3OGNA

Crystal structure of an odorant-binding protein from the southern house mosquito complexed with an oviposition pheromone
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
VTPRRDAEYPPPELLEALKPLHDICAKKTGVTDEAIIEFSDGKIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPNSMHDIAMHMGKRCLYPEGENLCEKAFWLHKCWKQADPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant-binding protein
publication title Crystal and solution structures of an odorant-binding protein from the southern house mosquito complexed with an oviposition pheromone.
pubmed doi rcsb
source organism Culex quinquefasciatus
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3ognA01
3BFAA 3QMEA 2PQLA 4FQTA 2WCJA 2WCMA 2H8VA 3PJIA 1GM0A 1TUJA 3D78A 1TWOA 1C3ZA 1OOIX 2JPOA 3R1PA 4F7FA 2ERBA 1OOHA 1OOGA 3S0FA 2WCHA 3S0GA 3FE8A 2QEOA 3D74A 3D76A 5DICA 3D77A 3FE6A 2P70A 3FE9A 3B86A 2WCLA 3CZ1A 4PT1A 3RZSA 3NGVA 3BFHA 2QEHA 4INXA 3VB1A 3L47A 3N7HA 3DZTA 3NHIA 3D75A 2FJYA 4JD9A 1P28A 5EL2A 1C3YA 3S0AA 3L4AA 1OOFA 1XFRA 3BFBA 3DY9A 3K1EA 3Q8IA 3L4LA 3B7AA 3D73A 3NHTA 1T14A 3DYEA 2QEVA 3B88A 2QDIA 3CABA 3CYZA 3CDNA 4OZDA 3R1VA 2WC6A 3S0EA 4INWA 3R1OA 3S0DA 3CZ0A 1DQEA 1OW4A 2GTEA 1LS8A 3DXLA 3OGNA 2QEBA 3CZ2A 3S0BA 2KPHA 1QWVA 2L2CA 3B6XA 2P71A 3BJHA 3B87A 3V2LA 3R72A 1ORGA 2WCKA 2WC5A
chains in the Genus database with same CATH superfamily
3FS7A 2JU0A 1NX1A 2BAPA 3OBVA 4FQTA 1DELA 1B4CA 1N2DA 2Y1NA 1NIWA 1QX7A 2KGRA 3TUYB 1TRFA 1K9KA 2F8PA 1KK7Z 1TUJA 3DD4A 1LA0A 1DF0B 1KK8C 1EG4A 3DVMA 5ER4X 4HSZA 1CLMA 3WXAA 1KFXL 4BY5A 2F3YA 3OP0A 4GGFA 1ZACA 2JPOA 1PULA 1MUXA 2LLTA 1YUSA 2HQ8A 2LLSA 3PLFB 1CFPA 1OOHA 1Y1XA 3I5HB 1J7OA 1OOGA 1RWYA 1WY9A 4ORAB 4YGAA 5FI2A 1B8LA 1L2OB 2LHLA 3EKJA 3JTDC 3CGAA 2MLFC 1IJ5A 1XVJA 2LHIA 1XFUO 2BECA 5HKWA 1CB1A 1K96A 1EL4A 3NSKA 3D76A 3IF7A 1NP8A 2KLEA 4PE4A 3WHTB 3H4SE 2M0RA 1G4YR 1SL9A 5D7FA 4QJ3B 1H4BA 3JVTB 1ZFSA 1KCYA 3I5GB 1RROA 1SRAA 1G8IA 2HETA 1NX3A 2I2RE 2JULA 2NLNA 3CZ1A 3TS5C 3RZSA 2QACA 3FWCA 3TZ1A 2KNEA 2B1UA 4AQJA 1MQ1A 2BBMA 2WORA 1FW4A 2CTNA 1SW8A 2BL0B 2M8UA 4NQGA 2Q4UA 1U5IB 4YBHB 4XJKA 1JF2A 1QVIY 2SASA 2KI4B 1KSOA 3OB1B 1IQ5A 2BCBA 5CSFA 1EJ3A 2LCPA 1XYDA 5HKZA 1BR4B 2JWWA 3EVRA 5FI6A 1XK4A 1LVCD 1NYAA 2I94A 3PN7B 3L47A 4F0ZB 4M2QA 3DZTA 1SY9A 1B8RA 1UHJA 2DOQA 1WRKA 3NHIA 3PSRA 4MSPA 1TCOB 2GGMA 4USLA 3I5IB 1KFUL 5EL2A 1OMDA 1AHRA 1J55A 1V1FA 1NPQA 2V53A 1CMFA 1CM1A 1AJ4A 4JQ0D 3BFBA 3AAJA 