3A 2ZNDA 2LLSA 3K1EA 1QVIY 3B86A 1TNQA 1B8RA 1BMOA 2ZKMX 1UHKA 2JTZA 2WOSA 2CXJA
chains in the Genus database with same CATH topology
1WRLA 3PM8A 2KAVA 3KEVA 4PE4A 2JXCA 4PE0A 2CCMA 1KK8B 1RTP1 2JULA 3PN7B 4BY4A 1QASA 2D8NA 1CM4A 3VROA 3KPXA 4PHJA 4NDCA 1KK7Y 1N65A 5CSNA 1J7OA 1KFUL 4L9MA 4GFTA 4YI8A 3SG7A 1S6CA 4QJ4B 1SYMA 3CR4X 3DVMA 2ZRTA 3VRRA 1XFXO 2OTGC 1SKTA 2BL0B 1XFWO 2MLFC 1M46A 1WRZA 1IJ5A 2K8MB 1BR4B 3PATA 4ORAB 1NX3A 5F6TA 1V1FA 1WDCB 3I5HC 1CMFA 1RJVA 2JXLA 4DRWA 3BOWA 2LMVA 1B8LA 1JBAA 1PULA 4Q04A 1KSMA 1AJ4A 2E30A 3E3RA 1IKUA 3NSKA 1NYAA 1DJIA 1G33A 3AKAA 1JSAA 1A4PA 3BUMB 4ORCB 3EKJA 3JVTC 2KI4B 1PRWA 3O78A 1G4YR 1L2OC 2NCOA 2BBNA 3EK4A 1WY9A 2M29A 1XK4A 1S3PA 1CDPA 4OVNF 2A4JA 1OMDA 2LP2A 3CZTX 1RECA 5DKNA 1K94A 4U8DA 1DJYA 3LK0A 3SIBA 1DVIA 4JWQA 5KU1A 2FCDA 1BU3A 5D69A 1KCYA 2F8PA 1J55A 3WHUB 2K7OA 3DVKA 2SCPA 4PHKA 1K2HA 3M0WA 2ZNEA 1XVJA 3OB1B 5D7FA 5AFPA 1S5GZ 3CWGA 4DCKA 3D10A 5DKQA 1EG3A 4I5NB 3SIAA 1IRJA 1BLQA 2QACA 1BR1B 1B47A 1U5IA 1QVIZ 2KGBC 1KWOC 4I5LB 2KGRA 1FW4A 1SCVA 1AUIB 2I18A 3I5IC 2I94A 2JOJA 2LCPA 2M9GA 4CPVA 1AJ5A 1GGZA 1RK9A 1K9KA 1WLMA 2KYCA 3LK1A 2F2PA 1UHIA 4ZCUA 1B8CA 1M31A 2HQWA 2K7CA 3NSIA 5I2LA 2MHHA 1J1EA 1KK7Z 1ODBA 2BECA 3C1VA 5HKZA 1C7VA 2JWWA 2FCEA 1NIWA 1PSBA 5KTYA 3I5FC 2MAZA 4N5XA 1L2OB 2EC6C 1UHHA 2HF5A 2ZN8A 3F45A 3LLEA 1CTRA 1A03A 2JC2A 2BCXA 1UHJA 2ZN9A 2BCAA 1KFXS 2H61A 1BF5A 3TS5C 2L4IA 1DJXA 1CLLA 2L2EA 4OKHA 4D1EA 3LL8B 5CSIA 1MHOA 2R2IA 3BOWB 4PCWA 3TDIA 4CIDA 2PRUA 1HQVA 2KBIA 1TNWA 1JF2A 2M0RA 5I2OA 1NCYA 3O6BA 1WRKA 3FIAA 5IBWA 1QLKA 1SRAA 3KO0A 1KWOB 2Y1MA 3JTDC 2LMTA 2KYFA 1NP8A 1LINA 2BKHB 1LVCD 4YI9A 4MVFA 4PE7A 1S26D 2BBMA 2JT8A 2L0PA 1TNPA 3O4YA 1B1GA 4MZKA 1OOJA 1K9PA 4MRXA 4XJKA 4WQ2A 2CNPA 1S6IA 2H61C 4P2YB 1X02A 1V1GA 1LA0A 1XYDA 2KHNA 3I5FB 2I7AA 3KHEA 1F70A 3SG6A 3D0YB 3WNXB 5BPJA 2EC6B 2WC8A 3A4UB 4CFQA 3SG4A 4PHMA 2EGDA 3WXAA 3EVRA 3KF9A 2FOTA 1OMVA 2GV5A 2PALA 1IWQA 2KI6C 2OS8B 3BXKA 2B1UA 3OP0A 1CFDA 2HETA 2K2AA 1MF8B 4E68A 2KDHA 2KBMA 1AVSA 4CLNA 1U5IB 1VRKA 2MJWB 1M39A 1C7WA 1R6PA 3EK7A 3TS5B 4DS7A 2LANA 2M7NA 1DMOA 2LMUA 1DF0A 1PVAA 2Y4QA 1F55A 1OMRA 3ZWHA 1FF1A 1SPYA 2LHIA 4MSPA 2LUCA 2JT3A 4YRUA 1CFCA 2IS9A 3EKHA 1ALWA 2VRGA 3RM1A 3JTDB 4ORBB 1PVBA 4PE1A 1YVLA 4M2PA 3H4SE 4YGEB 1FI5A 4GGNA 1QV0A 2JNXA 3GOFA 3I5GB 2LVJA 2WCEA 2V53A 5I8NA 2TN4A 2K0JA 4I5JA 3RLZA 1M63B 2PSRA 4UPGA 1AP4A 3HX4A 1XFUO 1SL7A 1AHRA 1N0YA 1LA3A 1XO5A 5CSJA 3D0YA 1EJ3A 3LCPC 1TRFA 4USLA 1SL9A 2LNKA 1SBJA 3A8RA 3K21A 1QJTA 1MR8A 4YGBB 4QJ3B 1CFPA 2CTNA 1ZOTB 2I2RE 4MZLA 4DIRA 2HPSA 2M1KB 1Y0VH 3AAJA 1NX0A 1QTXA 2MBXA 2LVKA 4WQ3A 1MQ1A 1YRUB 1TTXA 1UUSA 1OSAA 1QIWA 1YX7A 5AXIA 5JOLA 3SG3A 1SK6D 3VRQA 4AQJA 1QX7A 2G9BA 2K2FA 3FS7A 1IQ3A 1JC2A 1K9UA 1KQMB 1CLMA 1Q80A 1XK4C 2ZFDA 3SG5A 2WORA 4GGFA 4NQGA 1QV1A 1JWDA 2Q4UA 2ZRSA 3TDZA 4XJKB 2K61A 3OB2B 1B7TY 4F0ZB 2H2KA 2P6BB 2JZIA 1TCOB 1FPWA 1XFYO 2E6WA 2L4HA 1OZSA 1PALA 3HCMA 4PALA 3ZNIA 1A2XA 1S6JA 2BE6A 1YTZC 2LVIA 2O5GA 3OHMB 5JJGA 1CDNA 1NUBA 4OR9B 1BODA 1CKKA 4ICBA 1RFJA 2L98A 2QPTA 5AERA 1YX8A 2JU0A 1OZOA 4A4BA 5J3XA 2OS8C 3CTNA 2JQ6A 3EK8A 1JF0A 1NCXA 1TNXA 1HT9A 4I5KA 2HQ8A 2OPOA 1A29A 2KOTA 5CPVA 4ETOA 1NSHA 1S36A 1UP5A 4FTGA 4GNKB 4JPZB 5HLVA 4NDDA 1DF0B 4GUKA 4MLWA 3TUYC 4MN0A 2KI6D 4HSZA 4GGFC 1QATA 2KAXA 1EH2A 1QS7A 1NCZA 1YUTA 4FQOA 4PDZA 3TZ1A 4P5OE 3DVEA 1G8IA 5G08A 2KQYA 1KFXL 3FWCA 1DTLA 2MA2A 3VGOA 4M2OA 1BJFA 3VRPA 2JPTA 2L51A 3O2PA 3TDUA 1XFVO 1YVHA 1TOPA 1N2DA 1A75B 1UHNA 1R2UA 1C07A 3I5GC 3EVVA 1J7QA 1GQMA 4YBHB 5HKYA 3CGAA 1ALVA 4JQ0D 1UURA 1EXRA 4MBEA 1H8BA 2KNEA 2JT0A 4OCIA 2M1UA 1Y1XA 1F4OA 2LLTA 1BG1A 3OX5A 2NCPA 3AAKA 5DKRA 1SY9A 3NXAA 2PVBA 1RWYA 3ICBA 5ER5A 2K7BA 1CM1A 4CFRA 3GK1A 3OX6A 4ZCVA 2M7LA 1ZFSA 3CR2A 3GK4X 2F2OA 4C0LA 1OQPA 5HKWA 1DJGA 1KFUS 4YGDB 1Y1AA 1KSOA 1DT7B 2LV7A 1KQVA 1K93D 