1WLMA

Solution structure of mouse cgi-38 protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
151
structure length
151
Chain Sequence
b'GSSGSSGMAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein CGI-38
publication title Solution structure of mouse CGI-38 protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 25
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2004-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wlmA01
1SBJA 1V1FA 2PMYA 1NX2A 1QX2A 2F2PA 1YUUA 3I5IC 4I5NB 1ZUZA 1QIWA 1QLKA 2M3WA 1KFXS 1M63B 1DT7B 4NDCA 2BE6A 4YGAA 4PHJA 1YURA 3PN7B 4CPVA 2JXCA 4PE1A 4C0KA 2O60A 4QJ4B 1FI6A 3OB2B 4WRIA 4C0JA 1B47A 1RROA 3BXKA 1K9UA 3IF7A 3KO0A 1UHKA 2JU0A 2LP3A 4NQGA 1QATA 2JT0A 5HKZA 2GV5A 3VRQA 1TRFA 2CT9A 3DVMA 4WQ2A 3CLNA 2EGDA 3EVVA 2I7AA 1QJTA 1QS7A 2KFHA 4P5OE 3GK4X 3JVTB 5CSNA 4MZKA 2CTNA 4OV2A 3SG6A 1BU3A 2WOSA 3SIAA 4BY4A 1LVCD 3PFVA 4MSPA 2ZNEA 1GQMA 5CSFA 1CM4A 1S5GY 1XFZO 2BBNA 3NSKA 5J3XA 2HQWA 3DF0B 2ZRSA 2HPSA 1CFFA 5CSIA 1IRJA 2F2OA 1SNLA 2MAZA 2KQYA 2KYCA 1JBAA 4MLWA 1B4CA 1BMOA 3IQOA 1A75A 4ICBA 3EK8A 1TNPA 1J7PA 1B8RA 2LMTA 3D0YA 5AXIA 3VGOA 1OMRA 3KEVA 1AP4A 2BCAA 1QIVA 2KI4C 4MN0A 2KDHA 1CM1A 3OHMB 2NZ0A 1ZFSA 2LE9B 1Y1AA 2F8PA 4HRHA 1S26D 2JT3A 3DVKA 4GBAA 3I5HC 3CS1A 1UHIA 1BR1B 2WC8A 3SG4A 2CBLA 2KGRA 3SG3A 1OZSA 1J55A 3I5IB 1B1GA 4I5LB 4ORBB 1BG1A 1OSAA 2SCPA 1ZMZA 3WXAA 3OX6A 1C7VA 1CMFA 1HQVA 2OPOA 5AFPA 1PRWA 2LVJA 2EC6C 2LMVA 4GGFC 1K94A 1NPQA 4IL1A 2AAOA 1YUSA 1DJWA 1XO5A 3FWCA 2CXJA 4M2QA 2CNPA 4GPLB 2GGZA 5BPJA 1OE9B 3CGAA 1JFKA 1M45A 2KI6D 2OTGB 3PSRA 3SG7A 1DJYA 3FS7A 4YGDB 1XK4C 1CLLA 2KQ6A 2K61A 1UHHA 3EVRA 4AQJA 5K89A 1M46A 1NWDA 2BCBA 5KU1A 3K21A 1QLSA 3A4UB 4N5XA 1F55A 4MEWA 4YI8A 1NCXA 1KFXL 2LV7A 1EG3A 1WDCB 1K9KA 1N2DA 2L51A 1S3PA 3BUOB 4L9MA 1JUOA 1V1GA 1IKUA 3SG5A 2LP2A 3TS5B 2LCPA 2H61C 2NCPA 2NXQA 1CFDA 5G08A 5D7FA 4MRYA 2COLB 2L0PA 2M0RA 2Q4UA 4FTGA 3JTDC 5D69A 2JTZA 2KAYA 2K2AA 1AJ4A 2KHNA 3CZTX 4PDZA 3C1VA 1DJXA 4DUQA 2JT8A 2LUCA 3WNXB 1CNPA 4I5KA 2LAPA 3CWGA 2MLEC 1TN4A 1B7TY 1QVIZ 2ZNDA 2QPTA 2K2FA 3I5HB 5PALA 3CTNA 1E8AA 3H4SE 2F33A 2LLTA 2WCEA 1CB1A 1DVIA 1CLBA 4WQ3A 1BF5A 2L50A 4M2PA 4XYNA 1LINA 2OS8C 3D10A 1MHOA 1S6IA 1S1EA 2LC5A 1SYMA 2K7BA 3EK4A 2KAXA 1ALVA 2NLNA 1YVLA 1SL9A 1CFPA 1UHNA 1Y0VH 1WLZA 4U8DA 1X02A 2A4JA 4MVFA 2HQ8A 1QASA 1RWYA 2M49B 4CLNA 5DKQA 1A75B 1DGUA 2FCDA 3D0YB 4NDDA 4ORAB 1C07A 3EK7A 1F4QA 2L2EA 4YI9A 4N1GA 3BUXB 1CTRA 1XFVO 2WNDA 4PE7A 1K93D 1NYAA 2RGIA 4XJKA 4CFRA 1FW4A 2P6BB 1JSAA 2K7OA 1GGZA 1SW8A 2JXLA 4OKHA 1KQMC 3BUWB 2HF5A 3ZNIA 1TOPA 3VROA 2PSRA 4DS7A 3KF9A 1K2HA 2KSPA 5TNCA 1XFUO 1M31A 1MF8B 2FCEA 1HT9A 2PALA 3AKBA 1SCMB 1SY9A 1CMGA 1Y1XA 1EH2A 1EJ3A 2EHBA 1FF1A 1YTZC 4YGEB 4M2OA 4MZJA 1KK7Y 2JNFA 2I18A 1U5IA 3I5GB 1R6PA 1ZOTB 3TUYB 5KTYA 1TNWA 4GGFA 1R2UA 4C0LA 3TDZA 4OR9B 4ETOA 4HRGA 1G4YR 1G8IA 1NCZA 1EXRA 1AUIB 2K0JA 3BQ3A 1F54A 4UPGA 2JC2A 1BT6A 2WORA 3NSLA 4OCIA 2AMIA 2OS8B 2FJUB 3GK1A 1XK4A 2F3YA 2MJWB 1L7ZA 1QV1A 2Y4QA 1WY9A 5HKYA 2KYFA 3LCPC 1K95A 2H2KA 2LHLA 1KFUS 1ALWA 1H4BA 2LHIA 2JQ6A 2WCBA 1CFCA 1WRZA 1NUBA 1QVIY 5HYDA 2LM5A 1UURA 1UWOA 1IQ3A 2ZFDA 2JPTA 2I94A 2H61A 1L2OC 3LK0A 1AVSA 1AK8A 1IJ6A 2M29A 4FQOA 1MUXA 1JC2A 1NP8A 1AHRA 4USLA 2KBMA 3VRNA 2WCFA 1LKJA 2L98A 4JPZB 2DOQA 2LLSA 1MQ1A 3KPXA 4PHMA 1TCOB 1C7WA 1YUTA 1LXFC 2K7CA 1GGWA 3OX5A 2KI6C 4A4BA 2L4HA 1RJVA 4PHKA 1S5GZ 1ODBA 1OMDA 3IQQA 1UHJA 4ZCVA 5I2OA 3WHUB 2BL0C 2SASA 1D1OA 2G9BA 2M7NA 1JFJA 4GGNA 4XJKB 5DKRA 4CFQA 1BLQA 1QX5B 4CIDA 3JVTC 3BOWA 3QRXA 2JZIA 1Q80A 2MHHA 5F6TA 4BY5A 4AQIA 1CKKA 1F8HA 4R1EA 1SRAA 2KI4B 1DTLA 1MXLC 1DF0A 2I2RE 1PALA 4GNKB 3A8RA 3ICBA 1QXPA 4N1FA 1KSOA 5IBWA 1F70A 3O4YA 1IWQA 2LANA 1XFWO 3BUNB 1RTP1 3TZ1A 1S6CA 3BYAA 1QTXA 1YRUB 2L5XB 1K96A 1PVAA 1TTXA 2M7LA 1U5IB 3CR5X 2EC6B 1W7JB 3SG2A 1KWOC 2JWWA 3TDIA 1TCFA 3EKJA 1CDPA 3AAJA 2LUXA 2O5GA 1L2OB 1MR8A 2FOTA 3RM1A 3AKAA 1NIWA 4I5JA 1OMVA 2BE4A 2CCMA 1IGVA 3WHTB 1XVJA 2D8NA 2V53A 2AUCA 1PK0D 1OOJA 1KSMA 4ZCUA 2BKIB 3PALA 1IQ5A 2M8UA 5GQQC 4GAOA 1DMOA 1CLMA 1KFUL 1J1EA 3DD4A 2B1UA 2K8MB 1BOCA 1EL4A 3LL8B 5CPVA 3F45A 1NX1A 5HLOA 3NSIA 4YGBB 3SJSA 2BL0B 1GJYA 5KSZA 2Y1NA 1KQVA 5I8NA 5I2QA 2LVVA 2L4IA 5JJGA 4MZLA 3LK1A 1NSHA 3DVEA 2ZRTA 3JTDB 2OTGC 3TDUA 1SL7A 1A2XA 5FYXA 4Q04A 1NCYA 2BCXA 2IS9A 3CR2A 1PSBA 1XA5A 1J1DA 1K90D 1N65A 1IJ5A 1PULA 2JULA 2MLFC 3ZWHA 1QV0A 1RECA 2ZN9A 3OP0A 4QJ3B 1FPWA 1WDCC 1DJHA 1YX8A 4YBHB 1B7TZ 3NSOA 3EVUA 1A4PA 1SR6C 2MBXA 4PHNA 2R2IA 2ZKMX 3NXAA 1JWDA 2NCOA 1YR5A 1BR4B 1YX7A 3TS5C 2ZN8A 2TN4A 3VRRA 1PSRA 2KOTA 3PM8A 3KHEA 4GFTA 1KWOB 1B9AA 2ISDA 3BOWB 2Q91A 3I5FC 1LA3A 1DJZA 1OQPA 2KFFA 2KGBC 5I2LA 1SK6D 2HETA 1RK9A 2KNEA 1DF0B 5AERA 2JTTA 4GUKA 1K9PA 1KK8C 1EG4A 1SKTA 4D1EA 1J7QA 1JF2A 5HLVA 1ZACA 2Y1MA 1G33A 4HREE 1DJIA 1XFXO 1IH0A 2BECA 3OB1B 4PE0A 1NX0A 5JOLA 2M1KB 1TNQA 4ORCB 2G2BA 1KQMB 2LLUA 1A03A 5ER5A 1XFYO 1LA0A 1QX7A 2JRFA 4QJ5B 1WRKA 3PATA 4YRUA 2LMUA 4E68A 1W7IB 1H8BA 1UP5A 5AANA 2M1UA 1S6JA 5B8IB 3PN7C 2E6WA 3BUMB 3DF0A 3O2PA 1N0YA 2PASA 2E30A 2BBMA 3DVJA 2M9GA 1SPYA 4DCKA 3RLZA 2K7DA 3O6BA 3PLFB 4JWQA 1UUSA 1FBVA 3LLEA 4JQ0D 4AOMA 4MBEA 1S36A 2F3ZA 4MRXA 2LVIA 4DRWA 5AEQA 1PVBA 2KBIA 1DGVA 3GK2A 1KK7Z 3SIBA 2KFGA 3M0WA 1KCYA 2QACA 4P2YB 1JF0A 2KAVA 1A29A 1K8UA 1YVHA 1AJ5A 2BKHB 3FWBA 2GGMA 4YGCB 1F4OA 4PALA 1SL8A 2LNKA 4HSZA 1RFJA 5CSJA 1NX3A 1SR6B 2Y5IA 1CDLA 1B8CA 1MXEA 1CDNA 1Y1UA 1SCMC 1J7OA 3AAKA 4DIRA 4F0ZB 2PVBA 1SCVA 1MWNA 2PRUA 1VRKA 2MRDA 2JNXA 3GOFA 1BJFA 1YRTB 3O78A 1OZOA 3MSEB 4TNCA 1M39A 1WLMA 4NDBA 3I5FB 1SMGA 4A4CA 1TNXA 3VRPA 1TIZA 3I5GC 1B8LA 3E3RA 3TUYC 1IG5A 2LVKA 4PCWA 1BODA 2VRGA 1F71A 1KK8B 1WRLA 3FIAA 2M97A 1DJGA 4PE4A 1J7RA 3CR4X 3EKHA 1FI5A 3HCMA 3HX4A 5ER4X 1XYDA 5HKWA 5DKNA 1CDMA 2JOJA 1Y6WA 2MA2A 4OVNF
