2QEOA

Crystal structure of anopheles gambiae d7r4-norepinephrine complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
144
structure length
144
Chain Sequence
ETVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
total genus 58
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qeoA00
3NGVA 3VB1A 2WCMA 3BJHA 2ERBA 3NHTA 2PQLA 2JPOA 2QEOA 3OGNA 2QEBA 3D74A 3CDNA 3S0DA 3B86A 3B7AA 2QEHA 2P71A 3L4AA 3R1PA 2WC6A 2H8VA 2QDIA 3FE8A 3RZSA 3K1EA 3BFHA 1TUJA 3D78A 4F7FA 1GM0A 2WCJA 3B6XA 1XFRA 3DYEA 4INXA 2P70A 4OZDA 3BFBA 3NHIA 4JD9A 3CZ2A 3FE6A 3R1OA 2WCKA 2L2CA 1C3ZA 3B88A 3V2LA 1OOIX 3CZ1A 3D77A 1QWVA 1T14A 3S0AA 3S0GA 2GTEA 3CZ0A 3S0EA 2KPHA 1DQEA 3DY9A 3S0FA 3R72A 2FJYA 3L47A 1ORGA 3CYZA 1OOHA 2QEVA 4PT1A 1C3YA 3Q8IA 1P28A 3S0BA 1OOFA 4FQTA 3N7HA 1LS8A 3R1VA 1OOGA 4INWA 3CABA 1TWOA 3QMEA 3BFAA 3FE9A 3DXLA 3PJIA 3D75A 5DICA 1OW4A 2WC5A 3L4LA 2WCHA 2WCLA 3B87A 3DZTA 3D73A 3D76A 5EL2A
chains in the Genus database with same CATH superfamily
1KQMB 1Z4HA 5JOLA 2F3YA 1DGVA 3EK8A 1EJ3A 3VB1A 1Q80A 1TTXA 2KSPA 2WCMA 1B7TY 1DJXA 1W7IB 2R2IA 3BJHA 1JSAA 2HETA 1WRZA 1YR5A 1A4PA 1SSEB 2MHHA 1QLSA 1NX1A 2JPOA 3AKAA 1LA3A 3PLFB 1CMFA 3S0DA 1FBVA 3B86A 1KK7Z 3FWCA 1AJ5A 2G9BA 5HL1A 2RGIA 2M29A 4YGCB 4AQIA 1NPQA 2LHIA 1S6CA 1ZACA 2KOTA 2P71A 3K21A 4JQ0D 4XJKB 1TNQA 1OSAA 2KGRA 3MSEB 3IQQA 1DMOA 1NIWA 2F8PA 1K9PA 1OMRA 2I18A 2IS9A 2TN4A 1OOJA 2BBMA 2JNXA 3BFHA 2ZRTA 3JVTB 4DCKA 1XK4A 2MLFC 2F33A 3NSLA 1QX7A 2Q4UA 3BOWA 5I2QA 1TOPA 1UP5A 3IQOA 4ICBA 4NDCA 2CNPA 2P70A 1N0YA 2JULA 4P2YB 1TNXA 3O4YA 2KYCA 3BFBA 1A2XA 2E30A 5DKQA 1CDMA 2LMTA 2BL0B 1K9UA 3BYAA 2PRUA 4GUKA 1ODBA 1YRUB 1OZSA 2JTZA 1MF8B 2JTTA 1B4CA 1ZFSA 2K8MB 3F45A 3DD4A 3DVKA 3D0YA 1C3ZA 3JTDC 2SASA 1KWOC 2KFHA 3BXKA 1KK7Y 1TCFA 2K0JA 4IJ7A 1SL7A 2LNKA 3S0AA 4QJ3B 2M9GA 1PRWA 1CMGA 4YGBB 1CM1A 4HRGA 3D10A 1NCZA 4M2QA 1AUIB 2KPHA 1XFVO 4NQGA 1ALVA 2BKHB 2PYQA 3OBVA 1AJ4A 1XK4C 1C7VA 2M1KB 2LHLA 1QVIZ 2OTGB 1S1EA 3CWGA 1DJGA 3KF9A 1YUSA 2KFFA 4MVFA 2JPTA 3R72A 4GPLB 3TZ1A 1SKTA 1S3PA 1K90D 1QJTA 3PSRA 4N1FA 3L47A 1KCYA 1YUUA 1QIWA 2KI4B 2PASA 3FS7A 3NXAA 2LMVA 2M7NA 4WRIA 2BCXA 3PM8A 2JT3A 3EKJA 1B9AA 1DJWA 1KSOA 1Y1XA 2COLB 1SMGA 2PMYA 2KBIA 1SR6C 3PATA 1IKUA 2ISDA 3PALA 5I2LA 2BCAA 3BUMB 2NZ0A 4MN0A 2LANA 1AVSA 2JOJA 1PALA 4Q04A 2BNXA 3CABA 3EG5B 3GK1A 4INWA 1XFXO 2K61A 3BFAA 3CR2A 1IJ6A 3PN7B 2BECA 3RM1A 1K8UA 