1K95A 4WRIA 1NX2A 2RGIA 3IQOA 1B7TZ 1FI6A 1DJZA 1NX1A 3TUYB 2CBLA 2LHLA 2LE9B 1KQMC 4MEWA 2F3YA 1GJYA 3BUXB 5ER4X 1MXLC 4GPLB 1QX5B 5AANA 5I2QA 1EG4A 4YGCB 2LVVA 1MWNA 1SR6B 1QX2A 2BE4A 2F33A 3IF7A 2LAPA 1YUUA 1NWDA 3GK2A 3BUWB 2M8UA 1NPQA 5HLOA 3NSOA 3WHTB 4HRHA 3PALA 1A75A 4HREE 4XYNA 2KAYA 3BQ3A 2LLUA 1XA5A 2JNFA 2BCBA 4GAOA 3DF0A 1J7RA 5GQQC 4QJ5B 3PLFB 1JFKA 1K90D 1CDMA 3BUOB 2AAOA 4YGAA 4AQIA 2COLB 2Y5IA 1PSRA 1ZMZA 2EHBA 5AEQA 1JFJA 2NLNA 1TIZA 2FJUB 2NXQA 1J7PA 1YURA 1WLZA 1CDLA 4N1FA 1SW8A 2L50A 4AOMA 4M2QA 1CNPA 4N1GA 4C0JA 1AK8A 1YRTB 2AMIA 3IQQA 1FBVA 3BYAA 1IJ6A 3EVUA 1ZACA 1GGWA 4HRGA 1YUSA 3FWBA 2G2BA 4MRYA 2WCFA 1CLBA 3DD4A 2LC5A 3VRNA 2O60A 2MLEC 1SNLA 1MXEA 3SJSA 4TNCA 2L5XB 2KFHA 5CSFA 2ISDA 1QIVA 1W7IB 2OTGB 1D1OA 1DJHA 1CFFA 3AKBA 1SCMC 4IL1A 1M45A 3I5HB 1DGUA 2Y1NA 1CB1A 2JTTA 2WCBA 2MRDA 1XFZO 2GGMA 2AUCA 2NZ0A 1F8HA 1LXFC 1IQ5A 1E8AA 3QRXA 5K89A 2F3ZA 1B4CA 4OV2A 1F54A 1DGVA 1IGVA 3JVTB 1ZUZA 1F4QA 4MZJA 4BY5A 1KK8C 1QXPA 3PN7C 4R1EA 1EL4A 2JRFA 3CR5X 1Y6WA 4NDBA 2WNDA 2KFFA 2M97A 3PFVA 1SR6C 2PMYA 2GGZA 1UWOA 1L7ZA 3SG2A 4DUQA 4A4CA 1DJWA 1B9AA 2Q91A 1K96A 2BL0C 4GBAA 2K7DA 3NSLA 5HYDA 2KFGA 1TCFA 1WDCC 5TNCA 1F71A 1RROA 3DF0B 4PHNA 2LM5A 1YR5A 2CT9A 1SMGA 2DOQA 2KSPA 1K8UA 2SASA 1JUOA 3BUNB 2PASA 1BOCA 1IG5A 1W7JB 3PSRA 1TN4A 1BT6A 5B8IB 5KSZA 1IH0A 3CS1A 1SL8A 1S1EA 2LUXA 1CMGA 3CLNA 1PK0D 1Y1UA 1SCMB 2KI4C 1H4BA 3I5IB 3MSEB 1QLSA 1S5GY 1J1DA 2KQ6A 2M49B 3DVJA 5PALA 2BKIB 4C0KA 5FYXA 1OE9B 2M3WA 1LKJA 1MUXA 2LP3A 2ZNDA 2LLSA 1QVIY 1TNQA 1B8RA 1BMOA 2ZKMX 1UHKA 2JTZA 2WOSA 2CXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRL A;  3PM8 A;  2KAV A;  3KEV A;  4PE4 A;  2JXC A;  4PE0 A;  2CCM A;  1KK8 B;  1RTP 1;  2JUL A;  3PN7 B;  4BY4 A;  1QAS A;  2D8N A;  1CM4 A;  3VRO A;  3KPX A;  4PHJ A;  4NDC A;  1KK7 Y;  1N65 A;  5CSN A;  1J7O A;  1KFU L;  4L9M A;  4GFT A;  4YI8 A;  3SG7 A;  1S6C A;  4QJ4 B;  1SYM A;  3CR4 X;  3DVM A;  2ZRT A;  3VRR A;  1XFX O;  2OTG C;  1SKT A;  2BL0 B;  1XFW O;  2MLF C;  1M46 A;  1WRZ A;  1IJ5 A;  2K8M B;  1BR4 B;  3PAT A;  4ORA B;  1NX3 A;  5F6T A;  1V1F A;  1WDC B;  3I5H C;  1CMF A;  1RJV A;  2JXL A;  4DRW A;  3BOW A;  2LMV A;  1B8L A;  1JBA A;  1PUL A;  4Q04 A;  1KSM A;  1AJ4 A;  2E30 A;  3E3R A;  1IKU A;  3NSK A;  1NYA A;  1DJI A;  1G33 A;  3AKA A;  1JSA A;  1A4P A;  3BUM B;  4ORC B;  3EKJ A;  3JVT C;  2KI4 B;  1PRW A;  3O78 A;  1G4Y R;  1L2O C;  2NCO A;  2BBN A;  3EK4 A;  1WY9 A;  2M29 A;  1XK4 A;  1S3P A;  1CDP A;  4OVN F;  2A4J A;  1OMD A;  2LP2 A;  3CZT X;  1REC A;  5DKN A;  1K94 A;  4U8D A;  1DJY A;  3LK0 A;  3SIB A;  1DVI A;  4JWQ A;  5KU1 A;  2FCD A;  1BU3 A;  5D69 A;  1KCY A;  2F8P A;  1J55 A;  3WHU B;  2K7O A;  3DVK A;  2SCP A;  4PHK A;  1K2H A;  3M0W A;  2ZNE A;  1XVJ A;  3OB1 B;  5D7F A;  5AFP A;  1S5G Z;  3CWG A;  4DCK A;  3D10 A;  5DKQ A;  1EG3 A;  4I5N B;  3SIA A;  1IRJ A;  1BLQ A;  2QAC A;  1BR1 B;  1B47 A;  1U5I A;  1QVI Z;  2KGB C;  1KWO C;  4I5L B;  2KGR A;  1FW4 A;  1SCV A;  1AUI B;  2I18 A;  3I5I C;  2I94 A;  2JOJ A;  2LCP A;  2M9G A;  4CPV A;  1AJ5 A;  1GGZ A;  1RK9 A;  1K9K A;  1WLM A;  2KYC A;  3LK1 A;  2F2P A;  1UHI A;  4ZCU A;  1B8C A;  1M31 A;  2HQW A;  2K7C A;  3NSI A;  5I2L A;  2MHH A;  1J1E A;  1KK7 Z;  1ODB A;  2BEC A;  3C1V A;  5HKZ A;  1C7V A;  2JWW A;  2FCE A;  1NIW A;  1PSB A;  5KTY A;  3I5F C;  2MAZ A;  4N5X A;  1L2O B;  2EC6 C;  1UHH A;  2HF5 A;  2ZN8 A;  3F45 A;  3LLE A;  1CTR A;  1A03 A;  2JC2 A;  2BCX A;  1UHJ A;  2ZN9 A;  2BCA A;  1KFX S;  2H61 A;  1BF5 A;  3TS5 C;  2L4I A;  1DJX A;  1CLL A;  2L2E A;  4OKH A;  4D1E A;  3LL8 B;  5CSI A;  1MHO A;  2R2I A;  3BOW B;  4PCW A;  3TDI A;  4CID A;  2PRU A;  1HQV A;  2KBI A;  1TNW A;  1JF2 A;  2M0R A;  5I2O A;  1NCY A;  3O6B A;  1WRK A;  3FIA A;  5IBW A;  1QLK A;  1SRA A;  3KO0 A;  1KWO B;  2Y1M