chains in the Genus database with same CATH superfamily
2PQLA 1SBJA 1V1FA 2PMYA 1NX2A 1QX2A 2F2PA 1YUUA 3I5IC 4I5NB 1ZUZA 1QIWA 1QLKA 2M3WA 1KFXS 1M63B 1DT7B 4NDCA 2BE6A 3CYZA 4PHJA 4YGAA 3UO9A 1YURA 3PN7B 2K60A 2JXCA 4CPVA 2KLDA 4PE1A 2O60A 4C0KA 4QJ4B 1FI6A 3OB2B 4WRIA 4C0JA 1B47A 1RROA 3BXKA 1K9UA 3IF7A 3KO0A 1UHKA 2JU0A 2LP3A 4NQGA 1QATA 2JT0A 5HKZA 2GV5A 3VRQA 1TRFA 2CT9A 3DVMA 3DY9A 4WQ2A 3CLNA 2EGDA 3EVVA 2I7AA 1QJTA 1QS7A 2KFHA 4P5OE 3GK4X 3JVTB 5CSNA 4MZKA 2CTNA 4OV2A 3SG6A 1BU3A 1OOFA 2WOSA 3SIAA 4BY4A 1LVCD 3PFVA 4MSPA 2ZNEA 1GQMA 5CSFA 3CABA 1CM4A 1S5GY 1XFZO 2BBNA 3L47A 3NSKA 5J3XA 3D75A 2HQWA 3DF0B 3L4AA 2ZRSA 2HPSA 1C3ZA 1CFFA 5CSIA 1IRJA 2F2OA 1SNLA 2MAZA 3CZ2A 5FI7A 2KQYA 2KYCA 1JBAA 4MLWA 1B4CA 1BMOA 3IQOA 1A75A 4ICBA 3EK8A 1TNPA 1J7PA 1B8RA 2LMTA 3D0YA 5AXIA 3VGOA 5HL1A 3S0DA 1OMRA 3KEVA 5DICA 2BCAA 5FI2A 1AP4A 3RZSA 1QIVA 2KI4C 4MN0A 2KDHA 1CM1A 3OHMB 2NZ0A 1ZFSA 3S0FA 3R1VA 2LE9B 3PJIA 1Y1AA 2F8PA 3D74A 3D78A 4HRHA 1S26D 2JT3A 3DVKA 4GBAA 1SSEB 3I5HC 3CS1A 4FQTA 4OZDA 1UHIA 1BR1B 2WC8A 3SG4A 2CBLA 2GTEA 2KGRA 3SG3A 1OZSA 1J55A 3I5IB 1B1GA 4I5LB 4ORBB 1BG1A 1OSAA 1XFRA 2SCPA 1ZMZA 3WXAA 3OX6A 1C7VA 1CMFA 1HQVA 2OPOA 5AFPA 2H8VA 3B7AA 1PRWA 2LVJA 2EC6C 1OOHA 4F7FA 2LMVA 3PM2A 4GGFC 1K94A 1NPQA 4IL1A 2AAOA 1YUSA 1DJWA 1XO5A 3FWCA 2CXJA 3BFAA 4M2QA 2CNPA 4GPLB 4JD9A 2GGZA 5BPJA 1OE9B 3CGAA 1JFKA 1M45A 2KI6D 2OTGB 3PSRA 1DC1A 3SG7A 3R1OA 1DJYA 3FS7A 4YGDB 1XK4C 1CLLA 2KQ6A 2K61A 1UHHA 3EVRA 4AQJA 5K89A 1M46A 1NWDA 3R72A 2BCBA 5KU1A 3K21A 1QLSA 3A4UB 4N5XA 1F55A 2WCMA 4MEWA 4YI8A 1NCXA 1QWVA 1KFXL 2LV7A 1EG3A 1WDCB 1K9KA 1N2DA 1C3YA 2L51A 1S3PA 3BUOB 4L9MA 1JUOA 1V1GA 1IKUA 3SG5A 1Z2CB 4PT1A 2LP2A 3TS5B 2LCPA 2H61C 2NCPA 1OW4A 1CFDA 2NXQA 5G08A 5D7FA 4MRYA 2COLB 2L0PA 2M0RA 2Q4UA 4FTGA 3JTDC 5D69A 2JTZA 2KAYA 2K2AA 1AJ4A 2KHNA 3CZTX 4PDZA 3C1VA 1DJXA 4DUQA 2JT8A 5I94A 2LUCA 3WNXB 1CNPA 4I5KA 2LAPA 3CWGA 2MLEC 1TN4A 1B7TY 1QVIZ 2ZNDA 2QPTA 2K2FA 3I5HB 5PALA 3NHTA 1DQEA 3CTNA 1E8AA 3H4SE 2F33A 2LLTA 2WCEA 1CB1A 1DVIA 1CLBA 4WQ3A 1BF5A 2L50A 2QEVA 4M2PA 4XYNA 1LINA 2OS8C 3D10A 1MHOA 1S6IA 1S1EA 2LC5A 1SYMA 2K7BA 3EK4A 2KAXA 1ALVA 2NLNA 1YVLA 1SL9A 1CFPA 3BFHA 1UHNA 1Y0VH 1WLZA 4U8DA 1OOGA 1X02A 2A4JA 4MVFA 2HQ8A 1QASA 1RWYA 2M49B 4CLNA 5DKQA 1A75B 1DGUA 2FCDA 3D0YB 4KYNA 4NDDA 4ORAB 1C07A 1ORGA 3EK7A 3CZ0A 1F4QA 4INWA 2L2EA 3NHIA 1GM0A 4YI9A 4N1GA 3BUXB 1CTRA 1XFVO 2WNDA 4PE7A 1K93D 2KPHA 1NYAA 2RGIA 4XJKA 3CDNA 1DELA 3OGNA 4CFRA 1FW4A 2P6BB 3UNWA 1JSAA 2K7OA 1GGZA 1SW8A 2JXLA 3O4XA 1KQMC 3BUWB 2HF5A 4OKHA 3ZNIA 2WCHA 1TOPA 3VROA 2PSRA 4DS7A 3KF9A 1K2HA 2KSPA 5TNCA 1XFUO 1M31A 1MF8B 2FCEA 1HT9A 2PALA 2WC5A 3AKBA 1SCMB 3IVTA 1SY9A 1CMGA 1Y1XA 1EH2A 1EJ3A 3B6XA 2EHBA 1FF1A 2FJYA 1YTZC 4YGEB 4M2OA 4MZJA 1KK7Y 2JNFA 3NGVA 2I18A 1TWOA 1U5IA 3I5GB 1R6PA 1ZOTB 3TUYB 5KTYA 1TNWA 4GGFA 1R2UA 4C0LA 3TDZA 4OR9B 4ETOA 4HRGA 1G4YR 1G8IA 1NCZA 1EXRA 1AUIB 2K0JA 3BQ3A 1F54A 4UPGA 2JC2A 3B86A 1BT6A 2WORA 3NSLA 4OCIA 2AMIA 2OS8B 2FJUB 3GK1A 1LS8A 1XK4A 2F3YA 2MJWB 1L7ZA 1QV1A 2Y4QA 1WY9A 5HKYA 3EG5B 2KYFA 3LCPC 1K95A 1DEKA 2H2KA 2LHLA 2P71A 1KFUS 1ALWA 1H4BA 2LHIA 2JQ6A 2WCBA 3FE8A 3D73A 1CFCA 1WRZA 1NUBA 1QVIY 3S0BA 3B88A 5HYDA 2LM5A 1UURA 1UWOA 1IQ3A 2ZFDA 2JPTA 3V2LA 2I94A 2H61A 1Z4HA 1L2OC 3LK0A 1AVSA 1AK8A 1IJ6A 2M29A 4FQOA 5D3OA 1MUXA 3SS4A 1JC2A 1NP8A 1AHRA 4USLA 2KBMA 3VRNA 2WCFA 1LKJA 2L98A 2WCLA 4JPZB 2DOQA 2LLSA 1MQ1A 3K1EA 3KPXA 4PHMA 1TCOB 1C7WA 1YUTA 2P70A 1LXFC 2K7CA 2WC6A 1GGWA 3OX5A 2KI6C 4A4BA 2L4HA 1RJVA 4PHKA 1S5GZ 1ODBA 1OMDA 3IQQA 1UHJA 4ZCVA 5I2OA 3DXLA 2PYQA 3WHUB 2BL0C 2SASA 1D1OA 2G9BA 2M7NA 1JFJA 1T14A 4GGNA 4XJKB 5DKRA 2BNXA 4CFQA 1BLQA 4IJ7A 1QX5B 2QEHA 4CIDA 3JVTC 3BOWA 3QRXA 2JZIA 1Q80A 2MHHA 5F6TA 4BY5A 4AQIA 1CKKA 1F8HA 4R1EA 3Q8IA 1SRAA 2KI4B 1DTLA 1MXLC 1DF0A 2I2RE 1PALA 4GNKB 3A8RA 3ICBA 1QXPA 4N1FA 1KSOA 5IBWA 1F70A 3O4YA 1IWQA 2LANA 1XFWO 3D76A 3BUNB 1RTP1 3TZ1A 3B87A 1S6CA 3BYAA 1QTXA 1YRUB 2L5XB 1K96A 1PVAA 2KLEA 1TTXA 3FE6A 2M7LA 1U5IB 3CR5X 2EC6B 1W7JB 3SG2A 1KWOC 2JWWA 3L4LA 3TDIA 1TCFA 3EKJA 1CDPA 3AAJA 2LUXA 2O5GA 1L2OB 1MR8A 2FOTA 3RM1A 3AKAA 1NIWA 4I5JA 1OMVA 2BE4A 2CCMA 1IGVA 3WHTB 1XVJA 2D8NA 2V53A 1PK0D 2AUCA 1OOJA 1KSMA 2QEOA 2BKIB 4ZCUA 3PALA 1IQ5A 2M8UA 5GQQC 4GAOA 3SS3A 1DMOA 1CLMA 1KFUL 2ERBA 1J1EA 3DD4A 2B1UA 2K8MB 1BOCA 1EL4A 3LL8B 5CPVA 3D77A 2L2CA 3F45A 1NX1A 5HLOA 3NSIA 4YGBB 3SJSA 2BL0B 1GJYA 5KSZA 2Y1NA 1KQVA 5I8NA 5I2QA 2LVVA 2JPOA 2L4IA 5JJGA 4MZLA 3LK1A 1NSHA 3DVEA 2ZRTA 3JTDB 2OTGC 3TDUA 1SL7A 1TUZA 1A2XA 3OBVA 5FYXA 4Q04A 1NCYA 2BCXA 2IS9A 3CR2A 1PSBA 1XA5A 1J1DA 1K90D 1N65A 1IJ5A 1PULA 2JULA 2MLFC 3BJHA 3QMEA 4JKTA 1QV0A 3ZWHA 1RECA 2ZN9A 3OP0A 4QJ3B 1FPWA 1WDCC 1DJHA 1YX8A 4YBHB 1B7TZ 3NSOA 3EVUA 1A4PA 3VB1A 1SR6C 2MBXA 4PHNA 2R2IA 2ZKMX 3R1PA 3NXAA 1JWDA 2NCOA 1YR5A 1BR4B 1YX7A 3TS5C 3S0EA 2ZN8A 2TN4A 3VRRA 1PSRA 2KOTA 3PM8A 3KHEA 4GFTA 1KWOB 1W9ZA 1B9AA 2ISDA 3BOWB 