2QEOA

Crystal structure of anopheles gambiae d7r4-norepinephrine complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
144
structure length
144
Chain Sequence
ETVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
molecule keywords D7R4 Protein
total genus 58
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qeoA00
2KPHA 3BFHA 3CZ0A 2ERBA 5DICA 2QDIA 3L47A 3CABA 3D78A 1OOHA 3S0GA 1OW4A 3B87A 3L4AA 4OZDA 3OGNA 4FQTA 1DQEA 3S0DA 3BJHA 3FE9A 2WCHA 3RZSA 2PQLA 3VB1A 3BFBA 3CYZA 3Q8IA 3NHIA 1GM0A 3DXLA 3QMEA 3D75A 3R1PA 1XFRA 3R72A 2QEVA 3NHTA 4JD9A 2L2CA 3R1VA 3BFAA 3K1EA 3FE6A 2P71A 4INXA 3DYEA 4INWA 2QEHA 5EL2A 3DZTA 3D76A 3B7AA 2GTEA 2WCKA 1C3ZA 3D74A 2WC5A 2WCLA 1C3YA 2WCMA 3DY9A 4F7FA 3R1OA 3S0AA 1LS8A 3S0BA 3V2LA 3D77A 3B6XA 3D73A 2QEBA 4PT1A 3NGVA 3B88A 3N7HA 3B86A 2WC6A 2H8VA 2P70A 1OOGA 3S0FA 2QEOA 1ORGA 3CDNA 3FE8A 1QWVA 3L4LA 1OOIX 3CZ1A 2JPOA 3PJIA 1TWOA 1P28A 2WCJA 3CZ2A 2FJYA 1T14A 1TUJA 3S0EA 1OOFA
chains in the Genus database with same CATH superfamily
4BY5A 3NSOA 5TNCA 1N65A 3BXKA 2M97A 1B1GA 4PDZA 4JWQA 5DICA 1QIWA 2WCBA 4MSPA 2KHNA 2JRFA 3WXAA 2BKIB 2JOJA 1MQ1A 2LC5A 1M31A 5HL1A 3TUYC 1V1GA 2LP3A 4OZDA 1QX5B 1E8AA 4DUQA 1MWNA 1XK4C 2JT0A 2PVBA 5AEQA 1CFPA 3BJHA 2NXQA 2WCHA 2PMYA 3RZSA 2ZFDA 1GQMA 2PQLA 3VB1A 3VGOA 1JFKA 3EKJA 2H61C 2ZKMX 2SASA 1GM0A 4MBEA 1WY9A 2FJUB 3TDZA 3NSIA 1S5GY 1A4PA 1K9KA 1R6PA 2KGRA 4PHKA 2KBIA 4DS7A 4E68A 3QMEA 1XFRA 2M1KB 3DD4A 3DF0B 4DRWA 4QJ5B 1EG4A 2TN4A 1WRLA 2KFGA 1AP4A 1JWDA 1A75B 4YGBB 2MAZA 1SL7A 3PN7B 1YUUA 1YVLA 2ZRTA 4A4CA 3FE6A 1C7VA 4I5KA 1UUSA 2HF5A 1QLKA 2L5XB 5HYDA 3OHMB 1CMGA 3DVJA 3FWBA 5HKWA 1DJXA 2LVJA 3EK4A 5CSFA 5EL2A 3DZTA 5FI6A 2JULA 3D76A 2Q91A 4MZKA 3AKBA 4OR9B 1L2OC 1CKKA 1NCXA 1S3PA 5B8IB 3PFVA 2JTZA 5GQQC 1BR4B 1J1DA 2R2IA 3GK4X 4CLNA 1CDMA 1TNWA 4YGDB 1B7TY 2I94A 2WCMA 2K7DA 3QRXA 3ZWHA 1CFCA 2LAPA 1NIWA 2M3WA 2EHBA 3R1OA 2WNDA 2FCDA 2PASA 1MF8B 2LMTA 3V2LA 4YRUA 1K93D 1UHNA 1DJZA 3DVEA 3D73A 1S5GZ 3O2PA 2MBXA 1GJYA 2LCPA 1TCOB 2JNFA 2SCPA 4OCIA 5DKNA 1L7ZA 2BNXA 3SG4A 4XJKA 4YGAA 1Y6WA 4DCKA 3KO0A 3N7HA 3D10A 3B86A 2ZN8A 2WC6A 3GK1A 2P70A 3AAKA 2JZIA 4CFRA 1KWOB 2L0PA 2LHLA 5KSZA 3VRRA 3NSLA 2BE6A 3TS5B 3I5FC 1Q80A 1S6JA 1W7IB 2JC2A 4P5OE 2CNPA 3CDNA 1N2DA 3BUOB 1MHOA 2AMIA 2JWWA 4PE4A 1WRKA 3SG2A 1QS7A 1QLSA 3L4LA 2O5GA 5J3XA 4C0KA 3IF7A 2F8PA 4D1EA 1SBJA 2KDHA 2EGDA 1X02A 3LK1A 1K94A 1SCMB 2KGBC 3PJIA 1OE9B 2WCJA 3SS5A 1T14A 2LLSA 4L9MA 3OB1B 3VRQA 3S0EA 2KLEA 1NX0A 2F2OA 3BUNB 2OPOA 1C07A 1MR8A 3EVVA 2BKHB 1G33A 4NDBA 5FI7A 1YRTB 3KEVA 2V53A 4I5JA 2L51A 3CR2A 2D8NA 2KYCA 1CDPA 1KWOC 1DVIA 1V1FA 2LMVA 1NX1A 2ERBA 2QDIA 4UPGA 3L47A 1CFDA 1JF2A 1ZFSA 2JNXA 1UP5A 2KFHA 3EVUA 1KK8B 1SNLA 1XFWO 3OGNA 1XFVO 4FQOA 1AVSA 1PALA 1EH2A 1S1EA 1DQEA 2KI6D 1OMDA 1DJHA 4JKTA 3S0DA 5DKRA 5I94A 2F3YA 4I5LB 1LA3A 3CZTX 3BFBA 2QACA 2M29A 3GOFA 2M0RA 5I2QA 2OTGC 1TIZA 1CM4A 2RGIA 3NHIA 2ZRSA 1QVIY 2K8MB 2CTNA 1SL8A 2JXCA 1K90D 3KF9A 1ZMZA 4WQ3A 2KBMA 1G8IA 3R1PA 1A03A 2JT8A 1LVCD 2K60A 3NHTA 4JD9A 4N5XA 1YVHA 5AERA 1TN4A 2HQ8A 3R1VA 1YX8A 1HQVA 1OOJA 4MRXA 2NCOA 1RK9A 2K2AA 4YI8A 4Q04A 2Y1MA 4U8DA 2BE4A 2MJWB 1B4CA 3TUYB 4INXA 2P6BB 1YRUB 1EG3A 1NYAA 1PULA 1WRZA 2LNKA 3BOWB 2IS9A 2LV7A 4BY4A 2QEHA 3IVTA 1JBAA 1F4OA 2KAVA 3JVTB 3OX6A 1OQPA 4ORCB 3CR5X 3CWGA 3B7AA 4M2PA 3CR4X 1SY9A 2CBLA 1C3ZA 3BUWB 2Y4QA 1XFUO 1UHKA 1DF0A 1SR6B 4GGFA 2GV5A 3JTDB 2F2PA 5K89A 3F45A 3KHEA 1MXLC 2HPSA 3I5IC 1AUIB 1QX2A 1Z4HA 3EG5B 5KTYA 3S0AA 1XYDA 1LS8A 3A8RA 1XFYO 3E3RA 3TDIA 4CFQA 4CPVA 2ISDA 3VRPA 1C7WA 3H4SE 1RTP1 1M46A 3B6XA 1DJWA 4M2OA 1TNPA 1UURA 4PT1A 5D7FA 2M49B 1XK4A 2LVKA 2OS8C 1SPYA 2PSRA 2MHHA 5HLOA 3B88A 1CDNA 2G2BA 1B8RA 1QX7A 1IWQA 2KFFA 3CTNA 4ICBA 2AUCA 2H8VA 1OOGA 1TNXA 2LLUA 2QPTA 2H61A 1KK7Z 2JTTA 3NXAA 5F6TA 1KSMA 1L2OB 4NDDA 1KQMB 1PK0D 2EC6B 2LMUA 4KYNA 1BT6A 4HREE 2JPTA 1RJVA 2KI4C 1A2XA 4PHJA 1EXRA 1YR5A 4QJ4B 2JPOA 1TWOA 1RWYA 2BCAA 1UHHA 3RLZA 1ODBA 3WHUB 1NWDA 1BOCA 1OOFA 1ALWA 1OZSA 1NPQA 2OS8B 3PSRA 3ZNIA 2WCFA 1BLQA 2A4JA 2FOTA 1DMOA 3IQQA 1K96A 1AJ5A 4I5NB 3BFHA 2M8UA 1SL9A 4AOMA 1A29A 1EJ3A 3D0YA 4C0JA 3I5FB 1KFXL 3D78A 3RM1A 1YUTA 1OOHA 1QV0A 2L4IA 3K21A 1KK7Y 3L4AA 3IQOA 3S0GA 1FF1A 2MRDA 1SK6D 3SG6A 1PRWA 2ZN9A 4MZJA 1IQ3A 3SJSA 1KCYA 4PE0A 1QXPA 3CGAA 3O4XA 1S6IA 2MLFC 3KPXA 1IIOA 3CYZA 3SG5A 3SS4A 1BF5A 4PHNA 2NCPA 1BODA 2K7BA 3SS3A 4F0ZB 2WORA 2KI6C 3TDUA 4GGNA 1TTXA 2KNEA 3D75A 3R72A 2BL0C 1DC1A 2L2CA 3EK8A 1Y1XA 1K2HA 1DJGA 2L5YA 5D69A 3LL8B 3BFAA 3SIAA 3AAJA 2BAPA 4XYNA 3VROA 1CMFA 1SYMA 4PHMA 2PRUA 1XFZO 1CNPA 2ZNEA 2P71A 3OBVA 5JOLA 4YI9A 4PE7A 4INWA 4YBHB 2KQYA 2OTGB 1F4QA 1CLBA 2F33A 5I2LA 3C1VA 1JUOA 3M0WA 5I2OA 2BCBA 4AQIA 1FBVA 1KQVA 2AAOA 2KSPA 1N0YA 1UHJA 2GTEA 4FTGA 1CLMA 1TNQA 3MSEB 4NDCA 5FI2A 3BYAA 2YGUA 5HKZA 5KU1A 1SKTA 4N1FA 