A;  3JTD C;  2LMT A;  2KYF A;  1NP8 A;  1LIN A;  2BKH B;  1LVC D;  4YI9 A;  4MVF A;  4PE7 A;  1S26 D;  2BBM A;  2JT8 A;  2L0P A;  1TNP A;  3O4Y A;  1B1G A;  4MZK A;  1OOJ A;  1K9P A;  4MRX A;  4XJK A;  4WQ2 A;  2CNP A;  1S6I A;  2H61 C;  4P2Y B;  1X02 A;  1V1G A;  1LA0 A;  1XYD A;  2KHN A;  3I5F B;  2I7A A;  3KHE A;  1F70 A;  3SG6 A;  3D0Y B;  3WNX B;  5BPJ A;  2EC6 B;  2WC8 A;  3A4U B;  4CFQ A;  3SG4 A;  4PHM A;  2EGD A;  3WXA A;  3EVR A;  3KF9 A;  2FOT A;  1OMV A;  2GV5 A;  2PAL A;  1IWQ A;  2KI6 C;  2OS8 B;  3BXK A;  2B1U A;  3OP0 A;  1CFD A;  2HET A;  2K2A A;  1MF8 B;  4E68 A;  2KDH A;  2KBM A;  1AVS A;  4CLN A;  1U5I B;  1VRK A;  2MJW B;  1M39 A;  1C7W A;  1R6P A;  3EK7 A;  3TS5 B;  4DS7 A;  2LAN A;  2M7N A;  1DMO A;  2LMU A;  1DF0 A;  1PVA A;  2Y4Q A;  1F55 A;  1OMR A;  3ZWH A;  1FF1 A;  1SPY A;  2LHI A;  4MSP A;  2LUC A;  2JT3 A;  4YRU A;  1CFC A;  2IS9 A;  3EKH A;  1ALW A;  2VRG A;  3RM1 A;  3JTD B;  4ORB B;  1PVB A;  4PE1 A;  1YVL A;  4M2P A;  3H4S E;  4YGE B;  1FI5 A;  4GGN A;  1QV0 A;  2JNX A;  3GOF A;  3I5G B;  2LVJ A;  2WCE A;  2V53 A;  5I8N A;  2TN4 A;  2K0J A;  4I5J A;  3RLZ A;  1M63 B;  2PSR A;  4UPG A;  1AP4 A;  3HX4 A;  1XFU O;  1SL7 A;  1AHR A;  1N0Y A;  1LA3 A;  1XO5 A;  5CSJ A;  3D0Y A;  1EJ3 A;  3LCP C;  1TRF A;  4USL A;  1SL9 A;  2LNK A;  1SBJ A;  3A8R A;  3K21 A;  1QJT A;  1MR8 A;  4YGB B;  4QJ3 B;  1CFP A;  2CTN A;  1ZOT B;  2I2R E;  4MZL A;  4DIR A;  2HPS A;  2M1K B;  1Y0V H;  3AAJ A;  1NX0 A;  1QTX A;  2MBX A;  2LVK A;  4WQ3 A;  1MQ1 A;  1YRU B;  1TTX A;  1UUS A;  1OSA A;  1QIW A;  1YX7 A;  5AXI A;  5JOL A;  3SG3 A;  1SK6 D;  3VRQ A;  4AQJ A;  1QX7 A;  2G9B A;  2K2F A;  3FS7 A;  1IQ3 A;  1JC2 A;  1K9U A;  1KQM B;  1CLM A;  1Q80 A;  1XK4 C;  2ZFD A;  3SG5 A;  2WOR A;  4GGF A;  4NQG A;  1QV1 A;  1JWD A;  2Q4U A;  2ZRS A;  3TDZ A;  4XJK B;  2K61 A;  3OB2 B;  1B7T Y;  4F0Z B;  2H2K A;  2P6B B;  2JZI A;  1TCO B;  1FPW A;  1XFY O;  2E6W A;  2L4H A;  1OZS A;  1PAL A;  3HCM A;  4PAL A;  3ZNI A;  1A2X A;  1S6J A;  2BE6 A;  1YTZ C;  2LVI A;  2O5G A;  3OHM B;  5JJG A;  1CDN A;  1NUB A;  4OR9 B;  1BOD A;  1CKK A;  4ICB A;  1RFJ A;  2L98 A;  2QPT A;  5AER A;  1YX8 A;  2JU0 A;  1OZO A;  4A4B A;  5J3X A;  2OS8 C;  3CTN A;  2JQ6 A;  3EK8 A;  1JF0 A;  1NCX A;  1TNX A;  1HT9 A;  4I5K A;  2HQ8 A;  2OPO A;  1A29 A;  2KOT A;  5CPV A;  4ETO A;  1NSH A;  1S36 A;  1UP5 A;  4FTG A;  4GNK B;  4JPZ B;  5HLV A;  4NDD A;  1DF0 B;  4GUK A;  4MLW A;  3TUY C;  4MN0 A;  2KI6 D;  4HSZ A;  4GGF C;  1QAT A;  2KAX A;  1EH2 A;  1QS7 A;  1NCZ A;  1YUT A;  4FQO A;  4PDZ A;  3TZ1 A;  4P5O E;  3DVE A;  1G8I A;  5G08 A;  2KQY A;  1KFX L;  3FWC A;  1DTL A;  2MA2 A;  3VGO A;  4M2O A;  1BJF A;  3VRP A;  2JPT A;  2L51 A;  3O2P A;  3TDU A;  1XFV O;  1YVH A;  1TOP A;  1N2D A;  1A75 B;  1UHN A;  1R2U A;  1C07 A;  3I5G C;  3EVV A;  1J7Q A;  1GQM A;  4YBH B;  5HKY A;  3CGA A;  1ALV A;  4JQ0 D;  1UUR A;  1EXR A;  4MBE A;  1H8B A;  2KNE A;  2JT0 A;  4OCI A;  2M1U A;  1Y1X A;  1F4O A;  2LLT A;  1BG1 A;  3OX5 A;  2NCP A;  3AAK A;  5DKR A;  1SY9 A;  3NXA A;  2PVB A;  1RWY A;  3ICB A;  5ER5 A;  2K7B A;  1CM1 A;  4CFR A;  3GK1 A;  3OX6 A;  4ZCV A;  2M7L A;  1ZFS A;  3CR2 A;  3GK4 X;  2F2O A;  4C0L A;  1OQP A;  5HKW A;  1DJG A;  1KFU S;  4YGD B;  1Y1A A;  1KSO A;  1DT7 B;  2LV7 A;  1KQV A;  1K93 D;  1K95 A;  4WRI A;  1NX2 A;  2RGI A;  3IQO A;  1B7T Z;  1FI6 A;  1DJZ A;  1NX1 A;  3TUY B;  2CBL A;  2LHL A;  2LE9 B;  1KQM C;  4MEW A;  2F3Y A;  1GJY A;  3BUX B;  5ER4 X;  1MXL C;  4GPL B;  1QX5 B;  5AAN A;  5I2Q A;  1EG4 A;  4YGC B;  2LVV A;  1MWN A;  1SR6 B;  1QX2 A;  2BE4 A;  2F33 A;  3IF7 A;  2LAP A;  1YUU A;  1NWD A;  3GK2 A;  3BUW B;  2M8U A;  1NPQ A;  5HLO A;  3NSO A;  3WHT B;  4HRH A;  3PAL A;  1A75 A;  4HRE E;  4XYN A;  2KAY A;  3BQ3 A;  2LLU A;  1XA5 A;  2JNF