2QEOA

Crystal structure of anopheles gambiae d7r4-norepinephrine complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
144
structure length
144
Chain Sequence
b'ETVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
total genus 58
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qeoA00
2WCJA 3RZSA 2WCHA 3CZ0A 3D74A 2P70A 2WC5A 2WC6A 3BFHA 2L2CA 1OOGA 3NHTA 2JPOA 3S0DA 2QEOA 3BJHA 2WCLA 3B6XA 2GTEA 1P28A 1TWOA 4F7FA 3B7AA 3R1VA 1GM0A 2H8VA 3DY9A 3QMEA 3S0GA 1ORGA 3S0EA 3B88A 4INWA 3D77A 3V2LA 3R1PA 4PT1A 1OW4A 4INXA 1XFRA 3BFBA 3VB1A 3B86A 3CZ1A 1OOFA 5DICA 3PJIA 1LS8A 1OOIX 2QEBA 3L47A 3OGNA 3K1EA 3NHIA 3CZ2A 2WCKA 3R1OA 2QDIA 3S0FA 1DQEA 1TUJA 4OZDA 3FE8A 3CABA 3DYEA 1C3ZA 3DXLA 2WCMA 2P71A 3D78A 3Q8IA 5EL2A 3FE9A 3CDNA 2QEVA 3D76A 2FJYA 1QWVA 4FQTA 3NGVA 3S0AA 3DZTA 1T14A 4JD9A 3R72A 2ERBA 3FE6A 3D75A 3L4LA 2PQLA 3B87A 3L4AA 2QEHA 3CYZA 2KPHA 3N7HA 3S0BA 3BFAA 1OOHA 3D73A 1C3YA
chains in the Genus database with same CATH superfamily
1Y0VH 3PN7B 4WQ3A 1J7RA 1BR4B 3VROA 3RZSA 1BU3A 1X02A 2BE6A 4FQOA 2EC6B 2AAOA 2L98A 2P70A 2ZNDA 3I5IB 4DRWA 2VRGA 1G33A 3FWBA 2B1UA 2JWWA 4YGDB 3JVTC 2LV7A 1TCOB 2ZN9A 4AQJA 2LMVA 1G4YR 3SG6A 1WLZA 4XYNA 1LKJA 1NCYA 5CSIA 4A4CA 4CIDA 4UPGA 1B8RA 1SCVA 1JF2A 1WRLA 2GTEA 4MSPA 2LVVA 4OKHA 1TUZA 1XFYO 1SSEB 1S5GZ 3FS7A 4AOMA 1KCYA 4WQ2A 4U8DA 2F33A 2PYQA 2IS9A 1AVSA 4ZCVA 4MZJA 1N65A 1W9ZA 2Y5IA 1M39A 2H2KA 3R1VA 3SS4A 1L2OB 1YRTB 1EG4A 1ZFSA 2D8NA 3DVKA 4HRGA 1XK4A 2HQ8A 3DY9A 4IJ7A 1SCMC 4MEWA 1JBAA 1K95A 2JXCA 4Q04A 4R1EA 4PCWA 1UURA 3KHEA 1QVIY 1K90D 3O4YA 3TS5B 2JOJA 4C0JA 5I94A 2RGIA 4INWA 1F71A 1NSHA 2A4JA 2BBNA 5CSNA 3EVVA 1JFJA 4PT1A 2L2EA 2GGZA 4JWQA 5F6TA 5JOLA 1UP5A 3D0YA 1KFUS 3BFBA 1BLQA 3I5HC 1JFKA 3PSRA 2LHLA 3VB1A 4NQGA 3TUYB 1R6PA 4CPVA 2F2PA 1SYMA 2LVJA 1K93D 4DIRA 1K9KA 2HF5A 3QRXA 1QATA 1CM4A 2NCOA 2JPTA 2BE4A 3L47A 2MLEC 1XVJA 1PSBA 3AAJA 3OGNA 4I5NB 4A4BA 3BUXB 4GNKB 4JQ0D 2KYCA 4OR9B 1BR1B 2WCBA 2LM5A 3UO9A 1NX1A 2L4HA 5JJGA 1UHIA 3S0FA 2JT0A 1YX8A 2GV5A 1SR6B 2BCXA 2Y4QA 4QJ3B 3CZTX 1CFPA 4PE0A 1KQVA 1OQPA 1U5IA 4XJKA 2M7LA 1DGVA 3IVTA 1CFDA 3EKJA 3LLEA 2HETA 3OB2B 1DJHA 3OB1B 1JC2A 2FCEA 4ORAB 5AFPA 1J7OA 2PVBA 2LAPA 2P71A 3D78A 3Q8IA 3FE9A 1OSAA 3CDNA 4AQIA 1BF5A 2NLNA 5HKZA 1DF0B 4PHKA 3RLZA 2ZFDA 1J55A 4YRUA 3O78A 1WDCB 1YUUA 5FYXA 4YI8A 2MHHA 5K89A 5D3OA 3OP0A 1B7TY 2BBMA 2ZRTA 2AMIA 3MSEB 3IQOA 