2QEOA

Crystal structure of anopheles gambiae d7r4-norepinephrine complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
144
structure length
144
Chain Sequence
ETVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
total genus 58
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qeoA00
3QMEA 3DY9A 1TWOA 2WCKA 3OGNA 3DYEA 2WCMA 3D74A 3B87A 3L4LA 2FJYA 2L2CA 4JD9A 3DZTA 3CYZA 3S0FA 2JPOA 3BFBA 2QEHA 3FE9A 3FE8A 3CABA 3L4AA 3NHTA 3D73A 3D78A 3R1VA 3D75A 2WCLA 3L47A 3S0AA 3PJIA 2PQLA 2QDIA 3DXLA 3S0DA 5DICA 3B86A 1OOGA 1C3ZA 2WC6A 3RZSA 1OW4A 3D76A 2QEVA 3BFAA 2QEBA 4FQTA 3Q8IA 3S0GA 5EL2A 1LS8A 3S0EA 1XFRA 1GM0A 3BFHA 1QWVA 1C3YA 3FE6A 4F7FA 3S0BA 1TUJA 3CDNA 1ORGA 2KPHA 3K1EA 2WC5A 3CZ0A 4OZDA 2P71A 2ERBA 3NHIA 3R1PA 4INXA 3R1OA 1OOHA 1OOIX 3N7HA 4PT1A 3R72A 3NGVA 2H8VA 2QEOA 3V2LA 3CZ1A 1T14A 3B88A 3D77A 3VB1A 2GTEA 3BJHA 2P70A 3B7AA 1OOFA 2WCJA 4INWA 3B6XA 2WCHA 3CZ2A 1P28A 1DQEA
chains in the Genus database with same CATH superfamily
1PRWA 3HX4A 1DJGA 3IVTA 1J7RA 2NXQA 1UP5A 2BBNA 2ZN8A 1AUIB 1EL4A 3PLFB 3PN7C 2PRUA 1KCYA 2BKIB 3FS7A 1CFFA 1J7QA 2AUCA 1TOPA 4PALA 2FJYA 1RWYA 1C07A 3CYZA 2CBLA 4D1EA 2JPOA 1XFZO 2OTGC 1YRUB 1KSOA 3FE9A 1YURA 4MZLA 2E30A 2F8PA 4ICBA 1PVAA 4CPVA 2L5YA 1B47A 2LVIA 2JULA 1OMRA 4I5JA 2WCFA 1K95A 3A8RA 2WCLA 3PN7B 2BNXA 4YI8A 3TDIA 5KSZA 4MZJA 1G8IA 2QDIA 3HCMA 1M31A 1SRAA 1KK7Z 4JKTA 4TNCA 2KFFA 1NYAA 2DOQA 3SJSA 4JPZB 1OOGA 2M1KB 2WC6A 1WRLA 3MSEB 2BAPA 4AQIA 2TN4A 1OW4A 2QEVA 1YUUA 1NUBA 2F33A 4GUKA 1K9UA 1QLKA 4ZCUA 2PMYA 2JNFA 2Q4UA 1KFUS 4HRHA 1CMFA 1TUZA 1FBVA 1K96A 1CDNA 1OOJA 3D10A 4C0KA 1J1EA 1F54A 1WY9A 2KI6D 2PYQA 2Q91A 3EKJA 1TNWA 1LS8A 2EC6B 4M2QA 4YGBB 4UPGA 5CPVA 4USLA 1QASA 2LLUA 2LUXA 5CSNA 2ZRTA 1QWVA 1S6IA 5F6TA 1NPQA 2MJWB 3FE6A 4F7FA 3GK4X 3TS5C 3VRNA 4GPLB 3F45A 1F8HA 2KPHA 2JRFA 5AERA 2JT8A 4GGFA 1F70A 4MEWA 1SCMC 1F55A 1YVLA 1MXLC 2GGMA 1Y1UA 2FOTA 4GBAA 2JTTA 1OMDA 1K90D 2EGDA 3EK8A 2JT0A 1B4CA 1WLMA 4C0LA 1AJ4A 3NHIA 4HRGA 2BL0C 4MLWA 2LHLA 4ORAB 3BUXB 4INXA 3PM8A 1B8LA 1L7ZA 2M9GA 3IQQA 1JC2A 3AAJA 5K89A 1JUOA 1OOIX 3N7HA 4WQ3A 1CM1A 3AKBA 2HF5A 4NQGA 4PHNA 4WQ2A 1RJVA 2H8VA 3KPXA 1JF2A 1QV1A 1TCOB 2QEOA 5HYDA 2I18A 1A03A 1RFJA 1U5IB 2JPTA 2LVJA 3TDZA 1SCMB 1SY9A 4ORBB 1BJFA 3EK4A 4JWQA 4U8DA 3UNWA 2AAOA 3VB1A 1QJTA 1LINA 1NX1A 2F2PA 3BOWB 3EVUA 4DIRA 2FJUB 1OOFA 2WCJA 4INWA 3CTNA 1B8RA 3VGOA 3OBVA 