1OZOA 1MUXA 4I5NB 1OQPA 2M49B 1UWOA 4DRWA 1JF0A 1QLKA 1QVIY 1LKJA 5DICA 1OW4A 4C0LA 4GNKB 1C07A 3L4LA 1G4YR 1IGVA 1FI6A 1H4BA 2BKIB 3B87A 3DZTA 3D73A 4TNCA 3D76A 1QV0A 1YVLA 1DGUA 2L5XB 4L9MA 1N2DA 3CLNA 1PSRA 2F2OA 2LLTA 2NLNA 4GBAA 2LAPA 1YX8A 4NDBA 1CLBA 2JWWA 3NSIA 4N1GA 3DVEA 2GV5A 3SG7A 1QTXA 2Y1MA 3LL8B 1MWNA 3CR4X 1ALWA 1DJIA 3CDNA 3TS5C 2MA2A 2K7DA 2K60A 2KYFA 4MBEA 5CPVA 1J1DA 2LCPA 1J55A 3O2PA 3PM2A 2L4IA 3EVRA 1B8CA 3L4AA 1XVJA 2QPTA 1B8RA 1RROA 2H8VA 2JU0A 2Y1NA 1NX3A 3FE8A 4GGFC 2LLSA 2B1UA 3K1EA 4USLA 1TUJA 4ZCVA 2EC6C 1XYDA 4YI8A 4F7FA 3I5IC 1JFKA 2WCJA 1JUOA 2KQ6A 1QIVA 1KFXS 2L0PA 1PVAA 2DOQA 2V53A 1IG5A 2GGMA 1SK6D 1AP4A 4C0JA 5FYXA 1CDPA 1DF0A 1DJYA 3C1VA 3BOWB 2H2KA 2BBNA 1WLZA 2HQ8A 2KDHA 2LVVA 2WCBA 1DTLA 3AAKA 1SCMC 3CZ2A 3FWBA 3IF7A 2SCPA 3SG4A 3VROA 1QS7A 3FE6A 1ZMZA 1CM4A 2F3ZA 2OPOA 3R1OA 1NCYA 4PALA 4PHJA 1NX0A 2WCKA 4JKTA 3EKHA 4OKHA 4C0KA 1B1GA 3UO9A 1Z2CB 3I5FB 2JNFA 1DVIA 1OE9B 2Y5IA 1CDNA 1SY9A 2MBXA 1PSBA 2JRFA 1CB1A 3OB2B 3KEVA 1SYMA 3D0YB 2O60A 2L5YA 5KSZA 3S0EA 3SS5A 3A4UB 1WDCC 1Y1UA 1QX5B 1DQEA 4PDZA 3DY9A 2L51A 1CFDA 3KHEA 1K96A 3S0FA 1KFUL 3EVUA 3GK2A 2ZN8A 1EG4A 1V1FA 1YUTA 2PSRA 2MRDA 4M2OA 3SJSA 2WNDA 3WHUB 3SG5A 1L2OC 4MZKA 2FJYA 5BPJA 4QJ5B 1UHNA 1LXFC 1KQVA 2ZNDA 1ORGA 3CYZA 4MZJA 1FW4A 1F71A 4PT1A 1C3YA 2JT0A 1KSMA 4BY5A 1RWYA 2NCPA 3OX5A 4CPVA 3HCMA 1OOFA 1BF5A 4DUQA 1SL9A 2K7BA 1YRTB 3R1VA 1K95A 4I5LB 5D7FA 5PALA 1M63B 1J7QA 2Q91A 4JPZB 1MXEA 5GQQC 4OV2A 4PE7A 5FI6A 3TDIA 1L7ZA 4XJKA 2CXJA 4GGNA 1RFJA 1UHIA 2VRGA 3TDUA 4CIDA 3AAJA 3I5HC 4P5OE 1NSHA 4NDDA 1CNPA 4MZLA 1Y6WA 2AUCA 2KGBC 3TUYC 1Y0VH 1KQMC 2WC5A 4OVNF 1EH2A 2P6BB 2FJUB 2KFGA 5EL2A 1BOCA 1W9ZA 5CSIA 2JT8A 3I5GC 2LE9B 4HSZA 5J3XA 1B47A 3DF0A 1KK8C 4D1EA 4DS7A 3NHTA 3PFVA 2HQWA 4ZCUA 1BJFA 2PQLA 3WHTB 2LC5A 3FIAA 1XA5A 2QEOA 1CTRA 2HF5A 3OGNA 4MEWA 1EXRA 1G33A 5HLOA 1PK0D 1UHKA 1DT7B 2QEHA 2WOSA 1J7PA 1MHOA 2HPSA 1B8LA 3A8RA 3R1PA 1XFYO 1AHRA 2M3WA 3JVTC 1H8BA 4HRHA 4WQ3A 4AOMA 1F55A 2KLDA 1A75A 2LP3A 4GGFA 1JFJA 1NX2A 2QDIA 2QACA 1ZUZA 2WORA 1V1GA 1CFPA 3HX4A 3D78A 1S6IA 3DVJA 5AANA 3DYEA 2BL0C 4INXA 3OB1B 3E3RA 2M8UA 3EK7A 4OZDA 4YRUA 4F0ZB 2MLEC 2K7CA 1K93D 4I5KA 4N5XA 3BQ3A 1DEKA 1WDCB 4YGDB 3LCPC 5CSJA 1GGWA 5I2OA 2H61C 1BMOA 1F4QA 1D1OA 1ZOTB 2LUXA 4MRXA 4ORAB 1CLMA 3CGAA 3CZTX 2FCDA 4OR9B 1IRJA 1RJVA 1OOIX 1WRKA 1W7JB 3TDZA 1QWVA 2WCFA 1NP8A 1UUSA 