2Q91A 3I5FC 5EL2A 5FI6A 1LA3A 1DJZA 1OQPA 2KFFA 2KGBC 1TUJA 1SK6D 5I2LA 3S0GA 2HETA 1RK9A 2KNEA 1DF0B 5AERA 2JTTA 4GUKA 1K9PA 1KK8C 1EG4A 1SKTA 3BFBA 4D1EA 1JF2A 5HLVA 1ZACA 3S0AA 2Y1MA 1J7QA 1G33A 3DZTA 4HREE 1DJIA 1XFXO 1IH0A 2BECA 3OB1B 4PE0A 2WCJA 1NX0A 5JOLA 2L5YA 2M1KB 1TNQA 4ORCB 2G2BA 1KQMB 2LLUA 1A03A 5ER5A 3DYEA 1XFYO 2QEBA 1LA0A 1QX7A 2JRFA 4QJ5B 1WRKA 3PATA 4YRUA 2LMUA 4E68A 1W7IB 1H8BA 1UP5A 5AANA 2M1UA 1S6JA 5B8IB 3PN7C 2E6WA 3BUMB 2WCKA 3DF0A 3O2PA 1N0YA 2PASA 2E30A 2BBMA 3DVJA 2M9GA 1SPYA 4DCKA 3RLZA 2K7DA 3O6BA 3PLFB 4JWQA 1UUSA 1FBVA 3LLEA 4JQ0D 4AOMA 4MBEA 1S36A 2F3ZA 4MRXA 2LVIA 4DRWA 5AEQA 1PVBA 2KBIA 1DGVA 3GK2A 1KK7Z 3SIBA 2KFGA 3M0WA 1KCYA 2QACA 4P2YB 1JF0A 2KAVA 1A29A 1K8UA 1YVHA 1AJ5A 2BKHB 3FWBA 2GGMA 4YGCB 1F4OA 4PALA 1SL8A 2LNKA 4HSZA 1RFJA 2BAPA 1NX3A 1SR6B 2Y5IA 1CDLA 5CSJA 1B8CA 1MXEA 1CDNA 1Y1UA 1SCMC 1J7OA 3AAKA 4DIRA 2QDIA 1OOIX 3FE9A 4F0ZB 2PVBA 1SCVA 4INXA 1MWNA 2PRUA 3N7HA 2YGUA 1VRKA 2MRDA 2JNXA 3GOFA 1BJFA 1YRTB 3O78A 1OZOA 3MSEB 4TNCA 1M39A 1WLMA 4NDBA 3I5FB 1SMGA 4A4CA 1TNXA 3VRPA 1TIZA 1IIOA 3I5GC 1B8LA 3E3RA 3TUYC 1IG5A 2LVKA 4PCWA 1BODA 2VRGA 1F71A 1KK8B 1WRLA 3FIAA 2M97A 1DJGA 3CZ1A 4PE4A 1J7RA 3CR4X 3EKHA 1FI5A 3HCMA 3HX4A 5ER4X 1XYDA 5HKWA 5DKNA 1CDMA 1P28A 2JOJA 1Y6WA 3SS5A 2MA2A 4OVNF
chains in the Genus database with same CATH topology
1SBJA 1V1FA 2PMYA 1NX2A 1QX2A 2F2PA 1YUUA 3I5IC 4I5NB 1ZUZA 1QIWA 1QLKA 2M3WA 1KFXS 1M63B 1DT7B 4NDCA 2BE6A 4YGAA 4PHJA 1YURA 3PN7B 4CPVA 2JXCA 4PE1A 4C0KA 2O60A 4QJ4B 1FI6A 3OB2B 4WRIA 4C0JA 1B47A 1RROA 3BXKA 1K9UA 3IF7A 3KO0A 1UHKA 2JU0A 2LP3A 4NQGA 1QATA 2JT0A 5HKZA 2GV5A 3VRQA 1TRFA 2CT9A 3DVMA 4WQ2A 3CLNA 2EGDA 3EVVA 2I7AA 1QJTA 1QS7A 2KFHA 4P5OE 3GK4X 3JVTB 5CSNA 4MZKA 2CTNA 4OV2A 3SG6A 1BU3A 2WOSA 3SIAA 4BY4A 1LVCD 3PFVA 4MSPA 2ZNEA 1GQMA 5CSFA 1CM4A 1S5GY 1XFZO 2BBNA 3NSKA 5J3XA 2HQWA 3DF0B 2ZRSA 2HPSA 1CFFA 5CSIA 1IRJA 2F2OA 1SNLA 2MAZA 2KQYA 2KYCA 1JBAA 4MLWA 1B4CA 1BMOA 3IQOA 1A75A 4ICBA 3EK8A 1TNPA 1J7PA 1B8RA 2LMTA 3D0YA 5AXIA 3VGOA 1OMRA 3KEVA 1AP4A 2BCAA 1QIVA 2KI4C 4MN0A 2KDHA 1CM1A 3OHMB 2NZ0A 1ZFSA 2LE9B 1Y1AA 2F8PA 4HRHA 1S26D 2JT3A 3DVKA 4GBAA 3I5HC 3CS1A 1UHIA 1BR1B 2WC8A 3SG4A 2CBLA 2KGRA 3SG3A 1OZSA 1J55A 3I5IB 1B1GA 4I5LB 4ORBB 1BG1A 1OSAA 2SCPA 1ZMZA 3WXAA 3OX6A 1C7VA 1CMFA 1HQVA 2OPOA 5AFPA 1PRWA 2LVJA 2EC6C 2LMVA 4GGFC 1K94A 1NPQA 4IL1A 2AAOA 1YUSA 1DJWA 1XO5A 3FWCA 2CXJA 4M2QA 2CNPA 4GPLB 2GGZA 5BPJA 1OE9B 3CGAA 1JFKA 1M45A 2KI6D 2OTGB 3PSRA 3SG7A 1DJYA 3FS7A 4YGDB 1XK4C 1CLLA 2KQ6A 2K61A 1UHHA 3EVRA 4AQJA 5K89A 1M46A 1NWDA 2BCBA 5KU1A 3K21A 1QLSA 3A4UB 4N5XA 1F55A 4MEWA 4YI8A 1NCXA 1KFXL 2LV7A 1EG3A 1WDCB 1K9KA 1N2DA 2L51A 1S3PA 3BUOB 4L9MA 1JUOA 1V1GA 1IKUA 3SG5A 2LP2A 3TS5B 2LCPA 2H61C 2NCPA 2NXQA 1CFDA 5G08A 5D7FA 4MRYA 2COLB 2L0PA 2M0RA 2Q4UA 4FTGA 3JTDC 5D69A 2JTZA 2KAYA 2K2AA 1AJ4A 2KHNA 3CZTX 4PDZA 3C1VA 1DJXA 4DUQA 2JT8A 2LUCA 3WNXB 1CNPA 4I5KA 2LAPA 3CWGA 2MLEC 1TN4A 1B7TY 1QVIZ 2ZNDA 2QPTA 2K2FA 3I5HB 5PALA 3CTNA 1E8AA 3H4SE 2F33A 2LLTA 2WCEA 1CB1A 1DVIA 1CLBA 4WQ3A 1BF5A 2L50A 4M2PA 4XYNA 1LINA 2OS8C 3D10A 1MHOA 1S6IA 1S1EA 2LC5A 1SYMA 2K7BA 3EK4A 2KAXA 1ALVA 2NLNA 1YVLA 1SL9A 1CFPA 1UHNA 1Y0VH 1WLZA 4U8DA 1X02A 2A4JA 4MVFA 2HQ8A 1QASA 1RWYA 2M49B 4CLNA 5DKQA 1A75B 1DGUA 2FCDA 3D0YB 4NDDA 4ORAB 1C07A 3EK7A 1F4QA 2L2EA 4YI9A 4N1GA 3BUXB 1CTRA 1XFVO 2WNDA 4PE7A 1K93D 1NYAA 2RGIA 4XJKA 4CFRA 1FW4A 2P6BB 1JSAA 2K7OA 1GGZA 1SW8A 2JXLA 4OKHA 1KQMC 3BUWB 2HF5A 3ZNIA 1TOPA 3VROA 2PSRA 4DS7A 3KF9A 1K2HA 2KSPA 5TNCA 1XFUO 1M31A 1MF8B 2FCEA 1HT9A 2PALA 3AKBA 1SCMB 1SY9A 1CMGA 1Y1XA 1EH2A 1EJ3A 2EHBA 1FF1A 1YTZC 4YGEB 4M2OA 4MZJA 1KK7Y 2JNFA 2I18A 1U5IA 3I5GB 1R6PA 1ZOTB 3TUYB 5KTYA 1TNWA 4GGFA 1R2UA 4C0LA 3TDZA 4OR9B 4ETOA 4HRGA 1G4YR 1G8IA 1NCZA 1EXRA 1AUIB 2K0JA 3BQ3A 1F54A 4UPGA 2JC2A 1BT6A 2WORA 3NSLA 4OCIA 2AMIA 2OS8B 2FJUB 3GK1A 1XK4A 2F3YA 2MJWB 1L7ZA 1QV1A 2Y4QA 1WY9A 5HKYA 2KYFA 3LCPC 1K95A 2H2KA 2LHLA 1KFUS 1ALWA 1H4BA 2LHIA 2JQ6A 2WCBA 1CFCA 1WRZA 1NUBA 1QVIY 5HYDA 2LM5A 1UURA 1UWOA 1IQ3A 2ZFDA 2JPTA 2I94A 2H61A 1L2OC 3LK0A 1AVSA 1AK8A 1IJ6A 2M29A 4FQOA 1MUXA 1JC2A 1NP8A 1AHRA 4USLA 2KBMA 3VRNA 2WCFA 1LKJA 2L98A 4JPZB 2DOQA 2LLSA 1MQ1A 3KPXA 4PHMA 1TCOB 1C7WA 1YUTA 1LXFC 2K7CA 1GGWA 3OX5A 2KI6C 4A4BA 2L4HA 1RJVA 4PHKA 1S5GZ 1ODBA 1OMDA 3IQQA 1UHJA 4ZCVA 5I2OA 3WHUB 2BL0C 2SASA 1D1OA 2G9BA 2M7NA 1JFJA 4GGNA 4XJKB 5DKRA 4CFQA 1BLQA 1QX5B 4CIDA 3JVTC 3BOWA 3QRXA 2JZIA 1Q80A 2MHHA 5F6TA 4BY5A 4AQIA 1CKKA 1F8HA 4R1EA 1SRAA 2KI4B 1DTLA 1MXLC 1DF0A 2I2RE 1PALA 4GNKB 3A8RA 3ICBA 1QXPA 4N1FA 1KSOA 5IBWA 1F70A 3O4YA 1IWQA 2LANA 1XFWO 3BUNB 1RTP1 3TZ1A 1S6CA 3BYAA 1QTXA 1YRUB 2L5XB 1K96A 1PVAA 1TTXA 2M7LA 1U5IB 3CR5X 2EC6B 1W7JB 3SG2A 1KWOC 2JWWA 3TDIA 1TCFA 3EKJA 1CDPA 3AAJA 2LUXA 2O5GA 1L2OB 1MR8A 2FOTA 3RM1A 3AKAA 1NIWA 4I5JA 1OMVA 2BE4A 2CCMA 1IGVA 3WHTB 1XVJA 2D8NA 2V53A 2AUCA 1PK0D 1OOJA 1KSMA 4ZCUA 2BKIB 3PALA 1IQ5A 2M8UA 5GQQC 4GAOA 1DMOA 1CLMA 1KFUL 1J1EA 3DD4A 2B1UA 2K8MB 1BOCA 1EL4A 3LL8B 5CPVA 3F45A 1NX1A 5HLOA 3NSIA 4YGBB 3SJSA 2BL0B 1GJYA 5KSZA 2Y1NA 1KQVA 5I8NA 5I2QA 2LVVA 2L4IA 5JJGA 4MZLA 3LK1A 1NSHA 3DVEA 2ZRTA 3JTDB 2OTGC 3TDUA 1SL7A 1A2XA 5FYXA 4Q04A 1NCYA 2BCXA 2IS9A 3CR2A 1PSBA 1XA5A 1J1DA 1K90D 1N65A 1IJ5A 1PULA 2JULA 2MLFC 3ZWHA 1QV0A 1RECA 2ZN9A 3OP0A 4QJ3B 1FPWA 1WDCC 1DJHA 1YX8A 4YBHB 1B7TZ 3NSOA 