1WLMA

Solution structure of mouse cgi-38 protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
151
structure length
151
Chain Sequence
GSSGSSGMAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein CGI-38
publication title Solution structure of mouse CGI-38 protein
rcsb
source organism Mus musculus
total genus 25
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2004-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wlmA01
1F55A 1XFZO 2Y5IA 3VRPA 3ICBA 1UHHA 1CFDA 3C1VA 3E3RA 4CFQA 2JZIA 2KAXA 1C7WA 3DD4A 3TUYC 1L7ZA 5HLVA 4DCKA 1DF0A 1WLZA 2I18A 2LHIA 2JNXA 4QJ4B 1AP4A 3DVKA 4DUQA 1OZOA 3AKAA 4YGCB 1DTLA 4AOMA 1OMVA 3CR4X 3WXAA 1V1GA 2LUCA 2SCPA 1A4PA 2BE4A 5I2LA 3SIAA 1LVCD 1L2OB 1JFJA 1CFFA 2K8MB 1WLMA 2KYFA 1S5GZ 2KI4B 1SYMA 4JPZB 3SG7A 1NUBA 1B8LA 2L0PA 3LCPC 5BPJA 1KQMC 2M3WA 5CSFA 1S26D 5I8NA 1BMOA 1OZSA 1YRUB 2AAOA 2EGDA 2M8UA 2LMTA 2HPSA 1DJZA 1A75A 3RM1A 3KHEA 3SIBA 1MWNA 2WCFA 2CXJA 1N0YA 2MBXA 4A4CA 1QJTA 1QX7A 1K9PA 1VRKA 2LANA 5B8IB 2ZNDA 5AERA 1NX1A 4YI8A 1UUSA 1ZMZA 2KNEA 1U5IA 3CR2A 1ZFSA 2KI6C 2M0RA 2BCXA 1TNPA 4YGEB 2DOQA 1K9KA 2H2KA 2NCPA 4NDBA 1CDNA 1WRLA 1L2OC 2R2IA 3PM8A 1KQVA 5JOLA 5J3XA 3CR5X 1TRFA 3D0YA 1QATA 2M7LA 2JXCA 3H4SE 3RLZA 1EG4A 3KO0A 5ER4X 3FWBA 1IWQA 4MSPA 2PRUA 3VRRA 3CWGA 2BKHB 1S6CA 1QTXA 4E68A 1XFVO 1G33A 5KTYA 1R2UA 2M1UA 2MAZA 5D69A 2Q4UA 1CNPA 1K9UA 1KWOB 1AJ5A 2V53A 1KSMA 4GBAA 3VRQA 1UWOA 2ZN8A 1XVJA 2ISDA 1DF0B 2LLUA 2GGZA 3TS5B 1CFPA 1MQ1A 1SCMB 2KFHA 4QJ5B 1CFCA 2KFFA 4N5XA 3M0WA 1FPWA 2AMIA 4U8DA 2JU0A 1DJHA 2E30A 3A4UB 3NSOA 2LLTA 4ZCUA 3VROA 2LE9B 3I5IB 1OE9B 2OS8C 3D10A 1NWDA 5FYXA 2BECA 1QIWA 1XFXO 1YX8A 2K7BA 2F8PA 2WC8A 2B1UA 3TUYB 2QPTA 1B4CA 1F4QA 5TNCA 3DF0A 4FTGA 1FBVA 1XA5A 1IG5A 4FQOA 5CSNA 3SG2A 4BY4A 2KGBC 1F70A 3BUXB 1DGVA 3CS1A 4OCIA 1FF1A 1LINA 4JQ0D 1TNWA 4MZLA 1MF8B 1SNLA 4OR9B 3EVUA 5I2QA 1NPQA 1BT6A 2MA2A 2O60A 4GNKB 3CGAA 3FS7A 4HRGA 2PALA 4MEWA 2KBIA 1A75B 4CPVA 1NCXA 4DRWA 4YGAA 4M2PA 1MUXA 1QVIZ 1YUTA 1HT9A 4PE7A 4C0LA 2FCEA 3K21A 2Y1MA 4MZKA 2F3YA 3SG6A 2PVBA 2CCMA 5D7FA 1IGVA 1XFYO 2E6WA 1J7OA 1U5IB 1SCMC 2KYCA 2LVJA 4TNCA 1K90D 1DJXA 2K7CA 1JC2A 5G08A 1EL4A 2BKIB 1OMDA 1JF0A 3JTDB 2TN4A 4OV2A 1Y1AA 3AAJA 4D1EA 1C7VA 1CLBA 5ER5A 3I5IC 5DKNA 1G4YR 1QV1A 1W7IB 2WCBA 2M9GA 1SL9A 4MRXA 3A8RA 1TNQA 1S1EA 2OTGC 2CNPA 3QRXA 1B7TY 1UURA 3FWCA 1XK4C 3IQQA 1AHRA 2BCBA 3IF7A 3D0YB 4GAOA 1ZACA 3CTNA 1ALVA 2AUCA 1J7RA 2K2FA 2F2PA 4PE0A 1TCOB 2IS9A 1D1OA 1QX5B 2CTNA 4I5NB 1OQPA 1KFXS 4YGDB 4ORCB 5HYDA 1CTRA 2FJUB 2L5XB 1CDLA 1Y1UA 5I2OA 3LLEA 1XK4A 3SG3A 1S36A 4PHNA 2COLB 2BCAA 4CLNA 1AK8A 2NZ0A 1CMFA 2MLEC 2A4JA 2JXLA 2M1KB 1EH2A 1M45A 4P2YB 2NLNA 4NDDA 2HQ8A 2ZKMX 3JTDC 2LMVA 3O4YA 5AFPA 3VRNA 4AQJA 4OVNF 2M97A 4NQGA 1CDPA 3DF0B 1SR6C 3LK0A 5DKQA 4MVFA 1OOJA 3LL8B 4PALA 1LXFC 1DT7B 2M49B 2BBNA 2OS8B 1WY9A 1BLQA 1KK7Y 1AUIB 1GGWA 3PATA 4ICBA 5HKZA 1UP5A 2GGMA 2WCEA 4UPGA 1K93D 1IJ6A 2FCDA 2EC6C 2JRFA 1JFKA 4GFTA 2L51A 5AEQA 3I5HC 4GGFA 1KK7Z 4PHMA 5CSJA 1YVHA 3I5FB 4USLA 2OPOA 1PK0D 1SK6D 1TTXA 1YR5A 1JBAA 2SASA 2LV7A 1YTZC 2ZN9A 1M39A 4XYNA 1KK8C 1LKJA 3OB2B 1BF5A 1UHNA 2I94A 1RWYA 2BBMA 1KFUS 1X02A 4ZCVA 1S6JA 1NIWA 2RGIA 4HSZA 1AVSA 5GQQC 5HKYA 2BL0C 4MZJA 2HF5A 4I5LB 4ORAB 5AANA 2MLFC 3TDZA 1QXPA 3I5GC 4R1EA 2Q91A 1B8RA 1YURA 1YUSA 1CM1A 2JT3A 2HQWA 3BYAA 3HX4A 1WDCB 1TOPA 4GPLB 2HETA 1EXRA 2KGRA 4ORBB 2LP3A 2JQ6A 4YI9A 2KQYA 1Y1XA 2L4HA 3OB1B 1S6IA 1PSBA 2I2RE 4F0ZB 2F2OA 4DS7A 2OTGB 3F45A 5PALA 2K7OA 1QX2A 2LVIA 1PALA 2NXQA 3WNXB 4NDCA 3OX6A 2NCOA 4XJKA 4ETOA 3NSLA 3BOWA 1KFXL 2FOTA 4N1GA 3I5FC 1K95A 1Y0VH 3O78A 1YUUA 5DKRA 1LA0A 1F8HA 1SY9A 5KSZA 2WORA 1CKKA 2LHLA 3BQ3A 1ZOTB 1N65A 1YRTB 1Y6WA 3BUMB 2D8NA 4C0KA 1EJ3A 1JUOA 1BOCA 3MSEB 1QLKA 3SJSA 1BR1B 1DJYA 2O5GA 1MHOA 2KI6D 4C0JA 1XO5A 2EHBA 3VGOA 1IH0A 1XYDA 1S3PA 2KAYA 4M2OA 1WDCC 1SCVA 2KAVA 1GJYA 4IL1A 1RK9A 1SL8A 2M7NA 1DJIA 1RECA 2WNDA 4MBEA 3DVJA 1YX7A 2BE6A 1WRZA 1QV0A 1SR6B 3EKJA 1PVBA 3BUNB 1IKUA 1J1EA 2JPTA 3PLFB 2MHHA 1JSAA 4JWQA 2KFGA 1OMRA 1JF2A 3SG5A 3PN7C 3SG4A 1NP8A 1NCYA 2JTZA 1B7TZ 1ZUZA 3AAKA 3JVTC 2EC6B 2LMUA 4L9MA 2PSRA 3I5HB 1MR8A 2CBLA 2F33A 3AKBA 1TCFA 3EK7A 3PALA 1BG1A 3CZTX 1UHIA 1Q80A 3ZWHA 3EKHA 1RJVA 2MRDA 2VRGA 2H61C 3O2PA 2M29A 4GUKA 2JC2A 1KK8B 4YGBB 5HKWA 1BODA 1K2HA 1S5GY 1KFUL 1NX2A 1H8BA 3TDIA 1PRWA 3IQOA 4PE1A 4PDZA 2BL0B 4HREE 4OKHA 1A2XA 3KF9A 1JWDA 5HLOA 3I5GB 2ZNEA 1LA3A 4XJKB 5CSIA 2ZRSA 2Y1NA 1QIVA 4GGFC 1XFWO 3BOWB 2H61A 3TZ1A 1RFJA 1RTP1 1TIZA 1NCZA 1NX0A 2LP2A 3DVMA 3WHTB 3GOFA 1DGUA 2G2BA 3PFVA 1CLMA 4PHKA 2LVVA 4MN0A 4MRYA 3GK4X 3TDUA 4PCWA 1GQMA 1PULA 1M63B 5F6TA 2GV5A 1BR4B 3WHUB 4M2QA 2WOSA 1CMGA 5JJGA 2JNFA 1EG3A 5KU1A 2JWWA 1CB1A 2G9BA 1QS7A 2KDHA 3KEVA 4YBHB 1FI6A 3LK1A 1OSAA 1K94A 1A03A 2JOJA 1DMOA 2LNKA 1DJWA 3OX5A 2KQ6A 1M31A 3BUOB 4CIDA 1F4OA 5AXIA 2K61A 1UHJA 2L50A 4Q04A 1NYAA 2CT9A 3KPXA 1XFUO 1W7JB 4MLWA 1A29A 1NX3A 2JT8A 1IQ3A 1B8CA 3GK1A 2KI4C 4PE4A 1MXEA 1MXLC 2KBMA 3ZNIA 3OHMB 1CDMA 2JTTA 3EVRA 2MJWB 1J7QA 1CM4A 1K96A 1YVLA 4GGNA 1WRKA 2K2AA 3EVVA 1IJ5A 1NSHA 2I7AA 2KSPA 2ZRTA 1V1FA 3EK4A 4DIRA 1B1GA 4I5KA 1SBJA 1F71A 2L4IA 2LCPA 4I5JA 2L98A 4QJ3B 2P6BB 3FIAA 1C07A 5IBWA 2LUXA 2KOTA 3PN7B 1SL7A 1J55A 1SW8A 1SPYA 2Y4QA 4YRUA 4BY5A 1RROA 1GGZA 3JVTB 1TN4A 1PSRA 1M46A 1CLLA 1ALWA 1E8AA 3NSKA 4WRIA 5CPVA 1FW4A 2L2EA 4CFRA 4HRHA 1DJGA 5K89A 3NXAA 1G8IA 1IQ5A 2K0JA 2KHNA 3GK2A 3OP0A 1BJFA 4WQ2A 4AQIA 1J1DA 1UHKA 2JT0A 3PSRA 2LLSA 1DVIA 1QASA 1SKTA 1QVIY 2JULA 3DVEA 3O6BA 3EK8A 4N1FA 1FI5A 4PHJA 3BUWB 3NSIA 2PMYA 2K7DA 1BU3A 1ODBA 1SRAA 3BXKA 2F3ZA 2PASA 1B9AA 1R6PA 4WQ3A 1KWOC 2LVKA 3CLNA 4A4BA 1IRJA 1K8UA 2ZFDA 1KSOA 2LC5A 3TS5C 1KCYA 1KQMB 2LAPA 2LM5A 1J7PA 1N2DA 4P5OE 1PVAA 1AJ4A 3HCMA 1SMGA 1QLSA 1HQVA 2QACA 1TNXA 1F54A 1H4BA 1B47A