1UHJA 3BXKA 2D8NA 1XK4C 4N1FA 4XJKB 2ISDA 1B7TZ 1SPYA 1ZMZA 1C7VA 1ODBA 2KQ6A 3O6BA 2KNEA 1SNLA 3AKAA 3TZ1A 4C0JA 3E3RA 2FCDA 2Y4QA 2H61C 5DKRA 2SASA 3QMEA 1KQMC 4AQJA 1VRKA 4MVFA 1YUSA 1KWOC 2HPSA 4PHJA 1DMOA 1TCFA 2ZNDA 4FQOA 3O2PA 3LK1A 1Y1AA 1QX7A 1XFUO 1QVIZ 3L4LA 4ETOA 1AP4A 2LV7A 1IH0A 1KK8B 1SMGA 2L2CA 1PULA 2JZIA 2CTNA 3BFBA 2Y5IA 1CDMA 1GJYA 3CABA 3KEVA 2JWWA 3M0WA 4MZKA 4YGCB 1HT9A 3L4AA 1XYDA 1G33A 2B1UA 2YGUA 3I5HB 3PFVA 3VRQA 2F3ZA 1L2OC 2KI4C 3D75A 3KF9A 1M63B 4FTGA 1TNPA 3RM1A 3OX5A 3S0AA 2F2OA 5I8NA 1NCZA 2PQLA 1JF0A 5GQQC 2KFHA 3DXLA 1MR8A 2L4HA 3LK0A 3DVKA 4QJ3B 1CNPA 2LNKA 4GGNA 1K9KA 1IWQA 1C3ZA 2GV5A 2NLNA 5DKQA 2MLEC 4DUQA 2L50A 2LLTA 5I2LA 4NDDA 5HL1A 1KFXS 3SG5A 1XVJA 1NX0A 2QEBA 3CWGA 4FQTA 2LE9B 2ZFDA 1BR4B 2ZRSA 3I5GB 4HREE 5CSJA 2KI4B 1S1EA 3S0GA 5HKZA 5JJGA 2LVVA 1Y1XA 1U5IA 1CMGA 1CFPA 1CB1A 3O4YA 2BECA 3AAKA 3O78A 1UHNA 4PE7A 1D1OA 1M45A 1ZACA 1QIWA 2G2BA 3BOWA 2LAPA 2MLFC 1K93D 1QXPA 3OX6A 1TUJA 5AEQA 1LKJA 1ORGA 1DGUA 1DVIA 2L0PA 4GFTA 1JBAA 2M49B 4F0ZB 3EG5B 4XJKA 1KK7Y 1KFUL 2OTGB 2LMUA 3SG7A 2M0RA 2P71A 1F71A 1QATA 1R2UA 2BE4A 1ZFSA 1G4YR 1Q80A 2ERBA 2K61A 2WC8A 1RECA 1XFWO 1IKUA 2OPOA 3R1PA 4I5LB 2G9BA 1PALA 1BMOA 4MRXA 4YI9A 3SIBA 1M39A 2QACA 3H4SE 3DF0B 3NXAA 1S36A 2KHNA 2KI6C 5HLOA 2BE6A 3LLEA 3PM2A 1EJ3A 3BUMB 3BUWB 3NGVA 1GQMA 3KHEA 2KAYA 5AANA 3WNXB 3BQ3A 2MAZA 4OVNF 1OE9B 1F4OA 1XK4A 1ALVA 1N2DA 1B1GA 4YGEB 1CDLA 3TDUA 1DTLA 2MA2A 2GTEA 3VROA 4BY5A 1K2HA 2H61A 2P70A 3B7AA 4GAOA 3B6XA 3I5IC 1FW4A 4XYNA 1TNQA 4NDCA 1P28A 4MRYA 4YRUA 1R6PA 2AMIA 3GOFA 1BLQA 3I5FC 5AFPA 1CFCA 1UHIA 2M29A 5I2QA 1K94A 2Y1NA 1IGVA 1MXEA 1TWOA 2CXJA 2KDHA 2IS9A 3CLNA 3NSKA 2CNPA 3LCPC 4ORCB 3QRXA 1SYMA 1A4PA 1EG4A 3TS5B 3DYEA 1DGVA 1YUTA 2WCMA 2LC5A 2LHIA 2HETA 3K21A 4M2OA 1DJXA 3ICBA 3NSOA 3D74A 2NZ0A 4DS7A 2KBIA 1OMVA 5FI6A 1UURA 3I5IB 1TNXA 5D3OA 2BL0B 5ER5A 2JTZA 1XFYO 1BT6A 2JU0A 1V1FA 1MWNA 3NHTA 2L4IA 2K2AA 2PASA 3D73A 1H4BA 1NCYA 1NX3A 1QIVA 2L2EA 3SG4A 3CGAA 1B7TY 3R1VA 1CLBA 3CZTX 1LVCD 3EKHA 1QV0A 2JC2A 3L47A 1DEKA 1SK6D 2PALA 2KLDA 1XFXO 2M8UA 2K8MB 4CFRA 3S0DA 1ZOTB 3PALA 5DICA 1OSAA 5HKYA 2L51A 1NSHA 1SW8A 1IG5A 1TN4A 2MRDA 1KSMA 3RZSA 4OCIA 1HQVA 4QJ5B 1QVIY 2KGRA 3FWBA 2K60A 1J1DA 3DF0A 5PALA 5FI7A 1X02A 1SR6C 1UHHA 1SKTA 3Q8IA 3UO9A 1LA0A 1UUSA 2GGZA 3CR5X 1Z2CB 3KO0A 2KAVA 5EL2A 3DVEA 2CT9A 1KQMB 1QLSA 1SCVA 2R2IA 1DJYA 4OV2A 