3EVUA 1A4PA 1SR6C 2MBXA 4PHNA 2R2IA 2ZKMX 3NXAA 1JWDA 2NCOA 1YR5A 1BR4B 1YX7A 3TS5C 2ZN8A 2TN4A 3VRRA 1PSRA 2KOTA 3PM8A 3KHEA 4GFTA 1KWOB 1B9AA 2ISDA 3BOWB 2Q91A 3I5FC 1LA3A 1DJZA 1OQPA 2KFFA 2KGBC 5I2LA 1SK6D 2HETA 1RK9A 2KNEA 1DF0B 5AERA 2JTTA 4GUKA 1K9PA 1KK8C 1EG4A 1SKTA 4D1EA 1J7QA 1JF2A 5HLVA 1ZACA 2Y1MA 1G33A 4HREE 1DJIA 1XFXO 1IH0A 2BECA 3OB1B 4PE0A 1NX0A 5JOLA 2M1KB 1TNQA 4ORCB 2G2BA 1KQMB 2LLUA 1A03A 5ER5A 1XFYO 1LA0A 1QX7A 2JRFA 4QJ5B 1WRKA 3PATA 4YRUA 2LMUA 4E68A 1W7IB 1H8BA 1UP5A 5AANA 2M1UA 1S6JA 5B8IB 3PN7C 2E6WA 3BUMB 3DF0A 3O2PA 1N0YA 2PASA 2E30A 2BBMA 3DVJA 2M9GA 1SPYA 4DCKA 3RLZA 2K7DA 3O6BA 3PLFB 4JWQA 1UUSA 1FBVA 3LLEA 4JQ0D 4AOMA 4MBEA 1S36A 2F3ZA 4MRXA 2LVIA 4DRWA 5AEQA 1PVBA 2KBIA 1DGVA 3GK2A 1KK7Z 3SIBA 2KFGA 3M0WA 1KCYA 2QACA 4P2YB 1JF0A 2KAVA 1A29A 1K8UA 1YVHA 1AJ5A 2BKHB 3FWBA 2GGMA 4YGCB 1F4OA 4PALA 1SL8A 2LNKA 4HSZA 1RFJA 5CSJA 1NX3A 1SR6B 2Y5IA 1CDLA 1B8CA 1MXEA 1CDNA 1Y1UA 1SCMC 1J7OA 3AAKA 4DIRA 4F0ZB 2PVBA 1SCVA 1MWNA 2PRUA 1VRKA 2MRDA 2JNXA 3GOFA 1BJFA 1YRTB 3O78A 1OZOA 3MSEB 4TNCA 1M39A 1WLMA 4NDBA 3I5FB 1SMGA 4A4CA 1TNXA 3VRPA 1TIZA 3I5GC 1B8LA 3E3RA 3TUYC 1IG5A 2LVKA 4PCWA 1BODA 2VRGA 1F71A 1KK8B 1WRLA 3FIAA 2M97A 1DJGA 4PE4A 1J7RA 3CR4X 3EKHA 1FI5A 3HCMA 3HX4A 5ER4X 1XYDA 5HKWA 5DKNA 1CDMA 2JOJA 1Y6WA 2MA2A 4OVNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SBJ A;  1V1F A;  2PMY A;  1NX2 A;  1QX2 A;  2F2P A;  1YUU A;  3I5I C;  4I5N B;  1ZUZ A;  1QIW A;  1QLK A;  2M3W A;  1KFX S;  1M63 B;  1DT7 B;  4NDC A;  2BE6 A;  4YGA A;  4PHJ A;  1YUR A;  3PN7 B;  4CPV A;  2JXC A;  4PE1 A;  4C0K A;  2O60 A;  4QJ4 B;  1FI6 A;  3OB2 B;  4WRI A;  4C0J A;  1B47 A;  1RRO A;  3BXK A;  1K9U A;  3IF7 A;  3KO0 A;  1UHK A;  2JU0 A;  2LP3 A;  4NQG A;  1QAT A;  2JT0 A;  5HKZ A;  2GV5 A;  3VRQ A;  1TRF A;  2CT9 A;  3DVM A;  4WQ2 A;  3CLN A;  2EGD A;  3EVV A;  2I7A A;  1QJT A;  1QS7 A;  2KFH A;  4P5O E;  3GK4 X;  3JVT B;  5CSN A;  4MZK A;  2CTN A;  4OV2 A;  3SG6 A;  1BU3 A;  2WOS A;  3SIA A;  4BY4 A;  1LVC D;  3PFV A;  4MSP A;  2ZNE A;  1GQM A;  5CSF A;  1CM4 A;  1S5G Y;  1XFZ O;  2BBN A;  3NSK A;  5J3X A;  2HQW A;  3DF0 B;  2ZRS A;  2HPS A;  1CFF A;  5CSI A;  1IRJ A;  2F2O A;  1SNL A;  2MAZ A;  2KQY A;  2KYC A;  1JBA A;  4MLW A;  1B4C A;  1BMO A;  3IQO A;  1A75 A;  4ICB A;  3EK8 A;  1TNP A;  1J7P A;  1B8R A;  2LMT A;  3D0Y A;  5AXI A;  3VGO A;  1OMR A;  3KEV A;  1AP4 A;  2BCA A;  1QIV A;  2KI4 C;  4MN0 A;  2KDH A;  1CM1 A;  3OHM B;  2NZ0 A;  1ZFS A;  2LE9 B;  1Y1A A;  2F8P A;  4HRH A;  1S26 D;  2JT3 A;  3DVK A;  4GBA A;  3I5H C;  3CS1 A;  1UHI A;  1BR1 B;  2WC8 A;  3SG4 A;  2CBL A;  2KGR A;  3SG3 A;  1OZS A;  1J55 A;  3I5I B;  1B1G A;  4I5L B;  4ORB B;  1BG1 A;  1OSA A;  2SCP A;  1ZMZ A;  3WXA A;  3OX6 A;  1C7V A;  1CMF A;  1HQV A;  2OPO A;  5AFP A;  1PRW A;  2LVJ A;  2EC6 C;  2LMV A;  4GGF C;  1K94 A;  1NPQ A;  4IL1 A;  2AAO A;  1YUS A;  1DJW A;  1XO5 A;  3FWC A;  2CXJ A;  4M2Q A;  2CNP A;  4GPL B;  2GGZ A;  5BPJ A;  1OE9 B;  3CGA A;  1JFK A;  1M45 A;  2KI6 D;  2OTG B;  3PSR A;  3SG7 A;  1DJY A;  3FS7 A;  4YGD B;  1XK4 C;  1CLL A;  2KQ6 A;  2K61 A;  1UHH A;  3EVR A;  4AQJ A;  5K89 A;  1M46 A;  1NWD A;  2BCB A;  5KU1 A;  3K21 A;  1QLS A;  3A4U B;  4N5X A;  1F55 A;  4MEW A;  4YI8 A;  1NCX A;  1KFX L;  2LV7 A;  1EG3 A;  1WDC B;  1K9K A;  1N2D A;  2L51 A;  1S3P A;  3BUO B;  4L9M A;  1JUO A;  1V1G A;  1IKU A;  3SG5 A;  2LP2 A;  3TS5 B;  2LCP A;  2H61 C;  2NCP A;  2NXQ A;  1CFD A;  5G08 A;  5D7F A;  4MRY A;  2COL B;  2L0P A;  2M0R A;  2Q4U A;  4FTG A;  3JTD C;  5D69 A;  2JTZ A;  2KAY A;  2K2A A;  1AJ4 A;  2KHN A;  3CZT X;  4PDZ A;  3C1V A;  1DJX A;  4DUQ A;  2JT8 A;  2LUC A;  3WNX B;  1CNP A;  4I5K A;  2LAP A;  3CWG A;  2MLE C;  1TN4 A;  1B7T Y;  1QVI Z;  2ZND A;  2QPT A;  2K2F A;  3I5H B;  5PAL A;  3CTN A;  1E8A A;  3H4S E;  2F33 A;  2LLT A;  2WCE A;  1CB1 A;  1DVI A;  1CLB A;  4WQ3 A;  1BF5 A;  2L50 A;  4M2P A;  4XYN A;  1LIN A;  2OS8 C;  3D10 A;  1MHO A;  1S6I A;  1S1E A;  2LC5 A;  1SYM A;  2K7B A;  3EK4 A;  2KAX A;  1ALV A;  2NLN A;  1YVL A;  1SL9 A;  1CFP A;  1UHN A;  1Y0V H;  1WLZ A;  4U8D A;  1X02 A;  2A4J A;  4MVF A;  2HQ8 A;  1QAS A;  1RWY A;  2M49 B;  4CLN A;  5DKQ A;  1A75 B;  1DGU A;  2FCD A;  3D0Y B;  4NDD A;  4ORA B;  1C07 A;  3EK7 A;  1F4Q A;  2L2E A;  4YI9 A;  4N1G A;  3BUX B;  1CTR A;  1XFV O;  2WND A;  4PE7 A;  1K93 D;  1NYA A;  2RGI A;  4XJK A;  4CFR A;  1FW4 A;  2P6B B;  1JSA A;  2K7O A;  1GGZ A;  1SW8 A;  2JXL A;  4OKH A;  1KQM C;  3BUW B;  2HF5 A;  3ZNI A;  1TOP A;  3VRO A;  2PSR A;  4DS7 A;  3KF9 A;  1K2H A;  2KSP A;  5TNC A;  1XFU O;  1M31 A;  1MF8 B;  2FCE A;  1HT9 A;  2PAL A;  3AKB A;  1SCM B;  1SY9 A;  1CMG A;  1Y1X A;  1EH2 A;  1EJ3 A;  2EHB A;  1FF1 A;  1YTZ C;  4YGE B;  4M2O A;  4MZJ A;  1KK7 Y;  2JNF A;  2I18 A;  1U5I A;  3I5G B;  1R6P A;  1ZOT B;  3TUY B;  5KTY A;  1TNW A;  4GGF A;  1R2U A;  4C0L A;  3TDZ A;  4OR9 B;  4ETO A;  4HRG A;  1G4Y R;  1G8I A;  1NCZ A;  1EXR A;  1AUI B;  2K0J A;  3BQ3 A;  1F54 A;  4UPG A;  2JC2 A;  1BT6 A;  2WOR A;  3NSL A;  4OCI A;  2AMI A;  2OS8 B;  2FJU B;  3GK1 A;  1XK4 A;  2F3Y A;  2MJW B;  1L7Z A;  1QV1 A;  2Y4Q A;  1WY9 A;  5HKY A;  2KYF A;  3LCP C;  1K95 A;  2H2K A;  2LHL A;  1KFU S;  1ALW A;  1H4B A;  2LHI A;  2JQ6 A;  2WCB A;  1CFC A;  1WRZ A;  1NUB