chains in the Genus database with same CATH superfamily
1F55A 1XFZO 2Y5IA 3VRPA 3ICBA 1UHHA 1CFDA 3UO9A 3C1VA 3E3RA 4CFQA 3R1VA 2JZIA 2KAXA 2WCJA 1C7WA 3RZSA 3DD4A 3B88A 3IVTA 3TUYC 1L7ZA 4INWA 5HLVA 1DF0A 2WCKA 4DCKA 1WLZA 2I18A 2LHIA 2JNXA 5EL2A 4QJ4B 1AP4A 3DVKA 4DUQA 1OZOA 1P28A 3AKAA 4YGCB 1DTLA 4AOMA 1OMVA 3CR4X 3WXAA 1V1GA 2LUCA 2SCPA 3DXLA 1A4PA 2BE4A 5I2LA 3SIAA 1LVCD 1L2OB 1JFJA 2GTEA 1CFFA 2K8MB 1WLMA 2KYFA 1T14A 1XFRA 1S5GZ 2KI4B 1SYMA 4JPZB 3SG7A 1LS8A 1NUBA 1B8LA 2L0PA 3LCPC 5BPJA 1KQMC 2WC5A 2M3WA 5CSFA 1S26D 5I8NA 1BMOA 1OZSA 1YRUB 3S0EA 2AAOA 2EGDA 2M8UA 2LMTA 2HPSA 1DJZA 3NGVA 1A75A 3RM1A 3KHEA 3SIBA 1MWNA 3EG5B 2WCFA 2CXJA 1N0YA 2MBXA 4A4CA 3SS5A 1QJTA 1QX7A 1K9PA 1VRKA 4OZDA 2LANA 5B8IB 2ZNDA 5AERA 1NX1A 4YI8A 1UUSA 1ZMZA 2KNEA 1U5IA 3CR2A 2WCMA 1ZFSA 2KI6C 2M0RA 2BCXA 1TNPA 4YGEB 2DOQA 1K9KA 2H2KA 2NCPA 4NDBA 1CDNA 1WRLA 3CZ0A 1L2OC 2R2IA 3PM8A 1OOFA 3V2LA 1KQVA 5JOLA 5J3XA 3CR5X 4F7FA 1TRFA 3D0YA 1QATA 2M7LA 2JXCA 3H4SE 3RLZA 1EG4A 3KO0A 5ER4X 3FWBA 1IWQA 4MSPA 1C3ZA 3QMEA 2PRUA 3VRRA 3CWGA 2BKHB 1S6CA 1QTXA 4E68A 1XFVO 1G33A 5KTYA 1R2UA 2M1UA 2MAZA 5D69A 2Q4UA 3FE6A 1CNPA 1K9UA 1KWOB 1AJ5A 2V53A 1KSMA 4GBAA 4JKTA 1UWOA 2ZN8A 3VRQA 1XVJA 2ISDA 1DF0B 2LLUA 2GGZA 3TS5B 1CFPA 2QEOA 1MQ1A 1SCMB 2KFHA 4QJ5B 1CFCA 2KFFA 3PM2A 4PT1A 4N5XA 3M0WA 1FPWA 2AMIA 4U8DA 2JU0A 1DJHA 2E30A 3A4UB 3NSOA 2LLTA 4ZCUA 3VROA 2LE9B 3I5IB 1OE9B 2OS8C 3D10A 1NWDA 5FYXA 2BECA 2L5YA 1QIWA 1XFXO 3OBVA 1YX8A 1SSEB 2F8PA 2K7BA 2L2CA 2WC8A 1GM0A 2B1UA 3TUYB 2QPTA 1B4CA 1F4QA 4IJ7A 5TNCA 3DF0A 4FTGA 1FBVA 1XA5A 1IG5A 4FQOA 5CSNA 3SG2A 4BY4A 2KGBC 1F70A 3BUXB 1DGVA 3CS1A 4OCIA 1FF1A 1LINA 1OW4A 4JQ0D 1TNWA 4MZLA 1MF8B 1SNLA 4OR9B 3EVUA 5I2QA 1NPQA 1BT6A 2MA2A 2O60A 4GNKB 3CGAA 3FS7A 4HRGA 2PALA 4MEWA 2KBIA 1A75B 4CPVA 1NCXA 4DRWA 4YGAA 4M2PA 1MUXA 1QVIZ 1YUTA 1HT9A 4PE7A 4C0LA 2FCEA 3K21A 2Y1MA 4MZKA 2F3YA 3SG6A 2PVBA 2CCMA 5D7FA 1IGVA 1XFYO 2E6WA 1J7OA 1U5IB 1SCMC 2KYCA 2LVJA 4TNCA 1K90D 1DJXA 2K7CA 1QWVA 3B86A 3SS3A 5G08A 1JC2A 1EL4A 2BKIB 1OMDA 1JF0A 3JTDB 2TN4A 4OV2A 1Y1AA 3AAJA 4D1EA 3B7AA 1C7VA 1CLBA 3DY9A 5ER5A 3I5IC 5DKNA 1G4YR 1QV1A 1W7IB 2WCBA 2M9GA 1SL9A 4MRXA 2QEHA 1TNQA 1S1EA 3A8RA 2OTGC 2CNPA 3QRXA 1B7TY 1UURA 3FWCA 1XK4C 3IQQA 1AHRA 2BCBA 3IF7A 1DC1A 3D0YB 4GAOA 1ZACA 3CTNA 1ALVA 2AUCA 1J7RA 2K2FA 3R1PA 2F2PA 4PE0A 1TCOB 2IS9A 1D1OA 1QX5B 2CTNA 4I5NB 1OQPA 1KFXS 4YGDB 4ORCB 5HYDA 1CTRA 2JPOA 2FJUB 5DICA 2L5XB 1CDLA 1Y1UA 5I2OA 3LLEA 1XK4A 3D77A 3SG3A 1S36A 4PHNA 2COLB 5FI2A 2BCAA 4CLNA 1AK8A 2NZ0A 1CMFA 2MLEC 2A4JA 2JXLA 2M1KB 3DZTA 1EH2A 1M45A 3L47A 4P2YB 3R1OA 3CDNA 2NLNA 4NDDA 2HQ8A 2ZKMX 2ERBA 3JTDC 2LMVA 3NHIA 3O4YA 5AFPA 3VRNA 4AQJA 4OVNF 2M97A 4NQGA 1CDPA 3DF0B 1SR6C 3LK0A 5DKQA 4MVFA 1OOJA 3B87A 3LL8B 4PALA 1LXFC 1DT7B 2M49B 2BBNA 2OS8B 1WY9A 1BLQA 1KK7Y 1AUIB 1GGWA 3PATA 3R72A 4ICBA 1UP5A 5HKZA 2GGMA 2WCEA 4UPGA 1K93D 1IJ6A 2FCDA 2EC6C 2JRFA 1DQEA 1JFKA 4GFTA 2L51A 5AEQA 3I5HC 4GGFA 1KK7Z 4PHMA 2QEBA 5CSJA 1YVHA 3I5FB 4USLA 2OPOA 1PK0D 1SK6D 1TTXA 1YR5A 1Z4HA 1JBAA 2SASA 2LV7A 1YTZC 2ZN9A 2PQLA 1M39A 2WC6A 1KK8C 1LKJA 3CYZA 3OB2B 4XYNA 1BF5A 1UHNA 3L4AA 3N7HA 2I94A 1RWYA 2BBMA 3S0DA 2FJYA 1KFUS 1X02A 4ZCVA 1S6JA 1NIWA 2RGIA 4HSZA 1AVSA 5GQQC 5HKYA 2BL0C 4MZJA 2HF5A 4I5LB 4ORAB 5AANA 2MLFC 2P71A 1QXPA 3I5GC 4R1EA 3TDZA 2Q91A 1B8RA 1YURA 1YUSA 1CM1A 2JT3A 2HQWA 3BYAA 3HX4A 1WDCB 1TOPA 2H8VA 4GPLB 2HETA 1DEKA 1EXRA 2KGRA 4ORBB 2LP3A 4FQTA 2JQ6A 4YI9A 2KQYA 2QDIA 1Y1XA 2L4HA 3OB1B 1S6IA 1OOGA 1PSBA 2I2RE 4F0ZB 2F2OA 4DS7A 2OTGB 3F45A 5PALA 2K7OA 1QX2A 2LVIA 1PALA 2NXQA 3WNXB 4NDCA 3OX6A 2NCOA 4XJKA 4ETOA 3NSLA 3CZ1A 3BOWA 1KFXL 2FOTA 4N1GA 3I5FC 1K95A 1Y0VH 3O78A 1YUUA 5DKRA 3L4LA 1LA0A 1F8HA 1SY9A 5KSZA 2BAPA 2WORA 1CKKA 2LHLA 3BQ3A 1ZOTB 5I94A 1N65A 4INXA 1YRTB 1Y6WA 3UNWA 3BUMB 2D8NA 4C0KA 1EJ3A 1JUOA 1BOCA 3MSEB 1QLKA 3SJSA 3D73A 1BR1B 3D74A 1DJYA 3VB1A 2O5GA 1MHOA 2KI6D 3OGNA 1XO5A 4C0JA 2EHBA 3VGOA 1IH0A 1XYDA 1S3PA 2KAYA 4M2OA 1WDCC 1SCVA 2KAVA 1GJYA 4IL1A 1RK9A 1TUZA 1SL8A 2M7NA 1DJIA 1RECA 2WNDA 4MBEA 3DVJA 1YX7A 2BE6A 2WCHA 1W9ZA 1WRZA 1QV0A 1SR6B 3EKJA 1PVBA 3BUNB 1IKUA 1J1EA 2JPTA 3PLFB 2MHHA 1JSAA 4JWQA 2KFGA 4KYNA 1OMRA 1JF2A 3SG5A 3O4XA 3PN7C 3SG4A 1NP8A 3BFHA 1NCYA 2JTZA 1B7TZ 1ZUZA 3AAKA 3JVTC 2EC6B 2LMUA 4L9MA 2PSRA 3I5HB 1MR8A 2CBLA 2YGUA 2F33A 3AKBA 1TCFA 3EK7A 3S0BA 3PALA 1BG1A 3CZTX 2WCLA 3SS4A 1UHIA 1Q80A 3ZWHA 2KPHA 3EKHA 1RJVA 2MRDA 2VRGA 2H61C 3O2PA 2M29A 4GUKA 2JC2A 1KK8B 4YGBB 5HKWA 1BODA 1K2HA 1S5GY 1KFUL 1NX2A 1H8BA 3TDIA 1PRWA 3IQOA 4PE1A 4PDZA 2BL0B 5FI7A 4HREE 4OKHA 1A2XA 3KF9A 1JWDA 5HLOA 3I5GB 2ZNEA 1LA3A 3CZ2A 5HL1A 4XJKB 3K1EA 5CSIA 2ZRSA 2Y1NA 1QIVA 2BNXA 1XFWO 2P70A 2H61A 3BOWB 4GGFC 1RFJA 1RTP1 3TZ1A 1TIZA 4JD9A 1NCZA 3S0AA 1NX0A 2LP2A 3DVMA 3WHTB 3GOFA 1DGUA 2G2BA 3PFVA 1CLMA 4PHKA 2LVVA 4MN0A 4MRYA 3GK4X 3TDUA 4PCWA 1GQMA 1PULA 1M63B 5F6TA 3D76A 2GV5A 1OOIX 1BR4B 3WHUB 4M2QA 2WOSA 