A;  2BCB A;  4GAO A;  3DF0 A;  1J7R A;  5GQQ C;  4QJ5 B;  3PLF B;  1JFK A;  1K90 D;  1CDM A;  3BUO B;  2AAO A;  4YGA A;  4AQI A;  2COL B;  2Y5I A;  1PSR A;  1ZMZ A;  2EHB A;  5AEQ A;  1JFJ A;  2NLN A;  1TIZ A;  2FJU B;  2NXQ A;  1J7P A;  1YUR A;  1WLZ A;  1CDL A;  4N1F A;  1SW8 A;  2L50 A;  4AOM A;  4M2Q A;  1CNP A;  4N1G A;  4C0J A;  1AK8 A;  1YRT B;  2AMI A;  3IQQ A;  1FBV A;  3BYA A;  1IJ6 A;  3EVU A;  1ZAC A;  1GGW A;  4HRG A;  1YUS A;  3FWB A;  2G2B A;  4MRY A;  2WCF A;  1CLB A;  3DD4 A;  2LC5 A;  3VRN A;  2O60 A;  2MLE C;  1SNL A;  1MXE A;  3SJS A;  4TNC A;  2L5X B;  2KFH A;  5CSF A;  2ISD A;  1QIV A;  1W7I B;  2OTG B;  1D1O A;  1DJH A;  1CFF A;  3AKB A;  1SCM C;  4IL1 A;  1M45 A;  3I5H B;  1DGU A;  2Y1N A;  1CB1 A;  2JTT A;  2WCB A;  2MRD A;  1XFZ O;  2GGM A;  2AUC A;  2NZ0 A;  1F8H A;  1LXF C;  1IQ5 A;  1E8A A;  3QRX A;  5K89 A;  2F3Z A;  1B4C A;  4OV2 A;  1F54 A;  1DGV A;  1IGV A;  3JVT B;  1ZUZ A;  1F4Q A;  4MZJ A;  4BY5 A;  1KK8 C;  1QXP A;  3PN7 C;  4R1E A;  1EL4 A;  2JRF A;  3CR5 X;  1Y6W A;  4NDB A;  2WND A;  2KFF A;  2M97 A;  3PFV A;  1SR6 C;  2PMY A;  2GGZ A;  1UWO A;  1L7Z A;  3SG2 A;  4DUQ A;  4A4C A;  1DJW A;  1B9A A;  2Q91 A;  1K96 A;  2BL0 C;  4GBA A;  2K7D A;  3NSL A;  5HYD A;  2KFG A;  1TCF A;  1WDC C;  5TNC A;  1F71 A;  1RRO A;  3DF0 B;  4PHN A;  2LM5 A;  1YR5 A;  2CT9 A;  1SMG A;  2DOQ A;  2KSP A;  1K8U A;  2SAS A;  1JUO A;  3BUN B;  2PAS A;  1BOC A;  1IG5 A;  1W7J B;  3PSR A;  1TN4 A;  1BT6 A;  5B8I B;  5KSZ A;  1IH0 A;  3CS1 A;  1SL8 A;  1S1E A;  2LUX A;  1CMG A;  3CLN A;  1PK0 D;  1Y1U A;  1SCM B;  2KI4 C;  1H4B A;  3I5I B;  3MSE B;  1QLS A;  1S5G Y;  1J1D A;  2KQ6 A;  2M49 B;  3DVJ A;  5PAL A;  2BKI B;  4C0K A;  5FYX A;  1OE9 B;  2M3W A;  1LKJ A;  1MUX A;  2LP3 A;  2ZND A;  2LLS A;  1QVI Y;  1TNQ A;  1B8R A;  1BMO A;  2ZKM X;  1UHK A;  2JTZ A;  2WOS A;  2CXJ A; 
#chains in the Genus database with same CATH topology
 1WRL A;  3PM8 A;  2KAV A;  3KEV A;  4PE4 A;  2JXC A;  4PE0 A;  2CCM A;  1KK8 B;  1RTP 1;  2JUL A;  3PN7 B;  4F7F A;  4BY4 A;  1OOH A;  1QAS A;  2D8N A;  1CM4 A;  3VRO A;  3V2L A;  3KPX A;  4PHJ A;  4NDC A;  1ORG A;  1KK7 Y;  1N65 A;  5CSN A;  1J7O A;  3CZ2 A;  1KFU L;  4L9M A;  4GFT A;  4YI8 A;  3SG7 A;  1S6C A;  4QJ4 B;  1SYM A;  3CR4 X;  3DVM A;  2ZRT A;  3VRR A;  1XFX O;  2OTG C;  1SKT A;  1TUZ A;  1XFW O;  2BL0 B;  1M46 A;  1WRZ A;  1IJ5 A;  2K8M B;  1BR4 B;  2MLF C;  3PAT A;  4ORA B;  2QEH A;  1NX3 A;  5F6T A;  1V1F A;  1WDC B;  3I5H C;  5FI6 A;  1CMF A;  1RJV A;  2JXL A;  4DRW A;  3BOW A;  2LMV A;  1B8L A;  1JBA A;  1PUL A;  3B7A A;  4Q04 A;  1KSM A;  1AJ4 A;  2E30 A;  1Z2C B;  3E3R A;  1IKU A;  3NSK A;  1NYA A;  1DJI A;  1G33 A;  3AKA A;  1JSA A;  1A4P A;  3BUM B;  4ORC B;  3EKJ A;  3JVT C;  3S0G A;  2KI4 B;  1OW4 A;  1PRW A;  3O78 A;  1G4Y R;  1L2O C;  2NCO A;  2BBN A;  3EK4 A;  1WY9 A;  2M29 A;  1XK4 A;  1C3Z A;  1S3P A;  5D3O A;  1CDP A;  4OVN F;  2A4J A;  1OMD A;  2LP2 A;  3SS4 A;  3CZT X;  1REC A;  5DKN A;  1K94 A;  2WCM A;  4U8D A;  1DJY A;  3LK0 A;  3SIB A;  1DVI A;  4JWQ A;  5KU1 A;  2FCD A;  1BU3 A;  5D69 A;  1KCY A;  2F8P A;  1J55 A;  3WHU B;  2K7O A;  3DVK A;  2SCP A;  4PHK A;  3SS5 A;  1K2H A;  3M0W A;  2ZNE A;  1XVJ A;  3OB1 B;  3DXL A;  5D7F A;  5AFP A;  1S5G Z;  3CWG A;  4DCK A;  3D10 A;  5DKQ A;  1EG3 A;  3BFA A;  4I5N B;  3SIA A;  1IRJ A;  1BLQ A;  2QAC A;  1BR1 B;  1B47 A;  1U5I A;  1QVI Z;  2KGB C;  1KWO C;  4I5L B;  2KGR A;  1FW4 A;  1SCV A;  1AUI B;  2I18 A;  3I5I C;  3QME A;  4PT1 A;  2I94 A;  2JOJ A;  2LCP A;  2M9G A;  3O4X A;  4CPV A;  1AJ5 A;  1GGZ A;  1RK9 A;  1K9K A;  1WLM A;  2KYC A;  3LK1 A;  2F2P A;  1UHI A;  4ZCU A;  1B8C A;  1M31 A;  2HQW A;  2K7C A;  3NSI A;  5I2L A;  2MHH A;  1J1E A;  1KK7 Z;  1ODB A;  2BEC A;  2L5Y A;  2WC5 A;  3C1V A;  2JWW A;  5HKZ A;  2FCE A;  1NIW A;  1DC1 A;  1PSB A;  5KTY A;  3I5F C;  1C7V A;  2MAZ A;  4N5X A;  1L2O B;  2EC6 C;  1UHH A;  2HF5 A;  4INX A;  2ZN8 A;  3F45 A;  3LLE A;  1CTR A;  1P28 A;  2WCL A;  1A03 A;  2JC2 A;  3S0F A;  2BCX A;  1UHJ A;  2ZN9 A;  3D74 A;  3CZ0 A;  2BCA A;  1KFX S;  2H61 A;  5HL1 A;  1BF5 A;  3TS5 C;  2L4I A;  1DJX A;  1CLL A;  2L2E A;  4OKH A;  4D1E A;  3LL8 B;  5CSI A;  1MHO A;  2R2I A;  3BOW B;  4PCW A;  3R1V A;  3IVT A;  3TDI A;  2QDI A;  4CID A;  2PRU A;  1HQV A;  2KBI A;  1TNW A;  1JF2 A;  2M0R A;  5I2O A;  1NCY A;  3O6B A;  1WRK A;  3FIA A;  5IBW A;  1QLK A;  1SRA A;  3KO0 A;  1KWO B;  2Y1M A;  3JTD C;  2LMT A;  2KYF A;  1NP8 A;  1LIN A;  2BKH B;  1LVC D;  4JKT A;  4YI9 A;  4MVF A;  2QEB A;  1S26 D;  2BBM A;  2JT8 A;  2L0P A;  3R1P A;  4PE7 A;  1TNP A;  3FE9 A;  3O4Y A;  1B1G A;  4MZK A;  1OOJ A;  1K9P A;  4MRX A;  4XJK A;  3RZS A;  4WQ2 A;  2CNP A;  1S6I A;  2H61 C;  4P2Y B;  1OOI X;  3DZT A;  2PQL A;  3D73 A;  1X02 A;  1V1G A;  1LA0 A;  1XYD A;  2KHN A;  3I5F B;  2I7A A;  3KHE A;  1F70 A;  3SG6 A;  3D0Y B;  3WNX B;  5BPJ A;  2EC6 B;  2WC8 A;  3A4U B;  3D77 A;  4JD9 A;  4CFQ A;  3SG4 A;  4PHM A;  2EGD A;  3WXA A;  1QWV A;  3EVR A;  3KF9 A;  2FOT A;  5EL2 A;  1OMV A;  2GV5 A;  2PAL A;  1IWQ A;  3D76 A;  2KI6 C;  3R1O A;  2OS8 B;  3BXK A;  2B1U A;  3OP0 A;  1CFD A;  2HET A;  2K2A A;  1MF8 B;  3NGV A;  4E68 A;  2KDH A;  2KBM A;  1AVS A;  4CLN A;  1U5I B;  1VRK A;  2MJW B;  1M39 A;  1C7W A;  3S0B A;  1R6P A;  3EK7 A;  3L4A A;  3TS5 B;  4DS7 A;  2LAN A;  2M7N A;  1DMO A;  2LMU A;  1DF0 A;  3D75 A;  1PVA A;  2Y4Q A;  1F55 A;  3BFB A;  1OMR A;  3ZWH A;  1FF1 A;  1SPY A;  2LHI A;  4MSP A;  2LUC A;  2JPO A;  2JT3 A;  4YRU A;  1CFC A;  2IS9 A;  3EKH A;  1ALW A;  2VRG A;  3RM1 A;  3JTD B;  4ORB B;  1PVB A;  1TUJ A;  1YVL A;  4M2P A;  3H4S E;  4PE1 A;  4YGE B;  1C3Y A;  1FI5 A;  4GGN A;  1QV0 A;  2JNX A;  3GOF A;  3I5G B;  2LVJ A;  2WCE A;  2V53 A;  5I8N A;  2TN4 A;  2K0J A;  4I5J A;  3RLZ A;  1M63 B;  2PSR A;  4UPG A;  1AP4 A;  3HX4 A;  1XFU O;  1SL7 A;  1AHR A;  1N0Y A;  1LA3 A;  1XO5 A;  5CSJ A;  3D0Y A;  1EJ3 A;  3LCP C;  1TRF A;  4USL A;  1SL9 A;  2LNK A;  1SBJ A;  3A8R A;  1IIO A;  3K21 A;  3OBV A;  1QJT A;  1MR8 A;  4YGB B;  4QJ3 B;  1CFP A;  2CTN A;  1ZOT B;  2I2R E;  4MZL A;  4DIR A;  2HPS A;  2M1K B;  1Y0V H;  3AAJ A;  1NX0 A;  1QTX A;  3PM2 A;  2MBX A;  3UNW A;  3BFH A;  3VB1 A;  2LVK A;  4WQ3 A;  1MQ1 A;  1YRU B;  1TTX A;  1UUS A;  1OSA A;  1QIW A;  1YX7 A;  5AXI A;  5JOL A;  3SG3 A;  1SK6 D;  3VRQ A;  4AQJ A;  1QX7 A;  2G9B A;  2K2F A;  3FS7 A;  1IQ3 A;  1JC2 A;  1K9U A;  1KQM B;  1CLM A;  1Q80 A;  1XK4 C;  2ZFD A;  3PJI A;  2WOR A;  4GGF A;  4NQG A;  1QV1 A;  3SG5 A;  2Q4U A;  2ZRS A;  3TDZ A;  4XJK B;  2K61 A;  3OB2 B;  1B7T Y;  4F0Z B;  3L4L A;  2H2K A;  2P6B B;  2JZI A;  1TCO B;  1FPW A;  1XFY O;  2E6W A;  2L4H A;  1OZS A;  1PAL A;  2QEV A;  3HCM A;  4PAL A;  3ZNI A;  1A2X A;  1S6J A;  2BE6 A;  1YTZ C;  2LVI A;  2O5G A;  3OHM B;  5JJG A;  3TUY C;  1CDN A;  1NUB A;  4OR9 B;  3FE6 A;  1BOD A;  4INW A;  1OOG A;  1CKK A;  4ICB A;  1RFJ A;  2L98 A;  2QPT A;  5AER A;  1YX8 A;  2JU0 A;  1OZO A;  4A4B A;  5J3X A;  2OS8 C;  3CTN A;  2JQ6 A;  3EK8 A;  1JF0 A;  1NCX A;  1TNX A;  1HT9 A;  4I5K A;  2HQ8 A;  2OPO A;  1A29 A;  2KOT A;  3SS3 A;  5CPV A;  4ETO A;  1NSH A;  1S36 A;  1UP5 A;  4FTG A;  4GNK B;  4JPZ B;  5HLV A;  4NDD A;  1DF0 B;  4GUK A;  4MLW A;  5DIC A;  2FJY A;  5FI2 A;  4MN0 A;  2KI6 D;  4HSZ A;  4GGF C;  1QAT A;  4FQT A;  2KAX A;  1EH2 A;  1QS7 A;  1NCZ A;  1YUT A;  4FQO A;  4PDZ A;  3TZ1 A;  4P5O E;  3DVE A;  1G8I A;  2QEO A;  2KQY A;  5G08 A;  1KFX L;  3FWC A;  1DTL A;  2MA2 A;  3VGO A;  4M2O A;  3Q8I A;  1BJF A;  3VRP A;  2JPT A;  2L51 A;  3O2P A;  3TDU A;  1XFV O;  1YVH A;  1TOP A;  1N2D A;  1A75 B;  1UHN