A;  1QVI Y;  5HYD A;  2LM5 A;  1UUR A;  1UWO A;  1IQ3 A;  2ZFD A;  2JPT A;  2I94 A;  2H61 A;  1L2O C;  3LK0 A;  1AVS A;  1AK8 A;  1IJ6 A;  2M29 A;  4FQO A;  1MUX A;  1JC2 A;  1NP8 A;  1AHR A;  4USL A;  2KBM A;  3VRN A;  2WCF A;  1LKJ A;  2L98 A;  4JPZ B;  2DOQ A;  2LLS A;  1MQ1 A;  3KPX A;  4PHM A;  1TCO B;  1C7W A;  1YUT A;  1LXF C;  2K7C A;  1GGW A;  3OX5 A;  2KI6 C;  4A4B A;  2L4H A;  1RJV A;  4PHK A;  1S5G Z;  1ODB A;  1OMD A;  3IQQ A;  1UHJ A;  4ZCV A;  5I2O A;  3WHU B;  2BL0 C;  2SAS A;  1D1O A;  2G9B A;  2M7N A;  1JFJ A;  4GGN A;  4XJK B;  5DKR A;  4CFQ A;  1BLQ A;  1QX5 B;  4CID A;  3JVT C;  3BOW A;  3QRX A;  2JZI A;  1Q80 A;  2MHH A;  5F6T A;  4BY5 A;  4AQI A;  1CKK A;  1F8H A;  4R1E A;  1SRA A;  2KI4 B;  1DTL A;  1MXL C;  1DF0 A;  2I2R E;  1PAL A;  4GNK B;  3A8R A;  3ICB A;  1QXP A;  4N1F A;  1KSO A;  5IBW A;  1F70 A;  3O4Y A;  1IWQ A;  2LAN A;  1XFW O;  3BUN B;  1RTP 1;  3TZ1 A;  1S6C A;  3BYA A;  1QTX A;  1YRU B;  2L5X B;  1K96 A;  1PVA A;  1TTX A;  2M7L A;  1U5I B;  3CR5 X;  2EC6 B;  1W7J B;  3SG2 A;  1KWO C;  2JWW A;  3TDI A;  1TCF A;  3EKJ A;  1CDP A;  3AAJ A;  2LUX A;  2O5G A;  1L2O B;  1MR8 A;  2FOT A;  3RM1 A;  3AKA A;  1NIW A;  4I5J A;  1OMV A;  2BE4 A;  2CCM A;  1IGV A;  3WHT B;  1XVJ A;  2D8N A;  2V53 A;  2AUC A;  1PK0 D;  1OOJ A;  1KSM A;  4ZCU A;  2BKI B;  3PAL A;  1IQ5 A;  2M8U A;  5GQQ C;  4GAO A;  1DMO A;  1CLM A;  1KFU L;  1J1E A;  3DD4 A;  2B1U A;  2K8M B;  1BOC A;  1EL4 A;  3LL8 B;  5CPV A;  3F45 A;  1NX1 A;  5HLO A;  3NSI A;  4YGB B;  3SJS A;  2BL0 B;  1GJY A;  5KSZ A;  2Y1N A;  1KQV A;  5I8N A;  5I2Q A;  2LVV A;  2L4I A;  5JJG A;  4MZL A;  3LK1 A;  1NSH A;  3DVE A;  2ZRT A;  3JTD B;  2OTG C;  3TDU A;  1SL7 A;  1A2X A;  5FYX A;  4Q04 A;  1NCY A;  2BCX A;  2IS9 A;  3CR2 A;  1PSB A;  1XA5 A;  1J1D A;  1K90 D;  1N65 A;  1IJ5 A;  1PUL A;  2JUL A;  2MLF C;  3ZWH A;  1QV0 A;  1REC A;  2ZN9 A;  3OP0 A;  4QJ3 B;  1FPW A;  1WDC C;  1DJH A;  1YX8 A;  4YBH B;  1B7T Z;  3NSO A;  3EVU A;  1A4P A;  1SR6 C;  2MBX A;  4PHN A;  2R2I A;  2ZKM X;  3NXA A;  1JWD A;  2NCO A;  1YR5 A;  1BR4 B;  1YX7 A;  3TS5 C;  2ZN8 A;  2TN4 A;  3VRR A;  1PSR A;  2KOT A;  3PM8 A;  3KHE A;  4GFT A;  1KWO B;  1B9A A;  2ISD A;  3BOW B;  2Q91 A;  3I5F C;  1LA3 A;  1DJZ A;  1OQP A;  2KFF A;  2KGB C;  5I2L A;  1SK6 D;  2HET A;  1RK9 A;  2KNE A;  1DF0 B;  5AER A;  2JTT A;  4GUK A;  1K9P A;  1KK8 C;  1EG4 A;  1SKT A;  4D1E A;  1J7Q A;  1JF2 A;  5HLV A;  1ZAC A;  2Y1M A;  1G33 A;  4HRE E;  1DJI A;  1XFX O;  1IH0 A;  2BEC A;  3OB1 B;  4PE0 A;  1NX0 A;  5JOL A;  2M1K B;  1TNQ A;  4ORC B;  2G2B A;  1KQM B;  2LLU A;  1A03 A;  5ER5 A;  1XFY O;  1LA0 A;  1QX7 A;  2JRF A;  4QJ5 B;  1WRK A;  3PAT A;  4YRU A;  2LMU A;  4E68 A;  1W7I B;  1H8B A;  1UP5 A;  5AAN A;  2M1U A;  1S6J A;  5B8I B;  3PN7 C;  2E6W A;  3BUM B;  3DF0 A;  3O2P A;  1N0Y A;  2PAS A;  2E30 A;  2BBM A;  3DVJ A;  2M9G A;  1SPY A;  4DCK A;  3RLZ A;  2K7D A;  3O6B A;  3PLF B;  4JWQ A;  1UUS A;  1FBV A;  3LLE A;  4JQ0 D;  4AOM A;  4MBE A;  1S36 A;  2F3Z A;  4MRX A;  2LVI A;  4DRW A;  5AEQ A;  1PVB A;  2KBI A;  1DGV A;  3GK2 A;  1KK7 Z;  3SIB A;  2KFG A;  3M0W A;  1KCY A;  2QAC A;  4P2Y B;  1JF0 A;  2KAV A;  1A29 A;  1K8U A;  1YVH A;  1AJ5 A;  2BKH B;  3FWB A;  2GGM A;  4YGC B;  1F4O A;  4PAL A;  1SL8 A;  2LNK A;  4HSZ A;  1RFJ A;  5CSJ A;  1NX3 A;  1SR6 B;  2Y5I A;  1CDL A;  1B8C A;  1MXE A;  1CDN A;  1Y1U A;  1SCM C;  1J7O A;  3AAK A;  4DIR A;  4F0Z B;  2PVB A;  1SCV A;  1MWN A;  2PRU A;  1VRK A;  2MRD A;  2JNX A;  3GOF A;  1BJF A;  1YRT B;  3O78 A;  1OZO A;  3MSE B;  4TNC A;  1M39 A;  1WLM A;  4NDB A;  3I5F B;  1SMG A;  4A4C A;  1TNX A;  3VRP A;  1TIZ A;  3I5G C;  1B8L A;  3E3R A;  3TUY C;  1IG5 A;  2LVK A;  4PCW A;  1BOD A;  2VRG A;  1F71 A;  1KK8 B;  1WRL A;  3FIA A;  2M97 A;  1DJG A;  4PE4 A;  1J7R A;  3CR4 X;  3EKH A;  1FI5 A;  3HCM A;  3HX4 A;  5ER4 X;  1XYD A;  5HKW A;  5DKN A;  1CDM A;  2JOJ A;  1Y6W A;  2MA2 A;  4OVN F; 
#chains in the Genus database with same CATH topology
 2PQL A;  1SBJ A;  1V1F A;  2PMY A;  1NX2 A;  1QX2 A;  2F2P A;  1YUU A;  3I5I C;  4I5N B;  1ZUZ A;  1QIW A;  1QLK A;  2M3W A;  1KFX S;  1M63 B;  1DT7 B;  4NDC A;  2BE6 A;  3CYZ A;  4PHJ A;  4YGA A;  3UO9 A;  1YUR A;  3PN7 B;  2K60 A;  2JXC A;  4CPV A;  2KLD A;  4PE1 A;  2O60 A;  4C0K A;  4QJ4 B;  1FI6 A;  3OB2 B;  4WRI A;  4C0J A;  1B47 A;  1RRO A;  3BXK A;  1K9U A;  3IF7 A;  3KO0 A;  1UHK A;  2JU0 A;  2LP3 A;  4NQG A;  1QAT A;  2JT0 A;  5HKZ A;  2GV5 A;  3VRQ A;  1TRF A;  2CT9 A;  3DVM A;  3DY9 A;  4WQ2 A;  3CLN A;  2EGD A;  3EVV A;  2I7A A;  1QJT A;  1QS7 A;  2KFH A;  4P5O E;  3GK4 X;  3JVT B;  5CSN A;  4MZK A;  2CTN A;  4OV2 A;  3SG6 A;  1BU3 A;  1OOF A;  2WOS A;  3SIA A;  4BY4 A;  1LVC D;  3PFV A;  4MSP A;  2ZNE A;  1GQM A;  5CSF A;  3CAB A;  1CM4 A;  1S5G Y;  1XFZ O;  2BBN A;  3L47 A;  3NSK A;  5J3X A;  3D75 A;  2HQW A;  3DF0 B;  3L4A A;  2ZRS A;  2HPS A;  1C3Z A;  1CFF A;  5CSI A;  1IRJ A;  2F2O A;  1SNL A;  2MAZ A;  3CZ2 A;  5FI7 A;  2KQY A;  2KYC A;  1JBA A;  4MLW A;  1B4C A;  1BMO A;  3IQO A;  1A75 A;  4ICB A;  3EK8 A;  1TNP A;  1J7P A;  1B8R A;  2LMT A;  3D0Y A;  5AXI A;  3VGO A;  5HL1 A;  3S0D A;  1OMR A;  3KEV A;  5DIC A;  2BCA A;  5FI2 A;  1AP4 A;  3RZS A;  1QIV A;  2KI4 C;  4MN0 A;  2KDH A;  1CM1 A;  3OHM