3A8RA 4HREE 2M29A 3I5HC 2EHBA 2MLEC 2MRDA 1QIVA 4PHNA 3GK2A 4GBAA 4YGDB 3SIAA 1S6CA 3D73A 4PE7A 5FI7A 1FI5A 4WQ3A 1T14A 3DYEA 1PRWA 1K95A 1BG1A 2E30A 2O5GA 4CLNA 3CYZA 1CFFA 2K7CA 2ZN8A 1LKJA 2JTZA 1A2XA 1SYMA 1SPYA 3JVTC 3NSIA 3OB2B 1CDLA 3I5GC 4OZDA 1DJYA 2WCFA 3VRNA 1HT9A 1B9AA 3EK8A 1EG3A 1S5GZ 1XFXO 2FCDA 2KFGA 5AEQA 3KHEA 2BL0C 1NUBA 1M45A 2CCMA 2LV7A 2KI4C 1N0YA 1FF1A 1DGVA 1PSBA 1WDCB 1KFXS 2F2PA 1XFZO 2KBMA 3PN7C 2K7OA 2M1UA 1EH2A 1NSHA 1XFYO 1K90D 4MLWA 2M7LA 2KAVA 3I5IC 4PHMA 1QIWA 2L5XB 2MAZA 5FYXA 2KFFA 3SS3A 4IL1A 1YRTB 3BUOB 3R72A 4TNCA 4KYNA 4M2PA 1J7PA 2LLUA 4N1FA 2EC6B 4PALA 4PHJA 1FI6A 5DKQA 4MZJA 1YUUA 1K8UA 2M49B 3TDZA 1DT7B 1M46A 2IS9A 2MA2A 5I8NA 2ZNDA 3KO0A 3CTNA 2VRGA 1WLZA 1YRUB 4JWQA 1BU3A 1RK9A 1Y0VH 1IJ6A 1TNQA 3NXAA 1CDNA 1IWQA 1KSMA 2ZNEA 1MHOA 1OOJA 2OTGB 2JRFA 1BT6A 4GGNA 1Z4HA 1A75B 2ERBA 1Q80A 1UHIA 4I5NB 1DC1A 1PSRA 3HX4A 2KYCA 2WCHA 5DKRA 5AERA 2ZFDA 1FBVA 1KFUS 4DS7A 1WDCC 3RLZA 1F71A 4P5OE 1JFJA 1OSAA 2KBIA 3BXKA 1MXLC 4N1GA 3DF0A 5DKNA 1YURA 1QV0A 5DICA 5AANA 3UNWA 2JTTA 1J1DA 2ISDA 3PM2A 1QLKA 1QASA 1S3PA 2BCAA 2JXCA 2P70A 3B86A 2JT3A 4MVFA 1DGUA 4YGEB 1JWDA 1QX2A 5TNCA 1B1GA 4YI9A 4FQOA 3ZWHA 1S36A 3PM8A 1GQMA 1S6IA 4PE1A 3LLEA 2I7AA 2L0PA 1MWNA 1AUIB 3EVVA 1MR8A 2EC6C 1UP5A 2LVVA 1MF8B 1CDMA 2QEHA 1RJVA 2KHNA 3AAKA 4AOMA 1M31A 1F4QA 1WRLA 4HRGA 1DJIA 3BUXB 3VB1A 1CLLA 1R2UA 3LK0A 1K9PA 2H61C 4NDBA 3N7HA 1CTRA 1K2HA 2H2KA 2L4IA 4GPLB 1B47A 2M1KB 1HQVA 1C7WA 3GOFA 3CS1A 2FJYA 1IG5A 1S6JA 4OVNF 4OR9B 1QATA 2OTGC 2CBLA 3VRRA 2LUXA 2PRUA 3I5FC 1OOFA 3Q8IA 1AK8A 2NXQA 1EXRA 1M39A 3BUWB 3EVUA 2L50A 1IKUA 2Y1MA 3UO9A 3CR4X 2JZIA 3NHTA 1DJGA 4UPGA 1WLMA 4L9MA 4NDDA 2QEVA 3B88A 3CZTX 3CR2A 1RTP1 1W7JB 2BE4A 3SJSA 2MHHA 2F2OA 2QDIA 2ZKMX 3E3RA 5HYDA 1KK7Y 2WNDA 3FWBA 2BNXA 4I5JA 3LL8B 2KAYA 3VRQA 2WC8A 2L98A 3R1VA 1QV1A 4OCIA 1OZSA 5D3OA 3S0EA 1U5IA 3EK4A 4DRWA 3R1OA 3S0DA 2L4HA 2FCEA 2LMTA 2K7DA 4ICBA 4AQIA 3SG5A 1J1EA 2MJWB 1NCXA 3KEVA 5AFPA 1L2OC 2F3ZA 1LINA 2K8MB 1F54A 2KDHA 3WNXB 1TCFA 1QWVA 1V1GA 5PALA 5GQQC 3SG7A 2LVIA 1RECA 3B87A 1IRJA 1NWDA 2L51A 2O60A 4ETOA 1ZUZA 3O78A 3SG4A 4MRYA 3EK7A 2JQ6A 2PYQA 2JT8A 4ORCB 2WCKA 2WC5A 1KWOB 3BFAA 3BOWB 3QMEA 4YGBB 2PQLA 1QLSA 4N5XA 1KQVA 2LE9B 1B7TZ 2COLB 2D8NA 2NZ0A 2WCBA 3D0YB 5KU1A 2WCJA 2HF5A 1DTLA 1A03A 1DMOA 2H8VA 4DIRA 1GJYA 3PJIA 1GM0A 4ORBB 5CSNA 3D78A 1H8BA 1SL7A 1C07A 2AUCA 1C3ZA 1OQPA 5AXIA 1F4OA 3DVJA 1NX0A 