3Q8IA 1CMGA 5JJGA 2JNFA 1EG3A 5KU1A 2JWWA 3PJIA 1CB1A 2G9BA 1QS7A 2KDHA 1C3YA 3KEVA 4YBHB 1FI6A 3LK1A 5D3OA 1TWOA 1OSAA 1K94A 1A03A 2JOJA 1DMOA 2LNKA 1DELA 1DJWA 3OX5A 2KQ6A 1M31A 1IIOA 3BUOB 3BFAA 4CIDA 1F4OA 5AXIA 2K61A 1UHJA 2L50A 4Q04A 1NYAA 2CT9A 3KPXA 1XFUO 1W7JB 4MLWA 1A29A 3BFBA 1NX3A 2JT8A 1IQ3A 1B8CA 2KLDA 3GK1A 2KI4C 4PE4A 1MXEA 1MXLC 2KBMA 3ZNIA 1TUJA 1CDMA 2JTTA 3EVRA 3FE8A 3OHMB 2MJWB 1J7QA 1CM4A 1K96A 1YVLA 3BJHA 4GGNA 1WRKA 2K2AA 3EVVA 1IJ5A 1NSHA 2I7AA 2KSPA 2ZRTA 1V1FA 3EK4A 4DIRA 1B1GA 4I5KA 1SBJA 1F71A 2L4IA 2LCPA 4I5JA 2KLEA 2L98A 4QJ3B 2P6BB 3FIAA 1C07A 5IBWA 2LUXA 2KOTA 3PN7B 1SL7A 1J55A 1SW8A 2K60A 1SPYA 2Y4QA 4YRUA 4BY5A 1RROA 1GGZA 3JVTB 3NHTA 1TN4A 1PSRA 1M46A 1CLLA 3D78A 1ALWA 1E8AA 3NSKA 1OOHA 4WRIA 1FW4A 2L2EA 5CPVA 4CFRA 4HRHA 5FI6A 1DJGA 5K89A 3NXAA 1G8IA 1IQ5A 2K0JA 2KHNA 3FE9A 3GK2A 1BJFA 3OP0A 4WQ2A 3CABA 4AQIA 1J1DA 1UHKA 2JT0A 3PSRA 2LLSA 1DVIA 1QASA 1SKTA 1QVIY 2PYQA 2JULA 3DVEA 3O6BA 3EK8A 4N1FA 1FI5A 4PHJA 3BUWB 3NSIA 2PMYA 2K7DA 1BU3A 1ODBA 1SRAA 3BXKA 2F3ZA 3B6XA 2PASA 3S0GA 1B9AA 1R6PA 4WQ3A 1KWOC 2LVKA 3CLNA 3DYEA 4A4BA 1IRJA 3S0FA 1K8UA 2ZFDA 1KSOA 1ORGA 2LC5A 3TS5C 1KCYA 1KQMB 2LAPA 2LM5A 1J7PA 3D75A 1N2DA 4P5OE 1PVAA 2QEVA 1AJ4A 3HCMA 1SMGA 1QLSA 1Z2CB 1HQVA 2QACA 1TNXA 1F54A 1H4BA 1B47A
chains in the Genus database with same CATH topology
1F55A 1XFZO 2Y5IA 3VRPA 3ICBA 1UHHA 1CFDA 3C1VA 3E3RA 4CFQA 2JZIA 2KAXA 1C7WA 3DD4A 3TUYC 1L7ZA 5HLVA 4DCKA 1DF0A 1WLZA 2I18A 2LHIA 2JNXA 4QJ4B 1AP4A 3DVKA 4DUQA 1OZOA 3AKAA 4YGCB 1DTLA 4AOMA 1OMVA 3CR4X 3WXAA 1V1GA 2LUCA 2SCPA 1A4PA 2BE4A 5I2LA 3SIAA 1LVCD 1L2OB 1JFJA 1CFFA 2K8MB 1WLMA 2KYFA 1S5GZ 2KI4B 1SYMA 4JPZB 3SG7A 1NUBA 1B8LA 2L0PA 3LCPC 5BPJA 1KQMC 2M3WA 5CSFA 1S26D 5I8NA 1BMOA 1OZSA 1YRUB 2AAOA 2EGDA 2M8UA 2LMTA 2HPSA 1DJZA 1A75A 3RM1A 3KHEA 3SIBA 1MWNA 2WCFA 2CXJA 1N0YA 2MBXA 4A4CA 1QJTA 1QX7A 1K9PA 1VRKA 2LANA 5B8IB 2ZNDA 5AERA 1NX1A 4YI8A 1UUSA 1ZMZA 2KNEA 1U5IA 3CR2A 1ZFSA 2KI6C 2M0RA 2BCXA 1TNPA 4YGEB 2DOQA 1K9KA 2H2KA 2NCPA 4NDBA 1CDNA 1WRLA 1L2OC 2R2IA 3PM8A 1KQVA 5JOLA 5J3XA 3CR5X 1TRFA 3D0YA 1QATA 2M7LA 2JXCA 3H4SE 3RLZA 1EG4A 3KO0A 5ER4X 3FWBA 1IWQA 4MSPA 2PRUA 3VRRA 3CWGA 2BKHB 1S6CA 1QTXA 4E68A 1XFVO 1G33A 5KTYA 1R2UA 2M1UA 2MAZA 5D69A 2Q4UA 1CNPA 1K9UA 1KWOB 1AJ5A 2V53A 1KSMA 4GBAA 3VRQA 1UWOA 2ZN8A 1XVJA 2ISDA 1DF0B 2LLUA 2GGZA 3TS5B 1CFPA 1MQ1A 1SCMB 2KFHA 4QJ5B 1CFCA 2KFFA 4N5XA 3M0WA 1FPWA 2AMIA 4U8DA 2JU0A 1DJHA 2E30A 3A4UB 3NSOA 2LLTA 4ZCUA 3VROA 2LE9B 3I5IB 1OE9B 2OS8C 3D10A 1NWDA 5FYXA 2BECA 1QIWA 1XFXO 1YX8A 2K7BA 2F8PA 2WC8A 2B1UA 3TUYB 2QPTA 1B4CA 1F4QA 5TNCA 3DF0A 4FTGA 1FBVA 1XA5A 1IG5A 4FQOA 5CSNA 3SG2A 4BY4A 2KGBC 1F70A 3BUXB 1DGVA 3CS1A 4OCIA 1FF1A 1LINA 4JQ0D 1TNWA 4MZLA 1MF8B 1SNLA 4OR9B 3EVUA 5I2QA 1NPQA 1BT6A 2MA2A 2O60A 4GNKB 3CGAA 3FS7A 4HRGA 2PALA 4MEWA 2KBIA 1A75B 4CPVA 1NCXA 4DRWA 4YGAA 4M2PA 1MUXA 1QVIZ 1YUTA 1HT9A 4PE7A 4C0LA 2FCEA 3K21A 2Y1MA 4MZKA 2F3YA 3SG6A 2PVBA 2CCMA 5D7FA 1IGVA 1XFYO 2E6WA 1J7OA 1U5IB 1SCMC 2KYCA 2LVJA 4TNCA 1K90D 1DJXA 2K7CA 1JC2A 5G08A 1EL4A 2BKIB 1OMDA 1JF0A 3JTDB 2TN4A 4OV2A 1Y1AA 3AAJA 4D1EA 1C7VA 1CLBA 5ER5A 3I5IC 5DKNA 1G4YR 1QV1A 1W7IB 2WCBA 2M9GA 1SL9A 4MRXA 3A8RA 1TNQA 1S1EA 2OTGC 2CNPA 3QRXA 1B7TY 1UURA 3FWCA 1XK4C 3IQQA 1AHRA 2BCBA 3IF7A 3D0YB 4GAOA 1ZACA 3CTNA 1ALVA 2AUCA 1J7RA 2K2FA 2F2PA 4PE0A 1TCOB 2IS9A 1D1OA 1QX5B 2CTNA 4I5NB 1OQPA 1KFXS 4YGDB 4ORCB 5HYDA 1CTRA 2FJUB 2L5XB 1CDLA 1Y1UA 5I2OA 3LLEA 1XK4A 3SG3A 1S36A 4PHNA 2COLB 2BCAA 4CLNA 1AK8A 2NZ0A 1CMFA 2MLEC 2A4JA 2JXLA 2M1KB 1EH2A 1M45A 4P2YB 2NLNA 4NDDA 2HQ8A 2ZKMX 3JTDC 2LMVA 3O4YA 5AFPA 3VRNA 4AQJA 4OVNF 2M97A 4NQGA 1CDPA 3DF0B 1SR6C 3LK0A 5DKQA 4MVFA 1OOJA 3LL8B 4PALA 1LXFC 1DT7B 2M49B 2BBNA 2OS8B 1WY9A 1BLQA 1KK7Y 1AUIB 1GGWA 3PATA 4ICBA 5HKZA 1UP5A 2GGMA 2WCEA 4UPGA 1K93D 1IJ6A 2FCDA 2EC6C 2JRFA 1JFKA 4GFTA 2L51A 5AEQA 3I5HC 4GGFA 1KK7Z 4PHMA 5CSJA 1YVHA 3I5FB 4USLA 2OPOA 1PK0D 1SK6D 1TTXA 1YR5A 1JBAA 2SASA 2LV7A 1YTZC 2ZN9A 1M39A 4XYNA 1KK8C 1LKJA 3OB2B 1BF5A 1UHNA 2I94A 1RWYA 2BBMA 1KFUS 1X02A 4ZCVA 1S6JA 1NIWA 2RGIA 4HSZA 1AVSA 5GQQC 5HKYA 2BL0C 4MZJA 2HF5A 4I5LB 4ORAB 5AANA 2MLFC 3TDZA 1QXPA 3I5GC 4R1EA 2Q91A 1B8RA 1YURA 1YUSA 1CM1A 2JT3A 2HQWA 3BYAA 3HX4A 1WDCB 1TOPA 4GPLB 2HETA 1EXRA 2KGRA 4ORBB 2LP3A 2JQ6A 4YI9A 2KQYA 1Y1XA 2L4HA 3OB1B 1S6IA 1PSBA 2I2RE 4F0ZB 2F2OA 4DS7A 2OTGB 3F45A 5PALA 2K7OA 1QX2A 2LVIA 1PALA 2NXQA 3WNXB 4NDCA 3OX6A 2NCOA 4XJKA 4ETOA 3NSLA 3BOWA 1KFXL 2FOTA 4N1GA 3I5FC 1K95A 1Y0VH 3O78A 1YUUA 5DKRA 1LA0A 1F8HA 1SY9A 5KSZA 2WORA 1CKKA 2LHLA 3BQ3A 1ZOTB 1N65A 1YRTB 1Y6WA 3BUMB 2D8NA 4C0KA 1EJ3A 1JUOA 1BOCA 3MSEB 1QLKA 3SJSA 1BR1B 1DJYA 2O5GA 1MHOA 2KI6D 4C0JA 1XO5A 2EHBA 3VGOA 1IH0A 1XYDA 1S3PA 2KAYA 4M2OA 1WDCC 1SCVA 2KAVA 1GJYA 4IL1A 1RK9A 1SL8A 2M7NA 1DJIA 1RECA 2WNDA 4MBEA 3DVJA 1YX7A 2BE6A 1WRZA 1QV0A 1SR6B 3EKJA 1PVBA 3BUNB 1IKUA 1J1EA 2JPTA 3PLFB 2MHHA 1JSAA 4JWQA 2KFGA 1OMRA 1JF2A 3SG5A 3PN7C 3SG4A 1NP8A 1NCYA 2JTZA 1B7TZ 1ZUZA 3AAKA 3JVTC 2EC6B 2LMUA 4L9MA 2PSRA 3I5HB 1MR8A 2CBLA 2F33A 3AKBA 1TCFA 3EK7A 3PALA 1BG1A 3CZTX 1UHIA 1Q80A 3ZWHA 3EKHA 1RJVA 2MRDA 2VRGA 2H61C 3O2PA 2M29A 4GUKA 2JC2A 1KK8B 4YGBB 5HKWA 1BODA 1K2HA 1S5GY 1KFUL 1NX2A 1H8BA 3TDIA 1PRWA 3IQOA 4PE1A 4PDZA 2BL0B 4HREE 4OKHA 1A2XA 3KF9A 1JWDA 5HLOA 3I5GB 2ZNEA 1LA3A 4XJKB 5CSIA 2ZRSA 2Y1NA 1QIVA 4GGFC 