4A4BA 1XVJA 1J1EA 2NLNA 1QIVA 1B8LA 3D74A 2WC5A 2WCLA 1EL4A 5AANA 1C3YA 1K9PA 3SIBA 2O60A 1VRKA 3VRNA 5I8NA 2WOSA 1OMRA 2LM5A 3O78A 4GFTA 2BL0B 4GUKA 4IJ7A 4F7FA 1BU3A 1DTLA 3OP0A 4MVFA 1R2UA 5AFPA 2FCEA 2H2KA 3D77A 2WC8A 3O6BA 2KAYA 1GGWA 5BPJA 2L4HA 4NQGA 1NSHA 2Y5IA 4CIDA 2K61A 2KLDA 2M1UA 3BOWA 1UWOA 1K8UA 1DGUA 2K0JA 4GNKB 5G08A 3OB2B 1CB1A 1SSEB 2KOTA 1IH0A 2LE9B 1YURA 3NGVA 4MZLA 5ER4X 1XFXO 3FS7A 4TNCA 2COLB 3JTDC 3S0FA 3BUMB 2Q4UA 1W9ZA 3TZ1A 1IQ5A 3O4YA 4HRHA 1F54A 2QEOA 2BBMA 1DF0B 2I7AA 2LVVA 4MN0A 1HT9A 1YUSA 4OV2A 1MUXA 2M7NA 4GPLB 1ORGA 1CLLA 2MA2A 3LCPC 3FE8A 1NUBA 1QV1A 5FYXA 2LUCA 1H4BA 2K2FA 1RROA 3LLEA 2I2RE 3CZ1A 1IG5A 3ICBA 4P2YB 1IRJA 1P28A 4ETOA 1JSAA 3CZ2A 1TOPA 3PM8A 1Y1AA 4WRIA 2L2EA 2LLTA 4C0LA 1XO5A 2JXLA 2LHIA 2E6WA 2HQWA 5D3OA 1B8CA 2PALA 2K7CA 2L98A 3SG3A 2JT3A 1RFJA 1WLMA 1PSBA 3DF0A 1KFXS 2KPHA 2M7LA 3PLFB 3CZ0A 2K7OA 4YGCB 4USLA 4GGFC 1A75A 1SRAA 1J7RA 3CS1A 4OKHA 1F55A 5DKQA 1KQMC 2LUXA 3CABA 3HX4A 1Y0VH 5CSIA 1PVAA 1OW4A 3B87A 5CSNA 1DT7B 4DIRA 1JC2A 2Y1NA 1J55A 4FQTA 1FI6A 2NZ0A 4N1GA 4OVNF 2E30A 2M9GA 3PN7C 1LA0A 3FE9A 4PE1A 1U5IA 2KI4B 2LVIA 1JF0A 3SG7A 1AHRA 2BBNA 2ZNDA 1OMVA 1QTXA 4MLWA 1NX2A 1AK8A 4WQ2A 1M39A 1DEKA 3Q8IA 2CXJA 1PVBA 5ER5A 3JVTC 3EK7A 1KFUS 1J7PA 1DJIA 2KAXA 3I5HB 1DELA 1XA5A 3DXLA 1M63B 2QEVA 1WDCB 3BUXB 2JU0A 2G9BA 3D0YB 1B7TZ 1IGVA 3K1EA 1Z2CB 4MRYA 1K9UA 4MEWA 1F71A 3I5IB 1LINA 1SCVA 4YGEB 1F70A 1S6CA 1AJ4A 1W7JB 1ZACA 1Y1UA 1GGZA 1K95A 3DYEA 3I5GC 4ORAB 1IKUA 1U5IB 3FIAA 4XJKB 1TCFA 3PALA 1J7OA 2BECA 2L50A 1CFFA 2WCKA 3NSKA 1ZUZA 2VRGA 1QATA 1D1OA 3AKAA 1NP8A 3GK2A 3LK0A 1IJ6A 1OSAA 1SMGA 1ALVA 3DY9A 1CTRA 3I5HC 2CT9A 4ZCUA 1BJFA 1KSOA 3TS5C 1DGVA 1SW8A 3S0BA 4GBAA 1LKJA 1QJTA 1SCMC 1WDCC 2KYFA 2EC6C 5CSJA 1NCYA 1CDLA 2QEBA 1YTZC 5AXIA 1QVIZ 3A4UB 1H8BA 1CM1A 1M45A 3OX5A 4M2QA 4ZCVA 1FW4A 1J7QA 1FPWA 1NX3A 1TUZA 3PATA 2DOQA 3I5GB 1BR1B 4IL1A 2JQ6A 3EVRA 5CPVA 1SR6C 3UNWA 3WHTB 3FWCA 1B47A 1OZOA 1DJYA 3DVKA 1RECA 5PALA 5JJGA 1PSRA 1FI5A 1ZOTB 1KFUL 1YX7A 2WCEA 1TRFA 1S36A 3WNXB 1BMOA 2F3ZA 5HKYA 1F8HA 2CCMA 4JPZB 4AQJA 1S26D 1WLZA 2PYQA 1NCZA 1LXFC 1UHIA 4PALA 3EKHA 1QWVA 4GAOA 3PM2A 2LP2A 5IBWA 1B9AA 1OOIX 2MLEC 4R1EA 3UO9A 1BG1A 1G4YR 4HRGA 4ORBB 3DVMA 1KK8C 4PCWA 1QASA 2FJYA 3BQ3A 4HSZA 2HETA 4JQ0D 1TUJA 4QJ3B 2KQ6A 2BCXA 2I18A 3CLNA 1JFJA 2LANA 2B1UA 3HCMA 1MXEA 1IJ5A 2GGZA 2GGMA 5HLVA