1AVSA 3BUNB 3O4XA 1ALVA 4CPVA 2KI6D 1J7RA 4GNKB 1R6PA 1NCYA 3GK1A 1JBAA 2WOSA 3S0GA 3M0WA 3FE8A 5HKYA 4ZCVA 5JJGA 3PFVA 1M63B 1SCVA 1JC2A 2EGDA 2QEOA 3EKHA 2K7BA 3D74A 1CNPA 1DVIA 1XFWO 4GUKA 1OMRA 2ZRTA 3NSLA 1IH0A 1QS7A 1NX2A 2OPOA 2CXJA 2JC2A 1W7IB 1F8HA 1WRZA 4I5LB 3NGVA 5JOLA 2PSRA 1S5GY 5B8IB 1ALWA 1JFKA 5KTYA 1FPWA 1C7VA 2H61A 1KWOC 4MEWA 2AMIA 1ZMZA 2JNXA 2G9BA 2LM5A 4INXA 1TNPA 2TN4A 3MSEB 1UUSA 2M9GA 2BE6A 3LK1A 2LANA 4CFQA 4PDZA 5CPVA 3BQ3A 2LMUA 1SMGA 2OS8B 2Y4QA 1SL8A 1QJTA 2CNPA 2LMVA 3S0AA 1CKKA 1DJWA 2K60A 3D10A 2HQWA 3KPXA 1PALA 1XO5A 4JPZB 1IGVA 4OKHA 1D1OA 1UWOA 2AAOA 4QJ5B 1MXEA 3L4LA 3AKBA 1BJFA 4QJ4B 2BKHB 2JT0A 3B7AA 3C1VA 3WHUB 1Y1UA 4I5KA 1JF0A 4U8DA 5HL1A 3FIAA 3IQQA 2KQ6A 2JXLA 3RM1A 3CABA 1DF0A 3DVKA 1SCMB 4WRIA 4E68A 1KQMB 1TTXA 1AJ5A 5HLOA 2WC6A 1W9ZA 1YR5A 2KLDA 4HRHA 1UHKA 3VGOA 1AP4A 4Q04A 3K21A 5D69A 3CZ0A 3EG5B 3IQOA 1DQEA 1OW4A 2GTEA 1QVIZ 1XA5A 1LS8A 3OHMB 2K61A 3BUMB 3DXLA 3OGNA 2LVKA 3PALA 4JKTA 3SS5A 4ZCUA 5I2QA 2LUCA 1J7QA 1Y1AA 1YX8A 5I2LA 4FTGA 3CZ2A 1SBJA 1N65A 1YVHA 3S0BA 2OS8C 1CMGA 2KPHA 5KSZA 1TNWA 2LC5A 1PVBA 2L2CA 3NSOA 3B6XA 4DUQA 3BJHA 3DVEA 2PMYA 1K93D 1TNXA 1ODBA 1TUZA 2M7NA 3CR5X 4GFTA 2E6WA 5CSJA 1OE9B 2JOJA 1OZOA 2WCMA 1TN4A 2M97A 2JPTA 1E8AA 4XJKB 1F55A 5IBWA 5ER5A 4GAOA 2P6BB 1TWOA 2WCEA 1SCMC 2LVJA 3O6BA 2KSPA 1CLBA 1KQMC 3TUYC 1CFDA 1JSAA 1OOIX 2BCXA 5HLVA 1YVLA 5I94A 3R1PA 2SCPA 4C0KA 4R1EA 5K89A 2PVBA 4F7FA 1OMVA 3SG6A 1NCZA 3S0FA 4GGFC 4A4CA 3TDUA 1A29A 1YX7A 1YUTA 2JNFA 2MBXA 1GGZA 2Y5IA 4YI8A 3HCMA 4IJ7A 2FJUB 1DEKA 1SSEB 3LCPC 1BR1B 3SIBA 3SG3A 1DJHA 2G2BA 2LP3A 1SK6D 3D77A 3FE6A 3PATA 3FE9A 4PE0A 4YRUA 2WCLA 2HPSA 4PT1A 3BOWA 3CWGA 4PCWA 1F70A 3BFHA 3D0YA 2PALA 2KI6C 5F6TA 2Q91A 1GGWA 1UHNA 1X02A 3O2PA 4MZKA 4A4BA 2RGIA 2LNKA 1B8CA 4MN0A 1TOPA 4BY4A 4DCKA 3ZNIA 1DJXA 4C0JA 1DJZA 3QRXA 1BODA 1LXFC 3D75A 4JD9A 1LA3A 4M2OA 1P28A 1PK0D 1QX5B 1XK4C 2BBNA 2GGZA 3BYAA 1C3YA 2NCOA 1IIOA 4MRXA 3L4AA 3GK4X 1QXPA 2PASA 1XFRA 2L5YA 3DY9A 3IVTA 1L7ZA 3K1EA 2ZN9A 4XYNA 1BF5A 4CFRA 4D1EA 4WQ2A 1K9UA 2YGUA 1SR6B 2I18A 1PVAA 1XFVO 1Z2CB 2K2AA 2QPTA 3SG2A 1BLQA 1K94A 1B7TY 2M3WA 2KOTA 3AKAA 3SS4A 4P2YB 1SKTA 5BPJA 1KK8B 2L2EA 5G08A 4C0LA 2K0JA 3CDNA 5I2OA 1SNLA 1A4PA 1YTZC 1BMOA 2GV5A 1ZOTB 3A4UB 2A4JA 3KF9A 4MZLA 2R2IA 4INWA 2FOTA 3ICBA 4PHKA 3O4YA 4MBEA 1A75A 3OX6A 3TDIA 2K2FA 4CIDA 1S1EA 2KFHA 2KYFA 3VRPA 3JTDB 3OX5A 1TIZA 4OV2A 2KGBC 1UURA 3CLNA 1IQ3A 2BKIB 3F45A 1QTXA 2QEBA 1CDPA 2KAXA 2F33A 3I5FB 1UHHA 5CSIA 1CM4A 1VRKA 2KQYA 2P71A 3TS5B 3DF0B 3V2LA 2CT9A 1Y6WA 1G33A 2NCPA 2LAPA 3VROA 1CFCA 1RFJA 4YGCB 1JUOA 5J3XA 2LP2A 4NDCA 1BOCA 2ZRSA 1ORGA 1S26D 1SR6C