1XFWO 3BOWB 2H61A 3TZ1A 1RFJA 1RTP1 1TIZA 1NCZA 1NX0A 2LP2A 3DVMA 3WHTB 3GOFA 1DGUA 2G2BA 3PFVA 1CLMA 4PHKA 2LVVA 4MN0A 4MRYA 3GK4X 3TDUA 4PCWA 1GQMA 1PULA 1M63B 5F6TA 2GV5A 1BR4B 3WHUB 4M2QA 2WOSA 1CMGA 5JJGA 2JNFA 1EG3A 5KU1A 2JWWA 1CB1A 2G9BA 1QS7A 2KDHA 3KEVA 4YBHB 1FI6A 3LK1A 1OSAA 1K94A 1A03A 2JOJA 1DMOA 2LNKA 1DJWA 3OX5A 2KQ6A 1M31A 3BUOB 4CIDA 1F4OA 5AXIA 2K61A 1UHJA 2L50A 4Q04A 1NYAA 2CT9A 3KPXA 1XFUO 1W7JB 4MLWA 1A29A 1NX3A 2JT8A 1IQ3A 1B8CA 3GK1A 2KI4C 4PE4A 1MXEA 1MXLC 2KBMA 3ZNIA 3OHMB 1CDMA 2JTTA 3EVRA 2MJWB 1J7QA 1CM4A 1K96A 1YVLA 4GGNA 1WRKA 2K2AA 3EVVA 1IJ5A 1NSHA 2I7AA 2KSPA 2ZRTA 1V1FA 3EK4A 4DIRA 1B1GA 4I5KA 1SBJA 1F71A 2L4IA 2LCPA 4I5JA 2L98A 4QJ3B 2P6BB 3FIAA 1C07A 5IBWA 2LUXA 2KOTA 3PN7B 1SL7A 1J55A 1SW8A 1SPYA 2Y4QA 4YRUA 4BY5A 1RROA 1GGZA 3JVTB 1TN4A 1PSRA 1M46A 1CLLA 1ALWA 1E8AA 3NSKA 4WRIA 5CPVA 1FW4A 2L2EA 4CFRA 4HRHA 1DJGA 5K89A 3NXAA 1G8IA 1IQ5A 2K0JA 2KHNA 3GK2A 3OP0A 1BJFA 4WQ2A 4AQIA 1J1DA 1UHKA 2JT0A 3PSRA 2LLSA 1DVIA 1QASA 1SKTA 1QVIY 2JULA 3DVEA 3O6BA 3EK8A 4N1FA 1FI5A 4PHJA 3BUWB 3NSIA 2PMYA 2K7DA 1BU3A 1ODBA 1SRAA 3BXKA 2F3ZA 2PASA 1B9AA 1R6PA 4WQ3A 1KWOC 2LVKA 3CLNA 4A4BA 1IRJA 1K8UA 2ZFDA 1KSOA 2LC5A 3TS5C 1KCYA 1KQMB 2LAPA 2LM5A 1J7PA 1N2DA 4P5OE 1PVAA 1AJ4A 3HCMA 1SMGA 1QLSA 1HQVA 2QACA 1TNXA 1F54A 1H4BA 1B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F55 A;  1XFZ O;  2Y5I A;  3VRP A;  3ICB A;  1UHH A;  1CFD A;  3C1V A;  3E3R A;  4CFQ A;  2JZI A;  2KAX A;  1C7W A;  3DD4 A;  3TUY C;  1L7Z A;  5HLV A;  4DCK A;  1DF0 A;  1WLZ A;  2I18 A;  2LHI A;  2JNX A;  4QJ4 B;  1AP4 A;  3DVK A;  4DUQ A;  1OZO A;  3AKA A;  4YGC B;  1DTL A;  4AOM A;  1OMV A;  3CR4 X;  3WXA A;  1V1G A;  2LUC A;  2SCP A;  1A4P A;  2BE4 A;  5I2L A;  3SIA A;  1LVC D;  1L2O B;  1JFJ A;  1CFF A;  2K8M B;  1WLM A;  2KYF A;  1S5G Z;  2KI4 B;  1SYM A;  4JPZ B;  3SG7 A;  1NUB A;  1B8L A;  2L0P A;  3LCP C;  5BPJ A;  1KQM C;  2M3W A;  5CSF A;  1S26 D;  5I8N A;  1BMO A;  1OZS A;  1YRU B;  2AAO A;  2EGD A;  2M8U A;  2LMT A;  2HPS A;  1DJZ A;  1A75 A;  3RM1 A;  3KHE A;  3SIB A;  1MWN A;  2WCF A;  2CXJ A;  1N0Y A;  2MBX A;  4A4C A;  1QJT A;  1QX7 A;  1K9P A;  1VRK A;  2LAN A;  5B8I B;  2ZND A;  5AER A;  1NX1 A;  4YI8 A;  1UUS A;  1ZMZ A;  2KNE A;  1U5I A;  3CR2 A;  1ZFS A;  2KI6 C;  2M0R A;  2BCX A;  1TNP A;  4YGE B;  2DOQ A;  1K9K A;  2H2K A;  2NCP A;  4NDB A;  1CDN A;  1WRL A;  1L2O C;  2R2I A;  3PM8 A;  1KQV A;  5JOL A;  5J3X A;  3CR5 X;  1TRF A;  3D0Y A;  1QAT A;  2M7L A;  2JXC A;  3H4S E;  3RLZ A;  1EG4 A;  3KO0 A;  5ER4 X;  3FWB A;  1IWQ A;  4MSP A;  2PRU A;  3VRR A;  3CWG A;  2BKH B;  1S6C A;  1QTX A;  4E68 A;  1XFV O;  1G33 A;  5KTY A;  1R2U A;  2M1U A;  2MAZ A;  5D69 A;  2Q4U A;  1CNP A;  1K9U A;  1KWO B;  1AJ5 A;  2V53 A;  1KSM A;  4GBA A;  3VRQ A;  1UWO A;  2ZN8 A;  1XVJ A;  2ISD A;  1DF0 B;  2LLU A;  2GGZ A;  3TS5 B;  1CFP A;  1MQ1 A;  1SCM B;  2KFH A;  4QJ5 B;  1CFC A;  2KFF A;  4N5X A;  3M0W A;  1FPW A;  2AMI A;  4U8D A;  2JU0 A;  1DJH A;  2E30 A;  3A4U B;  3NSO A;  2LLT A;  4ZCU A;  3VRO A;  2LE9 B;  3I5I B;  1OE9 B;  2OS8 C;  3D10 A;  1NWD A;  5FYX A;  2BEC A;  1QIW A;  1XFX O;  1YX8 A;  2K7B A;  2F8P A;  2WC8 A;  2B1U A;  3TUY B;  2QPT A;  1B4C A;  1F4Q A;  5TNC A;  3DF0 A;  4FTG A;  1FBV A;  1XA5 A;  1IG5 A;  4FQO A;  5CSN A;  3SG2 A;  4BY4 A;  2KGB C;  1F70 A;  3BUX B;  1DGV A;  3CS1 A;  4OCI A;  1FF1 A;  1LIN A;  4JQ0 D;  1TNW A;  4MZL A;  1MF8 B;  1SNL A;  4OR9 B;  3EVU A;  5I2Q A;  1NPQ A;  1BT6 A;  2MA2 A;  2O60 A;  4GNK B;  3CGA A;  3FS7 A;  4HRG A;  2PAL A;  4MEW A;  2KBI A;  1A75 B;  4CPV A;  1NCX A;  4DRW A;  4YGA A;  4M2P A;  1MUX A;  1QVI Z;  1YUT A;  1HT9 A;  4PE7 A;  4C0L A;  2FCE A;  3K21 A;  2Y1M A;  4MZK A;  2F3Y A;  3SG6 A;  2PVB A;  2CCM A;  5D7F A;  1IGV A;  1XFY O;  2E6W A;  1J7O A;  1U5I B;  1SCM C;  2KYC A;  2LVJ A;  4TNC A;  1K90 D;  1DJX A;  2K7C A;  1JC2 A;  5G08 A;  1EL4 A;  2BKI B;  1OMD A;  1JF0 A;  3JTD B;  2TN4 A;  4OV2 A;  1Y1A A;  3AAJ A;  4D1E A;  1C7V A;  1CLB A;  5ER5 A;  3I5I C;  5DKN A;  1G4Y R;  1QV1 A;  1W7I B;  2WCB A;  2M9G A;  1SL9 A;  4MRX A;  3A8R A;  1TNQ A;  1S1E A;  2OTG C;  2CNP A;  3QRX A;  1B7T Y;  1UUR A;  3FWC A;  1XK4 C;  3IQQ A;  1AHR A;  2BCB A;  3IF7 A;  3D0Y B;  4GAO A;  1ZAC A;  3CTN A;  1ALV A;  2AUC A;  1J7R A;  2K2F A;  2F2P A;  4PE0 A;  1TCO B;  2IS9 A;  1D1O A;  1QX5 B;  2CTN A;  4I5N B;  1OQP A;  1KFX S;  4YGD B;  4ORC B;  5HYD A;  1CTR A;  2FJU B;  2L5X B;  1CDL A;  1Y1U A;  5I2O A;  3LLE A;  1XK4 A;  3SG3 A;  1S36 A;  4PHN A;  2COL B;  2BCA A;  4CLN A;  1AK8 A;  2NZ0 A;  1CMF A;  2MLE C;  2A4J A;  2JXL A;  2M1K B;  1EH2 A;  1M45 A;  4P2Y B;  2NLN A;  4NDD A;  2HQ8 A;  2ZKM X;  3JTD C;  2LMV A;  3O4Y A;  5AFP A;  3VRN A;  4AQJ A;  4OVN F;  2M97 A;  4NQG A;  1CDP A;  3DF0 B;  1SR6 C;  3LK0 A;  5DKQ A;  4MVF A;  1OOJ A;  3LL8 B;  4PAL A;  1LXF C;  1DT7 B;  2M49 B;  2BBN A;  2OS8 B;  1WY9 A;  1BLQ A;  1KK7 Y;  1AUI B;  1GGW A;  3PAT A;  4ICB A;  5HKZ A;  1UP5 A;  2GGM A;  2WCE A;  4UPG A;  1K93 D;  1IJ6 A;  2FCD A;  2EC6 C;  2JRF A;  1JFK A;  4GFT A;  2L51 A;  5AEQ A;  3I5H C;  4GGF A;  1KK7 Z;  4PHM A;  5CSJ A;  1YVH A;  3I5F B;  4USL A;  2OPO A;  1PK0 D;  1SK6 D;  1TTX A;  1YR5 A;  1JBA A;  2SAS A;  2LV7 A;  1YTZ C;  2ZN9 A;  1M39 A;  4XYN A;  1KK8 C;  