B;  2NZ0 A;  1ZFS A;  3S0F A;  3R1V A;  2LE9 B;  3PJI A;  1Y1A A;  2F8P A;  3D74 A;  3D78 A;  4HRH A;  1S26 D;  2JT3 A;  3DVK A;  4GBA A;  1SSE B;  3I5H C;  3CS1 A;  4FQT A;  4OZD A;  1UHI A;  1BR1 B;  2WC8 A;  3SG4 A;  2CBL A;  2GTE A;  2KGR A;  3SG3 A;  1OZS A;  1J55 A;  3I5I B;  1B1G A;  4I5L B;  4ORB B;  1BG1 A;  1OSA A;  1XFR A;  2SCP A;  1ZMZ A;  3WXA A;  3OX6 A;  1C7V A;  1CMF A;  1HQV A;  2OPO A;  5AFP A;  2H8V A;  3B7A A;  1PRW A;  2LVJ A;  2EC6 C;  1OOH A;  4F7F A;  2LMV A;  3PM2 A;  4GGF C;  1K94 A;  1NPQ A;  4IL1 A;  2AAO A;  1YUS A;  1DJW A;  1XO5 A;  3FWC A;  2CXJ A;  3BFA A;  4M2Q A;  2CNP A;  4GPL B;  4JD9 A;  2GGZ A;  5BPJ A;  1OE9 B;  3CGA A;  1JFK A;  1M45 A;  2KI6 D;  2OTG B;  3PSR A;  1DC1 A;  3SG7 A;  3R1O A;  1DJY A;  3FS7 A;  4YGD B;  1XK4 C;  1CLL A;  2KQ6 A;  2K61 A;  1UHH A;  3EVR A;  4AQJ A;  5K89 A;  1M46 A;  1NWD A;  3R72 A;  2BCB A;  5KU1 A;  3K21 A;  1QLS A;  3A4U B;  4N5X A;  1F55 A;  2WCM A;  4MEW A;  4YI8 A;  1NCX A;  1QWV A;  1KFX L;  2LV7 A;  1EG3 A;  1WDC B;  1K9K A;  1N2D A;  1C3Y A;  2L51 A;  1S3P A;  3BUO B;  4L9M A;  1JUO A;  1V1G A;  1IKU A;  3SG5 A;  1Z2C B;  4PT1 A;  2LP2 A;  3TS5 B;  2LCP A;  2H61 C;  2NCP A;  1OW4 A;  1CFD A;  2NXQ A;  5G08 A;  5D7F A;  4MRY A;  2COL B;  2L0P A;  2M0R A;  2Q4U A;  4FTG A;  3JTD C;  5D69 A;  2JTZ A;  2KAY A;  2K2A A;  1AJ4 A;  2KHN A;  3CZT X;  4PDZ A;  3C1V A;  1DJX A;  4DUQ A;  2JT8 A;  5I94 A;  2LUC A;  3WNX B;  1CNP A;  4I5K A;  2LAP A;  3CWG A;  2MLE C;  1TN4 A;  1B7T Y;  1QVI Z;  2ZND A;  2QPT A;  2K2F A;  3I5H B;  5PAL A;  3NHT A;  1DQE A;  3CTN A;  1E8A A;  3H4S E;  2F33 A;  2LLT A;  2WCE A;  1CB1 A;  1DVI A;  1CLB A;  4WQ3 A;  1BF5 A;  2L50 A;  2QEV A;  4M2P A;  4XYN A;  1LIN A;  2OS8 C;  3D10 A;  1MHO A;  1S6I A;  1S1E A;  2LC5 A;  1SYM A;  2K7B A;  3EK4 A;  2KAX A;  1ALV A;  2NLN A;  1YVL A;  1SL9 A;  1CFP A;  3BFH A;  1UHN A;  1Y0V H;  1WLZ A;  4U8D A;  1OOG A;  1X02 A;  2A4J A;  4MVF A;  2HQ8 A;  1QAS A;  1RWY A;  2M49 B;  4CLN A;  5DKQ A;  1A75 B;  1DGU A;  2FCD A;  3D0Y B;  4KYN A;  4NDD A;  4ORA B;  1C07 A;  1ORG A;  3EK7 A;  3CZ0 A;  1F4Q A;  4INW A;  2L2E A;  3NHI A;  1GM0 A;  4YI9 A;  4N1G A;  3BUX B;  1CTR A;  1XFV O;  2WND A;  4PE7 A;  1K93 D;  2KPH A;  1NYA A;  2RGI A;  4XJK A;  3CDN A;  1DEL A;  3OGN A;  4CFR A;  1FW4 A;  2P6B B;  3UNW A;  1JSA A;  2K7O A;  1GGZ A;  1SW8 A;  2JXL A;  3O4X A;  1KQM C;  3BUW B;  2HF5 A;  4OKH A;  3ZNI A;  2WCH A;  1TOP A;  3VRO A;  2PSR A;  4DS7 A;  3KF9 A;  1K2H A;  2KSP A;  5TNC A;  1XFU O;  1M31 A;  1MF8 B;  2FCE A;  1HT9 A;  2PAL A;  2WC5 A;  3AKB A;  1SCM B;  3IVT A;  1SY9 A;  1CMG A;  1Y1X A;  1EH2 A;  1EJ3 A;  3B6X A;  2EHB A;  1FF1 A;  2FJY A;  1YTZ C;  4YGE B;  4M2O A;  4MZJ A;  1KK7 Y;  2JNF A;  3NGV A;  2I18 A;  1TWO A;  1U5I A;  3I5G B;  1R6P A;  1ZOT B;  3TUY B;  5KTY A;  1TNW A;  4GGF A;  1R2U A;  4C0L A;  3TDZ A;  4OR9 B;  4ETO A;  4HRG A;  1G4Y R;  1G8I A;  1NCZ A;  1EXR A;  1AUI B;  2K0J A;  3BQ3 A;  1F54 A;  4UPG A;  2JC2 A;  3B86 A;  1BT6 A;  2WOR A;  3NSL A;  4OCI A;  2AMI A;  2OS8 B;  2FJU B;  3GK1 A;  1LS8 A;  1XK4 A;  2F3Y A;  2MJW B;  1L7Z A;  1QV1 A;  2Y4Q A;  1WY9 A;  5HKY A;  3EG5 B;  2KYF A;  3LCP C;  1K95 A;  1DEK A;  2H2K A;  2LHL A;  2P71 A;  1KFU S;  1ALW A;  1H4B A;  2LHI A;  2JQ6 A;  2WCB A;  3FE8 A;  3D73 A;  1CFC A;  1WRZ A;  1NUB A;  1QVI Y;  3S0B A;  3B88 A;  5HYD A;  2LM5 A;  1UUR A;  1UWO A;  1IQ3 A;  2ZFD A;  2JPT A;  3V2L A;  2I94 A;  2H61 A;  1Z4H A;  1L2O C;  3LK0 A;  1AVS A;  1AK8 A;  1IJ6 A;  2M29 A;  4FQO A;  5D3O A;  1MUX A;  3SS4 A;  1JC2 A;  1NP8 A;  1AHR A;  4USL A;  2KBM A;  3VRN A;  2WCF A;  1LKJ A;  2L98 A;  2WCL A;  4JPZ B;  2DOQ A;  2LLS A;  1MQ1 A;  3K1E A;  3KPX A;  4PHM A;  1TCO B;  1C7W A;  1YUT A;  2P70 A;  1LXF C;  2K7C A;  2WC6 A;  1GGW A;  3OX5 A;  2KI6 C;  4A4B A;  2L4H A;  1RJV A;  4PHK A;  1S5G Z;  1ODB A;  1OMD A;  3IQQ A;  1UHJ A;  4ZCV A;  5I2O A;  3DXL A;  2PYQ A;  3WHU B;  2BL0 C;  2SAS A;  1D1O A;  2G9B A;  2M7N A;  1JFJ A;  1T14 A;  4GGN A;  4XJK B;  5DKR A;  2BNX A;  4CFQ A;  1BLQ A;  4IJ7 A;  1QX5 B;  2QEH A;  4CID A;  3JVT C;  3BOW A;  3QRX A;  2JZI A;  1Q80 A;  2MHH A;  5F6T A;  4BY5 A;  4AQI A;  1CKK A;  1F8H A;  4R1E A;  3Q8I A;  1SRA A;  2KI4 B;  1DTL A;  1MXL C;  1DF0 A;  2I2R E;  1PAL A;  4GNK B;  3A8R A;  3ICB A;  1QXP A;  4N1F A;  1KSO A;  5IBW A;  1F70 A;  3O4Y A;  1IWQ A;  2LAN A;  1XFW O;  3D76 A;  3BUN B;  1RTP 1;  3TZ1 A;  3B87 A;  1S6C A;  3BYA A;  1QTX A;  1YRU B;  2L5X B;  1K96 A;  1PVA A;  2KLE A;  1TTX A;  3FE6 A;  2M7L A;  1U5I B;  3CR5 X;  2EC6 B;  1W7J B;  3SG2 A;  1KWO C;  2JWW A;  3L4L A;  3TDI A;  1TCF A;  3EKJ A;  1CDP A;  3AAJ A;  2LUX A;  2O5G A;  1L2O B;  1MR8 A;  2FOT A;  3RM1 A;  3AKA A;  1NIW A;  4I5J A;  1OMV A;  2BE4 A;  2CCM A;  1IGV A;  3WHT B;  1XVJ A;  2D8N A;  2V53 A;  1PK0 D;  2AUC A;  1OOJ A;  1KSM A;  2QEO A;  2BKI B;  4ZCU A;  3PAL A;  1IQ5 A;  2M8U A;  5GQQ C;  4GAO A;  3SS3 A;  1DMO A;  1CLM A;  1KFU L;  2ERB A;  1J1E A;  3DD4 A;  2B1U A;  2K8M B;  1BOC A;  1EL4 A;  3LL8 B;  5CPV A;  3D77 A;  2L2C A;  3F45 A;  1NX1 A;  5HLO A;  3NSI A;  4YGB B;  3SJS A;  2BL0 B;  1GJY A;  5KSZ A;  2Y1N A;  1KQV A;  5I8N A;  5I2Q A;  2LVV A;  2JPO A;  2L4I A;  5JJG A;  4MZL A;  3LK1 A;  1NSH A;  