chains in the Genus database with same CATH topology
3BFAA 3QMEA 2PQLA 4FQTA 2WCJA 2WCMA 2H8VA 3PJIA 1GM0A 1TUJA 3D78A 1TWOA 1C3ZA 1OOIX 2JPOA 3R1PA 4F7FA 2ERBA 1OOHA 1OOGA 3S0FA 2WCHA 3S0GA 3FE8A 2QEOA 3D74A 3D76A 5DICA 3D77A 3FE6A 2P70A 3FE9A 3B86A 2WCLA 3CZ1A 4PT1A 3RZSA 3NGVA 3BFHA 2QEHA 4INXA 3VB1A 3L47A 3N7HA 3DZTA 3NHIA 3D75A 2FJYA 4JD9A 1P28A 5EL2A 1C3YA 3S0AA 3L4AA 1OOFA 1XFRA 3BFBA 3DY9A 3K1EA 3Q8IA 3L4LA 3B7AA 3D73A 3NHTA 1T14A 3DYEA 2QEVA 3B88A 2QDIA 3CABA 3CYZA 3CDNA 4OZDA 3R1VA 2WC6A 3S0EA 4INWA 3R1OA 3S0DA 3CZ0A 1DQEA 1OW4A 2GTEA 1LS8A 3DXLA 3OGNA 2QEBA 3CZ2A 3S0BA 2KPHA 1QWVA 2L2CA 3B6XA 2P71A 3BJHA 3B87A 3V2LA 3R72A 1ORGA 2WCKA 2WC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFA A;  3QME A;  2PQL A;  4FQT A;  2WCJ A;  2WCM A;  2H8V A;  3PJI A;  1GM0 A;  1TUJ A;  3D78 A;  1TWO A;  1C3Z A;  1OOI X;  2JPO A;  3R1P A;  4F7F A;  2ERB A;  1OOH A;  1OOG A;  3S0F A;  2WCH A;  3S0G A;  3FE8 A;  2QEO A;  3D74 A;  3D76 A;  5DIC A;  3D77 A;  3FE6 A;  2P70 A;  3FE9 A;  3B86 A;  2WCL A;  3CZ1 A;  4PT1 A;  3RZS A;  3NGV A;  3BFH A;  2QEH A;  4INX A;  3VB1 A;  3L47 A;  3N7H A;  3DZT A;  3NHI A;  3D75 A;  2FJY A;  4JD9 A;  1P28 A;  5EL2 A;  1C3Y A;  3S0A A;  3L4A A;  1OOF A;  1XFR A;  3BFB A;  3DY9 A;  3K1E A;  3Q8I A;  3L4L A;  3B7A A;  3D73 A;  3NHT A;  1T14 A;  3DYE A;  2QEV A;  3B88 A;  2QDI A;  3CAB A;  3CYZ A;  3CDN A;  4OZD A;  3R1V A;  2WC6 A;  3S0E A;  4INW A;  3R1O A;  3S0D A;  3CZ0 A;  1DQE A;  1OW4 A;  2GTE A;  1LS8 A;  3DXL A;  3OGN A;  2QEB A;  3CZ2 A;  3S0B A;  2KPH A;  1QWV A;  2L2C A;  3B6X A;  2P71 A;  3BJH A;  3B87 A;  3V2L A;  3R72 A;  1ORG A;  2WCK A;  2WC5 A; 
#chains in the Genus database with same CATH topology
 3FS7 A;  2JU0 A;  1NX1 A;  2BAP A;  3OBV A;  4FQT A;  1DEL A;  1B4C A;  1N2D A;  2Y1N A;  1NIW A;  1QX7 A;  2KGR A;  3TUY B;  1TRF A;  1K9K A;  2F8P A;  1KK7 Z;  1TUJ A;  3DD4 A;  1LA0 A;  1DF0 B;  1KK8 C;  1EG4 A;  3DVM A;  5ER4 X;  4HSZ A;  1CLM A;  3WXA A;  1KFX L;  4BY5 A;  2F3Y A;  3OP0 A;  4GGF A;  1ZAC A;  2JPO A;  1PUL A;  1MUX A;  2LLT A;  1YUS A;  2HQ8 A;  2LLS A;  3PLF B;  1CFP A;  1OOH A;  1Y1X A;  3I5H B;  1J7O A;  1OOG A;  1RWY A;  1WY9 