2KI6C 2KFFA 1A75B 4ZCUA 2F3ZA 2COLB 4OVNF 3B87A 1D1OA 3EG5B 3L4AA 5AANA 3M0WA 2KPHA 1DVIA 3N7HA 2JTZA 3S0BA 2BKHB 2YGUA 3BOWB 1JF0A 1OOHA 4KYNA 2KNEA 4MVFA 2WCJA 1XK4C 4ETOA 1IRJA 2MBXA 4C0KA 3VRRA 5FI7A 2WC5A 2WC6A 1OMDA 1PRWA 1Y6WA 2I18A 2L2CA 3PATA 3SG2A 1SRAA 2ZNEA 3A4UB 4JKTA 2JPOA 3UNWA 1ALWA 2KQYA 2BL0C 1CFFA 1KWOC 2K2FA 1SW8A 3I5FB 3BJHA 4QJ5B 3B6XA 1MHOA 4XJKB 1M46A 1RFJA 1IGVA 1W7IB 2L5XB 2LP3A 3O4XA 3IQQA 3CR4X 4MZKA 3B7AA 5KU1A 1Y1UA 2M29A 3KF9A 1RECA 1IJ5A 1R2UA 1BJFA 2H8VA 3FWCA 1A03A 1KQMC 1QX2A 2OTGB 1NWDA 3BUMB 5CSJA 1TRFA 3SS5A 3OBVA 4NDBA 1ORGA 3CWGA 5TNCA 1AHRA 2SCPA 1DJGA 3CS1A 3I5GC 3PFVA 1B1GA 3F45A 1QTXA 1FW4A 1S5GY 3D77A 5CPVA 1F70A 1NX0A 3R1PA 2M8UA 3SS3A 5B8IB 4M2PA 1AUIB 1CLMA 2MAZA 1AJ5A 1YX7A 2CCMA 1QS7A 1SL8A 2WNDA 1JSAA 3WHTB 4M2OA 1OE9B 4N5XA 1F4OA 1OOFA 1UHJA 3O6BA 1BOCA 3EKHA 1K96A 1LS8A 2KDHA 1KK8B 1NIWA 2M1KB 1C07A 2JULA 1KK7Z 1DJYA 2WORA 3NSLA 2Q91A 2OS8B 2H61A 2K2AA 2QEBA 5HLVA 1QLSA 1DJIA 3AKBA 2F2OA 3IF7A 3PN7C 1DF0A 2KOTA 2EC6C 2ZN8A 3I5IC 3KO0A 1OZOA 4FTGA 4YGEB 4OZDA 1J1DA 1DJXA 2G2BA 2KI4B 2M3WA 3EK4A 3O2PA 2K7OA 1GGZA 1V1FA 1ZMZA 2F8PA 2KFGA 3EVUA 3NSKA 5IBWA 1CFCA 1A75A 3PALA 4M2QA 1JWDA 1JUOA 1B8CA 1YTZC 4OV2A 2KGRA 3DXLA 4DCKA 4P5OE 2ISDA 2M7NA 4WRIA 1QX7A 1LXFC 3BOWA 2BCAA 2CXJA 5FI6A 1OZSA 3LK1A 5D7FA 1NX3A 1L2OC 4MLWA 2NZ0A 4N1GA 2K7DA 5DKQA 1QXPA 1CDMA 1UHHA 1IWQA 1OMVA 5J3XA 1KFXL 1NCZA 5AERA 1QIVA 3S0AA 1T14A 3BQ3A 4JD9A 2LC5A 2I7AA 1IG5A 1CDNA 3PLFB 1B4CA 3TDUA 3HX4A 5FI2A 3TS5C 1OOJA 3D75A 3NXAA 1GGWA 1B47A 1TNXA 4C0LA 3LL8B 2KBIA 1AK8A 2LNKA 2LVIA 2KI6D 2QEHA 2JNFA 1Y1XA 3VRNA 1PK0D 1CKKA 2O5GA 1Y1AA 3TDZA 2LCPA 3TUYC 2LE9B 4PALA 1S1EA 2KSPA 1ZACA 2WCHA 4ORBB 3CGAA 1LA0A 3EK8A 1IH0A 1DTLA 3BFHA 1IIOA 2JC2A 1OOGA 1NX2A 1QLKA 3NHTA 3S0DA 2DOQA 4GGFA 1CNPA 2R2IA 2KHNA 5G08A 1KSMA 1S26D 5PALA 3DD4A 3VRPA 1HT9A 1TNWA 1J7QA 4L9MA 1QV1A 1BT6A 1LINA 1DT7B 1P28A 1TWOA 4I5LB 2L5YA 1SR6C 4PHJA 4F7FA 2KBMA 1H4BA 2O60A 2PMYA 2BAPA 2E6WA 2JRFA 1LVCD 4MZLA 4F0ZB 1GM0A 3DVJA 1C7WA 3NSIA 1SKTA 2K8MB 4QJ4B 1A29A 5ER4X 1XFXO 1YURA 2H61C 3SG3A 3DVMA 2PSRA 3S0EA 3B88A 1TTXA 1W7JB 1DJWA 1TIZA 2L0PA 5I2OA 4HREE 1CLLA 2M0RA 3CTNA 1CLBA 1BMOA 4NDCA 3AAKA 3V2LA 1WDCC 2KGBC 1S6IA 1OW4A 4INXA 1AP4A 3SIAA 1HQVA 2LVKA 4CLNA 2WCEA 1B9AA 1CB1A 2JNXA 1B7TZ 1CDPA 2JT8A 5DKRA 1XFZO 2KLEA 3B86A 1EG3A 1TN4A 3PM2A 1DMOA 2F3YA 1YVHA 1IKUA 2FCDA 