1KWOB 1DF0A 3SG3A 2K7BA 1XFRA 4DCKA 1PSRA 1J7PA 1GM0A 1Z4HA 2ZN9A 2LANA 1YVHA 3JVTC 4N1GA 3DVMA 5HLVA 4PE1A 3S0BA 3SS3A 2BCXA 3CDNA 4NDBA 1NIWA 5KTYA 1IQ3A 1QS7A 2KSPA 4OZDA 4CFQA 3SG2A 4YGAA 1BODA 1XFVO 2O60A 2FCEA 2I7AA 5J3XA 1YR5A 5IBWA 4GNKB 1YTZC 1UHKA 3CR4X 3R1OA 3PATA 3IQOA 1L2OB 1JWDA 1XA5A 3FWCA 1OOHA 4E68A 4I5KA 4PT1A 5FYXA 3WHUB 2MHHA 5DKNA 1S6JA 1PVBA 3JVTB 3R72A 2PSRA 2M7LA 1AK8A 1QTXA 4MSPA 1SBJA 1PSBA 1TRFA 3IF7A 4MBEA 5I2OA 3V2LA 1WRZA 2BKHB 1DJZA 2I2RE 2L5XB 3CZ1A 3SS5A 3OP0A 2M7NA 1IIOA 1IJ5A 2RGIA 3D77A 1NWDA 2MBXA 1J7OA 2JXCA 1IRJA 1S6CA 2JOJA 2WOSA 1AJ5A 1DJHA 2ZNEA 3BJHA 4PHKA 1A75A 2NCPA 1A29A 3A4UB 2E6WA 1MF8B 3SS4A 1EH2A 1BU3A 3O4XA 5CSFA 4CLNA 3SIAA 2KAXA 3BUNB 4QJ4B 2CCMA 1IQ5A 1CLLA 2WCEA 1JSAA 2O5GA 4PDZA 2LMVA 4L9MA 1SSEB 2LVKA 1OZOA 1V1GA 4IJ7A 4CIDA 1S26D 3DY9A 3OGNA 2WCKA 2EC6C 1SL8A 5FI2A 3GK1A 3TUYC 2H2KA 5KU1A 2WCBA 1LXFC 4I5NB 1W7JB 2K0JA 2QPTA 3B87A 1DF0B 3CS1A 3FIAA 5AXIA 2KLEA 4DRWA 1BOCA 4JD9A 3EK7A 3DZTA 3S0FA 1MQ1A 2LP2A 2QEHA 3FE8A 1CLMA 1CDPA 1PK0D 1RTP1 2LMTA 3LL8B 4OR9B 2I94A 4A4BA 2JXLA 1K8UA 1FF1A 5TNCA 4PE4A 3SG6A 2LCPA 1FI5A 1OQPA 2LUCA 1EG3A 1JFKA 3D78A 4KYNA 1S3PA 2LLSA 2PVBA 4BY4A 2KYFA 1B8CA 3JTDC 1SL9A 5D7FA 3TUYB 1NCXA 4P5OE 2M97A 2WORA 1ALWA 3PJIA 1QX5B 3ZWHA 5BPJA 1CM4A 2K7OA 3D0YA 1BG1A 2ZKMX 3CR2A 1IJ6A 3PSRA 1TIZA 2KGBC 3WXAA 2M3WA 1CKKA 2SCPA 3B86A 2K7DA 2V53A 4YGDB 1WDCC 3NSIA 3OB1B 2WNDA 3BYAA 1H8BA 3D76A 3BFAA 1F4QA 3VRPA 5JOLA 1Y6WA 1ZUZA 1CFDA 1TTXA 1S5GZ 2VRGA 3I5FB 3JTDB 1GGZA 1WRKA 1Y0VH 1FPWA 1S5GY 1DELA 1A2XA 1A75B 1N0YA 1LA3A 2HQ8A 3EVVA 5ER4X 1GGWA 2KBMA 2BBMA 3S0EA 2KOTA 1E8AA 3BFHA 4AOMA 2K7CA 2BCBA 1DT7B 3EVRA 2P6BB 1C3YA 4WRIA 1FI6A 2F3YA 2KFGA 1OZSA 1M46A 1MUXA 1DC1A 1WDCB 4YBHB 5D69A 3K1EA 1EXRA 2WC5A 3CZ0A 2BCAA 3OB2B 1YX7A 3WHTB 1J55A 1B9AA 1C7WA 1XO5A 1KK8C 2COLB 4Q04A 4R1EA 2OS8C 1RROA 4A4CA 2HQWA 2JQ6A 4M2PA 4PCWA 3VRRA 4OKHA 3NSLA 5HKWA 4GGFC 1QX2A 3BUOB 3C1VA 1BR1B 1W9ZA 3I5HC 1W7IB 2M1UA 1NX2A 4JQ0D 2K2FA 3OHMB 2A4JA 4PHMA 2JT3A 2KYCA 5CSIA 1CTRA 4PE0A 3ZNIA 2NCOA 1AVSA 3RLZA 1KQVA 3GK2A 4ZCVA 1WLZA 5I94A 1T14A 1MHOA 1DJIA 3B88A 5B8IB 1JFJA 1DJWA 3DVJA 1AHRA 1KFXL 2KQYA 2OS8B 3DD4A 1K9PA 1NP8A 1BF5A 1RK9A 2LP3A 3D0YB 4HSZA 4N5XA 1YRTB 1YX8A 4IL1A 1SR6B 2JNXA 1N65A 5G08A 2L98A 2EHBA 2WCHA 2Y1MA 3CZ2A 4P2YB 2LM5A 1SL7A 4MN0A 1UWOA 1DQEA 3I5GC
chains in the Genus database with same CATH topology