A;  4ORA B;  4YGA A;  5FI2 A;  1B8L A;  1L2O B;  2LHL A;  3EKJ A;  3JTD C;  3CGA A;  2MLF C;  1IJ5 A;  1XVJ A;  2LHI A;  1XFU O;  2BEC A;  5HKW A;  1CB1 A;  1K96 A;  1EL4 A;  3NSK A;  3D76 A;  3IF7 A;  1NP8 A;  2KLE A;  4PE4 A;  3WHT B;  3H4S E;  2M0R A;  1G4Y R;  1SL9 A;  5D7F A;  4QJ3 B;  1H4B A;  3JVT B;  1ZFS A;  1KCY A;  3I5G B;  1RRO A;  1SRA A;  1G8I A;  2HET A;  1NX3 A;  2I2R E;  2JUL A;  2NLN A;  3CZ1 A;  3TS5 C;  3RZS A;  2QAC A;  3FWC A;  3TZ1 A;  2KNE A;  2B1U A;  4AQJ A;  1MQ1 A;  2BBM A;  2WOR A;  1FW4 A;  2CTN A;  1SW8 A;  2BL0 B;  2M8U A;  4NQG A;  2Q4U A;  1U5I B;  4YBH B;  4XJK A;  1JF2 A;  1QVI Y;  2SAS A;  2KI4 B;  1KSO A;  3OB1 B;  1IQ5 A;  2BCB A;  5CSF A;  1EJ3 A;  2LCP A;  1XYD A;  5HKZ A;  1BR4 B;  2JWW A;  3EVR A;  5FI6 A;  1XK4 A;  1LVC D;  1NYA A;  2I94 A;  3PN7 B;  3L47 A;  4F0Z B;  4M2Q A;  3DZT A;  1SY9 A;  1B8R A;  1UHJ A;  2DOQ A;  1WRK A;  3NHI A;  3PSR A;  4MSP A;  1TCO B;  2GGM A;  4USL A;  3I5I B;  1KFU L;  5EL2 A;  1OMD A;  1AHR A;  1J55 A;  1V1F A;  1NPQ A;  2V53 A;  1CMF A;  1CM1 A;  1AJ4 A;  4JQ0 D;  3BFB A;  3AAJ A;  3A8R A;  4HRE E;  2M29 A;  3I5H C;  2EHB A;  2MLE C;  2MRD A;  1QIV A;  4PHN A;  3GK2 A;  4GBA A;  4YGD B;  3SIA A;  1S6C A;  3D73 A;  4PE7 A;  5FI7 A;  1FI5 A;  4WQ3 A;  1T14 A;  3DYE A;  1PRW A;  1K95 A;  1BG1 A;  2E30 A;  2O5G A;  4CLN A;  3CYZ A;  1CFF A;  2K7C A;  2ZN8 A;  1LKJ A;  2JTZ A;  1A2X A;  1SYM A;  1SPY A;  3JVT C;  3NSI A;  3OB2 B;  1CDL A;  3I5G C;  4OZD A;  1DJY A;  2WCF A;  3VRN A;  1HT9 A;  1B9A A;  3EK8 A;  1EG3 A;  1S5G Z;  1XFX O;  2FCD A;  2KFG A;  5AEQ A;  3KHE A;  2BL0 C;  1NUB A;  1M45 A;  2CCM A;  2LV7 A;  2KI4 C;  1N0Y A;  1FF1 A;  1DGV A;  1PSB A;  1WDC B;  1KFX S;  2F2P A;  1XFZ O;  2KBM A;  3PN7 C;  2K7O A;  2M1U A;  1EH2 A;  1NSH A;  1XFY O;  1K90 D;  4MLW A;  2M7L A;  2KAV A;  3I5I C;  4PHM A;  1QIW A;  2L5X B;  2MAZ A;  5FYX A;  2KFF A;  3SS3 A;  4IL1 A;  1YRT B;  3BUO B;  3R72 A;  4TNC A;  4KYN A;  4M2P A;  1J7P A;  2LLU A;  4N1F A;  2EC6 B;  4PAL A;  4PHJ A;  1FI6 A;  5DKQ A;  4MZJ A;  1YUU A;  1K8U A;  2M49 B;  3TDZ A;  1DT7 B;  1M46 A;  2IS9 A;  2MA2 A;  5I8N A;  2ZND A;  3KO0 A;  3CTN A;  2VRG A;  1WLZ A;  1YRU B;  4JWQ A;  1BU3 A;  1RK9 A;  1Y0V H;  1IJ6 A;  1TNQ A;  3NXA A;  1CDN A;  1IWQ A;  1KSM A;  2ZNE A;  1MHO A;  1OOJ A;  2OTG B;  2JRF A;  1BT6 A;  4GGN A;  1Z4H A;  1A75 B;  2ERB A;  1Q80 A;  1UHI A;  