2JQ6A 2HPSA 1ZUZA 1N0YA 1F54A 3PJIA 3ICBA 1OOIX 1YVLA 1NPQA 2LLUA 4IL1A 4N1FA 3JVTB 1K94A 4GFTA 3K1EA 1RTP1 1SBJA 3KEVA 5HYDA 2BNXA 3OX6A 3CZ2A 1ODBA 2WCKA 2LMUA 4GGNA 3E3RA 1SL9A 4PHMA 2MLFC 2G9BA 1IQ5A 2SASA 3OHMB 4DUQA 1OMRA 1ZOTB 2LLSA 3VGOA 1WY9A 4GBAA 2Y1NA 1FF1A 2PASA 3CABA 1YUSA 1QIWA 3DYEA 1EJ3A 3I5FC 1EXRA 4GPLB 3LK0A 4JPZB 3ZNIA 1SCMB 2AUCA 2OPOA 1S3PA 1XO5A 1H8BA 1NCXA 1A2XA 1TNPA 1FI6A 5HKWA 2K0JA 4P2YB 4PE4A 3BUNB 1Q80A 5HKYA 1ALVA 2WC8A 2LLTA 3KPXA 3SJSA 2OTGC 1QWVA 4FQTA 3NGVA 3DZTA 3PM8A 3ZWHA 1DJZA 3FIAA 1MF8B 3R72A 1M63B 2L4IA 1K8UA 2BECA 2I94A 4I5KA 1MXLC 3I5HB 4GGFC 2NXQA 1EH2A 1CM1A 2JTTA 1GJYA 2PALA 2BKIB 5DKNA 5KTYA 2JXLA 1QV0A 1DELA 1K9PA 4USLA 3HCMA 3D73A 2HQWA 2BCBA 1KFXS 1S6JA 3WNXB 2KAXA 1FPWA 1C3YA 1BG1A 1F55A 2E30A 5D69A 5HL1A 1XFWO 3C1VA 1CDLA 1MUXA 1GQMA 3CZ0A 3D74A 4TNCA 1KK8C 4YBHB 4ORCB 2I2RE 1B8LA 1CMFA 4CFRA 1RJVA 2OS8C 3WXAA 3CR2A 1M31A 3DVEA 4PE7A 1TNQA 1SNLA 2WOSA 4NDDA 3RM1A 1L7ZA 2LMTA 2QEOA 4HSZA 2LP2A 2K7BA 4YGBB 1F4QA 1MXEA 1PVBA 1QVIZ 1WRZA 2LANA 2TN4A 2WCLA 1BODA 2V53A 1Z2CB 1KSOA 1F8HA 3GK2A 3TZ1A 5BPJA 2ZKMX 2KI4C 1CTRA 4YGAA 1SMGA 1PALA 2CNPA 2KLDA 2KFHA 4PHNA 1KFUL 1MR8A 2JT3A 5ER5A 5AEQA 1DEKA 4GUKA 3SG5A 3QMEA 2QPTA 1K9UA 1EL4A 1RROA 1V1GA 1PVAA 4MRXA 4MN0A 3S0GA 1YUTA 2LUXA 1LA3A 2M49B 3LCPC 4OCIA 4BY5A 2KAYA 5CSFA 3D10A 2MA2A 2LHIA 3BXKA 3DF0A 1TOPA 3JTDB 2KAVA 3A8RA 4CFQA 2K60A 2JU0A 1XFVO 2K7CA 1XFRA 1QX5B 2PRUA 3GOFA 3AKAA 3NSOA 1J7PA 3GK4X 1K2HA 3VRQA 1QASA 3WHUB 5KSZA 2L51A 4BY4A 1DGUA 3CZ1A 3TDIA 2M97A 2NCPA 2L50A 5DICA 4MRYA 1RK9A 1VRKA 3K21A 3SG7A 2CBLA 1CMGA 2EHBA 3SG4A 2BL0B 3NHIA 1KWOB 2LUCA 3R1OA 4MBEA 2MJWB 2QDIA 1DQEA 1YRUB 1UHNA 1M45A 1TUJA 3D0YB 2KQ6A 2Q4UA 1QJTA 3GK1A 4ICBA 2KYFA 3JTDC 5I8NA 1IQ3A 3FE8A 3SIBA 2P6BB 1FBVA 4PE1A 1E8AA 1C3ZA 1TCFA 1A4PA 1XYDA 1KQMB 2M9GA 3EVRA 1G8IA 1WLMA 1PULA 2FJUB 2WCFA 4DS7A 4E68A 1J1EA 3BUOB 1C7VA 1UWOA 2CTNA 2WCMA 2M1UA 2GGMA 4YI9A 5EL2A 1DC1A 1SL7A 1UUSA 2QEVA 2Y1MA 1SPYA 1SY9A 1SK6D 1N2DA 3EK7A 1NYAA 1Z4HA 3I5GB 3D76A 2K61A 1MQ1A 3OX5A 4HRHA 4D1EA 2FJYA 3DF0B 3BUWB 3H4SE 2JZIA 2ERBA 5HLOA 4YGCB 2CT9A 1S36A 1FI5A 3FE6A 1PSRA 3CLNA 1U5IB 4I5JA 2MRDA 4PDZA 2QACA 3L4LA 3BYAA 2FOTA 1MWNA 1IJ6A 4GAOA 2PQLA 1NP8A 1S6CA 3CR5X 3CYZA 1YR5A 1KK7Y 2ZRSA 1UHKA 1WRKA 5I2QA 3BFAA 1XA5A 1RWYA 5I2LA 5AXIA 2EGDA 1XFUO 1AJ4A 5GQQC 1NUBA
chains in the Genus database with same CATH topology