3DVE A;  2ZRT A;  3JTD B;  2OTG C;  3TDU A;  1SL7 A;  1TUZ A;  1A2X A;  3OBV A;  5FYX A;  4Q04 A;  1NCY A;  2BCX A;  2IS9 A;  3CR2 A;  1PSB A;  1XA5 A;  1J1D A;  1K90 D;  1N65 A;  1IJ5 A;  1PUL A;  2JUL A;  2MLF C;  3BJH A;  3QME A;  4JKT A;  1QV0 A;  3ZWH A;  1REC A;  2ZN9 A;  3OP0 A;  4QJ3 B;  1FPW A;  1WDC C;  1DJH A;  1YX8 A;  4YBH B;  1B7T Z;  3NSO A;  3EVU A;  1A4P A;  3VB1 A;  1SR6 C;  2MBX A;  4PHN A;  2R2I A;  2ZKM X;  3R1P A;  3NXA A;  1JWD A;  2NCO A;  1YR5 A;  1BR4 B;  1YX7 A;  3TS5 C;  3S0E A;  2ZN8 A;  2TN4 A;  3VRR A;  1PSR A;  2KOT A;  3PM8 A;  3KHE A;  4GFT A;  1KWO B;  1W9Z A;  1B9A A;  2ISD A;  3BOW B;  2Q91 A;  3I5F C;  5EL2 A;  5FI6 A;  1LA3 A;  1DJZ A;  1OQP A;  2KFF A;  2KGB C;  1TUJ A;  1SK6 D;  5I2L A;  3S0G A;  2HET A;  1RK9 A;  2KNE A;  1DF0 B;  5AER A;  2JTT A;  4GUK A;  1K9P A;  1KK8 C;  1EG4 A;  1SKT A;  3BFB A;  4D1E A;  1JF2 A;  5HLV A;  1ZAC A;  3S0A A;  2Y1M A;  1J7Q A;  1G33 A;  3DZT A;  4HRE E;  1DJI A;  1XFX O;  1IH0 A;  2BEC A;  3OB1 B;  4PE0 A;  2WCJ A;  1NX0 A;  5JOL A;  2L5Y A;  2M1K B;  1TNQ A;  4ORC B;  2G2B A;  1KQM B;  2LLU A;  1A03 A;  5ER5 A;  3DYE A;  1XFY O;  2QEB A;  1LA0 A;  1QX7 A;  2JRF A;  4QJ5 B;  1WRK A;  3PAT A;  4YRU A;  2LMU A;  4E68 A;  1W7I B;  1H8B A;  1UP5 A;  5AAN A;  2M1U A;  1S6J A;  5B8I B;  3PN7 C;  2E6W A;  3BUM B;  2WCK A;  3DF0 A;  3O2P A;  1N0Y A;  2PAS A;  2E30 A;  2BBM A;  3DVJ A;  2M9G A;  1SPY A;  4DCK A;  3RLZ A;  2K7D A;  3O6B A;  3PLF B;  4JWQ A;  1UUS A;  1FBV A;  3LLE A;  4JQ0 D;  4AOM A;  4MBE A;  1S36 A;  2F3Z A;  4MRX A;  2LVI A;  4DRW A;  5AEQ A;  1PVB A;  2KBI A;  1DGV A;  3GK2 A;  1KK7 Z;  3SIB A;  2KFG A;  3M0W A;  1KCY A;  2QAC A;  4P2Y B;  1JF0 A;  2KAV A;  1A29 A;  1K8U A;  1YVH A;  1AJ5 A;  2BKH B;  3FWB A;  2GGM A;  4YGC B;  1F4O A;  4PAL A;  1SL8 A;  2LNK A;  4HSZ A;  1RFJ A;  2BAP A;  1NX3 A;  1SR6 B;  2Y5I A;  1CDL A;  5CSJ A;  1B8C A;  1MXE A;  1CDN A;  1Y1U A;  1SCM C;  1J7O A;  3AAK A;  4DIR A;  2QDI A;  1OOI X;  3FE9 A;  4F0Z B;  2PVB A;  1SCV A;  4INX A;  1MWN A;  2PRU A;  3N7H A;  2YGU A;  1VRK A;  2MRD A;  2JNX A;  3GOF A;  1BJF A;  1YRT B;  3O78 A;  1OZO A;  3MSE B;  4TNC A;  1M39 A;  1WLM A;  4NDB A;  3I5F B;  1SMG A;  4A4C A;  1TNX A;  3VRP A;  1TIZ A;  1IIO A;  3I5G C;  1B8L A;  3E3R A;  3TUY C;  1IG5 A;  2LVK A;  4PCW A;  1BOD A;  2VRG A;  1F71 A;  1KK8 B;  1WRL A;  3FIA A;  2M97 A;  1DJG A;  3CZ1 A;  4PE4 A;  1J7R A;  3CR4 X;  3EKH A;  1FI5 A;  3HCM A;  3HX4 A;  5ER4 X;  1XYD A;  5HKW A;  5DKN A;  1CDM A;  1P28 A;  2JOJ A;  1Y6W A;  3SS5 A;  2MA2 A;  4OVN F; 
#chains in the Genus database with same CATH homology
 1SBJ A;  1V1F A;  2PMY A;  1NX2 A;  1QX2 A;  2F2P A;  1YUU A;  3I5I C;  4I5N B;  1ZUZ A;  1QIW A;  1QLK A;  2M3W A;  1KFX S;  1M63 B;  1DT7 B;  4NDC A;  2BE6 A;  4YGA A;  4PHJ A;  1YUR A;  3PN7 B;  4CPV A;  2JXC A;  4PE1 A;  4C0K A;  2O60 A;  4QJ4 B;  1FI6 A;  3OB2 B;  4WRI A;  4C0J A;  1B47 A;  1RRO A;  3BXK A;  1K9U A;  3IF7 A;  3KO0 A;  1UHK A;  2JU0 A;  2LP3 A;  4NQG A;  1QAT A;  2JT0 A;  5HKZ A;  2GV5 A;  3VRQ A;  1TRF A;  2CT9 A;  3DVM A;  4WQ2 A;  3CLN A;  2EGD A;  3EVV A;  2I7A A;  1QJT A;  1QS7 A;  2KFH A;  4P5O E;  3GK4 X;  3JVT B;  5CSN A;  4MZK A;  2CTN A;  4OV2 A;  3SG6 A;  1BU3 A;  2WOS A;  3SIA A;  4BY4 A;  1LVC D;  3PFV A;  4MSP A;  2ZNE A;  1GQM A;  5CSF A;  1CM4 A;  1S5G Y;  1XFZ O;  2BBN A;  3NSK A;  5J3X A;  2HQW A;  3DF0 B;  2ZRS A;  2HPS A;  1CFF A;  5CSI A;  1IRJ A;  2F2O A;  1SNL A;  2MAZ A;  2KQY A;  2KYC A;  1JBA A;  4MLW A;  1B4C A;  1BMO A;  3IQO A;  1A75 A;  4ICB A;  3EK8 A;  1TNP A;  1J7P A;  1B8R A;  2LMT A;  3D0Y A;  5AXI A;  3VGO A;  1OMR A;  3KEV A;  1AP4 A;  2BCA A;  1QIV A;  2KI4 C;  4MN0 A;  2KDH A;  1CM1 A;  3OHM B;  2NZ0 A;  1ZFS A;  2LE9 B;  1Y1A A;  2F8P A;  4HRH A;  1S26 D;  2JT3 A;  3DVK A;  4GBA A;  3I5H C;  3CS1 A;  1UHI A;  1BR1 B;  2WC8 A;  3SG4 A;  2CBL A;  2KGR A;  3SG3 A;  1OZS A;  1J55 A;  3I5I B;  1B1G A;  4I5L B;  4ORB B;  1BG1 A;  1OSA A;  2SCP A;  1ZMZ A;  3WXA A;  3OX6 A;  1C7V A;  1CMF A;  1HQV A;  2OPO A;  5AFP A;  1PRW A;  2LVJ A;  2EC6 C;  2LMV A;  4GGF C;  1K94 A;  1NPQ A;  4IL1 A;  2AAO A;  1YUS A;  1DJW A;  1XO5 A;  3FWC A;  2CXJ A;  4M2Q A;  2CNP A;  4GPL B;  2GGZ A;  5BPJ A;  1OE9 B;  3CGA A;  1JFK A;  1M45 A;  2KI6 D;  2OTG B;  3PSR A;  3SG7 A;  1DJY A;  3FS7 A;  4YGD B;  1XK4 C;  1CLL A;  2KQ6 A;  2K61 A;  1UHH A;  3EVR A;  4AQJ A;  5K89 A;  1M46 A;  1NWD A;  2BCB A;  5KU1 A;  3K21 A;  1QLS A;  3A4U B;  4N5X A;  1F55 A;  4MEW A;  4YI8 A;  1NCX A;  1KFX L;  2LV7 A;  1EG3 A;  1WDC B;  1K9K A;  1N2D A;  2L51 A;  1S3P A;  3BUO B;  4L9M A;  1JUO A;  1V1G A;  1IKU A;  3SG5 A;  2LP2 A;  3TS5 B;  2LCP A;  2H61 C;  2NCP A;  2NXQ A;  1CFD A;  5G08 A;  5D7F A;  4MRY A;  2COL B;  2L0P A;  2M0R A;  2Q4U A;  4FTG A;  3JTD C;  5D69 A;  2JTZ A;  2KAY A;  2K2A A;  1AJ4 A;  2KHN A;  3CZT X;  4PDZ A;  3C1V A;  1DJX A;  4DUQ A;  2JT8 A;  2LUC A;  3WNX B;  1CNP A;  4I5K A;  2LAP A;  3CWG A;  2MLE C;  1TN4 A;  1B7T Y;  1QVI Z;  2ZND A;  2QPT A;  2K2F A;  3I5H B;  5PAL A;  3CTN A;  1E8A A;  3H4S E;  2F33 A;  2LLT A;  2WCE A;  1CB1 A;  1DVI A;  1CLB A;  4WQ3 A;  1BF5 A;  2L50 A;  4M2P A;  4XYN A;  1LIN A;  2OS8 C;  3D10 A;  1MHO A;  1S6I A;  1S1E A;  2LC5 A;  1SYM A;  2K7B A;  