1LKJ A;  3OB2 B;  1BF5 A;  1UHN A;  2I94 A;  1RWY A;  2BBM A;  1KFU S;  1X02 A;  4ZCV A;  1S6J A;  1NIW A;  2RGI A;  4HSZ A;  1AVS A;  5GQQ C;  5HKY A;  2BL0 C;  4MZJ A;  2HF5 A;  4I5L B;  4ORA B;  5AAN A;  2MLF C;  3TDZ A;  1QXP A;  3I5G C;  4R1E A;  2Q91 A;  1B8R A;  1YUR A;  1YUS A;  1CM1 A;  2JT3 A;  2HQW A;  3BYA A;  3HX4 A;  1WDC B;  1TOP A;  4GPL B;  2HET A;  1EXR A;  2KGR A;  4ORB B;  2LP3 A;  2JQ6 A;  4YI9 A;  2KQY A;  1Y1X A;  2L4H A;  3OB1 B;  1S6I A;  1PSB A;  2I2R E;  4F0Z B;  2F2O A;  4DS7 A;  2OTG B;  3F45 A;  5PAL A;  2K7O A;  1QX2 A;  2LVI A;  1PAL A;  2NXQ A;  3WNX B;  4NDC A;  3OX6 A;  2NCO A;  4XJK A;  4ETO A;  3NSL A;  3BOW A;  1KFX L;  2FOT A;  4N1G A;  3I5F C;  1K95 A;  1Y0V H;  3O78 A;  1YUU A;  5DKR A;  1LA0 A;  1F8H A;  1SY9 A;  5KSZ A;  2WOR A;  1CKK A;  2LHL A;  3BQ3 A;  1ZOT B;  1N65 A;  1YRT B;  1Y6W A;  3BUM B;  2D8N A;  4C0K A;  1EJ3 A;  1JUO A;  1BOC A;  3MSE B;  1QLK A;  3SJS A;  1BR1 B;  1DJY A;  2O5G A;  1MHO A;  2KI6 D;  4C0J A;  1XO5 A;  2EHB A;  3VGO A;  1IH0 A;  1XYD A;  1S3P A;  2KAY A;  4M2O A;  1WDC C;  1SCV A;  2KAV A;  1GJY A;  4IL1 A;  1RK9 A;  1SL8 A;  2M7N A;  1DJI A;  1REC A;  2WND A;  4MBE A;  3DVJ A;  1YX7 A;  2BE6 A;  1WRZ A;  1QV0 A;  1SR6 B;  3EKJ A;  1PVB A;  3BUN B;  1IKU A;  1J1E A;  2JPT A;  3PLF B;  2MHH A;  1JSA A;  4JWQ A;  2KFG A;  1OMR A;  1JF2 A;  3SG5 A;  3PN7 C;  3SG4 A;  1NP8 A;  1NCY A;  2JTZ A;  1B7T Z;  1ZUZ A;  3AAK A;  3JVT C;  2EC6 B;  2LMU A;  4L9M A;  2PSR A;  3I5H B;  1MR8 A;  2CBL A;  2F33 A;  3AKB A;  1TCF A;  3EK7 A;  3PAL A;  1BG1 A;  3CZT X;  1UHI A;  1Q80 A;  3ZWH A;  3EKH A;  1RJV A;  2MRD A;  2VRG A;  2H61 C;  3O2P A;  2M29 A;  4GUK A;  2JC2 A;  1KK8 B;  4YGB B;  5HKW A;  1BOD A;  1K2H A;  1S5G Y;  1KFU L;  1NX2 A;  1H8B A;  3TDI A;  1PRW A;  3IQO A;  4PE1 A;  4PDZ A;  2BL0 B;  4HRE E;  4OKH A;  1A2X A;  3KF9 A;  1JWD A;  5HLO A;  3I5G B;  2ZNE A;  1LA3 A;  4XJK B;  5CSI A;  2ZRS A;  2Y1N A;  1QIV A;  4GGF C;  1XFW O;  3BOW B;  2H61 A;  3TZ1 A;  1RFJ A;  1RTP 1;  1TIZ A;  1NCZ A;  1NX0 A;  2LP2 A;  3DVM A;  3WHT B;  3GOF A;  1DGU A;  2G2B A;  3PFV A;  1CLM A;  4PHK A;  2LVV A;  4MN0 A;  4MRY A;  3GK4 X;  3TDU A;  4PCW A;  1GQM A;  1PUL A;  1M63 B;  5F6T A;  2GV5 A;  1BR4 B;  3WHU B;  4M2Q A;  2WOS A;  1CMG A;  5JJG A;  2JNF A;  1EG3 A;  5KU1 A;  2JWW A;  1CB1 A;  2G9B A;  1QS7 A;  2KDH A;  3KEV A;  4YBH B;  1FI6 A;  3LK1 A;  1OSA A;  1K94 A;  1A03 A;  2JOJ A;  1DMO A;  2LNK A;  1DJW A;  3OX5 A;  2KQ6 A;  1M31 A;  3BUO B;  4CID A;  1F4O A;  5AXI A;  2K61 A;  1UHJ A;  2L50 A;  4Q04 A;  1NYA A;  2CT9 A;  3KPX A;  1XFU O;  1W7J B;  4MLW A;  1A29 A;  1NX3 A;  2JT8 A;  1IQ3 A;  1B8C A;  3GK1 A;  2KI4 C;  4PE4 A;  1MXE A;  1MXL C;  2KBM A;  3ZNI A;  3OHM B;  1CDM A;  2JTT A;  3EVR A;  2MJW B;  1J7Q A;  1CM4 A;  1K96 A;  1YVL A;  4GGN A;  1WRK A;  2K2A A;  3EVV A;  1IJ5 A;  1NSH A;  2I7A A;  2KSP A;  2ZRT A;  1V1F A;  3EK4 A;  4DIR A;  1B1G A;  4I5K A;  1SBJ A;  1F71 A;  2L4I A;  2LCP A;  4I5J A;  2L98 A;  4QJ3 B;  2P6B B;  3FIA A;  1C07 A;  5IBW A;  2LUX A;  2KOT A;  3PN7 B;  1SL7 A;  1J55 A;  1SW8 A;  1SPY A;  2Y4Q A;  4YRU A;  4BY5 A;  1RRO A;  1GGZ A;  3JVT B;  1TN4 A;  1PSR A;  1M46 A;  1CLL A;  1ALW A;  1E8A A;  3NSK A;  4WRI A;  5CPV A;  1FW4 A;  2L2E A;  4CFR A;  4HRH A;  1DJG A;  5K89 A;  3NXA A;  1G8I A;  1IQ5 A;  2K0J A;  2KHN A;  3GK2 A;  3OP0 A;  1BJF A;  4WQ2 A;  4AQI A;  1J1D A;  1UHK A;  2JT0 A;  3PSR A;  2LLS A;  1DVI A;  1QAS A;  1SKT A;  1QVI Y;  2JUL A;  3DVE A;  3O6B A;  3EK8 A;  4N1F A;  1FI5 A;  4PHJ A;  3BUW B;  3NSI A;  2PMY A;  2K7D A;  1BU3 A;  1ODB A;  1SRA A;  3BXK A;  2F3Z A;  2PAS A;  1B9A A;  1R6P A;  4WQ3 A;  1KWO C;  2LVK A;  3CLN A;  4A4B A;  1IRJ A;  1K8U A;  2ZFD A;  1KSO A;  2LC5 A;  3TS5 C;  1KCY A;  1KQM B;  2LAP A;  2LM5 A;  1J7P A;  1N2D A;  4P5O E;  1PVA A;  1AJ4 A;  3HCM A;  1SMG A;  1QLS A;  1HQV A;  2QAC A;  1TNX A;  1F54 A;  1H4B A;  1B47 A; 
#chains in the Genus database with same CATH topology
 1F55 A;  1XFZ O;  2Y5I A;  3VRP A;  3ICB A;  1UHH A;  1CFD A;  3UO9 A;  3C1V A;  3E3R A;  4CFQ A;  3R1V A;  2JZI A;  2KAX A;  2WCJ A;  1C7W A;  3RZS A;  3DD4 A;  3B88 A;  3IVT A;  3TUY C;  1L7Z A;  4INW A;  5HLV A;  1DF0 A;  2WCK A;  4DCK A;  1WLZ A;  2I18 A;  2LHI A;  2JNX A;  5EL2 A;  4QJ4 B;  1AP4 A;  3DVK A;  4DUQ A;  1OZO A;  1P28 A;  3AKA A;  4YGC B;  1DTL A;  4AOM A;  1OMV A;  3CR4 X;  3WXA A;  1V1G A;  2LUC A;  2SCP A;  3DXL A;  1A4P A;  2BE4 A;  5I2L A;  3SIA A;  1LVC D;  1L2O B;  1JFJ A;  2GTE A;  1CFF A;  2K8M B;  1WLM A;  2KYF A;  1T14 A;  1XFR A;  1S5G Z;  2KI4 B;  1SYM A;  4JPZ B;  3SG7 A;  1LS8 A;  1NUB A;  1B8L A;  2L0P A;  3LCP C;  5BPJ A;  1KQM C;  2WC5 A;  2M3W A;  5CSF A;  1S26 D;  5I8N A;  1BMO A;  1OZS A;  1YRU B;  3S0E A;  2AAO A;  2EGD A;  2M8U A;  2LMT A;  2HPS A;  1DJZ A;  3NGV A;  1A75 A;  3RM1 A;  3KHE A;  3SIB A;  1MWN A;  3EG5 B;  2WCF A;  2CXJ A;  1N0Y A;  2MBX A;  4A4C A;  3SS5 A;  1QJT A;  1QX7 A;  1K9P A;  1VRK A;  4OZD A;  2LAN A;  5B8I B;  2ZND A;  5AER A;  1NX1 A;  4YI8 A;  1UUS A;  1ZMZ A;  2KNE A;  1U5I A;  3CR2 A;  2WCM A;  1ZFS A;  2KI6 C;  2M0R A;  2BCX A;  1TNP A;  4YGE B;  2DOQ A;  1K9K A;  2H2K A;  2NCP A;  4NDB A;  1CDN A;  1WRL A;  3CZ0 A;  1L2O C;  2R2I A;  3PM8 A;  1OOF