4I5N B;  1DC1 A;  1PSR A;  3HX4 A;  2KYC A;  2WCH A;  5DKR A;  5AER A;  2ZFD A;  1FBV A;  1KFU S;  4DS7 A;  1WDC C;  3RLZ A;  1F71 A;  4P5O E;  1JFJ A;  1OSA A;  2KBI A;  3BXK A;  1MXL C;  4N1G A;  3DF0 A;  5DKN A;  1YUR A;  1QV0 A;  5DIC A;  5AAN A;  3UNW A;  2JTT A;  1J1D A;  2ISD A;  3PM2 A;  1QLK A;  1QAS A;  1S3P A;  2BCA A;  2JXC A;  2P70 A;  3B86 A;  2JT3 A;  4MVF A;  1DGU A;  4YGE B;  1JWD A;  1QX2 A;  5TNC A;  1B1G A;  4YI9 A;  4FQO A;  3ZWH A;  1S36 A;  3PM8 A;  1GQM A;  1S6I A;  4PE1 A;  3LLE A;  2I7A A;  2L0P A;  1MWN A;  1AUI B;  3EVV A;  1MR8 A;  2EC6 C;  1UP5 A;  2LVV A;  1MF8 B;  1CDM A;  2QEH A;  1RJV A;  2KHN A;  3AAK A;  4AOM A;  1M31 A;  1F4Q A;  1WRL A;  4HRG A;  1DJI A;  3BUX B;  3VB1 A;  1CLL A;  1R2U A;  3LK0 A;  1K9P A;  2H61 C;  4NDB A;  3N7H A;  1CTR A;  1K2H A;  2H2K A;  2L4I A;  4GPL B;  1B47 A;  2M1K B;  1HQV A;  1C7W A;  3GOF A;  3CS1 A;  2FJY A;  1IG5 A;  1S6J A;  4OVN F;  4OR9 B;  1QAT A;  2OTG C;  2CBL A;  3VRR A;  2LUX A;  2PRU A;  3I5F C;  1OOF A;  3Q8I A;  1AK8 A;  2NXQ A;  1EXR A;  1M39 A;  3BUW B;  3EVU A;  2L50 A;  1IKU A;  2Y1M A;  3UO9 A;  3CR4 X;  2JZI A;  3NHT A;  1DJG A;  4UPG A;  1WLM A;  4L9M A;  4NDD A;  2QEV A;  3B88 A;  3CZT X;  3CR2 A;  1RTP 1;  1W7J B;  2BE4 A;  3SJS A;  2MHH A;  2F2O A;  2QDI A;  2ZKM X;  3E3R A;  5HYD A;  1KK7 Y;  2WND A;  3FWB A;  2BNX A;  4I5J A;  3LL8 B;  2KAY A;  3VRQ A;  2WC8 A;  2L98 A;  3R1V A;  1QV1 A;  4OCI A;  1OZS A;  5D3O A;  3S0E A;  1U5I A;  3EK4 A;  4DRW A;  3R1O A;  3S0D A;  2L4H A;  2FCE A;  2LMT A;  2K7D A;  4ICB A;  4AQI A;  3SG5 A;  1J1E A;  2MJW B;  1NCX A;  3KEV A;  5AFP A;  1L2O C;  2F3Z A;  1LIN A;  2K8M B;  1F54 A;  2KDH A;  3WNX B;  1TCF A;  1QWV A;  1V1G A;  5PAL A;  5GQQ C;  3SG7 A;  2LVI A;  1REC A;  3B87 A;  1IRJ A;  1NWD A;  2L51 A;  2O60 A;  4ETO A;  1ZUZ A;  3O78 A;  3SG4 A;  4MRY A;  3EK7 A;  2JQ6 A;  2PYQ A;  2JT8 A;  4ORC B;  2WCK A;  2WC5 A;  1KWO B;  3BFA A;  3BOW B;  3QME A;  4YGB B;  2PQL A;  1QLS A;  4N5X A;  1KQV A;  2LE9 B;  1B7T Z;  2COL B;  2D8N A;  2NZ0 A;  2WCB A;  3D0Y B;  5KU1 A;  2WCJ A;  2HF5 A;  1DTL A;  1A03 A;  1DMO A;  2H8V A;  4DIR A;  1GJY A;  3PJI A;  1GM0 A;  4ORB B;  5CSN A;  3D78 A;  1H8B A;  1SL7 A;  1C07 A;  2AUC A;  1C3Z A;  1OQP A;  5AXI A;  1F4O A;  3DVJ A;  1NX0 A;  1AVS A;  3BUN B;  3O4X A;  1ALV A;  4CPV A;  2KI6 D;  1J7R A;  4GNK B;  1R6P A;  1NCY A;  3GK1 A;  