chains in the Genus database with same CATH topology
2KPHA 3BFHA 3CZ0A 2ERBA 5DICA 2QDIA 3L47A 3CABA 3D78A 1OOHA 3S0GA 1OW4A 3B87A 3L4AA 4OZDA 3OGNA 4FQTA 1DQEA 3S0DA 3BJHA 3FE9A 2WCHA 3RZSA 2PQLA 3VB1A 3BFBA 3CYZA 3Q8IA 3NHIA 1GM0A 3DXLA 3QMEA 3D75A 3R1PA 1XFRA 3R72A 2QEVA 3NHTA 4JD9A 2L2CA 3R1VA 3BFAA 3K1EA 3FE6A 2P71A 4INXA 3DYEA 4INWA 2QEHA 5EL2A 3DZTA 3D76A 3B7AA 2GTEA 2WCKA 1C3ZA 3D74A 2WC5A 2WCLA 1C3YA 2WCMA 3DY9A 4F7FA 3R1OA 3S0AA 1LS8A 3S0BA 3V2LA 3D77A 3B6XA 3D73A 2QEBA 4PT1A 3NGVA 3B88A 3N7HA 3B86A 2WC6A 2H8VA 2P70A 1OOGA 3S0FA 2QEOA 1ORGA 3CDNA 3FE8A 1QWVA 3L4LA 1OOIX 3CZ1A 2JPOA 3PJIA 1TWOA 1P28A 2WCJA 3CZ2A 2FJYA 1T14A 1TUJA 3S0EA 1OOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPH A;  3BFH A;  3CZ0 A;  2ERB A;  5DIC A;  2QDI A;  3L47 A;  3CAB A;  3D78 A;  1OOH A;  3S0G A;  1OW4 A;  3B87 A;  3L4A A;  4OZD A;  3OGN A;  4FQT A;  1DQE A;  3S0D A;  3BJH A;  3FE9 A;  2WCH A;  3RZS A;  2PQL A;  3VB1 A;  3BFB A;  3CYZ A;  3Q8I A;  3NHI A;  1GM0 A;  3DXL A;  3QME A;  3D75 A;  3R1P A;  1XFR A;  3R72 A;  2QEV A;  3NHT A;  4JD9 A;  2L2C A;  3R1V A;  3BFA A;  3K1E A;  3FE6 A;  2P71 A;  4INX A;  3DYE A;  4INW A;  2QEH A;  5EL2 A;  3DZT A;  3D76 A;  3B7A A;  2GTE A;  2WCK A;  1C3Z A;  3D74 A;  2WC5 A;  2WCL A;  1C3Y A;  2WCM A;  3DY9 A;  4F7F A;  3R1O A;  3S0A A;  1LS8 A;  3S0B A;  3V2L A;  3D77 A;  3B6X A;  3D73 A;  2QEB A;  4PT1 A;  3NGV A;  3B88 A;  3N7H A;  3B86 A;  2WC6 A;  2H8V A;  2P70 A;  1OOG A;  3S0F A;  2QEO A;  1ORG A;  3CDN A;  3FE8 A;  1QWV A;  3L4L A;  1OOI X;  3CZ1 A;  2JPO A;  3PJI A;  1TWO A;  1P28 A;  2WCJ A;  3CZ2 A;  2FJY A;  1T14 A;  1TUJ A;  3S0E A;  1OOF A; 
#chains in the Genus database with same CATH topology
 4BY5 A;  3NSO A;  5TNC A;  1N65 A;  3BXK A;  2M97 A;  1B1G A;  4PDZ A;  4JWQ A;  5DIC A;  1QIW A;  2WCB A;  4MSP A;  2KHN A;  2JRF A;  3WXA A;  2BKI B;  2JOJ A;  1MQ1 A;  2LC5 A;  1M31 A;  5HL1 A;  3TUY C;  1V1G A;  2LP3 A;  4OZD A;  1QX5 B;  1E8A A;  4DUQ A;  1MWN A;  1XK4 C;  2JT0 A;  2PVB A;  5AEQ A;  1CFP A;  3BJH A;  2NXQ A;  2WCH A;  2PMY A;  3RZS A;  2ZFD A;  1GQM A;  2PQL A;  3VB1 A;  3VGO A;  1JFK A;  3EKJ A;  2H61 C;  2ZKM X;  2SAS A;  1GM0 A;  4MBE A;  1WY9 A;  2FJU B;  3TDZ A;  3NSI A;  1S5G Y;  1A4P A;  1K9K A;  1R6P A;  2KGR A;  4PHK A;  2KBI A;  4DS7 A;  4E68 A;  3QME A;  1XFR A;  2M1K B;  3DD4 A;  3DF0 B;  4DRW A;  4QJ5 B;  1EG4 A;  