A;  3V2L A;  1KQV A;  5JOL A;  5J3X A;  3CR5 X;  4F7F A;  1TRF A;  3D0Y A;  1QAT A;  2M7L A;  2JXC A;  3H4S E;  3RLZ A;  1EG4 A;  3KO0 A;  5ER4 X;  3FWB A;  1IWQ A;  4MSP A;  1C3Z A;  3QME A;  2PRU A;  3VRR A;  3CWG A;  2BKH B;  1S6C A;  1QTX A;  4E68 A;  1XFV O;  1G33 A;  5KTY A;  1R2U A;  2M1U A;  2MAZ A;  5D69 A;  2Q4U A;  3FE6 A;  1CNP A;  1K9U A;  1KWO B;  1AJ5 A;  2V53 A;  1KSM A;  4GBA A;  4JKT A;  1UWO A;  2ZN8 A;  3VRQ A;  1XVJ A;  2ISD A;  1DF0 B;  2LLU A;  2GGZ A;  3TS5 B;  1CFP A;  2QEO A;  1MQ1 A;  1SCM B;  2KFH A;  4QJ5 B;  1CFC A;  2KFF A;  3PM2 A;  4PT1 A;  4N5X A;  3M0W A;  1FPW A;  2AMI A;  4U8D A;  2JU0 A;  1DJH A;  2E30 A;  3A4U B;  3NSO A;  2LLT A;  4ZCU A;  3VRO A;  2LE9 B;  3I5I B;  1OE9 B;  2OS8 C;  3D10 A;  1NWD A;  5FYX A;  2BEC A;  2L5Y A;  1QIW A;  1XFX O;  3OBV A;  1YX8 A;  1SSE B;  2F8P A;  2K7B A;  2L2C A;  2WC8 A;  1GM0 A;  2B1U A;  3TUY B;  2QPT A;  1B4C A;  1F4Q A;  4IJ7 A;  5TNC A;  3DF0 A;  4FTG A;  1FBV A;  1XA5 A;  1IG5 A;  4FQO A;  5CSN A;  3SG2 A;  4BY4 A;  2KGB C;  1F70 A;  3BUX B;  1DGV A;  3CS1 A;  4OCI A;  1FF1 A;  1LIN A;  1OW4 A;  4JQ0 D;  1TNW A;  4MZL A;  1MF8 B;  1SNL A;  4OR9 B;  3EVU A;  5I2Q A;  1NPQ A;  1BT6 A;  2MA2 A;  2O60 A;  4GNK B;  3CGA A;  3FS7 A;  4HRG A;  2PAL A;  4MEW A;  2KBI A;  1A75 B;  4CPV A;  1NCX A;  4DRW A;  4YGA A;  4M2P A;  1MUX A;  1QVI Z;  1YUT A;  1HT9 A;  4PE7 A;  4C0L A;  2FCE A;  3K21 A;  2Y1M A;  4MZK A;  2F3Y A;  3SG6 A;  2PVB A;  2CCM A;  5D7F A;  1IGV A;  1XFY O;  2E6W A;  1J7O A;  1U5I B;  1SCM C;  2KYC A;  2LVJ A;  4TNC A;  1K90 D;  1DJX A;  2K7C A;  1QWV A;  3B86 A;  3SS3 A;  5G08 A;  1JC2 A;  1EL4 A;  2BKI B;  1OMD A;  1JF0 A;  3JTD B;  2TN4 A;  4OV2 A;  1Y1A A;  3AAJ A;  4D1E A;  3B7A A;  1C7V A;  1CLB A;  3DY9 A;  5ER5 A;  3I5I C;  5DKN A;  1G4Y R;  1QV1 A;  1W7I B;  2WCB A;  2M9G A;  1SL9 A;  4MRX A;  2QEH A;  1TNQ A;  1S1E A;  3A8R A;  2OTG C;  2CNP A;  3QRX A;  1B7T Y;  1UUR A;  3FWC A;  1XK4 C;  3IQQ A;  1AHR A;  2BCB A;  3IF7 A;  1DC1 A;  3D0Y B;  4GAO A;  1ZAC A;  3CTN A;  1ALV A;  2AUC A;  1J7R A;  2K2F A;  3R1P A;  2F2P A;  4PE0 A;  1TCO B;  2IS9 A;  1D1O A;  1QX5 B;  2CTN A;  4I5N B;  1OQP A;  1KFX S;  4YGD B;  4ORC B;  5HYD A;  1CTR A;  2JPO A;  2FJU B;  5DIC A;  2L5X B;  1CDL A;  1Y1U A;  5I2O A;  3LLE A;  1XK4 A;  3D77 A;  3SG3 A;  1S36 A;  4PHN A;  2COL B;  5FI2 A;  2BCA A;  4CLN A;  1AK8 A;  2NZ0 A;  1CMF A;  2MLE C;  2A4J A;  2JXL A;  2M1K B;  3DZT A;  1EH2 A;  1M45 A;  3L47 A;  4P2Y B;  3R1O A;  3CDN A;  2NLN A;  4NDD A;  2HQ8 A;  2ZKM X;  2ERB A;  3JTD C;  2LMV A;  3NHI A;  3O4Y A;  5AFP A;  3VRN A;  4AQJ A;  4OVN F;  2M97 A;  4NQG A;  1CDP A;  3DF0 B;  1SR6 C;  3LK0 A;  5DKQ A;  4MVF A;  1OOJ A;  3B87 A;  3LL8 B;  4PAL A;  1LXF C;  1DT7 B;  2M49 B;  2BBN A;  2OS8 B;  1WY9 A;  1BLQ A;  1KK7 Y;  1AUI B;  1GGW A;  3PAT A;  3R72 A;  4ICB A;  1UP5 A;  5HKZ A;  2GGM A;  2WCE A;  4UPG A;  1K93 D;  1IJ6 A;  2FCD A;  2EC6 C;  2JRF A;  1DQE A;  1JFK A;  4GFT A;  2L51 A;  5AEQ A;  3I5H C;  4GGF A;  1KK7 Z;  4PHM A;  2QEB A;  5CSJ A;  1YVH A;  3I5F B;  4USL A;  2OPO A;  1PK0 D;  1SK6 D;  1TTX A;  1YR5 A;  1Z4H A;  1JBA A;  2SAS A;  2LV7 A;  1YTZ C;  2ZN9 A;  2PQL A;  1M39 A;  2WC6 A;  1KK8 C;  1LKJ A;  3CYZ A;  3OB2 B;  4XYN A;  1BF5 A;  1UHN A;  3L4A A;  3N7H A;  2I94 A;  1RWY A;  2BBM A;  3S0D A;  2FJY A;  1KFU S;  1X02 A;  4ZCV A;  1S6J A;  1NIW A;  2RGI A;  4HSZ A;  1AVS A;  5GQQ C;  5HKY A;  2BL0 C;  4MZJ A;  2HF5 A;  4I5L B;  4ORA B;  5AAN A;  2MLF C;  2P71 A;  1QXP A;  3I5G C;  4R1E A;  3TDZ A;  2Q91 A;  1B8R A;  1YUR A;  1YUS A;  1CM1 A;  2JT3 A;  2HQW A;  3BYA A;  3HX4 A;  1WDC B;  1TOP A;  2H8V A;  4GPL B;  2HET A;  1DEK A;  1EXR A;  2KGR A;  4ORB B;  2LP3 A;  4FQT A;  2JQ6 A;  4YI9 A;  2KQY A;  2QDI A;  1Y1X A;  2L4H A;  3OB1 B;  1S6I A;  1OOG A;  1PSB A;  2I2R E;  4F0Z B;  2F2O A;  4DS7 A;  2OTG B;  3F45 A;  5PAL A;  2K7O A;  1QX2 A;  2LVI A;  1PAL A;  2NXQ A;  3WNX B;  4NDC A;  3OX6 A;  2NCO A;  4XJK A;  4ETO A;  3NSL A;  3CZ1 A;  3BOW A;  1KFX L;  2FOT A;  4N1G A;  3I5F C;  1K95 A;  1Y0V H;  3O78 A;  1YUU A;  5DKR A;  3L4L A;  1LA0 A;  1F8H A;  1SY9 A;  5KSZ A;  2BAP A;  2WOR A;  1CKK A;  2LHL A;  3BQ3 A;  1ZOT B;  5I94 A;  1N65 A;  4INX A;  1YRT B;  1Y6W A;  3UNW A;  3BUM B;  2D8N A;  4C0K A;  1EJ3 A;  1JUO A;  1BOC A;  3MSE B;  1QLK A;  3SJS A;  3D73 A;  1BR1 B;  3D74 A;  1DJY A;  3VB1 A;  2O5G A;  1MHO A;  2KI6 D;  3OGN A;  1XO5 A;  4C0J A;  2EHB A;  3VGO A;  1IH0 A;  1XYD A;  1S3P A;  2KAY A;  4M2O A;  1WDC C;  1SCV A;  2KAV A;  1GJY A;  4IL1 A;  1RK9 A;  1TUZ A;  1SL8 A;  2M7N A;  1DJI A;  1REC A;  2WND A;  4MBE A;  3DVJ A;  1YX7 A;  2BE6 A;  2WCH A;  1W9Z A;  1WRZ A;  1QV0 A;  1SR6 B;  3EKJ A;  1PVB A;  3BUN B;  1IKU A;  1J1E A;  2JPT A;  3PLF B;  2MHH A;  1JSA A;  4JWQ A;  2KFG A;  4KYN A;  1OMR A;  1JF2 A;  3SG5 A;  3O4X A;  3PN7 C;  3SG4 A;  1NP8 A;  3BFH A;  1NCY A;  2JTZ A;  1B7T Z;  1ZUZ A;  3AAK A;  3JVT C;  2EC6 B;  2LMU A;  4L9M A;  2PSR A;  3I5H B;  1MR8 A;  2CBL A;  2YGU A;  2F33 A;  3AKB A;  1TCF A;  3EK7 A;  3S0B A;  3PAL A;  1BG1 A;  3CZT X;  2WCL A;  3SS4 A;  1UHI A;  1Q80 A;  3ZWH A;  2KPH A;  3EKH A;  1RJV A;  2MRD A;  2VRG A;  2H61 C;  3O2P A;  2M29 A;  4GUK A;  2JC2 A;  1KK8 B;  4YGB B;  5HKW A;  