3QMEA 3DY9A 1TWOA 2WCKA 3OGNA 3DYEA 2WCMA 3D74A 3B87A 3L4LA 2FJYA 2L2CA 4JD9A 3DZTA 3CYZA 3S0FA 2JPOA 3BFBA 2QEHA 3FE9A 3FE8A 3CABA 3L4AA 3NHTA 3D73A 3D78A 3R1VA 3D75A 2WCLA 3L47A 3S0AA 3PJIA 2PQLA 2QDIA 3DXLA 3S0DA 5DICA 3B86A 1OOGA 1C3ZA 2WC6A 3RZSA 1OW4A 3D76A 2QEVA 3BFAA 2QEBA 4FQTA 3Q8IA 3S0GA 5EL2A 1LS8A 3S0EA 1XFRA 1GM0A 3BFHA 1QWVA 1C3YA 3FE6A 4F7FA 3S0BA 1TUJA 3CDNA 1ORGA 2KPHA 3K1EA 2WC5A 3CZ0A 4OZDA 2P71A 2ERBA 3NHIA 3R1PA 4INXA 3R1OA 1OOHA 1OOIX 3N7HA 4PT1A 3R72A 3NGVA 2H8VA 2QEOA 3V2LA 3CZ1A 1T14A 3B88A 3D77A 3VB1A 2GTEA 3BJHA 2P70A 3B7AA 1OOFA 2WCJA 4INWA 3B6XA 2WCHA 3CZ2A 1P28A 1DQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QME A;  3DY9 A;  1TWO A;  2WCK A;  3OGN A;  3DYE A;  2WCM A;  3D74 A;  3B87 A;  3L4L A;  2FJY A;  2L2C A;  4JD9 A;  3DZT A;  3CYZ A;  3S0F A;  2JPO A;  3BFB A;  2QEH A;  3FE9 A;  3FE8 A;  3CAB A;  3L4A A;  3NHT A;  3D73 A;  3D78 A;  3R1V A;  3D75 A;  2WCL A;  3L47 A;  3S0A A;  3PJI A;  2PQL A;  2QDI A;  3DXL A;  3S0D A;  5DIC A;  3B86 A;  1OOG A;  1C3Z A;  2WC6 A;  3RZS A;  1OW4 A;  3D76 A;  2QEV A;  3BFA A;  2QEB A;  4FQT A;  3Q8I A;  3S0G A;  5EL2 A;  1LS8 A;  3S0E A;  1XFR A;  1GM0 A;  3BFH A;  1QWV A;  1C3Y A;  3FE6 A;  4F7F A;  3S0B A;  1TUJ A;  3CDN A;  1ORG A;  2KPH A;  3K1E A;  2WC5 A;  3CZ0 A;  4OZD A;  2P71 A;  2ERB A;  3NHI A;  3R1P A;  4INX A;  3R1O A;  1OOH A;  1OOI X;  3N7H A;  4PT1 A;  3R72 A;  3NGV A;  2H8V A;  2QEO A;  3V2L A;  3CZ1 A;  1T14 A;  3B88 A;  3D77 A;  3VB1 A;  2GTE A;  3BJH A;  2P70 A;  3B7A A;  1OOF A;  2WCJ A;  4INW A;  3B6X A;  2WCH A;  3CZ2 A;  1P28 A;  1DQE A; 
#chains in the Genus database with same CATH topology
 1PRW A;  3HX4 A;  1DJG A;  3IVT A;  1J7R A;  2NXQ A;  1UP5 A;  2BBN A;  2ZN8 A;  1AUI B;  1EL4 A;  3PLF B;  3PN7 C;  2PRU A;  1KCY A;  2BKI B;  3FS7 A;  1CFF A;  1J7Q A;  2AUC A;  1TOP A;  4PAL A;  2FJY A;  1RWY A;  1C07 A;  3CYZ A;  2CBL A;  4D1E A;  2JPO A;  1XFZ O;  2OTG C;  1YRU B;  1KSO A;  3FE9 A;  1YUR A;  4MZL A;  2E30 A;  2F8P A;  4ICB A;  1PVA A;  4CPV A;  2L5Y A;  1B47 A;  2LVI A;  2JUL A;  1OMR A;  4I5J A;  2WCF A;  1K95 A;  3A8R A;  2WCL A;  3PN7 B;  2BNX A;  4YI8 A;  3TDI A;  5KSZ A;  4MZJ A;  1G8I A;  2QDI A;  3HCM A;  1M31 A;  1SRA A;  1KK7 Z;  4JKT A;  4TNC A;  2KFF A;  1NYA A;  2DOQ A;  3SJS A;  4JPZ B;  1OOG A;  2M1K B;  2WC6 A;  1WRL A;  3MSE