A;  1R2U A;  1C07 A;  3I5G C;  3EVV A;  1J7Q A;  1GQM A;  4YBH B;  5HKY A;  3CGA A;  1ALV A;  4JQ0 D;  1UUR A;  1EXR A;  4MBE A;  1H8B A;  3FE8 A;  2KNE A;  2JT0 A;  4OCI A;  2M1U A;  1Y1X A;  1F4O A;  2LLT A;  3B6X A;  1BG1 A;  3OX5 A;  1XFR A;  2NCP A;  3AAK A;  5DKR A;  1SY9 A;  3NXA A;  2PVB A;  1RWY A;  3D78 A;  3ICB A;  5ER5 A;  2WCH A;  2K7B A;  1CM1 A;  4CFR A;  3GK1 A;  3OX6 A;  4ZCV A;  2M7L A;  1ZFS A;  3CR2 A;  3GK4 X;  2F2O A;  3NHT A;  4C0L A;  1OQP A;  5HKW A;  1DJG A;  1KFU S;  4YGD B;  1Y1A A;  1KSO A;  1DT7 B;  2LV7 A;  1KQV A;  1K93 D;  1K95 A;  4WRI A;  1NX2 A;  2RGI A;  1OOF A;  3IQO A;  1B7T Z;  1FI6 A;  1DJZ A;  4IJ7 A;  1NX1 A;  3TUY B;  2CBL A;  2LHL A;  2LE9 B;  1KQM C;  4MEW A;  2F3Y A;  1W9Z A;  2K60 A;  1GJY A;  3BUX B;  5ER4 X;  1MXL C;  4GPL B;  1QX5 B;  2KLE A;  5AAN A;  5I2Q A;  1EG4 A;  4YGC B;  2LVV A;  1MWN A;  1SR6 B;  1QX2 A;  2BE4 A;  2F33 A;  3IF7 A;  2LAP A;  1YUU A;  1NWD A;  3GK2 A;  3BUW B;  2BAP A;  2M8U A;  1NPQ A;  5HLO A;  1GM0 A;  3OGN A;  3NSO A;  3WHT B;  4HRH A;  3PAL A;  1A75 A;  4HRE E;  4XYN A;  2KAY A;  3BQ3 A;  2LLU A;  1XA5 A;  2JNF A;  2BCB A;  4GAO A;  3DF0 A;  1J7R A;  5GQQ C;  4QJ5 B;  1JWD A;  1SSE B;  3PLF B;  1JFK A;  2KLD A;  1K90 D;  1CDM A;  2WCK A;  3BUO B;  2AAO A;  4YGA A;  4AQI A;  2GTE A;  2COL B;  2Y5I A;  1PSR A;  3EG5 B;  2P70 A;  3N7H A;  2WC6 A;  3R72 A;  1ZMZ A;  2EHB A;  5AEQ A;  1JFJ A;  2NLN A;  1TIZ A;  2FJU B;  2NXQ A;  1DEL A;  2H8V A;  1YUR A;  1WLZ A;  1J7P A;  1CDL A;  4N1F A;  1SW8 A;  2L50 A;  4AOM A;  2P71 A;  2PYQ A;  4M2Q A;  3CAB A;  1CNP A;  4N1G A;  4C0J A;  1AK8 A;  1YRT B;  2AMI A;  3S0D A;  3IQQ A;  1FBV A;  3BYA A;  1IJ6 A;  3EVU A;  1ZAC A;  1GGW A;  4HRG A;  1YUS A;  3FWB A;  2G2B A;  4MRY A;  2WCF A;  1CLB A;  2WCJ A;  3DD4 A;  2LC5 A;  3VRN A;  2O60 A;  2MLE C;  1SNL A;  1MXE A;  2L2C A;  3CDN A;  3SJS A;  4TNC A;  2L5X B;  2KFH A;  5CSF A;  3L47 A;  1QIV A;  2ISD A;  1W7I B;  2OTG B;  1D1O A;  1DJH A;  1CFF A;  3AKB A;  3B88 A;  1SCM C;  4IL1 A;  1M45 A;  3I5H B;  1DGU A;  2Y1N A;  1CB1 A;  2JTT A;  2WCB A;  2MRD A;  1DQE A;  1T14 A;  1XFZ O;  2GGM A;  2AUC A;  2NZ0 A;  1F8H A;  1LXF C;  1IQ5 A;  1E8A A;  3DY9 A;  3QRX A;  5K89 A;  2F3Z A;  1B4C A;  4OV2 A;  1F54 A;  1DGV A;  1IGV A;  3JVT B;  5I94 A;  3S0A A;  3B87 A;  1TWO A;  1ZUZ A;  1F4Q A;  3UO9 A;  2BNX A;  4MZJ A;  5FI7 A;  4BY5 A;  4KYN A;  1KK8 C;  1QXP A;  3PN7 C;  1LS8 A;  4R1E A;  1EL4 A;  1Z4H A;  2JRF A;  3CR5 X;  1Y6W A;  4NDB A;  2WND A;  2KFF A;  2M97 A;  3PFV A;  1SR6 C;  2PMY A;  2GGZ A;  1UWO A;  2KPH A;  1L7Z A;  3SG2 A;  4DUQ A;  4A4C A;  1DEK A;  1DJW A;  1B9A A;  4OZD A;  2Q91 A;  1K96 A;  2BL0 C;  3NHI A;  4GBA A;  2K7D A;  3NSL A;  5HYD A;  2KFG A;  3BJH A;  1TCF A;  1WDC C;  5TNC A;  1F71 A;  1RRO A;  3DF0 B;  4PHN A;  2LM5 A;  1YR5 A;  1SMG A;  2CT9 A;  2DOQ A;  2KSP A;  1K8U A;  2SAS A;  3CYZ A;  1JUO A;  3BUN B;  2PAS A;  1BOC A;  1IG5 A;  1W7J B;  3PSR A;  1TN4 A;  1BT6 A;  2ERB A;  5B8I B;  5KSZ A;  1IH0 A;  3CS1 A;  1SL8 A;  1S1E A;  2LUX A;  1CMG A;  3CLN A;  1PK0 D;  1Y1U A;  1SCM B;  2KI4 C;  3DYE A;  1H4B A;  3I5I B;  3CZ1 A;  1QLS A;  1S5G Y;  1J1D A;  2KQ6 A;  2M49 B;  2YGU A;  3DVJ A;  2BKI B;  3MSE B;  5PAL A;  3S0E A;  4C0K A;  5FYX A;  1OE9 B;  2M3W A;  1LKJ A;  1MUX A;  2LP3 A;  2ZND A;  2LLS A;  3K1E A;  1QVI Y;  3B86 A;  1TNQ A;  1B8R A;  1BMO A;  2ZKM X;  1UHK A;  2JTZ A;  2WOS A;  2CXJ A; 
#chains in the Genus database with same CATH homology