1JBA A;  2WOS A;  3S0G A;  3M0W A;  3FE8 A;  5HKY A;  4ZCV A;  5JJG A;  3PFV A;  1M63 B;  1SCV A;  1JC2 A;  2EGD A;  2QEO A;  3EKH A;  2K7B A;  3D74 A;  1CNP A;  1DVI A;  1XFW O;  4GUK A;  1OMR A;  2ZRT A;  3NSL A;  1IH0 A;  1QS7 A;  1NX2 A;  2OPO A;  2CXJ A;  2JC2 A;  1W7I B;  1F8H A;  1WRZ A;  4I5L B;  3NGV A;  5JOL A;  2PSR A;  1S5G Y;  5B8I B;  1ALW A;  1JFK A;  5KTY A;  1FPW A;  1C7V A;  2H61 A;  1KWO C;  4MEW A;  2AMI A;  1ZMZ A;  2JNX A;  2G9B A;  2LM5 A;  4INX A;  1TNP A;  2TN4 A;  3MSE B;  1UUS A;  2M9G A;  2BE6 A;  3LK1 A;  2LAN A;  4CFQ A;  4PDZ A;  5CPV A;  3BQ3 A;  2LMU A;  1SMG A;  2OS8 B;  2Y4Q A;  1SL8 A;  1QJT A;  2CNP A;  2LMV A;  3S0A A;  1CKK A;  1DJW A;  2K60 A;  3D10 A;  2HQW A;  3KPX A;  1PAL A;  1XO5 A;  4JPZ B;  1IGV A;  4OKH A;  1D1O A;  1UWO A;  2AAO A;  4QJ5 B;  1MXE A;  3L4L A;  3AKB A;  1BJF A;  4QJ4 B;  2BKH B;  2JT0 A;  3B7A A;  3C1V A;  3WHU B;  1Y1U A;  4I5K A;  1JF0 A;  4U8D A;  5HL1 A;  3FIA A;  3IQQ A;  2KQ6 A;  2JXL A;  3RM1 A;  3CAB A;  1DF0 A;  3DVK A;  1SCM B;  4WRI A;  4E68 A;  1KQM B;  1TTX A;  1AJ5 A;  5HLO A;  2WC6 A;  1W9Z A;  1YR5 A;  2KLD A;  4HRH A;  1UHK A;  3VGO A;  1AP4 A;  4Q04 A;  3K21 A;  5D69 A;  3CZ0 A;  3EG5 B;  3IQO A;  1DQE A;  1OW4 A;  2GTE A;  1QVI Z;  1XA5 A;  1LS8 A;  3OHM B;  2K61 A;  3BUM B;  3DXL A;  3OGN A;  2LVK A;  3PAL A;  4JKT A;  3SS5 A;  4ZCU A;  5I2Q A;  2LUC A;  1J7Q A;  1Y1A A;  1YX8 A;  5I2L A;  4FTG A;  3CZ2 A;  1SBJ A;  1N65 A;  1YVH A;  3S0B A;  2OS8 C;  1CMG A;  2KPH A;  5KSZ A;  1TNW A;  2LC5 A;  1PVB A;  2L2C A;  3NSO A;  3B6X A;  4DUQ A;  3BJH A;  3DVE A;  2PMY A;  1K93 D;  1TNX A;  1ODB A;  1TUZ A;  2M7N A;  3CR5 X;  4GFT A;  2E6W A;  5CSJ A;  1OE9 B;  2JOJ A;  1OZO A;  2WCM A;  1TN4 A;  2M97 A;  2JPT A;  1E8A A;  4XJK B;  1F55 A;  5IBW A;  5ER5 A;  4GAO A;  2P6B B;  1TWO A;  2WCE A;  1SCM C;  2LVJ A;  3O6B A;  2KSP A;  1CLB A;  1KQM C;  3TUY C;  1CFD A;  1JSA A;  1OOI X;  2BCX A;  5HLV A;  1YVL A;  5I94 A;  3R1P A;  2SCP A;  4C0K A;  4R1E A;  5K89 A;  2PVB A;  4F7F A;  1OMV A;  3SG6 A;  1NCZ A;  3S0F A;  4GGF C;  4A4C A;  3TDU A;  1A29 A;  1YX7 A;  1YUT A;  2JNF A;  2MBX A;  1GGZ A;  2Y5I A;  4YI8 A;  3HCM A;  4IJ7 A;  2FJU B;  1DEK A;  1SSE B;  3LCP C;  1BR1 B;  3SIB A;  3SG3 A;  1DJH A;  2G2B A;  2LP3 A;  1SK6 D;  3D77 A;  3FE6 A;  3PAT A;  3FE9 A;  4PE0 A;  4YRU A;  2WCL A;  2HPS A;  4PT1 A;  3BOW A;  3CWG A;  4PCW