2WCJA 3RZSA 2WCHA 3CZ0A 3D74A 2P70A 2WC5A 2WC6A 3BFHA 2L2CA 1OOGA 3NHTA 2JPOA 3S0DA 2QEOA 3BJHA 2WCLA 3B6XA 2GTEA 1P28A 1TWOA 4F7FA 3B7AA 3R1VA 1GM0A 2H8VA 3DY9A 3QMEA 3S0GA 1ORGA 3S0EA 3B88A 4INWA 3D77A 3V2LA 3R1PA 4PT1A 1OW4A 4INXA 1XFRA 3BFBA 3VB1A 3B86A 3CZ1A 1OOFA 5DICA 3PJIA 1LS8A 1OOIX 2QEBA 3L47A 3OGNA 3K1EA 3NHIA 3CZ2A 2WCKA 3R1OA 2QDIA 3S0FA 1DQEA 1TUJA 4OZDA 3FE8A 3CABA 3DYEA 1C3ZA 3DXLA 2WCMA 2P71A 3D78A 3Q8IA 5EL2A 3FE9A 3CDNA 2QEVA 3D76A 2FJYA 1QWVA 4FQTA 3NGVA 3S0AA 3DZTA 1T14A 4JD9A 3R72A 2ERBA 3FE6A 3D75A 3L4LA 2PQLA 3B87A 3L4AA 2QEHA 3CYZA 2KPHA 3N7HA 3S0BA 3BFAA 1OOHA 3D73A 1C3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCJ A;  3RZS A;  2WCH A;  3CZ0 A;  3D74 A;  2P70 A;  2WC5 A;  2WC6 A;  3BFH A;  2L2C A;  1OOG A;  3NHT A;  2JPO A;  3S0D A;  2QEO A;  3BJH A;  2WCL A;  3B6X A;  2GTE A;  1P28 A;  1TWO A;  4F7F A;  3B7A A;  3R1V A;  1GM0 A;  2H8V A;  3DY9 A;  3QME A;  3S0G A;  1ORG A;  3S0E A;  3B88 A;  4INW A;  3D77 A;  3V2L A;  3R1P A;  4PT1 A;  1OW4 A;  4INX A;  1XFR A;  3BFB A;  3VB1 A;  3B86 A;  3CZ1 A;  1OOF A;  5DIC A;  3PJI A;  1LS8 A;  1OOI X;  2QEB A;  3L47 A;  3OGN A;  3K1E A;  3NHI A;  3CZ2 A;  2WCK A;  3R1O A;  2QDI A;  3S0F A;  1DQE A;  1TUJ A;  4OZD A;  3FE8 A;  3CAB A;  3DYE A;  1C3Z A;  3DXL A;  2WCM A;  2P71 A;  3D78 A;  3Q8I A;  5EL2 A;  3FE9 A;  3CDN A;  2QEV A;  3D76 A;  2FJY A;  1QWV A;  4FQT A;  3NGV A;  3S0A A;  3DZT A;  1T14 A;  4JD9 A;  3R72 A;  2ERB A;  3FE6 A;  3D75 A;  3L4L A;  2PQL A;  3B87 A;  3L4A A;  2QEH A;  3CYZ A;  2KPH A;  3N7H A;  3S0B A;  3BFA A;  1OOH A;  3D73 A;  1C3Y A; 
#chains in the Genus database with same CATH topology
 1Y0V H;  3PN7 B;  4WQ3 A;  1J7R A;  1BR4 B;  3VRO A;  3RZS A;  1BU3 A;  1X02 A;  2BE6 A;  4FQO A;  2EC6 B;  2AAO A;  2L98 A;  2P70 A;  2ZND A;  3I5I B;  4DRW A;  2VRG A;  1G33 A;  3FWB A;  2B1U A;  2JWW A;  4YGD B;  3JVT C;  2LV7 A;  1TCO B;  2ZN9 A;  4AQJ A;  2LMV A;  1G4Y R;  3SG6 A;  1WLZ A;  4XYN A;  1LKJ A;  1NCY A;  5CSI A;  4A4C A;  4CID A;  4UPG A;  1B8R A;  1SCV A;  1JF2 A;  1WRL A;  2GTE A;  4MSP A;  2LVV A;  4OKH A;  1TUZ A;  1XFY O;  1SSE B;  1S5G Z;  3FS7 A;  4AOM A;  1KCY A;  4WQ2 A;  4U8D A;  2F33 A;  2PYQ A;  2IS9 A;  1AVS A;  4ZCV A;  4MZJ A;  1N65 A;  1W9Z A;  2Y5I A;  1M39 A;  2H2K A;  3R1V A;  3SS4 A;  1L2O B;  1YRT B;  1EG4 A;  1ZFS A;  2D8N