2TN4 A;  1WRL A;  2KFG A;  1AP4 A;  1JWD A;  1A75 B;  4YGB B;  2MAZ A;  1SL7 A;  3PN7 B;  1YUU A;  1YVL A;  2ZRT A;  4A4C A;  3FE6 A;  1C7V A;  4I5K A;  1UUS A;  2HF5 A;  1QLK A;  2L5X B;  5HYD A;  3OHM B;  1CMG A;  3DVJ A;  3FWB A;  5HKW A;  1DJX A;  2LVJ A;  3EK4 A;  5CSF A;  5EL2 A;  3DZT A;  5FI6 A;  2JUL A;  3D76 A;  2Q91 A;  4MZK A;  3AKB A;  4OR9 B;  1L2O C;  1CKK A;  1NCX A;  1S3P A;  5B8I B;  3PFV A;  2JTZ A;  5GQQ C;  1BR4 B;  1J1D A;  2R2I A;  3GK4 X;  4CLN A;  1CDM A;  1TNW A;  4YGD B;  1B7T Y;  2I94 A;  2WCM A;  2K7D A;  3QRX A;  3ZWH A;  1CFC A;  2LAP A;  1NIW A;  2M3W A;  2EHB A;  3R1O A;  2WND A;  2FCD A;  2PAS A;  1MF8 B;  2LMT A;  3V2L A;  4YRU A;  1K93 D;  1UHN A;  1DJZ A;  3DVE A;  3D73 A;  1S5G Z;  3O2P A;  2MBX A;  1GJY A;  2LCP A;  1TCO B;  2JNF A;  2SCP A;  4OCI A;  5DKN A;  1L7Z A;  2BNX A;  3SG4 A;  4XJK A;  4YGA A;  1Y6W A;  4DCK A;  3KO0 A;  3N7H A;  3D10 A;  3B86 A;  2ZN8 A;  2WC6 A;  3GK1 A;  2P70 A;  3AAK A;  2JZI A;  4CFR A;  1KWO B;  2L0P A;  2LHL A;  5KSZ A;  3VRR A;  3NSL A;  2BE6 A;  3TS5 B;  3I5F C;  1Q80 A;  1S6J A;  1W7I B;  2JC2 A;  4P5O E;  2CNP A;  3CDN A;  1N2D A;  3BUO B;  1MHO A;  2AMI A;  2JWW A;  4PE4 A;  1WRK A;  3SG2 A;  1QS7 A;  1QLS A;  3L4L A;  2O5G A;  5J3X A;  4C0K A;  3IF7 A;  2F8P A;  4D1E A;  1SBJ A;  2KDH A;  2EGD A;  1X02 A;  3LK1 A;  1K94 A;  1SCM B;  2KGB C;  3PJI A;  1OE9 B;  2WCJ A;  3SS5 A;  1T14 A;  2LLS A;  4L9M A;  3OB1 B;  3VRQ A;  3S0E A;  2KLE A;  1NX0 A;  2F2O A;  3BUN B;  2OPO A;  1C07 A;  1MR8 A;  3EVV A;  2BKH B;  1G33 A;  4NDB A;  5FI7 A;  1YRT B;  3KEV A;  2V53 A;  4I5J A;  2L51 A;  3CR2 A;  2D8N A;  2KYC A;  1CDP A;  1KWO C;  1DVI A;  1V1F A;  2LMV A;  1NX1 A;  2ERB A;  2QDI A;  4UPG A;  3L47 A;  1CFD A;  1JF2 A;  1ZFS A;  2JNX A;  1UP5 A;  2KFH A;  3EVU A;  1KK8 B;  1SNL A;  1XFW O;  3OGN A;  1XFV O;  4FQO A;  1AVS A;  1PAL A;  1EH2 A;  1S1E A;  1DQE A;  2KI6 D;  1OMD A;  1DJH A;  4JKT A;  3S0D A;  5DKR A;  5I94 A;  2F3Y A;  4I5L B;  1LA3 A;  3CZT X;  3BFB A;  2QAC A;  2M29 A;  3GOF A;  2M0R A;  5I2Q A;  2OTG C;  1TIZ A;  1CM4 A;  2RGI A;  3NHI A;  2ZRS A;  1QVI Y;  2K8M B;  2CTN A;  1SL8 A;  2JXC A;  1K90 D;  3KF9 A;  1ZMZ A;  4WQ3 A;  2KBM A;  1G8I A;  3R1P A;  1A03 A;  2JT8 A;  1LVC D;  2K60 A;  3NHT A;  4JD9 A;  4N5X A;  1YVH A;  5AER A;  1TN4 A;  2HQ8 A;  3R1V A;  1YX8 A;  1HQV A;  1OOJ A;  4MRX A;  2NCO A;  1RK9 A;  2K2A A;  4YI8 A;  4Q04 A;  2Y1M A;  4U8D A;  2BE4 A;  2MJW B;  1B4C A;  3TUY B;  4INX A;  2P6B B;  1YRU B;  1EG3 A;  1NYA A;  1PUL A;  1WRZ A;  2LNK A;  3BOW B;  2IS9 A;  2LV7 A;  4BY4 A;  2QEH A;  3IVT A;  1JBA A;  1F4O A;  2KAV A;  3JVT B;  3OX6 A;  1OQP A;  4ORC B;  3CR5 X;  3CWG A;  3B7A A;  4M2P A;  3CR4 X;  1SY9 A;  2CBL A;  1C3Z A;  3BUW B;  2Y4Q A;  1XFU O;  1UHK A;  1DF0 A;  1SR6 B;  4GGF A;  2GV5 A;  3JTD B;  2F2P A;  5K89 A;  3F45 A;  3KHE A;  1MXL C;  2HPS A;  3I5I C;  1AUI B;  1QX2 A;  1Z4H A;  3EG5 B;  5KTY A;  3S0A A;  1XYD A;  1LS8 A;  3A8R A;  1XFY O;  3E3R A;  3TDI A;  4CFQ A;  4CPV A;  2ISD A;  3VRP A;  1C7W A;  3H4S E;  1RTP 1;  1M46 A;  3B6X A;  1DJW A;  4M2O A;  1TNP A;  1UUR A;  4PT1 A;  5D7F A;  2M49 B;  1XK4 A;  2LVK A;  2OS8 C;  1SPY A;  2PSR A;  2MHH A;  5HLO A;  3B88 A;  1CDN A;  2G2B A;  1B8R A;  1QX7 A;  1IWQ A;  2KFF A;  3CTN A;  4ICB A;  2AUC A;  2H8V A;  1OOG A;  1TNX A;  2LLU A;  2QPT A;  2H61 A;  1KK7 Z;  2JTT A;  3NXA A;  5F6T A;  1KSM A;  1L2O B;  4NDD A;  1KQM B;  1PK0 D;  2EC6 B;  2LMU A;  4KYN A;  1BT6 A;  4HRE E;  2JPT A;  1RJV A;  2KI4 C;  1A2X A;  4PHJ A;  1EXR A;  1YR5 A;  4QJ4 B;  2JPO A;  1TWO A;  1RWY A;  2BCA A;  1UHH A;  3RLZ A;  1ODB A;  3WHU B;  1NWD A;  1BOC A;  1OOF A;  1ALW A;  1OZS A;  1NPQ A;  2OS8 B;  3PSR A;  3ZNI A;  2WCF A;  1BLQ A;  2A4J A;  2FOT A;  1DMO A;  3IQQ A;  1K96 A;  1AJ5 A;  4I5N B;  3BFH A;  2M8U A;  1SL9 A;  4AOM A;  1A29 A;  1EJ3 A;  3D0Y A;  4C0J A;  3I5F B;  1KFX L;  3D78 A;  3RM1 A;  1YUT A;  1OOH A;  1QV0 A;  2L4I A;  3K21 A;  1KK7 Y;  3L4A A;  3IQO A;  3S0G A;  1FF1 A;  2MRD A;  1SK6 D;  3SG6 A;  1PRW A;  2ZN9 A;  4MZJ A;  1IQ3 A;  3SJS A;  1KCY A;  4PE0 A;  1QXP A;  3CGA A;  3O4X A;  1S6I A;  2MLF C;  3KPX A;  1IIO A;  3CYZ A;  3SG5 A;  3SS4 A;  1BF5 A;  4PHN A;  2NCP A;  1BOD A;  2K7B A;  3SS3 A;  4F0Z B;  2WOR A;  2KI6 C;  3TDU A;  4GGN A;  1TTX A;  2KNE A;  3D75 A;  3R72 A;  2BL0 C;  1DC1 A;  2L2C A;  3EK8 A;  1Y1X A;  1K2H A;  1DJG A;  2L5Y A;  5D69 A;  3LL8 B;  3BFA A;  3SIA A;  3AAJ A;  2BAP A;  4XYN A;  3VRO A;  1CMF A;  1SYM A;  4PHM A;  2PRU A;  1XFZ O;  1CNP A;  2ZNE A;  2P71 A;  3OBV A;  5JOL A;  4YI9 A;  4PE7 A;  4INW A;  4YBH B;  2KQY A;  2OTG B;  1F4Q A;  1CLB A;  2F33 A;  5I2L A;  3C1V A;  1JUO A;  3M0W A;  5I2O A;  2BCB A;  4AQI A;  1FBV