1BOD A;  1K2H A;  1S5G Y;  1KFU L;  1NX2 A;  1H8B A;  3TDI A;  1PRW A;  3IQO A;  4PE1 A;  4PDZ A;  2BL0 B;  5FI7 A;  4HRE E;  4OKH A;  1A2X A;  3KF9 A;  1JWD A;  5HLO A;  3I5G B;  2ZNE A;  1LA3 A;  3CZ2 A;  5HL1 A;  4XJK B;  3K1E A;  5CSI A;  2ZRS A;  2Y1N A;  1QIV A;  2BNX A;  1XFW O;  2P70 A;  2H61 A;  3BOW B;  4GGF C;  1RFJ A;  1RTP 1;  3TZ1 A;  1TIZ A;  4JD9 A;  1NCZ A;  3S0A A;  1NX0 A;  2LP2 A;  3DVM A;  3WHT B;  3GOF A;  1DGU A;  2G2B A;  3PFV A;  1CLM A;  4PHK A;  2LVV A;  4MN0 A;  4MRY A;  3GK4 X;  3TDU A;  4PCW A;  1GQM A;  1PUL A;  1M63 B;  5F6T A;  3D76 A;  2GV5 A;  1OOI X;  1BR4 B;  3WHU B;  4M2Q A;  2WOS A;  3Q8I A;  1CMG A;  5JJG A;  2JNF A;  1EG3 A;  5KU1 A;  2JWW A;  3PJI A;  1CB1 A;  2G9B A;  1QS7 A;  2KDH A;  1C3Y A;  3KEV A;  4YBH B;  1FI6 A;  3LK1 A;  5D3O A;  1TWO A;  1OSA A;  1K94 A;  1A03 A;  2JOJ A;  1DMO A;  2LNK A;  1DEL A;  1DJW A;  3OX5 A;  2KQ6 A;  1M31 A;  1IIO A;  3BUO B;  3BFA A;  4CID A;  1F4O A;  5AXI A;  2K61 A;  1UHJ A;  2L50 A;  4Q04 A;  1NYA A;  2CT9 A;  3KPX A;  1XFU O;  1W7J B;  4MLW A;  1A29 A;  3BFB A;  1NX3 A;  2JT8 A;  1IQ3 A;  1B8C A;  2KLD A;  3GK1 A;  2KI4 C;  4PE4 A;  1MXE A;  1MXL C;  2KBM A;  3ZNI A;  1TUJ A;  1CDM A;  2JTT A;  3EVR A;  3FE8 A;  3OHM B;  2MJW B;  1J7Q A;  1CM4 A;  1K96 A;  1YVL A;  3BJH A;  4GGN A;  1WRK A;  2K2A A;  3EVV A;  1IJ5 A;  1NSH A;  2I7A A;  2KSP A;  2ZRT A;  1V1F A;  3EK4 A;  4DIR A;  1B1G A;  4I5K A;  1SBJ A;  1F71 A;  2L4I A;  2LCP A;  4I5J A;  2KLE A;  2L98 A;  4QJ3 B;  2P6B B;  3FIA A;  1C07 A;  5IBW A;  2LUX A;  2KOT A;  3PN7 B;  1SL7 A;  1J55 A;  1SW8 A;  2K60 A;  1SPY A;  2Y4Q A;  4YRU A;  4BY5 A;  1RRO A;  1GGZ A;  3JVT B;  3NHT A;  1TN4 A;  1PSR A;  1M46 A;  1CLL A;  3D78 A;  1ALW A;  1E8A A;  3NSK A;  1OOH A;  4WRI A;  1FW4 A;  2L2E A;  5CPV A;  4CFR A;  4HRH A;  5FI6 A;  1DJG A;  5K89 A;  3NXA A;  1G8I A;  1IQ5 A;  2K0J A;  2KHN A;  3FE9 A;  3GK2 A;  1BJF A;  3OP0 A;  4WQ2 A;  3CAB A;  4AQI A;  1J1D A;  1UHK A;  2JT0 A;  3PSR A;  2LLS A;  1DVI A;  1QAS A;  1SKT A;  1QVI Y;  2PYQ A;  2JUL A;  3DVE A;  3O6B A;  3EK8 A;  4N1F A;  1FI5 A;  4PHJ A;  3BUW B;  3NSI A;  2PMY A;  2K7D A;  1BU3 A;  1ODB A;  1SRA A;  3BXK A;  2F3Z A;  3B6X A;  2PAS A;  3S0G A;  1B9A A;  1R6P A;  4WQ3 A;  1KWO C;  2LVK A;  3CLN A;  3DYE A;  4A4B A;  1IRJ A;  3S0F A;  1K8U A;  2ZFD A;  1KSO A;  1ORG A;  2LC5 A;  3TS5 C;  1KCY A;  1KQM B;  2LAP A;  2LM5 A;  1J7P A;  3D75 A;  1N2D A;  4P5O E;  1PVA A;  2QEV A;  1AJ4 A;  3HCM A;  1SMG A;  1QLS A;  1Z2C B;  1HQV A;  2QAC A;  1TNX A;  1F54 A;  1H4B A;  1B47 A; 
#chains in the Genus database with same CATH homology
 1F55 A;  1XFZ O;  2Y5I A;  3VRP A;  3ICB A;  1UHH A;  1CFD A;  3C1V A;  3E3R A;  4CFQ A;  2JZI A;  2KAX A;  1C7W A;  3DD4 A;  3TUY C;  1L7Z A;  5HLV A;  4DCK A;  1DF0 A;  1WLZ A;  2I18 A;  2LHI A;  2JNX A;  4QJ4 B;  1AP4 A;  3DVK A;  4DUQ A;  1OZO A;  3AKA A;  4YGC B;  1DTL A;  4AOM A;  1OMV A;  3CR4 X;  3WXA A;  1V1G A;  2LUC A;  2SCP A;  1A4P A;  2BE4 A;  5I2L A;  3SIA A;  1LVC D;  1L2O B;  1JFJ A;  1CFF A;  2K8M B;  1WLM A;  2KYF A;  1S5G Z;  2KI4 B;  1SYM A;  4JPZ B;  3SG7 A;  1NUB A;  1B8L A;  2L0P A;  3LCP C;  5BPJ A;  1KQM C;  2M3W A;  5CSF A;  1S26 D;  5I8N A;  1BMO A;  1OZS A;  1YRU B;  2AAO A;  2EGD A;  2M8U A;  2LMT A;  2HPS A;  1DJZ A;  1A75 A;  3RM1 A;  3KHE A;  3SIB A;  1MWN A;  2WCF A;  2CXJ A;  1N0Y A;  2MBX A;  4A4C A;  1QJT A;  1QX7 A;  1K9P A;  1VRK A;  2LAN A;  5B8I B;  2ZND A;  5AER A;  1NX1 A;  4YI8 A;  1UUS A;  1ZMZ A;  2KNE A;  1U5I A;  3CR2 A;  1ZFS A;  2KI6 C;  2M0R A;  2BCX A;  1TNP A;  4YGE B;  2DOQ A;  1K9K A;  2H2K A;  2NCP A;  4NDB A;  1CDN A;  1WRL A;  1L2O C;  2R2I A;  3PM8 A;  1KQV A;  5JOL A;  5J3X A;  3CR5 X;  1TRF A;  3D0Y A;  1QAT A;  2M7L A;  2JXC A;  3H4S E;  3RLZ A;  1EG4 A;  3KO0 A;  5ER4 X;  3FWB A;  1IWQ A;  4MSP A;  2PRU A;  3VRR A;  3CWG A;  2BKH B;  1S6C A;  1QTX A;  4E68 A;  1XFV O;  1G33 A;  5KTY A;  1R2U A;  2M1U A;  2MAZ A;  5D69 A;  2Q4U A;  1CNP A;  1K9U A;  1KWO B;  1AJ5 A;  2V53 A;  1KSM A;  4GBA A;  3VRQ A;  1UWO A;  2ZN8 A;  1XVJ A;  2ISD A;  1DF0 B;  2LLU A;  2GGZ A;  3TS5 B;  1CFP A;  1MQ1 A;  1SCM B;  2KFH A;  4QJ5 B;  1CFC A;  2KFF A;  4N5X A;  3M0W A;  1FPW A;  2AMI A;  4U8D A;  2JU0 A;  1DJH A;  2E30 A;  3A4U B;  3NSO A;  2LLT A;  4ZCU A;  3VRO A;  2LE9 B;  3I5I B;  1OE9 B;  2OS8 C;  3D10 A;  1NWD A;  5FYX A;  2BEC A;  1QIW A;  1XFX O;  1YX8 A;  2K7B A;  2F8P A;  2WC8 A;  2B1U A;  3TUY B;  2QPT A;  1B4C A;  1F4Q A;  5TNC A;  3DF0 A;  4FTG A;  1FBV A;  1XA5 A;  1IG5 A;  4FQO A;  5CSN A;  3SG2 A;  4BY4 A;  2KGB C;  1F70 A;  3BUX B;  1DGV A;  3CS1 A;  4OCI A;  1FF1 A;  1LIN A;  4JQ0 D;  1TNW A;  4MZL A;  1MF8 B;  1SNL A;  4OR9 B;  3EVU A;  5I2Q A;  1NPQ A;  1BT6 A;  2MA2 A;  2O60 A;  4GNK B;  3CGA A;  3FS7 A;  4HRG A;  2PAL A;  4MEW A;  2KBI A;  1A75 B;  4CPV A;  1NCX A;  4DRW A;  4YGA A;  4M2P A;  1MUX A;  1QVI Z;  1YUT A;  1HT9 A;  4PE7 A;  4C0L A;  2FCE A;  3K21 A;  2Y1M A;  4MZK A;  2F3Y A;  3SG6 A;  2PVB A;  2CCM A;  5D7F A;  1IGV A;  1XFY O;  2E6W A;  1J7O A;  1U5I B;  1SCM C;  2KYC A;  2LVJ A;  4TNC A;  1K90 D;  1DJX A;  2K7C A;  1JC2 A;  5G08 A;  1EL4 A;  2BKI B;  1OMD A;  1JF0 A;  3JTD B;  2TN4 A;  4OV2 A;  1Y1A A;  3AAJ A;  4D1E A;  1C7V A;  1CLB