A;  3DVK A;  4HRG A;  1XK4 A;  2HQ8 A;  3DY9 A;  4IJ7 A;  1SCM C;  4MEW A;  1JBA A;  1K95 A;  2JXC A;  4Q04 A;  4R1E A;  4PCW A;  1UUR A;  3KHE A;  1QVI Y;  1K90 D;  3O4Y A;  3TS5 B;  2JOJ A;  4C0J A;  5I94 A;  2RGI A;  4INW A;  1F71 A;  1NSH A;  2A4J A;  2BBN A;  5CSN A;  3EVV A;  1JFJ A;  4PT1 A;  2L2E A;  2GGZ A;  4JWQ A;  5F6T A;  5JOL A;  1UP5 A;  3D0Y A;  1KFU S;  3BFB A;  1BLQ A;  3I5H C;  1JFK A;  3PSR A;  2LHL A;  3VB1 A;  4NQG A;  3TUY B;  1R6P A;  4CPV A;  2F2P A;  1SYM A;  2LVJ A;  1K93 D;  4DIR A;  1K9K A;  2HF5 A;  3QRX A;  1QAT A;  1CM4 A;  2NCO A;  2JPT A;  2BE4 A;  3L47 A;  2MLE C;  1XVJ A;  1PSB A;  3AAJ A;  3OGN A;  4I5N B;  4A4B A;  3BUX B;  4GNK B;  4JQ0 D;  2KYC A;  4OR9 B;  1BR1 B;  2WCB A;  2LM5 A;  3UO9 A;  1NX1 A;  2L4H A;  5JJG A;  1UHI A;  3S0F A;  2JT0 A;  1YX8 A;  2GV5 A;  1SR6 B;  2BCX A;  2Y4Q A;  4QJ3 B;  3CZT X;  1CFP A;  4PE0 A;  1KQV A;  1OQP A;  1U5I A;  4XJK A;  2M7L A;  1DGV A;  3IVT A;  1CFD A;  3EKJ A;  3LLE A;  2HET A;  3OB2 B;  1DJH A;  3OB1 B;  1JC2 A;  2FCE A;  4ORA B;  5AFP A;  1J7O A;  2PVB A;  2LAP A;  2P71 A;  3D78 A;  3Q8I A;  3FE9 A;  1OSA A;  3CDN A;  4AQI A;  1BF5 A;  2NLN A;  5HKZ A;  1DF0 B;  4PHK A;  3RLZ A;  2ZFD A;  1J55 A;  4YRU A;  3O78 A;  1WDC B;  1YUU A;  5FYX A;  4YI8 A;  2MHH A;  5K89 A;  5D3O A;  3OP0 A;  1B7T Y;  2BBM A;  2ZRT A;  2AMI A;  3MSE B;  3IQO A;  2KI6 C;  2KFF A;  1A75 B;  4ZCU A;  2F3Z A;  2COL B;  4OVN F;  3B87 A;  1D1O A;  3EG5 B;  3L4A A;  5AAN A;  3M0W A;  2KPH A;  1DVI A;  3N7H A;  2JTZ A;  3S0B A;  2BKH B;  2YGU A;  3BOW B;  1JF0 A;  1OOH A;  4KYN A;  2KNE A;  4MVF A;  2WCJ A;  1XK4 C;  4ETO A;  1IRJ A;  2MBX A;  4C0K A;  3VRR A;  5FI7 A;  2WC5 A;  2WC6 A;  1OMD A;  1PRW A;  1Y6W A;  2I18 A;  2L2C A;  3PAT A;  3SG2 A;  1SRA A;  2ZNE A;  3A4U B;  4JKT A;  2JPO A;  3UNW A;  1ALW A;  2KQY A;  2BL0 C;  1CFF A;  1KWO C;  2K2F A;  1SW8 A;  3I5F B;  3BJH A;  4QJ5 B;  3B6X A;  1MHO A;  4XJK B;  1M46 A;  1RFJ A;  1IGV A;  1W7I B;  2L5X B;  2LP3 A;  3O4X A;  3IQQ A;  3CR4 X;  4MZK A;  3B7A A;  5KU1 A;  1Y1U A;  2M29 A;  3KF9 A;  1REC A;  1IJ5 A;  1R2U A;  1BJF A;  2H8V A;  3FWC A;  1A03 A;  1KQM C;  1QX2 A;  2OTG B;  1NWD A;  3BUM B;  5CSJ A;  1TRF A;  3SS5 A;  3OBV A;  4NDB A;  1ORG A;  3CWG A;  5TNC A;  1AHR A;  2SCP A;  1DJG A;  3CS1 A;  3I5G C;  3PFV A;  1B1G A;  3F45 A;  1QTX A;  1FW4 