A;  1KQV A;  2AAO A;  2KSP A;  1N0Y A;  1UHJ A;  2GTE A;  4FTG A;  1CLM A;  1TNQ A;  3MSE B;  4NDC A;  5FI2 A;  3BYA A;  2YGU A;  5HKZ A;  5KU1 A;  1SKT A;  4N1F A;  4A4B A;  1XVJ A;  1J1E A;  2NLN A;  1QIV A;  1B8L A;  3D74 A;  2WC5 A;  2WCL A;  1EL4 A;  5AAN A;  1C3Y A;  1K9P A;  3SIB A;  2O60 A;  1VRK A;  3VRN A;  5I8N A;  2WOS A;  1OMR A;  2LM5 A;  3O78 A;  4GFT A;  2BL0 B;  4GUK A;  4IJ7 A;  4F7F A;  1BU3 A;  1DTL A;  3OP0 A;  4MVF A;  1R2U A;  5AFP A;  2FCE A;  2H2K A;  3D77 A;  2WC8 A;  3O6B A;  2KAY A;  1GGW A;  5BPJ A;  2L4H A;  4NQG A;  1NSH A;  2Y5I A;  4CID A;  2K61 A;  2KLD A;  2M1U A;  3BOW A;  1UWO A;  1K8U A;  1DGU A;  2K0J A;  4GNK B;  5G08 A;  3OB2 B;  1CB1 A;  1SSE B;  2KOT A;  1IH0 A;  2LE9 B;  1YUR A;  3NGV A;  4MZL A;  5ER4 X;  1XFX O;  3FS7 A;  4TNC A;  2COL B;  3JTD C;  3S0F A;  3BUM B;  2Q4U A;  1W9Z A;  3TZ1 A;  1IQ5 A;  3O4Y A;  4HRH A;  1F54 A;  2QEO A;  2BBM A;  1DF0 B;  2I7A A;  2LVV A;  4MN0 A;  1HT9 A;  1YUS A;  4OV2 A;  1MUX A;  2M7N A;  4GPL B;  1ORG A;  1CLL A;  2MA2 A;  3LCP C;  3FE8 A;  1NUB A;  1QV1 A;  5FYX A;  2LUC A;  1H4B A;  2K2F A;  1RRO A;  3LLE A;  2I2R E;  3CZ1 A;  1IG5 A;  3ICB A;  4P2Y B;  1IRJ A;  1P28 A;  4ETO A;  1JSA A;  3CZ2 A;  1TOP A;  3PM8 A;  1Y1A A;  4WRI A;  2L2E A;  2LLT A;  4C0L A;  1XO5 A;  2JXL A;  2LHI A;  2E6W A;  2HQW A;  5D3O A;  1B8C A;  2PAL A;  2K7C A;  2L98 A;  3SG3 A;  2JT3 A;  1RFJ A;  1WLM A;  1PSB A;  3DF0 A;  1KFX S;  2KPH A;  2M7L A;  3PLF B;  3CZ0 A;  2K7O A;  4YGC B;  4USL A;  4GGF C;  1A75 A;  1SRA A;  1J7R A;  3CS1 A;  4OKH A;  1F55 A;  5DKQ A;  1KQM C;  2LUX A;  3CAB A;  3HX4 A;  1Y0V H;  5CSI A;  1PVA A;  1OW4 A;  3B87 A;  5CSN A;  1DT7 B;  4DIR A;  1JC2 A;  2Y1N A;  1J55 A;  4FQT A;  1FI6 A;  2NZ0 A;  4N1G A;  4OVN F;  2E30 A;  2M9G A;  3PN7 C;  1LA0 A;  3FE9 A;  4PE1 A;  1U5I A;  2KI4 B;  2LVI A;  1JF0 A;  3SG7 A;  1AHR A;  2BBN A;  2ZND A;  1OMV A;  1QTX A;  4MLW A;  1NX2 A;  1AK8 A;  4WQ2 A;  1M39 A;  1DEK A;  3Q8I A;  2CXJ A;  1PVB A;  5ER5 A;  3JVT C;  3EK7 A;  1KFU S;  1J7P A;  1DJI A;  2KAX A;  3I5H B;  1DEL A;  1XA5 A;  3DXL A;  1M63 B;  2QEV A;  1WDC B;  3BUX B;  2JU0 A;  2G9B A;  3D0Y B;  1B7T Z;  1IGV A;  3K1E A;  1Z2C B;  4MRY A;  1K9U A;  4MEW A;  1F71 A;  3I5I B;  1LIN A;  1SCV A;  4YGE B;  1F70 A;  1S6C A;  1AJ4 A;  1W7J B;  1ZAC A;  1Y1U A;  1GGZ A;  1K95 A;  3DYE A;  