B;  2BAP A;  4AQI A;  2TN4 A;  1OW4 A;  2QEV A;  1YUU A;  1NUB A;  2F33 A;  4GUK A;  1K9U A;  1QLK A;  4ZCU A;  2PMY A;  2JNF A;  2Q4U A;  1KFU S;  4HRH A;  1CMF A;  1TUZ A;  1FBV A;  1K96 A;  1CDN A;  1OOJ A;  3D10 A;  4C0K A;  1J1E A;  1F54 A;  1WY9 A;  2KI6 D;  2PYQ A;  2Q91 A;  3EKJ A;  1TNW A;  1LS8 A;  2EC6 B;  4M2Q A;  4YGB B;  4UPG A;  5CPV A;  4USL A;  1QAS A;  2LLU A;  2LUX A;  5CSN A;  2ZRT A;  1QWV A;  1S6I A;  5F6T A;  1NPQ A;  2MJW B;  3FE6 A;  4F7F A;  3GK4 X;  3TS5 C;  3VRN A;  4GPL B;  3F45 A;  1F8H A;  2KPH A;  2JRF A;  5AER A;  2JT8 A;  4GGF A;  1F70 A;  4MEW A;  1SCM C;  1F55 A;  1YVL A;  1MXL C;  2GGM A;  1Y1U A;  2FOT A;  4GBA A;  2JTT A;  1OMD A;  1K90 D;  2EGD A;  3EK8 A;  2JT0 A;  1B4C A;  1WLM A;  4C0L A;  1AJ4 A;  3NHI A;  4HRG A;  2BL0 C;  4MLW A;  2LHL A;  4ORA B;  3BUX B;  4INX A;  3PM8 A;  1B8L A;  1L7Z A;  2M9G A;  3IQQ A;  1JC2 A;  3AAJ A;  5K89 A;  1JUO A;  1OOI X;  3N7H A;  4WQ3 A;  1CM1 A;  3AKB A;  2HF5 A;  4NQG A;  4PHN A;  4WQ2 A;  1RJV A;  2H8V A;  3KPX A;  1JF2 A;  1QV1 A;  1TCO B;  2QEO A;  5HYD A;  2I18 A;  1A03 A;  1RFJ A;  1U5I B;  2JPT A;  2LVJ A;  3TDZ A;  1SCM B;  1SY9 A;  4ORB B;  1BJF A;  3EK4 A;  4JWQ A;  4U8D A;  3UNW A;  2AAO A;  3VB1 A;  1QJT A;  1LIN A;  1NX1 A;  2F2P A;  3BOW B;  3EVU A;  4DIR A;  2FJU B;  1OOF A;  2WCJ A;  4INW A;  3CTN A;  1B8R A;  3VGO A;  3OBV A;  1UHJ A;  3BXK A;  2D8N A;  1XK4 C;  4N1F A;  4XJK B;  2ISD A;  1B7T Z;  1SPY A;  1ZMZ A;  1C7V A;  1ODB A;  2KQ6 A;  3O6B A;  2KNE A;  1SNL A;  3AKA A;  3TZ1 A;  4C0J A;  3E3R A;  2FCD A;  2Y4Q A;  2H61 C;  5DKR A;  2SAS A;  3QME A;  1KQM C;  4AQJ A;  1VRK A;  4MVF A;  1YUS A;  1KWO C;  2HPS A;  4PHJ A;  1DMO A;  1TCF A;  2ZND A;  4FQO A;  3O2P A;  3LK1 A;  1Y1A A;  1QX7 A;  1XFU O;  1QVI Z;  3L4L A;  4ETO A;  1AP4 A;  2LV7 A;  1IH0 A;  1KK8 B;  1SMG A;  2L2C A;  1PUL A;  2JZI A;  2CTN A;  3BFB A;  2Y5I A;  1CDM A;  1GJY A;  3CAB A;  3KEV A;  2JWW A;  3M0W A;  4MZK A;  4YGC B;  1HT9 A;  3L4A A;  1XYD A;  1G33 A;  2B1U A;  2YGU A;  3I5H B;  3PFV A;  3VRQ A;  2F3Z A;  1L2O C;  2KI4 C;  3D75 A;  3KF9 A;  1M63 B;  4FTG A;  1TNP A;  3RM1 A;  3OX5 A;  3S0A A;  2F2O A;  5I8N A;  1NCZ A;  2PQL A;  1JF0 A;  5GQQ C;  2KFH A;  3DXL A;  1MR8 A;  2L4H A;  3LK0 A;  3DVK A;  4QJ3 B;  1CNP A;  2LNK A;  4GGN A;  1K9K A;  1IWQ A;  1C3Z A;  2GV5 A;  2NLN A;  5DKQ A;  2MLE C;  4DUQ A;  2L50 A;  2LLT A;  5I2L A;  4NDD A;  5HL1 A;  1KFX S;  3SG5 A;  1XVJ A;  1NX0 A;  2QEB A;  3CWG A;  4FQT A;  2LE9 B;  2ZFD A;  1BR4 B;  2ZRS A;  3I5G B;  4HRE E;  5CSJ A;  2KI4 B;  1S1E A;  3S0G A;  5HKZ A;  5JJG A;  2LVV A;  1Y1X A;  1U5I A;  1CMG A;  1CFP A;  1CB1 A;  3O4Y A;  2BEC A;  3AAK A;  3O78 A;  1UHN A;  4PE7 A;  1D1O A;  1M45 A;  1ZAC A;  1QIW A;  2G2B A;  3BOW A;  2LAP A;  2MLF C;  1K93 D;  1QXP A;  3OX6 A;  1TUJ A;  5AEQ A;  1LKJ A;  1ORG A;  1DGU A;  1DVI A;  2L0P A;  4GFT A;  1JBA A;  2M49 B;  4F0Z B;  3EG5 B;  4XJK A;  1KK7 Y;  1KFU L;  2OTG B;  2LMU A;  3SG7 A;  2M0R A;  2P71 A;  1F71 A;  1QAT A;  1R2U A;  2BE4 A;  1ZFS A;  1G4Y R;  1Q80 A;  2ERB A;  2K61 A;  2WC8 A;  1REC A;  1XFW O;  1IKU A;  2OPO A;  3R1P A;  4I5L B;  2G9B A;  1PAL A;  1BMO A;  4MRX A;  4YI9 A;  3SIB A;  1M39 A;  2QAC A;  3H4S E;  3DF0 B;  3NXA A;  1S36 A;  2KHN A;  2KI6 C;  5HLO A;  2BE6 A;  3LLE A;  3PM2 A;  1EJ3 A;  3BUM B;  3BUW B;  3NGV A;  1GQM A;  3KHE A;  2KAY A;  5AAN A;  3WNX B;  3BQ3 A;  2MAZ A;  4OVN F;  1OE9 B;  1F4O A;  1XK4 A;  1ALV A;  1N2D A;  1B1G A;  4YGE B;  1CDL A;  3TDU A;  1DTL A;  2MA2 A;  2GTE A;  3VRO A;  4BY5 A;  1K2H A;  2H61 A;  2P70 A;  3B7A A;  4GAO A;  3B6X A;  3I5I C;  1FW4 A;  4XYN A;  1TNQ A;  4NDC A;  1P28 A;  4MRY A;  4YRU A;  1R6P A;  2AMI A;  3GOF A;  1BLQ A;  3I5F C;  5AFP A;  1CFC A;  1UHI A;  2M29 A;  5I2Q A;  1K94 A;  2Y1N A;  1IGV A;  1MXE A;  1TWO A;  2CXJ A;  2KDH A;  2IS9 A;  3CLN A;  3NSK A;  2CNP A;  3LCP C;  4ORC B;  3QRX A;  1SYM A;  1A4P A;  1EG4 A;  3TS5 B;  3DYE A;  1DGV A;  1YUT A;  2WCM A;  2LC5 A;  2LHI A;  2HET A;  3K21 A;  4M2O A;  1DJX A;  3ICB A;  3NSO A;  3D74 A;  2NZ0 A;  4DS7 A;  2KBI A;  1OMV A;  5FI6 A;  1UUR A;  3I5I B;  1TNX A;  5D3O A;  2BL0 B;  5ER5 A;  2JTZ A;  1XFY O;  1BT6 A;  2JU0 A;  1V1F A;  1MWN A;  3NHT A;  2L4I A;  2K2A A;  2PAS A;  3D73 A;  1H4B A;  1NCY A;  1NX3 A;  1QIV A;  2L2E A;  3SG4 A;  3CGA A;  1B7T Y;  3R1V A;  1CLB A;  3CZT X;  1LVC D;  3EKH A;  1QV0 A;  2JC2 A;  3L47 A;  1DEK A;  1SK6 D;  2PAL A;  2KLD A;  1XFX O;  2M8U A;  2K8M B;  4CFR A;  3S0D A;  1ZOT B;  3PAL A;  5DIC A;  1OSA A;  5HKY A;  2L51 A;  1NSH A;  1SW8 A;  1IG5 A;  1TN4 A;  2MRD A;  1KSM A;  3RZS A;  4OCI A;  1HQV A;  4QJ5 B;  1QVI Y;  2KGR A;  3FWB A;  2K60 A;  1J1D A;  3DF0 A;  5PAL A;  5FI7 A;  1X02 