A;  5ER5 A;  3I5I C;  5DKN A;  1G4Y R;  1QV1 A;  1W7I B;  2WCB A;  2M9G A;  1SL9 A;  4MRX A;  3A8R A;  1TNQ A;  1S1E A;  2OTG C;  2CNP A;  3QRX A;  1B7T Y;  1UUR A;  3FWC A;  1XK4 C;  3IQQ A;  1AHR A;  2BCB A;  3IF7 A;  3D0Y B;  4GAO A;  1ZAC A;  3CTN A;  1ALV A;  2AUC A;  1J7R A;  2K2F A;  2F2P A;  4PE0 A;  1TCO B;  2IS9 A;  1D1O A;  1QX5 B;  2CTN A;  4I5N B;  1OQP A;  1KFX S;  4YGD B;  4ORC B;  5HYD A;  1CTR A;  2FJU B;  2L5X B;  1CDL A;  1Y1U A;  5I2O A;  3LLE A;  1XK4 A;  3SG3 A;  1S36 A;  4PHN A;  2COL B;  2BCA A;  4CLN A;  1AK8 A;  2NZ0 A;  1CMF A;  2MLE C;  2A4J A;  2JXL A;  2M1K B;  1EH2 A;  1M45 A;  4P2Y B;  2NLN A;  4NDD A;  2HQ8 A;  2ZKM X;  3JTD C;  2LMV A;  3O4Y A;  5AFP A;  3VRN A;  4AQJ A;  4OVN F;  2M97 A;  4NQG A;  1CDP A;  3DF0 B;  1SR6 C;  3LK0 A;  5DKQ A;  4MVF A;  1OOJ A;  3LL8 B;  4PAL A;  1LXF C;  1DT7 B;  2M49 B;  2BBN A;  2OS8 B;  1WY9 A;  1BLQ A;  1KK7 Y;  1AUI B;  1GGW A;  3PAT A;  4ICB A;  5HKZ A;  1UP5 A;  2GGM A;  2WCE A;  4UPG A;  1K93 D;  1IJ6 A;  2FCD A;  2EC6 C;  2JRF A;  1JFK A;  4GFT A;  2L51 A;  5AEQ A;  3I5H C;  4GGF A;  1KK7 Z;  4PHM A;  5CSJ A;  1YVH A;  3I5F B;  4USL A;  2OPO A;  1PK0 D;  1SK6 D;  1TTX A;  1YR5 A;  1JBA A;  2SAS A;  2LV7 A;  1YTZ C;  2ZN9 A;  1M39 A;  4XYN A;  1KK8 C;  1LKJ A;  3OB2 B;  1BF5 A;  1UHN A;  2I94 A;  1RWY A;  2BBM A;  1KFU S;  1X02 A;  4ZCV A;  1S6J A;  1NIW A;  2RGI A;  4HSZ A;  1AVS A;  5GQQ C;  5HKY A;  2BL0 C;  4MZJ A;  2HF5 A;  4I5L B;  4ORA B;  5AAN A;  2MLF C;  3TDZ A;  1QXP A;  3I5G C;  4R1E A;  2Q91 A;  1B8R A;  1YUR A;  1YUS A;  1CM1 A;  2JT3 A;  2HQW A;  3BYA A;  3HX4 A;  1WDC B;  1TOP A;  4GPL B;  2HET A;  1EXR A;  2KGR A;  4ORB B;  2LP3 A;  2JQ6 A;  4YI9 A;  2KQY A;  1Y1X A;  2L4H A;  3OB1 B;  1S6I A;  1PSB A;  2I2R E;  4F0Z B;  2F2O A;  4DS7 A;  2OTG B;  3F45 A;  5PAL A;  2K7O A;  1QX2 A;  2LVI A;  1PAL A;  2NXQ A;  3WNX B;  4NDC A;  3OX6 A;  2NCO A;  4XJK A;  4ETO A;  3NSL A;  3BOW A;  1KFX L;  2FOT A;  4N1G A;  3I5F C;  1K95 A;  1Y0V H;  3O78 A;  1YUU A;  5DKR A;  1LA0 A;  1F8H A;  1SY9 A;  5KSZ A;  2WOR A;  1CKK A;  2LHL A;  3BQ3 A;  1ZOT B;  1N65 A;  1YRT B;  1Y6W A;  3BUM B;  2D8N A;  4C0K A;  1EJ3 A;  1JUO A;  1BOC A;  3MSE B;  1QLK A;  3SJS A;  1BR1 B;  1DJY A;  2O5G A;  1MHO A;  2KI6 D;  4C0J A;  1XO5 A;  2EHB A;  3VGO A;  1IH0 A;  1XYD A;  1S3P A;  2KAY A;  4M2O A;  1WDC C;  1SCV A;  2KAV A;  1GJY A;  4IL1 A;  1RK9 A;  1SL8 A;  2M7N A;  1DJI A;  1REC A;  2WND A;  4MBE A;  3DVJ A;  1YX7 A;  2BE6 A;  1WRZ A;  1QV0 A;  1SR6 B;  3EKJ A;  1PVB A;  3BUN B;  1IKU A;  1J1E A;  2JPT A;  3PLF B;  2MHH A;  1JSA A;  4JWQ A;  2KFG A;  1OMR A;  1JF2 A;  3SG5 A;  3PN7 C;  3SG4 A;  1NP8 A;  1NCY A;  2JTZ A;  1B7T Z;  1ZUZ A;  3AAK A;  3JVT C;  2EC6 B;  2LMU A;  4L9M A;  2PSR A;  3I5H B;  1MR8 A;  2CBL A;  2F33 A;  3AKB A;  1TCF A;  3EK7 A;  3PAL A;  1BG1 A;  3CZT X;  1UHI A;  1Q80 A;  3ZWH A;  3EKH A;  1RJV A;  2MRD A;  2VRG A;  2H61 C;  3O2P A;  2M29 A;  4GUK A;  2JC2 A;  1KK8 B;  4YGB B;  5HKW A;  1BOD A;  1K2H A;  1S5G Y;  1KFU L;  1NX2 A;  1H8B A;  3TDI A;  1PRW A;  3IQO A;  4PE1 A;  4PDZ A;  2BL0 B;  4HRE E;  4OKH A;  1A2X A;  3KF9 A;  1JWD A;  5HLO A;  3I5G B;  2ZNE A;  1LA3 A;  4XJK B;  5CSI A;  2ZRS A;  2Y1N A;  1QIV A;  4GGF C;  1XFW O;  3BOW B;  2H61 A;  3TZ1 A;  1RFJ A;  1RTP 1;  1TIZ A;  1NCZ A;  1NX0 A;  2LP2 A;  3DVM A;  3WHT B;  3GOF A;  1DGU A;  2G2B A;  3PFV A;  1CLM A;  4PHK A;  2LVV A;  4MN0 A;  4MRY A;  3GK4 X;  3TDU A;  4PCW A;  1GQM A;  1PUL A;  1M63 B;  5F6T A;  2GV5 A;  1BR4 B;  3WHU B;  4M2Q A;  2WOS A;  1CMG A;  5JJG A;  2JNF A;  1EG3 A;  5KU1 A;  2JWW A;  1CB1 A;  2G9B A;  1QS7 A;  2KDH A;  3KEV A;  4YBH B;  1FI6 A;  3LK1 A;  1OSA A;  1K94 A;  1A03 A;  2JOJ A;  1DMO A;  2LNK A;  1DJW A;  3OX5 A;  2KQ6 A;  1M31 A;  3BUO B;  4CID A;  1F4O A;  5AXI A;  2K61 A;  1UHJ A;  2L50 A;  4Q04 A;  1NYA A;  2CT9 A;  3KPX A;  1XFU O;  1W7J B;  4MLW A;  1A29 A;  1NX3 A;  2JT8 A;  1IQ3 A;  1B8C A;  3GK1 A;  2KI4 C;  4PE4 A;  1MXE A;  1MXL C;  2KBM A;  3ZNI A;  3OHM B;  1CDM A;  2JTT A;  3EVR A;  2MJW B;  1J7Q A;  1CM4 A;  1K96 A;  1YVL A;  4GGN A;  1WRK A;  2K2A A;  3EVV A;  1IJ5 A;  1NSH A;  2I7A A;  2KSP A;  2ZRT A;  1V1F A;  3EK4 A;  4DIR A;  1B1G A;  4I5K A;  1SBJ A;  1F71 A;  2L4I A;  2LCP A;  4I5J A;  2L98 A;  4QJ3 B;  2P6B B;  3FIA A;  1C07 A;  5IBW A;  2LUX A;  2KOT A;  3PN7 B;  1SL7 A;  1J55 A;  1SW8 A;  1SPY A;  2Y4Q A;  4YRU A;  4BY5 A;  1RRO A;  1GGZ A;  3JVT B;  1TN4 A;  1PSR A;  1M46 A;  1CLL A;  1ALW A;  1E8A A;  3NSK A;  4WRI A;  5CPV A;  1FW4 A;  2L2E A;  4CFR A;  4HRH A;  1DJG A;  5K89 A;  3NXA A;  1G8I A;  1IQ5 A;  2K0J A;  2KHN A;  3GK2 A;  3OP0 A;  1BJF A;  4WQ2 A;  4AQI A;  1J1D A;  1UHK A;  2JT0 A;  3PSR A;  2LLS A;  1DVI A;  1QAS A;  1SKT A;  1QVI Y;  2JUL A;  3DVE A;  3O6B A;  3EK8 A;  4N1F A;  1FI5 A;  4PHJ A;  3BUW B;  3NSI A;  2PMY A;  2K7D A;  1BU3 A;  1ODB A;  1SRA A;  3BXK A;  2F3Z A;  2PAS A;  1B9A A;  1R6P A;  4WQ3 A;  1KWO C;  2LVK A;  3CLN A;  4A4B A;  1IRJ A;  1K8U A;  2ZFD A;  1KSO A;  2LC5 A;  3TS5 C;  1KCY A;  1KQM B;  2LAP A;  2LM5 A;  1J7P A;  1N2D A;  4P5O E;  1PVA A;  1AJ4 A;  3HCM A;  1SMG A;  1QLS A;  1HQV A;  2QAC A;  1TNX A;  1F54 A;  1H4B A;  1B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...