2MAZA 1NUBA 4A4BA 3S0GA 3JTDB 4MLWA 1KWOB 1F70A 1S26D 4YGAA 1N65A 4M2PA 2OTGC 4PHKA 4CFRA 3BUWB 5FI2A 1BU3A 1J7RA 1IIOA 4FQOA 2LM5A 1CDLA 1MXLC 4GFTA 4PE4A 3M0WA 3O78A 1YX7A 3VRQA 2KAYA 1MQ1A 1BG1A 1OOHA 2QEVA 1R2UA 2K2FA 1C7WA 3OHMB 3LK0A 1GGZA 1P28A 1DJZA 4JWQA 5HKWA 1K2HA 3EVVA 1DJHA 2GGZA 1JWDA 2M1UA 3AKBA 5D69A 1LS8A 2AMIA 5FI7A 3VGOA 3VRRA 3WXAA 1FF1A 1XFWO 3I5GB 1J7OA 1OOGA 1SR6B 1TN4A 2OS8C 1IH0A 3ZWHA 1PVBA 3SS3A 4CFQA 1KK8B 3PN7C 4PE1A 1CFFA 1TWOA 3BUNB 1M31A 3NSOA 1X02A 1OMVA 1WRLA 3FE9A 5DKRA 1JBAA 1LINA 3DXLA 4E68A 1CFCA 2BE4A 4HREE 3PJIA 1U5IA 1FPWA 4IL1A 3D75A 5D3OA 1WLMA 1TNPA 3BUOB 3NSKA 1BODA 1XO5A 2KQYA 1F4OA 1SCVA 4MSPA 3O6BA 5HKZA 2JXCA 2L2EA 1IQ5A 1M46A 1NWDA 3NGVA 2JXLA 3UNWA 1IJ5A 3SIAA 1MR8A 4MRYA 3KO0A 5AERA 5KU1A 1F8HA 3RLZA 5CSNA 5CSFA 2JZIA 1GJYA 1TNWA 1TIZA 2ERBA 2ZFDA 5ER4X 1AK8A 1S36A 4ORBB 1XFZO 2LV7A 2KI6D 2QEBA 1A29A 3D74A 5F6TA 3DF0B 1CLLA 1SNLA 5ER5A 2LUCA 4A4CA 1NYAA 2KLEA 1JF2A 3B7AA 3ZNIA 2FCEA 2G2BA 4U8DA 3TS5B 2ZRSA 3EK4A 4AQJA 2ZNEA 1KFUS 2WC6A 1IQ3A 2BCBA 1EG3A 1LA0A 1G8IA 4PHNA 2LMUA 1QXPA 2M0RA 3LLEA 4OCIA 3RZSA 3IVTA 1SPYA 1K94A 1RTP1 5JJGA 4YBHB 2KAVA 2M97A 2ZN9A 2ZKMX 1FI5A 1GM0A 3B6XA 1XFRA 1S5GZ 1A75B 2KHNA 1CKKA 1DELA 3QRXA 5TNCA 1YVHA 2EC6B 1RECA 2BAPA 3WNXB 3I5IB 3O4XA 2H61A 2KI6C 2WCEA 1TCOB 3NHIA 5G08A 3LK1A 1QX2A 1TRFA 2MJWB 4JD9A 5K89A 4R1EA 2EGDA 4CLNA 1LVCD 1F54A 2AAOA 2LP2A 2L50A 2NCOA 1UURA 1YTZC 3I5FC 3BUXB 3CS1A 4ETOA 2L2CA 2KNEA 1SCMB 3B88A 3GK4X 4BY4A 3V2LA 3OP0A 5AXIA 4KYNA 3CZ1A 1BR1B 1IWQA 5DKNA 1DC1A 3D77A 1T14A 1J1EA 2LLUA 1HT9A 2I7AA 4PE0A 1BT6A 1EL4A 2GTEA 3CZ0A 3CR5X 2CTNA 2M7LA 3KPXA 3DVMA 5HKYA 1M45A 4PHMA 2YGUA 1NCXA 2WC8A 4WQ2A 3VRPA 3ICBA 3GOFA 1TUZA 1QASA 2CT9A 2FOTA 2OS8B 3SG6A 5IBWA 2I94A 1Y1AA 1S5GY 3SS4A 2K2AA 2LVJA 2D8NA 4XYNA 2NXQA 4FTGA 1SRAA 2LVKA 1E8AA 1UHHA 5AEQA 4DIRA 1DF0B 2Y4QA 1L2OB 1B7TZ 3Q8IA 1KFXL 2JQ6A 2EHBA 1WY9A 2A4JA 4UPGA 3S0BA 2F2PA 3VRNA 2L98A 4FQTA 3N7HA 1RK9A 4YI9A 2KBMA 4QJ4B 2L4HA 1QV1A 1XFUO 3SG2A 2PALA 5I94A 2K7OA 2CBLA 1BR4B 4GAOA 4I5JA 1SW8A 2PVBA 1GQMA 1SBJA 1PULA 3OX6A 1K9KA 1QATA 4PCWA 3SIBA 3SG3A 2LVIA 3QMEA 5AFPA 4ORCB 2E6WA 1VRKA 2KI4C 5HYDA 5KTYA 1SL8A 1HQVA 1JC2A 1M39A 2O5GA 2BE6A 1R6PA 3CTNA 5HLVA 1A03A 3I5HB 2WCHA 5B8IB 1OMDA 2JC2A 1S6JA 2WCLA 5I8NA 2CCMA 1U5IB 1UHJA 3H4SE 1BLQA 3TUYB 2I2RE 2KAXA 4YGEB 1YURA
chains in the Genus database with same CATH topology
3NGVA 3VB1A 2WCMA 3BJHA 2ERBA 3NHTA 2PQLA 2JPOA 2QEOA 3OGNA 2QEBA 3D74A 3CDNA 3S0DA 3B86A 3B7AA 2QEHA 2P71A 3L4AA 3R1PA 2WC6A 2H8VA 2QDIA 3FE8A 3RZSA 3K1EA 3BFHA 1TUJA 3D78A 4F7FA 1GM0A 2WCJA 3B6XA 1XFRA 3DYEA 4INXA 2P70A 4OZDA 3BFBA 3NHIA 4JD9A 3CZ2A 3FE6A 3R1OA 2WCKA 2L2CA 1C3ZA 3B88A 3V2LA 1OOIX 3CZ1A 3D77A 1QWVA 1T14A 3S0AA 3S0GA 2GTEA 3CZ0A 3S0EA 2KPHA 1DQEA 3DY9A 3S0FA 3R72A 2FJYA 3L47A 1ORGA 3CYZA 1OOHA 2QEVA 4PT1A 1C3YA 3Q8IA 1P28A 3S0BA 1OOFA 4FQTA 3N7HA 1LS8A 3R1VA 1OOGA 4INWA 3CABA 1TWOA 3QMEA 3BFAA 3FE9A 3DXLA 3PJIA 3D75A 5DICA 1OW4A 2WC5A 3L4LA 2WCHA 2WCLA 3B87A 3DZTA 3D73A 3D76A 5EL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGV A;  3VB1 A;  2WCM A;  3BJH A;  2ERB A;  3NHT A;  2PQL A;  2JPO A;  2QEO A;  3OGN A;  2QEB A;  3D74 A;  3CDN A;  3S0D A;  3B86 A;  3B7A A;  2QEH A;  2P71 A;  3L4A A;  3R1P A;  2WC6 A;  2H8V A;  2QDI A;  3FE8 A;  3RZS A;  3K1E A;  3BFH A;  1TUJ A;  3D78 A;  4F7F A;  1GM0 A;  2WCJ A;  3B6X A;  1XFR A;  3DYE A;  4INX A;  2P70 A;  4OZD A;  3BFB A;  3NHI A;  4JD9 A;  3CZ2 A;  3FE6 A;  3R1O A;  2WCK A;  2L2C A;  1C3Z A;  3B88 A;  3V2L A;  1OOI X;  3CZ1 A;  3D77 A;  1QWV A;  1T14 A;  3S0A A;  3S0G A;  2GTE A;  3CZ0 A;  3S0E A;  2KPH A;  1DQE A;  3DY9 A;  3S0F A;  3R72 A;  2FJY A;  3L47 A;  1ORG A;  3CYZ A;  1OOH A;  2QEV A;  4PT1 A;  1C3Y A;  3Q8I A;  1P28 A;  3S0B A;  1OOF A;  4FQT A;  3N7H A;  1LS8 A;  3R1V A;  1OOG A;  4INW A;  3CAB A;  1TWO A;  3QME A;  3BFA A;  3FE9 A;  3DXL A;  3PJI A;  3D75 A;  5DIC A;  1OW4 A;  2WC5 A;  3L4L A;  2WCH A;  2WCL A;  3B87 A;  3DZT A;  3D73 A;  3D76 A;  5EL2 A; 
#chains in the Genus database with same CATH topology
 1KQM B;  1Z4H A;  5JOL A;  2F3Y A;  1DGV A;  3EK8 A;  1EJ3 A;  3VB1 A;  1Q80 A;  1TTX A;  2KSP A;  2WCM A;  1B7T Y;  1DJX A;  1W7I B;  2R2I A;  3BJH A;  1JSA A;  2HET A;  1WRZ A;  1YR5 A;  1A4P A;  1SSE B;  2MHH A;  1QLS A;  1NX1 A;  2JPO A;  3AKA A;  1LA3 A;  3PLF B;  1CMF A;  3S0D A;  1FBV A;  3B86 A;  1KK7 Z;  3FWC A;  1AJ5 A;  2G9B A;  5HL1 A;  2RGI A;  2M29 A;  4YGC B;  4AQI A;  1NPQ A;  2LHI A;  1S6C A;  1ZAC A;  2KOT A;  2P71 A;  3K21 A;  4JQ0 D;  4XJK B;  1TNQ A;  1OSA A;  2KGR A;  3MSE B;  3IQQ A;  1DMO A;  1NIW A;  2F8P A;  1K9P A;  1OMR A;  2I18 A;  2IS9 A;  2TN4 A;  1OOJ A;  2BBM A;  2JNX A;  3BFH A;  2ZRT A;  3JVT B;  4DCK A;  1XK4 A;  2MLF C;  2F33 