A;  1SR6 C;  1UHH A;  1SKT A;  3Q8I A;  3UO9 A;  1LA0 A;  1UUS A;  2GGZ A;  3CR5 X;  1Z2C B;  3KO0 A;  2KAV A;  5EL2 A;  3DVE A;  2CT9 A;  1KQM B;  1QLS A;  1SCV A;  2R2I A;  1DJY A;  4OV2 A;  1KWO B;  1DF0 A;  3SG3 A;  2K7B A;  1XFR A;  4DCK A;  1PSR A;  1J7P A;  1GM0 A;  1Z4H A;  2ZN9 A;  2LAN A;  1YVH A;  3JVT C;  4N1G A;  3DVM A;  5HLV A;  4PE1 A;  3S0B A;  3SS3 A;  2BCX A;  3CDN A;  4NDB A;  1NIW A;  5KTY A;  1IQ3 A;  1QS7 A;  2KSP A;  4OZD A;  4CFQ A;  3SG2 A;  4YGA A;  1BOD A;  1XFV O;  2O60 A;  2FCE A;  2I7A A;  5J3X A;  1YR5 A;  5IBW A;  4GNK B;  1YTZ C;  1UHK A;  3CR4 X;  3R1O A;  3PAT A;  3IQO A;  1L2O B;  1JWD A;  1XA5 A;  3FWC A;  1OOH A;  4E68 A;  4I5K A;  4PT1 A;  5FYX A;  3WHU B;  2MHH A;  5DKN A;  1S6J A;  1PVB A;  3JVT B;  3R72 A;  2PSR A;  2M7L A;  1AK8 A;  1QTX A;  4MSP A;  1SBJ A;  1PSB A;  1TRF A;  3IF7 A;  4MBE A;  5I2O A;  3V2L A;  1WRZ A;  2BKH B;  1DJZ A;  2I2R E;  2L5X B;  3CZ1 A;  3SS5 A;  3OP0 A;  2M7N A;  1IIO A;  1IJ5 A;  2RGI A;  3D77 A;  1NWD A;  2MBX A;  1J7O A;  2JXC A;  1IRJ A;  1S6C A;  2JOJ A;  2WOS A;  1AJ5 A;  1DJH A;  2ZNE A;  3BJH A;  4PHK A;  1A75 A;  2NCP A;  1A29 A;  3A4U B;  2E6W A;  1MF8 B;  3SS4 A;  1EH2 A;  1BU3 A;  3O4X A;  5CSF A;  4CLN A;  3SIA A;  2KAX A;  3BUN B;  4QJ4 B;  2CCM A;  1IQ5 A;  1CLL A;  2WCE A;  1JSA A;  2O5G A;  4PDZ A;  2LMV A;  4L9M A;  1SSE B;  2LVK A;  1OZO A;  1V1G A;  4IJ7 A;  4CID A;  1S26 D;  3DY9 A;  3OGN A;  2WCK A;  2EC6 C;  1SL8 A;  5FI2 A;  3GK1 A;  3TUY C;  2H2K A;  5KU1 A;  2WCB A;  1LXF C;  4I5N B;  1W7J B;  2K0J A;  2QPT A;  3B87 A;  1DF0 B;  3CS1 A;  3FIA A;  5AXI A;  2KLE A;  4DRW A;  1BOC A;  4JD9 A;  3EK7 A;  3DZT A;  3S0F A;  1MQ1 A;  2LP2 A;  2QEH A;  3FE8 A;  1CLM A;  1CDP A;  1PK0 D;  1RTP 1;  2LMT A;  3LL8 B;  4OR9 B;  2I94 A;  4A4B A;  2JXL A;  1K8U A;  1FF1 A;  5TNC A;  4PE4 A;  3SG6 A;  2LCP A;  1FI5 A;  1OQP A;  2LUC A;  1EG3 A;  1JFK A;  3D78 A;  4KYN A;  1S3P A;  2LLS A;  2PVB A;  4BY4 A;  2KYF A;  1B8C A;  3JTD C;  1SL9 A;  5D7F A;  3TUY B;  1NCX A;  4P5O E;  2M97 A;  2WOR A;  1ALW A;  3PJI A;  1QX5 B;  3ZWH A;  5BPJ A;  1CM4 A;  2K7O A;  3D0Y A;  1BG1 A;  2ZKM X;  3CR2 A;  1IJ6 A;  3PSR A;  1TIZ A;  2KGB C;  3WXA A;  2M3W A;  1CKK A;  2SCP A;  3B86 A;  2K7D A;  2V53 A;  4YGD B;  1WDC C;  3NSI A;  3OB1 B;  2WND A;  3BYA A;  1H8B A;  3D76 A;  3BFA A;  1F4Q A;  3VRP