3I5G C;  4ORA B;  1IKU A;  1U5I B;  3FIA A;  4XJK B;  1TCF A;  3PAL A;  1J7O A;  2BEC A;  2L50 A;  1CFF A;  2WCK A;  3NSK A;  1ZUZ A;  2VRG A;  1QAT A;  1D1O A;  3AKA A;  1NP8 A;  3GK2 A;  3LK0 A;  1IJ6 A;  1OSA A;  1SMG A;  1ALV A;  3DY9 A;  1CTR A;  3I5H C;  2CT9 A;  4ZCU A;  1BJF A;  1KSO A;  3TS5 C;  1DGV A;  1SW8 A;  3S0B A;  4GBA A;  1LKJ A;  1QJT A;  1SCM C;  1WDC C;  2KYF A;  2EC6 C;  5CSJ A;  1NCY A;  1CDL A;  2QEB A;  1YTZ C;  5AXI A;  1QVI Z;  3A4U B;  1H8B A;  1CM1 A;  1M45 A;  3OX5 A;  4M2Q A;  4ZCV A;  1FW4 A;  1J7Q A;  1FPW A;  1NX3 A;  1TUZ A;  3PAT A;  2DOQ A;  3I5G B;  1BR1 B;  4IL1 A;  2JQ6 A;  3EVR A;  5CPV A;  1SR6 C;  3UNW A;  3WHT B;  3FWC A;  1B47 A;  1OZO A;  1DJY A;  3DVK A;  1REC A;  5PAL A;  5JJG A;  1PSR A;  1FI5 A;  1ZOT B;  1KFU L;  1YX7 A;  2WCE A;  1TRF A;  1S36 A;  3WNX B;  1BMO A;  2F3Z A;  5HKY A;  1F8H A;  2CCM A;  4JPZ B;  4AQJ A;  1S26 D;  1WLZ A;  2PYQ A;  1NCZ A;  1LXF C;  1UHI A;  4PAL A;  3EKH A;  1QWV A;  4GAO A;  3PM2 A;  2LP2 A;  5IBW A;  1B9A A;  1OOI X;  2MLE C;  4R1E A;  3UO9 A;  1BG1 A;  1G4Y R;  4HRG A;  4ORB B;  3DVM A;  1KK8 C;  4PCW A;  1QAS A;  2FJY A;  3BQ3 A;  4HSZ A;  2HET A;  4JQ0 D;  1TUJ A;  4QJ3 B;  2KQ6 A;  2BCX A;  2I18 A;  3CLN A;  1JFJ A;  2LAN A;  2B1U A;  3HCM A;  1MXE A;  1IJ5 A;  2GGZ A;  2GGM A;  5HLV A; 
#chains in the Genus database with same CATH homology
 2KPH A;  3BFH A;  3CZ0 A;  2ERB A;  5DIC A;  2QDI A;  3L47 A;  3CAB A;  3D78 A;  1OOH A;  3S0G A;  1OW4 A;  3B87 A;  3L4A A;  4OZD A;  3OGN A;  4FQT A;  1DQE A;  3S0D A;  3BJH A;  3FE9 A;  2WCH A;  3RZS A;  2PQL A;  3VB1 A;  3BFB A;  3CYZ A;  3Q8I A;  3NHI A;  1GM0 A;  3DXL A;  3QME A;  3D75 A;  3R1P A;  1XFR A;  3R72 A;  2QEV A;  3NHT A;  4JD9 A;  2L2C A;  3R1V A;  3BFA A;  3K1E A;  3FE6 A;  2P71 A;  4INX A;  3DYE A;  4INW A;  2QEH A;  5EL2 A;  3DZT A;  3D76 A;  3B7A A;  2GTE A;  2WCK A;  1C3Z A;  3D74 A;  2WC5 A;  2WCL A;  1C3Y A;  2WCM A;  3DY9 A;  4F7F A;  3R1O A;  3S0A A;  1LS8 A;  3S0B A;  3V2L A;  3D77 A;  3B6X A;  3D73 A;  2QEB A;  4PT1 A;  3NGV A;  3B88 A;  3N7H A;  3B86 A;  2WC6 A;  2H8V A;  2P70 A;  1OOG A;  3S0F A;  2QEO A;  1ORG A;  3CDN A;  3FE8 A;  1QWV A;  3L4L A;  1OOI X;  3CZ1 A;  2JPO A;  3PJI A;  1TWO A;  1P28 A;  2WCJ A;  3CZ2 A;  2FJY A;  1T14 A;  1TUJ A;  3S0E A;  1OOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...