 1WRL A;  3PM8 A;  2KAV A;  3KEV A;  4PE4 A;  2JXC A;  4PE0 A;  2CCM A;  1KK8 B;  1RTP 1;  2JUL A;  3PN7 B;  4BY4 A;  1QAS A;  2D8N A;  1CM4 A;  3VRO A;  3KPX A;  4PHJ A;  4NDC A;  1KK7 Y;  1N65 A;  5CSN A;  1J7O A;  1KFU L;  4L9M A;  4GFT A;  4YI8 A;  3SG7 A;  1S6C A;  4QJ4 B;  1SYM A;  3CR4 X;  3DVM A;  2ZRT A;  3VRR A;  1XFX O;  2OTG C;  1SKT A;  2BL0 B;  1XFW O;  2MLF C;  1M46 A;  1WRZ A;  1IJ5 A;  2K8M B;  1BR4 B;  3PAT A;  4ORA B;  1NX3 A;  5F6T A;  1V1F A;  1WDC B;  3I5H C;  1CMF A;  1RJV A;  2JXL A;  4DRW A;  3BOW A;  2LMV A;  1B8L A;  1JBA A;  1PUL A;  4Q04 A;  1KSM A;  1AJ4 A;  2E30 A;  3E3R A;  1IKU A;  3NSK A;  1NYA A;  1DJI A;  1G33 A;  3AKA A;  1JSA A;  1A4P A;  3BUM B;  4ORC B;  3EKJ A;  3JVT C;  2KI4 B;  1PRW A;  3O78 A;  1G4Y R;  1L2O C;  2NCO A;  2BBN A;  3EK4 A;  1WY9 A;  2M29 A;  1XK4 A;  1S3P A;  1CDP A;  4OVN F;  2A4J A;  1OMD A;  2LP2 A;  3CZT X;  1REC A;  5DKN A;  1K94 A;  4U8D A;  1DJY A;  3LK0 A;  3SIB A;  1DVI A;  4JWQ A;  5KU1 A;  2FCD A;  1BU3 A;  5D69 A;  1KCY A;  2F8P A;  1J55 A;  3WHU B;  2K7O A;  3DVK A;  2SCP A;  4PHK A;  1K2H A;  3M0W A;  2ZNE A;  1XVJ A;  3OB1 B;  5D7F A;  5AFP A;  1S5G Z;  3CWG A;  4DCK A;  3D10 A;  5DKQ A;  1EG3 A;  4I5N B;  3SIA A;  1IRJ A;  1BLQ A;  2QAC A;  1BR1 B;  1B47 A;  1U5I A;  1QVI Z;  2KGB C;  1KWO C;  4I5L B;  2KGR A;  1FW4 A;  1SCV A;  1AUI B;  2I18 A;  3I5I C;  2I94 A;  2JOJ A;  2LCP A;  2M9G A;  4CPV A;  1AJ5 A;  1GGZ A;  1RK9 A;  1K9K A;  1WLM A;  2KYC A;  3LK1 A;  2F2P A;  1UHI A;  4ZCU A;  1B8C A;  1M31 A;  2HQW A;  2K7C A;  3NSI A;  5I2L A;  2MHH A;  1J1E A;  1KK7 Z;  1ODB A;  2BEC A;  3C1V A;  5HKZ A;  1C7V A;  2JWW A;  2FCE A;  1NIW A;  1PSB A;  5KTY A;  3I5F C;  2MAZ A;  4N5X A;  1L2O B;  2EC6 C;  1UHH A;  2HF5 A;  2ZN8 A;  3F45 A;  3LLE A;  1CTR A;  1A03 A;  2JC2 A;  2BCX A;  1UHJ A;  2ZN9 A;  2BCA A;  1KFX S;  2H61 A;  1BF5 A;  3TS5 C;  2L4I A;  1DJX A;  1CLL A;  2L2E A;  4OKH A;  4D1E A;  3LL8 B;  5CSI A;  1MHO A;  2R2I A;  3BOW B;  4PCW A;  3TDI A;  4CID A;  2PRU A;  1HQV A;  2KBI A;  1TNW A;  1JF2 A;  2M0R A;  5I2O A;  1NCY A;  3O6B A;  1WRK A;  3FIA A;  5IBW A;  1QLK A;  1SRA A;  3KO0 A;  1KWO B;  2Y1M A;  3JTD C;  2LMT A;  2KYF A;  1NP8 A;  1LIN A;  2BKH B;  1LVC D;  4YI9 A;  4MVF A;  4PE7 A;  1S26 D;  2BBM A;  2JT8 A;  2L0P A;  1TNP A;  3O4Y A;  1B1G A;  4MZK A;  1OOJ A;  1K9P A;  4MRX A;  4XJK A;  4WQ2 A;  2CNP A;  1S6I A;  2H61 C;  4P2Y B;  1X02 A;  1V1G A;  1LA0 A;  1XYD A;  2KHN A;  3I5F B;  2I7A A;  3KHE A;  1F70 A;  3SG6 A;  3D0Y B;  3WNX B;  5BPJ A;  2EC6 B;  2WC8 A;  3A4U B;  4CFQ A;  3SG4 A;  4PHM A;  2EGD A;  3WXA A;  3EVR A;  3KF9 A;  2FOT A;  1OMV A;  2GV5 A;  2PAL A;  1IWQ A;  2KI6 C;  2OS8 B;  3BXK A;  2B1U A;  3OP0 A;  1CFD A;  2HET A;  2K2A A;  1MF8 B;  4E68 A;  2KDH A;  2KBM A;  1AVS A;  4CLN A;  1U5I B;  1VRK A;  2MJW B;  1M39 A;  1C7W A;  1R6P A;  3EK7 A;  3TS5 B;  4DS7 A;  2LAN A;  2M7N A;  1DMO A;  2LMU A;  1DF0 A;  1PVA A;  2Y4Q A;  1F55 A;  1OMR A;  3ZWH A;  1FF1 A;  1SPY A;  2LHI A;  4MSP A;  2LUC A;  2JT3 A;  4YRU A;  1CFC A;  2IS9 A;  3EKH A;  1ALW A;  2VRG A;  3RM1 A;  3JTD B;  4ORB B;  1PVB A;  4PE1 A;  1YVL A;  4M2P A;  3H4S E;  4YGE B;  1FI5 A;  4GGN A;  1QV0 A;  2JNX A;  3GOF A;  3I5G B;  2LVJ A;  2WCE A;  2V53 A;  5I8N A;  2TN4 A;  2K0J A;  4I5J A;  3RLZ A;  1M63 B;  2PSR A;  4UPG A;  1AP4 A;  3HX4 A;  1XFU O;  1SL7 A;  1AHR A;  1N0Y A;  1LA3 A;  1XO5 A;  5CSJ A;  3D0Y A;  1EJ3 A;  3LCP C;  1TRF A;  4USL A;  1SL9 A;  2LNK A;  1SBJ A;  3A8R A;  3K21 A;  1QJT A;  1MR8 A;  4YGB B;  4QJ3 B;  1CFP A;  2CTN A;  1ZOT B;  2I2R E;  4MZL A;  4DIR A;  2HPS A;  2M1K B;  1Y0V H;  3AAJ A;  1NX0 A;  1QTX A;  2MBX A;  2LVK A;  4WQ3 A;  1MQ1 A;  1YRU B;  1TTX A;  1UUS A;  1OSA A;  1QIW A;  1YX7 A;  5AXI A;  5JOL A;  3SG3 A;  1SK6 D;  3VRQ A;  4AQJ A;  1QX7 A;  2G9B A;  2K2F A;  3FS7 A;  1IQ3 A;  1JC2 A;  1K9U A;  1KQM B;  1CLM A;  1Q80 A;  1XK4 C;  2ZFD A;  3SG5 A;  2WOR A;  4GGF A;  4NQG A;  1QV1 A;  1JWD A;  2Q4U A;  2ZRS A;  3TDZ A;  4XJK B;  2K61 A;  3OB2 B;  1B7T Y;  4F0Z B;  2H2K A;  2P6B B;  2JZI A;  1TCO B;  1FPW