A;  1S5G Y;  3D77 A;  5CPV A;  1F70 A;  1NX0 A;  3R1P A;  2M8U A;  3SS3 A;  5B8I B;  4M2P A;  1AUI B;  1CLM A;  2MAZ A;  1AJ5 A;  1YX7 A;  2CCM A;  1QS7 A;  1SL8 A;  2WND A;  1JSA A;  3WHT B;  4M2O A;  1OE9 B;  4N5X A;  1F4O A;  1OOF A;  1UHJ A;  3O6B A;  1BOC A;  3EKH A;  1K96 A;  1LS8 A;  2KDH A;  1KK8 B;  1NIW A;  2M1K B;  1C07 A;  2JUL A;  1KK7 Z;  1DJY A;  2WOR A;  3NSL A;  2Q91 A;  2OS8 B;  2H61 A;  2K2A A;  2QEB A;  5HLV A;  1QLS A;  1DJI A;  3AKB A;  2F2O A;  3IF7 A;  3PN7 C;  1DF0 A;  2KOT A;  2EC6 C;  2ZN8 A;  3I5I C;  3KO0 A;  1OZO A;  4FTG A;  4YGE B;  4OZD A;  1J1D A;  1DJX A;  2G2B A;  2KI4 B;  2M3W A;  3EK4 A;  3O2P A;  2K7O A;  1GGZ A;  1V1F A;  1ZMZ A;  2F8P A;  2KFG A;  3EVU A;  3NSK A;  5IBW A;  1CFC A;  1A75 A;  3PAL A;  4M2Q A;  1JWD A;  1JUO A;  1B8C A;  1YTZ C;  4OV2 A;  2KGR A;  3DXL A;  4DCK A;  4P5O E;  2ISD A;  2M7N A;  4WRI A;  1QX7 A;  1LXF C;  3BOW A;  2BCA A;  2CXJ A;  5FI6 A;  1OZS A;  3LK1 A;  5D7F A;  1NX3 A;  1L2O C;  4MLW A;  2NZ0 A;  4N1G A;  2K7D A;  5DKQ A;  1QXP A;  1CDM A;  1UHH A;  1IWQ A;  1OMV A;  5J3X A;  1KFX L;  1NCZ A;  5AER A;  1QIV A;  3S0A A;  1T14 A;  3BQ3 A;  4JD9 A;  2LC5 A;  2I7A A;  1IG5 A;  1CDN A;  3PLF B;  1B4C A;  3TDU A;  3HX4 A;  5FI2 A;  3TS5 C;  1OOJ A;  3D75 A;  3NXA A;  1GGW A;  1B47 A;  1TNX A;  4C0L A;  3LL8 B;  2KBI A;  1AK8 A;  2LNK A;  2LVI A;  2KI6 D;  2QEH A;  2JNF A;  1Y1X A;  3VRN A;  1PK0 D;  1CKK A;  2O5G A;  1Y1A A;  3TDZ A;  2LCP A;  3TUY C;  2LE9 B;  4PAL A;  1S1E A;  2KSP A;  1ZAC A;  2WCH A;  4ORB B;  3CGA A;  1LA0 A;  3EK8 A;  1IH0 A;  1DTL A;  3BFH A;  1IIO A;  2JC2 A;  1OOG A;  1NX2 A;  1QLK A;  3NHT A;  3S0D A;  2DOQ A;  4GGF A;  1CNP A;  2R2I A;  2KHN A;  5G08 A;  1KSM A;  1S26 D;  5PAL A;  3DD4 A;  3VRP A;  1HT9 A;  1TNW A;  1J7Q A;  4L9M A;  1QV1 A;  1BT6 A;  1LIN A;  1DT7 B;  1P28 A;  1TWO A;  4I5L B;  2L5Y A;  1SR6 C;  4PHJ A;  4F7F A;  2KBM A;  1H4B A;  2O60 A;  2PMY A;  2BAP A;  2E6W A;  2JRF A;  1LVC D;  4MZL A;  4F0Z B;  1GM0 A;  3DVJ A;  1C7W A;  3NSI A;  1SKT A;  2K8M B;  4QJ4 B;  1A29 A;  5ER4 X;  1XFX O;  1YUR A;  2H61 C;  3SG3 A;  3DVM A;  2PSR A;  3S0E A;  3B88 A;  1TTX A;  1W7J B;  1DJW A;  1TIZ A;  2L0P A;  5I2O A;  4HRE E;  1CLL A;  2M0R A;  3CTN A;  1CLB A;  1BMO A;  4NDC A;  3AAK A;  3V2L A;  1WDC C;  2KGB C;  1S6I A;  1OW4 A;  4INX A;  1AP4 A;  3SIA A;  1HQV