A;  3NSL A;  1QX7 A;  2Q4U A;  3BOW A;  5I2Q A;  1TOP A;  1UP5 A;  3IQO A;  4ICB A;  4NDC A;  2CNP A;  2P70 A;  1N0Y A;  2JUL A;  4P2Y B;  1TNX A;  3O4Y A;  2KYC A;  3BFB A;  1A2X A;  2E30 A;  5DKQ A;  1CDM A;  2LMT A;  2BL0 B;  1K9U A;  3BYA A;  2PRU A;  4GUK A;  1ODB A;  1YRU B;  1OZS A;  2JTZ A;  1MF8 B;  2JTT A;  1B4C A;  1ZFS A;  2K8M B;  3F45 A;  3DD4 A;  3DVK A;  3D0Y A;  1C3Z A;  3JTD C;  2SAS A;  1KWO C;  2KFH A;  3BXK A;  1KK7 Y;  1TCF A;  2K0J A;  4IJ7 A;  1SL7 A;  2LNK A;  3S0A A;  4QJ3 B;  2M9G A;  1PRW A;  1CMG A;  4YGB B;  1CM1 A;  4HRG A;  3D10 A;  1NCZ A;  4M2Q A;  1AUI B;  2KPH A;  1XFV O;  4NQG A;  1ALV A;  2BKH B;  2PYQ A;  3OBV A;  1AJ4 A;  1XK4 C;  1C7V A;  2M1K B;  2LHL A;  1QVI Z;  2OTG B;  1S1E A;  3CWG A;  1DJG A;  3KF9 A;  1YUS A;  2KFF A;  4MVF A;  2JPT A;  3R72 A;  4GPL B;  3TZ1 A;  1SKT A;  1S3P A;  1K90 D;  1QJT A;  3PSR A;  4N1F A;  3L47 A;  1KCY A;  1YUU A;  1QIW A;  2KI4 B;  2PAS A;  3FS7 A;  3NXA A;  2LMV A;  2M7N A;  4WRI A;  2BCX A;  3PM8 A;  2JT3 A;  3EKJ A;  1B9A A;  1DJW A;  1KSO A;  1Y1X A;  2COL B;  1SMG A;  2PMY A;  2KBI A;  1SR6 C;  3PAT A;  1IKU A;  2ISD A;  3PAL A;  5I2L A;  2BCA A;  3BUM B;  2NZ0 A;  4MN0 A;  2LAN A;  1AVS A;  2JOJ A;  1PAL A;  4Q04 A;  2BNX A;  3CAB A;  3EG5 B;  3GK1 A;  4INW A;  1XFX O;  2K61 A;  3BFA A;  3CR2 A;  1IJ6 A;  3PN7 B;  2BEC A;  3RM1 A;  1K8U A;  1OZO A;  1MUX A;  4I5N B;  1OQP A;  2M49 B;  1UWO A;  4DRW A;  1JF0 A;  1QLK A;  1QVI Y;  1LKJ A;  5DIC A;  1OW4 A;  4C0L A;  4GNK B;  1C07 A;  3L4L A;  1G4Y R;  1IGV A;  1FI6 A;  1H4B A;  2BKI B;  3B87 A;  3DZT A;  3D73 A;  4TNC A;  3D76 A;  1QV0 A;  1YVL A;  1DGU A;  2L5X B;  4L9M A;  1N2D A;  3CLN A;  1PSR A;  2F2O A;  2LLT A;  2NLN A;  4GBA A;  2LAP A;  1YX8 A;  4NDB A;  1CLB A;  2JWW A;  3NSI A;  4N1G A;  3DVE A;  2GV5 A;  3SG7 A;  1QTX A;  2Y1M A;  3LL8 B;  1MWN A;  3CR4 X;  1ALW A;  1DJI A;  3CDN A;  3TS5 C;  2MA2 A;  2K7D A;  2K60 A;  2KYF A;  4MBE A;  5CPV A;  1J1D A;  2LCP A;  1J55 A;  3O2P A;  3PM2 A;  2L4I A;  3EVR A;  1B8C A;  3L4A A;  1XVJ A;  2QPT A;  1B8R A;  1RRO A;  2H8V A;  2JU0 A;  2Y1N A;  1NX3 A;  3FE8 A;  4GGF C;  2LLS A;  2B1U A;  3K1E A;  4USL A;  1TUJ A;  4ZCV A;  2EC6 C;  1XYD A;  4YI8 A;  4F7F A;  3I5I C;  1JFK A;  2WCJ A;  1JUO A;  2KQ6 A;  1QIV A;  1KFX S;  2L0P A;  1PVA A;  2DOQ A;  2V53 A;  1IG5 A;  2GGM A;  1SK6 