3EK4 A;  2KAX A;  1ALV A;  2NLN A;  1YVL A;  1SL9 A;  1CFP A;  1UHN A;  1Y0V H;  1WLZ A;  4U8D A;  1X02 A;  2A4J A;  4MVF A;  2HQ8 A;  1QAS A;  1RWY A;  2M49 B;  4CLN A;  5DKQ A;  1A75 B;  1DGU A;  2FCD A;  3D0Y B;  4NDD A;  4ORA B;  1C07 A;  3EK7 A;  1F4Q A;  2L2E A;  4YI9 A;  4N1G A;  3BUX B;  1CTR A;  1XFV O;  2WND A;  4PE7 A;  1K93 D;  1NYA A;  2RGI A;  4XJK A;  4CFR A;  1FW4 A;  2P6B B;  1JSA A;  2K7O A;  1GGZ A;  1SW8 A;  2JXL A;  4OKH A;  1KQM C;  3BUW B;  2HF5 A;  3ZNI A;  1TOP A;  3VRO A;  2PSR A;  4DS7 A;  3KF9 A;  1K2H A;  2KSP A;  5TNC A;  1XFU O;  1M31 A;  1MF8 B;  2FCE A;  1HT9 A;  2PAL A;  3AKB A;  1SCM B;  1SY9 A;  1CMG A;  1Y1X A;  1EH2 A;  1EJ3 A;  2EHB A;  1FF1 A;  1YTZ C;  4YGE B;  4M2O A;  4MZJ A;  1KK7 Y;  2JNF A;  2I18 A;  1U5I A;  3I5G B;  1R6P A;  1ZOT B;  3TUY B;  5KTY A;  1TNW A;  4GGF A;  1R2U A;  4C0L A;  3TDZ A;  4OR9 B;  4ETO A;  4HRG A;  1G4Y R;  1G8I A;  1NCZ A;  1EXR A;  1AUI B;  2K0J A;  3BQ3 A;  1F54 A;  4UPG A;  2JC2 A;  1BT6 A;  2WOR A;  3NSL A;  4OCI A;  2AMI A;  2OS8 B;  2FJU B;  3GK1 A;  1XK4 A;  2F3Y A;  2MJW B;  1L7Z A;  1QV1 A;  2Y4Q A;  1WY9 A;  5HKY A;  2KYF A;  3LCP C;  1K95 A;  2H2K A;  2LHL A;  1KFU S;  1ALW A;  1H4B A;  2LHI A;  2JQ6 A;  2WCB A;  1CFC A;  1WRZ A;  1NUB A;  1QVI Y;  5HYD A;  2LM5 A;  1UUR A;  1UWO A;  1IQ3 A;  2ZFD A;  2JPT A;  2I94 A;  2H61 A;  1L2O C;  3LK0 A;  1AVS A;  1AK8 A;  1IJ6 A;  2M29 A;  4FQO A;  1MUX A;  1JC2 A;  1NP8 A;  1AHR A;  4USL A;  2KBM A;  3VRN A;  2WCF A;  1LKJ A;  2L98 A;  4JPZ B;  2DOQ A;  2LLS A;  1MQ1 A;  3KPX A;  4PHM A;  1TCO B;  1C7W A;  1YUT A;  1LXF C;  2K7C A;  1GGW A;  3OX5 A;  2KI6 C;  4A4B A;  2L4H A;  1RJV A;  4PHK A;  1S5G Z;  1ODB A;  1OMD A;  3IQQ A;  1UHJ A;  4ZCV A;  5I2O A;  3WHU B;  2BL0 C;  2SAS A;  1D1O A;  2G9B A;  2M7N A;  1JFJ A;  4GGN A;  4XJK B;  5DKR A;  4CFQ A;  1BLQ A;  1QX5 B;  4CID A;  3JVT C;  3BOW A;  3QRX A;  2JZI A;  1Q80 A;  2MHH A;  5F6T A;  4BY5 A;  4AQI A;  1CKK A;  1F8H A;  4R1E A;  1SRA A;  2KI4 B;  1DTL A;  1MXL C;  1DF0 A;  2I2R E;  1PAL A;  4GNK B;  3A8R A;  3ICB A;  1QXP A;  4N1F A;  1KSO A;  5IBW A;  1F70 A;  3O4Y A;  1IWQ A;  2LAN A;  1XFW O;  3BUN B;  1RTP 1;  3TZ1 A;  1S6C A;  3BYA A;  1QTX A;  1YRU B;  2L5X B;  1K96 A;  1PVA A;  1TTX A;  2M7L A;  1U5I B;  3CR5 X;  2EC6 B;  1W7J B;  3SG2 A;  1KWO C;  2JWW A;  3TDI A;  1TCF A;  3EKJ A;  1CDP A;  3AAJ A;  2LUX A;  2O5G A;  1L2O B;  1MR8 A;  2FOT A;  3RM1 A;  3AKA A;  1NIW A;  4I5J A;  1OMV A;  2BE4 A;  2CCM A;  1IGV A;  3WHT B;  1XVJ A;  2D8N A;  2V53 A;  2AUC A;  1PK0 D;  1OOJ A;  1KSM A;  4ZCU A;  2BKI B;  3PAL A;  1IQ5 A;  2M8U A;  5GQQ C;  4GAO A;  1DMO A;  1CLM A;  1KFU L;  1J1E A;  3DD4 A;  2B1U A;  2K8M B;  1BOC A;  1EL4 A;  3LL8 B;  5CPV A;  3F45 A;  1NX1 A;  5HLO A;  3NSI A;  4YGB B;  3SJS A;  2BL0 B;  1GJY A;  5KSZ A;  2Y1N A;  1KQV A;  5I8N A;  5I2Q A;  2LVV A;  2L4I A;  5JJG A;  4MZL A;  3LK1 A;  1NSH A;  3DVE A;  2ZRT A;  3JTD B;  2OTG C;  3TDU A;  1SL7 A;  1A2X A;  5FYX A;  4Q04 A;  1NCY A;  2BCX A;  2IS9 A;  3CR2 A;  1PSB A;  1XA5 A;  1J1D A;  1K90 D;  1N65 A;  1IJ5 A;  1PUL A;  2JUL A;  2MLF C;  3ZWH A;  1QV0 A;  1REC A;  2ZN9 A;  3OP0 A;  4QJ3 B;  1FPW A;  1WDC C;  1DJH A;  1YX8 A;  4YBH B;  1B7T Z;  3NSO A;  3EVU A;  1A4P A;  1SR6 C;  2MBX A;  4PHN A;  2R2I A;  2ZKM X;  3NXA A;  1JWD A;  2NCO A;  1YR5 A;  1BR4 B;  1YX7 A;  3TS5 C;  2ZN8 A;  2TN4 A;  3VRR A;  1PSR A;  2KOT A;  3PM8 A;  3KHE A;  4GFT A;  1KWO B;  1B9A A;  2ISD A;  3BOW B;  2Q91 A;  3I5F C;  1LA3 A;  1DJZ A;  1OQP A;  2KFF A;  2KGB C;  5I2L A;  1SK6 D;  2HET A;  1RK9 A;  2KNE A;  1DF0 B;  5AER A;  2JTT A;  4GUK A;  1K9P A;  1KK8 C;  1EG4 A;  1SKT A;  4D1E A;  1J7Q A;  1JF2 A;  5HLV A;  1ZAC A;  2Y1M A;  1G33 A;  4HRE E;  1DJI A;  1XFX O;  1IH0 A;  2BEC A;  3OB1 B;  4PE0 A;  1NX0 A;  5JOL A;  2M1K B;  1TNQ A;  4ORC B;  2G2B A;  1KQM B;  2LLU A;  1A03 A;  5ER5 A;  1XFY O;  1LA0 A;  1QX7 A;  2JRF A;  4QJ5 B;  1WRK A;  3PAT A;  4YRU A;  2LMU A;  4E68 A;  1W7I B;  1H8B A;  1UP5 A;  5AAN A;  2M1U A;  1S6J A;  5B8I B;  3PN7 C;  2E6W A;  3BUM B;  3DF0 A;  3O2P A;  1N0Y A;  2PAS A;  2E30 A;  2BBM A;  3DVJ A;  2M9G A;  1SPY A;  4DCK A;  3RLZ A;  2K7D A;  3O6B A;  3PLF B;  4JWQ A;  1UUS A;  1FBV A;  3LLE A;  4JQ0 D;  4AOM A;  4MBE A;  1S36 A;  2F3Z A;  4MRX A;  2LVI A;  4DRW A;  5AEQ A;  1PVB A;  2KBI A;  1DGV A;  3GK2 A;  1KK7 Z;  3SIB A;  2KFG A;  3M0W A;  1KCY A;  2QAC A;  4P2Y B;  1JF0 A;  2KAV A;  1A29 A;  1K8U A;  1YVH A;  1AJ5 A;  2BKH B;  3FWB A;  2GGM A;  4YGC B;  1F4O A;  4PAL A;  1SL8 A;  2LNK A;  4HSZ A;  1RFJ A;  5CSJ A;  1NX3 A;  1SR6 B;  2Y5I A;  1CDL A;  1B8C A;  1MXE A;  1CDN A;  1Y1U A;  1SCM C;  1J7O A;  3AAK A;  4DIR A;  4F0Z B;  2PVB A;  1SCV A;  1MWN A;  2PRU A;  1VRK A;  2MRD A;  2JNX A;  3GOF A;  1BJF A;  1YRT B;  3O78 A;  1OZO A;  3MSE B;  4TNC A;  1M39 A;  1WLM A;  4NDB A;  3I5F B;  1SMG A;  4A4C A;  1TNX A;  3VRP A;  1TIZ A;  3I5G C;  1B8L A;  3E3R A;  3TUY C;  1IG5 A;  2LVK A;  4PCW A;  1BOD A;  2VRG A;  1F71 A;  1KK8 B;  1WRL A;  3FIA A;  2M97 A;  1DJG A;  4PE4 A;  1J7R A;  3CR4 X;  3EKH A;  1FI5 A;  3HCM A;  3HX4 A;  5ER4 X;  1XYD A;  5HKW A;  5DKN A;  1CDM A;  2JOJ A;  1Y6W A;  2MA2 A;  4OVN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...