A;  2LVK A;  4CLN A;  2WCE A;  1B9A A;  1CB1 A;  2JNX A;  1B7T Z;  1CDP A;  2JT8 A;  5DKR A;  1XFZ O;  2KLE A;  3B86 A;  1EG3 A;  1TN4 A;  3PM2 A;  1DMO A;  2F3Y A;  1YVH A;  1IKU A;  2FCD A;  2JQ6 A;  2HPS A;  1ZUZ A;  1N0Y A;  1F54 A;  3PJI A;  3ICB A;  1OOI X;  1YVL A;  1NPQ A;  2LLU A;  4IL1 A;  4N1F A;  3JVT B;  1K94 A;  4GFT A;  3K1E A;  1RTP 1;  1SBJ A;  3KEV A;  5HYD A;  2BNX A;  3OX6 A;  3CZ2 A;  1ODB A;  2WCK A;  2LMU A;  4GGN A;  3E3R A;  1SL9 A;  4PHM A;  2MLF C;  2G9B A;  1IQ5 A;  2SAS A;  3OHM B;  4DUQ A;  1OMR A;  1ZOT B;  2LLS A;  3VGO A;  1WY9 A;  4GBA A;  2Y1N A;  1FF1 A;  2PAS A;  3CAB A;  1YUS A;  1QIW A;  3DYE A;  1EJ3 A;  3I5F C;  1EXR A;  4GPL B;  3LK0 A;  4JPZ B;  3ZNI A;  1SCM B;  2AUC A;  2OPO A;  1S3P A;  1XO5 A;  1H8B A;  1NCX A;  1A2X A;  1TNP A;  1FI6 A;  5HKW A;  2K0J A;  4P2Y B;  4PE4 A;  3BUN B;  1Q80 A;  5HKY A;  1ALV A;  2WC8 A;  2LLT A;  3KPX A;  3SJS A;  2OTG C;  1QWV A;  4FQT A;  3NGV A;  3DZT A;  3PM8 A;  3ZWH A;  1DJZ A;  3FIA A;  1MF8 B;  3R72 A;  1M63 B;  2L4I A;  1K8U A;  2BEC A;  2I94 A;  4I5K A;  1MXL C;  3I5H B;  4GGF C;  2NXQ A;  1EH2 A;  1CM1 A;  2JTT A;  1GJY A;  2PAL A;  2BKI B;  5DKN A;  5KTY A;  2JXL A;  1QV0 A;  1DEL A;  1K9P A;  4USL A;  3HCM A;  3D73 A;  2HQW A;  2BCB A;  1KFX S;  1S6J A;  3WNX B;  2KAX A;  1FPW A;  1C3Y A;  1BG1 A;  1F55 A;  2E30 A;  5D69 A;  5HL1 A;  1XFW O;  3C1V A;  1CDL A;  1MUX A;  1GQM A;  3CZ0 A;  3D74 A;  4TNC A;  1KK8 C;  4YBH B;  4ORC B;  2I2R E;  1B8L A;  1CMF A;  4CFR A;  1RJV A;  2OS8 C;  3WXA A;  3CR2 A;  1M31 A;  3DVE A;  4PE7 A;  1TNQ A;  1SNL A;  2WOS A;  4NDD A;  3RM1 A;  1L7Z A;  2LMT A;  2QEO A;  4HSZ A;  2LP2 A;  2K7B A;  4YGB B;  1F4Q A;  1MXE A;  1PVB A;  1QVI Z;  1WRZ A;  2LAN A;  2TN4 A;  2WCL A;  1BOD A;  2V53 A;  1Z2C B;  1KSO A;  1F8H A;  3GK2 A;  3TZ1 A;  5BPJ A;  2ZKM X;  2KI4 C;  1CTR A;  4YGA A;  1SMG A;  1PAL A;  2CNP A;  2KLD A;  2KFH A;  4PHN A;  1KFU L;  1MR8 A;  2JT3 A;  5ER5 A;  5AEQ A;  1DEK A;  4GUK A;  3SG5 A;  3QME A;  2QPT A;  1K9U A;  1EL4 A;  1RRO A;  1V1G A;  1PVA A;  4MRX A;  4MN0 A;  3S0G A;  1YUT A;  2LUX A;  1LA3 A;  2M49 B;  3LCP C;  4OCI A;  4BY5 A;  2KAY A;  5CSF A;  3D10 A;  2MA2 A;  2LHI A;  3BXK A;  3DF0 A;  1TOP A;  3JTD B;  2KAV A;  3A8R A;  4CFQ A;  2K60 A;  2JU0 A;  1XFV O;  2K7C A;  1XFR A;  1QX5 B;  2PRU A;  3GOF A;  3AKA A;  3NSO