D;  1AP4 A;  4C0J A;  5FYX A;  1CDP A;  1DF0 A;  1DJY A;  3C1V A;  3BOW B;  2H2K A;  2BBN A;  1WLZ A;  2HQ8 A;  2KDH A;  2LVV A;  2WCB A;  1DTL A;  3AAK A;  1SCM C;  3CZ2 A;  3FWB A;  3IF7 A;  2SCP A;  3SG4 A;  3VRO A;  1QS7 A;  3FE6 A;  1ZMZ A;  1CM4 A;  2F3Z A;  2OPO A;  3R1O A;  1NCY A;  4PAL A;  4PHJ A;  1NX0 A;  2WCK A;  4JKT A;  3EKH A;  4OKH A;  4C0K A;  1B1G A;  3UO9 A;  1Z2C B;  3I5F B;  2JNF A;  1DVI A;  1OE9 B;  2Y5I A;  1CDN A;  1SY9 A;  2MBX A;  1PSB A;  2JRF A;  1CB1 A;  3OB2 B;  3KEV A;  1SYM A;  3D0Y B;  2O60 A;  2L5Y A;  5KSZ A;  3S0E A;  3SS5 A;  3A4U B;  1WDC C;  1Y1U A;  1QX5 B;  1DQE A;  4PDZ A;  3DY9 A;  2L51 A;  1CFD A;  3KHE A;  1K96 A;  3S0F A;  1KFU L;  3EVU A;  3GK2 A;  2ZN8 A;  1EG4 A;  1V1F A;  1YUT A;  2PSR A;  2MRD A;  4M2O A;  3SJS A;  2WND A;  3WHU B;  3SG5 A;  1L2O C;  4MZK A;  2FJY A;  5BPJ A;  4QJ5 B;  1UHN A;  1LXF C;  1KQV A;  2ZND A;  1ORG A;  3CYZ A;  4MZJ A;  1FW4 A;  1F71 A;  4PT1 A;  1C3Y A;  2JT0 A;  1KSM A;  4BY5 A;  1RWY A;  2NCP A;  3OX5 A;  4CPV A;  3HCM A;  1OOF A;  1BF5 A;  4DUQ A;  1SL9 A;  2K7B A;  1YRT B;  3R1V A;  1K95 A;  4I5L B;  5D7F A;  5PAL A;  1M63 B;  1J7Q A;  2Q91 A;  4JPZ B;  1MXE A;  5GQQ C;  4OV2 A;  4PE7 A;  5FI6 A;  3TDI A;  1L7Z A;  4XJK A;  2CXJ A;  4GGN A;  1RFJ A;  1UHI A;  2VRG A;  3TDU A;  4CID A;  3AAJ A;  3I5H C;  4P5O E;  1NSH A;  4NDD A;  1CNP A;  4MZL A;  1Y6W A;  2AUC A;  2KGB C;  3TUY C;  1Y0V H;  1KQM C;  2WC5 A;  4OVN F;  1EH2 A;  2P6B B;  2FJU B;  2KFG A;  5EL2 A;  1BOC A;  1W9Z A;  5CSI A;  2JT8 A;  3I5G C;  2LE9 B;  4HSZ A;  5J3X A;  1B47 A;  3DF0 A;  1KK8 C;  4D1E A;  4DS7 A;  3NHT A;  3PFV A;  2HQW A;  4ZCU A;  1BJF A;  2PQL A;  3WHT B;  2LC5 A;  3FIA A;  1XA5 A;  2QEO A;  1CTR A;  2HF5 A;  3OGN A;  4MEW A;  1EXR A;  1G33 A;  5HLO A;  1PK0 D;  1UHK A;  1DT7 B;  2QEH A;  2WOS A;  1J7P A;  1MHO A;  2HPS A;  1B8L A;  3A8R A;  3R1P A;  1XFY O;  1AHR A;  2M3W A;  3JVT C;  1H8B A;  4HRH A;  4WQ3 A;  4AOM A;  1F55 A;  2KLD A;  1A75 A;  2LP3 A;  4GGF A;  1JFJ A;  1NX2 A;  2QDI A;  2QAC A;  1ZUZ A;  2WOR A;  1V1G A;  1CFP A;  3HX4 A;  3D78 A;  1S6I A;  3DVJ A;  5AAN A;  3DYE A;  2BL0 C;  4INX A;  3OB1 B;  3E3R A;  2M8U A;  3EK7 A;  4OZD A;  4YRU A;  4F0Z B;  2MLE C;  2K7C A;  1K93 D;  4I5K A;  4N5X A;  3BQ3 A;  1DEK A;  1WDC B;  4YGD B;  3LCP C;  5CSJ A;  1GGW A;  5I2O A;  2H61 C;  1BMO