A;  1XFY O;  2E6W A;  2L4H A;  1OZS A;  1PAL A;  3HCM A;  4PAL A;  3ZNI A;  1A2X A;  1S6J A;  2BE6 A;  1YTZ C;  2LVI A;  2O5G A;  3OHM B;  5JJG A;  1CDN A;  1NUB A;  4OR9 B;  1BOD A;  1CKK A;  4ICB A;  1RFJ A;  2L98 A;  2QPT A;  5AER A;  1YX8 A;  2JU0 A;  1OZO A;  4A4B A;  5J3X A;  2OS8 C;  3CTN A;  2JQ6 A;  3EK8 A;  1JF0 A;  1NCX A;  1TNX A;  1HT9 A;  4I5K A;  2HQ8 A;  2OPO A;  1A29 A;  2KOT A;  5CPV A;  4ETO A;  1NSH A;  1S36 A;  1UP5 A;  4FTG A;  4GNK B;  4JPZ B;  5HLV A;  4NDD A;  1DF0 B;  4GUK A;  4MLW A;  3TUY C;  4MN0 A;  2KI6 D;  4HSZ A;  4GGF C;  1QAT A;  2KAX A;  1EH2 A;  1QS7 A;  1NCZ A;  1YUT A;  4FQO A;  4PDZ A;  3TZ1 A;  4P5O E;  3DVE A;  1G8I A;  5G08 A;  2KQY A;  1KFX L;  3FWC A;  1DTL A;  2MA2 A;  3VGO A;  4M2O A;  1BJF A;  3VRP A;  2JPT A;  2L51 A;  3O2P A;  3TDU A;  1XFV O;  1YVH A;  1TOP A;  1N2D A;  1A75 B;  1UHN A;  1R2U A;  1C07 A;  3I5G C;  3EVV A;  1J7Q A;  1GQM A;  4YBH B;  5HKY A;  3CGA A;  1ALV A;  4JQ0 D;  1UUR A;  1EXR A;  4MBE A;  1H8B A;  2KNE A;  2JT0 A;  4OCI A;  2M1U A;  1Y1X A;  1F4O A;  2LLT A;  1BG1 A;  3OX5 A;  2NCP A;  3AAK A;  5DKR A;  1SY9 A;  3NXA A;  2PVB A;  1RWY A;  3ICB A;  5ER5 A;  2K7B A;  1CM1 A;  4CFR A;  3GK1 A;  3OX6 A;  4ZCV A;  2M7L A;  1ZFS A;  3CR2 A;  3GK4 X;  2F2O A;  4C0L A;  1OQP A;  5HKW A;  1DJG A;  1KFU S;  4YGD B;  1Y1A A;  1KSO A;  1DT7 B;  2LV7 A;  1KQV A;  1K93 D;  1K95 A;  4WRI A;  1NX2 A;  2RGI A;  3IQO A;  1B7T Z;  1FI6 A;  1DJZ A;  1NX1 A;  3TUY B;  2CBL A;  2LHL A;  2LE9 B;  1KQM C;  4MEW A;  2F3Y A;  1GJY A;  3BUX B;  5ER4 X;  1MXL C;  4GPL B;  1QX5 B;  5AAN A;  5I2Q A;  1EG4 A;  4YGC B;  2LVV A;  1MWN A;  1SR6 B;  1QX2 A;  2BE4 A;  2F33 A;  3IF7 A;  2LAP A;  1YUU A;  1NWD A;  3GK2 A;  3BUW B;  2M8U A;  1NPQ A;  5HLO A;  3NSO A;  3WHT B;  4HRH A;  3PAL A;  1A75 A;  4HRE E;  4XYN A;  2KAY A;  3BQ3 A;  2LLU A;  1XA5 A;  2JNF A;  2BCB A;  4GAO A;  3DF0 A;  1J7R A;  5GQQ C;  4QJ5 B;  3PLF B;  1JFK A;  1K90 D;  1CDM A;  3BUO B;  2AAO A;  4YGA A;  4AQI A;  2COL B;  2Y5I A;  1PSR A;  1ZMZ A;  2EHB A;  5AEQ A;  1JFJ A;  2NLN A;  1TIZ A;  2FJU B;  2NXQ A;  1J7P A;  1YUR A;  1WLZ A;  1CDL A;  4N1F A;  1SW8 A;  2L50 A;  4AOM A;  4M2Q A;  1CNP A;  4N1G A;  4C0J A;  1AK8 A;  1YRT B;  2AMI A;  3IQQ A;  1FBV A;  3BYA A;  1IJ6 A;  3EVU A;  1ZAC A;  1GGW A;  4HRG A;  1YUS A;  3FWB A;  2G2B A;  4MRY A;  2WCF A;  1CLB A;  3DD4 A;  2LC5 A;  3VRN A;  2O60 A;  2MLE C;  1SNL A;  1MXE A;  3SJS A;  4TNC A;  2L5X B;  2KFH A;  5CSF A;  2ISD A;  1QIV A;  1W7I B;  2OTG B;  1D1O A;  1DJH A;  1CFF A;  3AKB A;  1SCM C;  4IL1 A;  1M45 A;  3I5H B;  1DGU A;  2Y1N A;  1CB1 A;  2JTT A;  2WCB A;  2MRD A;  1XFZ O;  2GGM A;  2AUC A;  2NZ0 A;  1F8H A;  1LXF C;  1IQ5 A;  1E8A A;  3QRX A;  5K89 A;  2F3Z A;  1B4C A;  4OV2 A;  1F54 A;  1DGV A;  1IGV A;  3JVT B;  1ZUZ A;  1F4Q A;  4MZJ A;  4BY5 A;  1KK8 C;  1QXP A;  3PN7 C;  4R1E A;  1EL4 A;  2JRF A;  3CR5 X;  1Y6W A;  4NDB A;  2WND A;  2KFF A;  2M97 A;  3PFV A;  1SR6 C;  2PMY A;  2GGZ A;  1UWO A;  1L7Z A;  3SG2 A;  4DUQ A;  4A4C A;  1DJW A;  1B9A A;  2Q91 A;  1K96 A;  2BL0 C;  4GBA A;  2K7D A;  3NSL A;  5HYD A;  2KFG A;  1TCF A;  1WDC C;  5TNC A;  1F71 A;  1RRO A;  3DF0 B;  4PHN A;  2LM5 A;  1YR5 A;  2CT9 A;  1SMG A;  2DOQ A;  2KSP A;  1K8U A;  2SAS A;  1JUO A;  3BUN B;  2PAS A;  1BOC A;  1IG5 A;  1W7J B;  3PSR A;  1TN4 A;  1BT6 A;  5B8I B;  5KSZ A;  1IH0 A;  3CS1 A;  1SL8 A;  1S1E A;  2LUX A;  1CMG A;  3CLN A;  1PK0 D;  1Y1U A;  1SCM B;  2KI4 C;  1H4B A;  3I5I B;  3MSE B;  1QLS A;  1S5G Y;  1J1D A;  2KQ6 A;  2M49 B;  3DVJ A;  5PAL A;  2BKI B;  4C0K A;  5FYX A;  1OE9 B;  2M3W A;  1LKJ A;  1MUX A;  2LP3 A;  2ZND A;  2LLS A;  1QVI Y;  1TNQ A;  1B8R A;  1BMO A;  2ZKM X;  1UHK A;  2JTZ A;  2WOS A;  2CXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...