A;  1J7P A;  3GK4 X;  1K2H A;  3VRQ A;  1QAS A;  3WHU B;  5KSZ A;  2L51 A;  4BY4 A;  1DGU A;  3CZ1 A;  3TDI A;  2M97 A;  2NCP A;  2L50 A;  5DIC A;  4MRY A;  1RK9 A;  1VRK A;  3K21 A;  3SG7 A;  2CBL A;  1CMG A;  2EHB A;  3SG4 A;  2BL0 B;  3NHI A;  1KWO B;  2LUC A;  3R1O A;  4MBE A;  2MJW B;  2QDI A;  1DQE A;  1YRU B;  1UHN A;  1M45 A;  1TUJ A;  3D0Y B;  2KQ6 A;  2Q4U A;  1QJT A;  3GK1 A;  4ICB A;  2KYF A;  3JTD C;  5I8N A;  1IQ3 A;  3FE8 A;  3SIB A;  2P6B B;  1FBV A;  4PE1 A;  1E8A A;  1C3Z A;  1TCF A;  1A4P A;  1XYD A;  1KQM B;  2M9G A;  3EVR A;  1G8I A;  1WLM A;  1PUL A;  2FJU B;  2WCF A;  4DS7 A;  4E68 A;  1J1E A;  3BUO B;  1C7V A;  1UWO A;  2CTN A;  2WCM A;  2M1U A;  2GGM A;  4YI9 A;  5EL2 A;  1DC1 A;  1SL7 A;  1UUS A;  2QEV A;  2Y1M A;  1SPY A;  1SY9 A;  1SK6 D;  1N2D A;  3EK7 A;  1NYA A;  1Z4H A;  3I5G B;  3D76 A;  2K61 A;  1MQ1 A;  3OX5 A;  4HRH A;  4D1E A;  2FJY A;  3DF0 B;  3BUW B;  3H4S E;  2JZI A;  2ERB A;  5HLO A;  4YGC B;  2CT9 A;  1S36 A;  1FI5 A;  3FE6 A;  1PSR A;  3CLN A;  1U5I B;  4I5J A;  2MRD A;  4PDZ A;  2QAC A;  3L4L A;  3BYA A;  2FOT A;  1MWN A;  1IJ6 A;  4GAO A;  2PQL A;  1NP8 A;  1S6C A;  3CR5 X;  3CYZ A;  1YR5 A;  1KK7 Y;  2ZRS A;  1UHK A;  1WRK A;  5I2Q A;  3BFA A;  1XA5 A;  1RWY A;  5I2L A;  5AXI A;  2EGD A;  1XFU O;  1AJ4 A;  5GQQ C;  1NUB A; 
#chains in the Genus database with same CATH homology
 2WCJ A;  3RZS A;  2WCH A;  3CZ0 A;  3D74 A;  2P70 A;  2WC5 A;  2WC6 A;  3BFH A;  2L2C A;  1OOG A;  3NHT A;  2JPO A;  3S0D A;  2QEO A;  3BJH A;  2WCL A;  3B6X A;  2GTE A;  1P28 A;  1TWO A;  4F7F A;  3B7A A;  3R1V A;  1GM0 A;  2H8V A;  3DY9 A;  3QME A;  3S0G A;  1ORG A;  3S0E A;  3B88 A;  4INW A;  3D77 A;  3V2L A;  3R1P A;  4PT1 A;  1OW4 A;  4INX A;  1XFR A;  3BFB A;  3VB1 A;  3B86 A;  3CZ1 A;  1OOF A;  5DIC A;  3PJI A;  1LS8 A;  1OOI X;  2QEB A;  3L47 A;  3OGN A;  3K1E A;  3NHI A;  3CZ2 A;  2WCK A;  3R1O A;  2QDI A;  3S0F A;  1DQE A;  1TUJ A;  4OZD A;  3FE8 A;  3CAB A;  3DYE A;  1C3Z A;  3DXL A;  2WCM A;  2P71 A;  3D78 A;  3Q8I A;  5EL2 A;  3FE9 A;  3CDN A;  2QEV A;  3D76 A;  2FJY A;  1QWV A;  4FQT A;  3NGV A;  3S0A A;  3DZT A;  1T14 A;  4JD9 A;  3R72 A;  2ERB A;  3FE6 A;  3D75 A;  3L4L A;  2PQL A;  3B87 A;  3L4A A;  2QEH A;  3CYZ A;  2KPH A;  3N7H A;  3S0B A;  3BFA A;  1OOH A;  3D73 A;  1C3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...