A;  5JOL A;  1Y6W A;  1ZUZ A;  1CFD A;  1TTX A;  1S5G Z;  2VRG A;  3I5F B;  3JTD B;  1GGZ A;  1WRK A;  1Y0V H;  1FPW A;  1S5G Y;  1DEL A;  1A2X A;  1A75 B;  1N0Y A;  1LA3 A;  2HQ8 A;  3EVV A;  5ER4 X;  1GGW A;  2KBM A;  2BBM A;  3S0E A;  2KOT A;  1E8A A;  3BFH A;  4AOM A;  2K7C A;  2BCB A;  1DT7 B;  3EVR A;  2P6B B;  1C3Y A;  4WRI A;  1FI6 A;  2F3Y A;  2KFG A;  1OZS A;  1M46 A;  1MUX A;  1DC1 A;  1WDC B;  4YBH B;  5D69 A;  3K1E A;  1EXR A;  2WC5 A;  3CZ0 A;  2BCA A;  3OB2 B;  1YX7 A;  3WHT B;  1J55 A;  1B9A A;  1C7W A;  1XO5 A;  1KK8 C;  2COL B;  4Q04 A;  4R1E A;  2OS8 C;  1RRO A;  4A4C A;  2HQW A;  2JQ6 A;  4M2P A;  4PCW A;  3VRR A;  4OKH A;  3NSL A;  5HKW A;  4GGF C;  1QX2 A;  3BUO B;  3C1V A;  1BR1 B;  1W9Z A;  3I5H C;  1W7I B;  2M1U A;  1NX2 A;  4JQ0 D;  2K2F A;  3OHM B;  2A4J A;  4PHM A;  2JT3 A;  2KYC A;  5CSI A;  1CTR A;  4PE0 A;  3ZNI A;  2NCO A;  1AVS A;  3RLZ A;  1KQV A;  3GK2 A;  4ZCV A;  1WLZ A;  5I94 A;  1T14 A;  1MHO A;  1DJI A;  3B88 A;  5B8I B;  1JFJ A;  1DJW A;  3DVJ A;  1AHR A;  1KFX L;  2KQY A;  2OS8 B;  3DD4 A;  1K9P A;  1NP8 A;  1BF5 A;  1RK9 A;  2LP3 A;  3D0Y B;  4HSZ A;  4N5X A;  1YRT B;  1YX8 A;  4IL1 A;  1SR6 B;  2JNX A;  1N65 A;  5G08 A;  2L98 A;  2EHB A;  2WCH A;  2Y1M A;  3CZ2 A;  4P2Y B;  2LM5 A;  1SL7 A;  4MN0 A;  1UWO A;  1DQE A;  3I5G C; 
#chains in the Genus database with same CATH homology
 3QME A;  3DY9 A;  1TWO A;  2WCK A;  3OGN A;  3DYE A;  2WCM A;  3D74 A;  3B87 A;  3L4L A;  2FJY A;  2L2C A;  4JD9 A;  3DZT A;  3CYZ A;  3S0F A;  2JPO A;  3BFB A;  2QEH A;  3FE9 A;  3FE8 A;  3CAB A;  3L4A A;  3NHT A;  3D73 A;  3D78 A;  3R1V A;  3D75 A;  2WCL A;  3L47 A;  3S0A A;  3PJI A;  2PQL A;  2QDI A;  3DXL A;  3S0D A;  5DIC A;  3B86 A;  1OOG A;  1C3Z A;  2WC6 A;  3RZS A;  1OW4 A;  3D76 A;  2QEV A;  3BFA A;  2QEB A;  4FQT A;  3Q8I A;  3S0G A;  5EL2 A;  1LS8 A;  3S0E A;  1XFR A;  1GM0 A;  3BFH A;  1QWV A;  1C3Y A;  3FE6 A;  4F7F A;  3S0B A;  1TUJ A;  3CDN A;  1ORG A;  2KPH A;  3K1E A;  2WC5 A;  3CZ0 A;  4OZD A;  2P71 A;  2ERB A;  3NHI A;  3R1P A;  4INX A;  3R1O A;  1OOH A;  1OOI X;  3N7H A;  4PT1 A;  3R72 A;  3NGV A;  2H8V A;  2QEO A;  3V2L A;  3CZ1 A;  1T14 A;  3B88 A;  3D77 A;  3VB1 A;  2GTE A;  3BJH A;  2P70 A;  3B7A A;  1OOF A;  2WCJ A;  4INW A;  3B6X A;  2WCH A;  3CZ2 A;  1P28 A;  1DQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...