A;  1F4Q A;  1D1O A;  1ZOT B;  2LUX A;  4MRX A;  4ORA B;  1CLM A;  3CGA A;  3CZT X;  2FCD A;  4OR9 B;  1IRJ A;  1RJV A;  1OOI X;  1WRK A;  1W7J B;  3TDZ A;  1QWV A;  2WCF A;  1NP8 A;  1UUS A;  2MAZ A;  1NUB A;  4A4B A;  3S0G A;  3JTD B;  4MLW A;  1KWO B;  1F70 A;  1S26 D;  4YGA A;  1N65 A;  4M2P A;  2OTG C;  4PHK A;  4CFR A;  3BUW B;  5FI2 A;  1BU3 A;  1J7R A;  1IIO A;  4FQO A;  2LM5 A;  1CDL A;  1MXL C;  4GFT A;  4PE4 A;  3M0W A;  3O78 A;  1YX7 A;  3VRQ A;  2KAY A;  1MQ1 A;  1BG1 A;  1OOH A;  2QEV A;  1R2U A;  2K2F A;  1C7W A;  3OHM B;  3LK0 A;  1GGZ A;  1P28 A;  1DJZ A;  4JWQ A;  5HKW A;  1K2H A;  3EVV A;  1DJH A;  2GGZ A;  1JWD A;  2M1U A;  3AKB A;  5D69 A;  1LS8 A;  2AMI A;  5FI7 A;  3VGO A;  3VRR A;  3WXA A;  1FF1 A;  1XFW O;  3I5G B;  1J7O A;  1OOG A;  1SR6 B;  1TN4 A;  2OS8 C;  1IH0 A;  3ZWH A;  1PVB A;  3SS3 A;  4CFQ A;  1KK8 B;  3PN7 C;  4PE1 A;  1CFF A;  1TWO A;  3BUN B;  1M31 A;  3NSO A;  1X02 A;  1OMV A;  1WRL A;  3FE9 A;  5DKR A;  1JBA A;  1LIN A;  3DXL A;  4E68 A;  1CFC A;  2BE4 A;  4HRE E;  3PJI A;  1U5I A;  1FPW A;  4IL1 A;  3D75 A;  5D3O A;  1WLM A;  1TNP A;  3BUO B;  3NSK A;  1BOD A;  1XO5 A;  2KQY A;  1F4O A;  1SCV A;  4MSP A;  3O6B A;  5HKZ A;  2JXC A;  2L2E A;  1IQ5 A;  1M46 A;  1NWD A;  3NGV A;  2JXL A;  3UNW A;  1IJ5 A;  3SIA A;  1MR8 A;  4MRY A;  3KO0 A;  5AER A;  5KU1 A;  1F8H A;  3RLZ A;  5CSN A;  5CSF A;  2JZI A;  1GJY A;  1TNW A;  1TIZ A;  2ERB A;  2ZFD A;  5ER4 X;  1AK8 A;  1S36 A;  4ORB B;  1XFZ O;  2LV7 A;  2KI6 D;  2QEB A;  1A29 A;  3D74 A;  5F6T A;  3DF0 B;  1CLL A;  1SNL A;  5ER5 A;  2LUC A;  4A4C A;  1NYA A;  2KLE A;  1JF2 A;  3B7A A;  3ZNI A;  2FCE A;  2G2B A;  4U8D A;  3TS5 B;  2ZRS A;  3EK4 A;  4AQJ A;  2ZNE A;  1KFU S;  2WC6 A;  1IQ3 A;  2BCB A;  1EG3 A;  1LA0 A;  1G8I A;  4PHN A;  2LMU A;  1QXP A;  2M0R A;  3LLE A;  4OCI A;  3RZS A;  3IVT A;  1SPY A;  1K94 A;  1RTP 1;  5JJG A;  4YBH B;  2KAV A;  2M97 A;  2ZN9 A;  2ZKM X;  1FI5 A;  1GM0 A;  3B6X A;  1XFR A;  1S5G Z;  1A75 B;  2KHN A;  1CKK A;  1DEL A;  3QRX A;  5TNC A;  1YVH A;  2EC6 B;  1REC A;  2BAP A;  3WNX B;  3I5I B;  3O4X A;  2H61 A;  2KI6 C;  2WCE A;  1TCO B;  3NHI A;  5G08 A;  3LK1 A;  1QX2 A;  1TRF A;  2MJW B;  4JD9 A;  5K89 A;  4R1E A;  2EGD A;  4CLN A;  1LVC D;  1F54 A;  2AAO A;  2LP2 A;  2L50 A;  2NCO A;  1UUR A;  1YTZ C;  3I5F C;  3BUX B;  3CS1 A;  4ETO A;  2L2C A;  2KNE A;  1SCM B;  3B88 A;  3GK4 X;  4BY4 A;  3V2L A;  3OP0 A;  5AXI A;  4KYN A;  3CZ1 A;  1BR1 B;  1IWQ A;  5DKN A;  1DC1 A;  3D77 A;  1T14 A;  1J1E A;  2LLU A;  1HT9 A;  2I7A A;  4PE0 A;  1BT6 A;  1EL4 A;  2GTE A;  3CZ0 A;  3CR5 X;  2CTN A;  2M7L A;  3KPX A;  3DVM A;  5HKY A;  1M45 A;  4PHM A;  2YGU A;  1NCX A;  2WC8 A;  4WQ2 A;  3VRP A;  3ICB A;  3GOF A;  1TUZ A;  1QAS A;  2CT9 A;  2FOT A;  2OS8 B;  3SG6 A;  5IBW A;  2I94 A;  1Y1A A;  1S5G Y;  3SS4 A;  2K2A A;  2LVJ A;  2D8N A;  4XYN A;  2NXQ A;  4FTG A;  1SRA A;  2LVK A;  1E8A A;  1UHH A;  5AEQ A;  4DIR A;  1DF0 B;  2Y4Q A;  1L2O B;  1B7T Z;  3Q8I A;  1KFX L;  2JQ6 A;  2EHB A;  1WY9 A;  2A4J A;  4UPG A;  3S0B A;  2F2P A;  3VRN A;  2L98 A;  4FQT A;  3N7H A;  1RK9 A;  4YI9 A;  2KBM A;  4QJ4 B;  2L4H A;  1QV1 A;  1XFU O;  3SG2 A;  2PAL A;  5I94 A;  2K7O A;  2CBL A;  1BR4 B;  4GAO A;  4I5J A;  1SW8 A;  2PVB A;  1GQM A;  1SBJ A;  1PUL A;  3OX6 A;  1K9K A;  1QAT A;  4PCW A;  3SIB A;  3SG3 A;  2LVI A;  3QME A;  5AFP A;  4ORC B;  2E6W A;  1VRK A;  2KI4 C;  5HYD A;  5KTY A;  1SL8 A;  1HQV A;  1JC2 A;  1M39 A;  2O5G A;  2BE6 A;  1R6P A;  3CTN A;  5HLV A;  1A03 A;  3I5H B;  2WCH A;  5B8I B;  1OMD A;  2JC2 A;  1S6J A;  2WCL A;  5I8N A;  2CCM A;  1U5I B;  1UHJ A;  3H4S E;  1BLQ A;  3TUY B;  2I2R E;  2KAX A;  4YGE B;  1YUR A; 
#chains in the Genus database with same CATH homology
 3NGV A;  3VB1 A;  2WCM A;  3BJH A;  2ERB A;  3NHT A;  2PQL A;  2JPO A;  2QEO A;  3OGN A;  2QEB A;  3D74 A;  3CDN A;  3S0D A;  3B86 A;  3B7A A;  2QEH A;  2P71 A;  3L4A A;  3R1P A;  2WC6 A;  2H8V A;  2QDI A;  3FE8 A;  3RZS A;  3K1E A;  3BFH A;  1TUJ A;  3D78 A;  4F7F A;  1GM0 A;  2WCJ A;  3B6X A;  1XFR A;  3DYE A;  4INX A;  2P70 A;  4OZD A;  3BFB A;  3NHI A;  4JD9 A;  3CZ2 A;  3FE6 A;  3R1O A;  2WCK A;  2L2C A;  1C3Z A;  3B88 A;  3V2L A;  1OOI X;  3CZ1 A;  3D77 A;  1QWV A;  1T14 A;  3S0A A;  3S0G A;  2GTE A;  3CZ0 A;  3S0E A;  2KPH A;  1DQE A;  3DY9 A;  3S0F A;  3R72 A;  2FJY A;  3L47 A;  1ORG A;  3CYZ A;  1OOH A;  2QEV A;  4PT1 A;  1C3Y A;  3Q8I A;  1P28 A;  3S0B A;  1OOF A;  4FQT A;  3N7H A;  1LS8 A;  3R1V A;  1OOG A;  4INW A;  3CAB A;  1TWO A;  3QME A;  3BFA A;  3FE9 A;  3DXL A;  3PJI A;  3D75 A;  5DIC A;  1OW4 A;  2WC5 A;  3L4L A;  2WCH A;  2WCL A;  3B87 A;  3DZT A;  3D73 A;  3D76 A;  5EL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...