A;  1F70 A;  3BFH A;  3D0Y A;  2PAL A;  2KI6 C;  5F6T A;  2Q91 A;  1GGW A;  1UHN A;  1X02 A;  3O2P A;  4MZK A;  4A4B A;  2RGI A;  2LNK A;  1B8C A;  4MN0 A;  1TOP A;  4BY4 A;  4DCK A;  3ZNI A;  1DJX A;  4C0J A;  1DJZ A;  3QRX A;  1BOD A;  1LXF C;  3D75 A;  4JD9 A;  1LA3 A;  4M2O A;  1P28 A;  1PK0 D;  1QX5 B;  1XK4 C;  2BBN A;  2GGZ A;  3BYA A;  1C3Y A;  2NCO A;  1IIO A;  4MRX A;  3L4A A;  3GK4 X;  1QXP A;  2PAS A;  1XFR A;  2L5Y A;  3DY9 A;  3IVT A;  1L7Z A;  3K1E A;  2ZN9 A;  4XYN A;  1BF5 A;  4CFR A;  4D1E A;  4WQ2 A;  1K9U A;  2YGU A;  1SR6 B;  2I18 A;  1PVA A;  1XFV O;  1Z2C B;  2K2A A;  2QPT A;  3SG2 A;  1BLQ A;  1K94 A;  1B7T Y;  2M3W A;  2KOT A;  3AKA A;  3SS4 A;  4P2Y B;  1SKT A;  5BPJ A;  1KK8 B;  2L2E A;  5G08 A;  4C0L A;  2K0J A;  3CDN A;  5I2O A;  1SNL A;  1A4P A;  1YTZ C;  1BMO A;  2GV5 A;  1ZOT B;  3A4U B;  2A4J A;  3KF9 A;  4MZL A;  2R2I A;  4INW A;  2FOT A;  3ICB A;  4PHK A;  3O4Y A;  4MBE A;  1A75 A;  3OX6 A;  3TDI A;  2K2F A;  4CID A;  1S1E A;  2KFH A;  2KYF A;  3VRP A;  3JTD B;  3OX5 A;  1TIZ A;  4OV2 A;  2KGB C;  1UUR A;  3CLN A;  1IQ3 A;  2BKI B;  3F45 A;  1QTX A;  2QEB A;  1CDP A;  2KAX A;  2F33 A;  3I5F B;  1UHH A;  5CSI A;  1CM4 A;  1VRK A;  2KQY A;  2P71 A;  3TS5 B;  3DF0 B;  3V2L A;  2CT9 A;  1Y6W A;  1G33 A;  2NCP A;  2LAP A;  3VRO A;  1CFC A;  1RFJ A;  4YGC B;  1JUO A;  5J3X A;  2LP2 A;  4NDC A;  1BOC A;  2ZRS A;  1ORG A;  1S26 D;  1SR6 C; 
#chains in the Genus database with same CATH homology
 3BFA A;  3QME A;  2PQL A;  4FQT A;  2WCJ A;  2WCM A;  2H8V A;  3PJI A;  1GM0 A;  1TUJ A;  3D78 A;  1TWO A;  1C3Z A;  1OOI X;  2JPO A;  3R1P A;  4F7F A;  2ERB A;  1OOH A;  1OOG A;  3S0F A;  2WCH A;  3S0G A;  3FE8 A;  2QEO A;  3D74 A;  3D76 A;  5DIC A;  3D77 A;  3FE6 A;  2P70 A;  3FE9 A;  3B86 A;  2WCL A;  3CZ1 A;  4PT1 A;  3RZS A;  3NGV A;  3BFH A;  2QEH A;  4INX A;  3VB1 A;  3L47 A;  3N7H A;  3DZT A;  3NHI A;  3D75 A;  2FJY A;  4JD9 A;  1P28 A;  5EL2 A;  1C3Y A;  3S0A A;  3L4A A;  1OOF A;  1XFR A;  3BFB A;  3DY9 A;  3K1E A;  3Q8I A;  3L4L A;  3B7A A;  3D73 A;  3NHT A;  1T14 A;  3DYE A;  2QEV A;  3B88 A;  2QDI A;  3CAB A;  3CYZ A;  3CDN A;  4OZD A;  3R1V A;  2WC6 A;  3S0E A;  4INW A;  3R1O A;  3S0D A;  3CZ0 A;  1DQE A;  1OW4 A;  2GTE A;  1LS8 A;  3DXL A;  3OGN A;  2QEB A;  3CZ2 A;  3S0B A;  2KPH A;  1QWV A;  2L2C A;  3B6X A;  2P71 A;  3BJH A;  3B87 A;  3V2L A;  3R72 A;  1ORG A;  2WCK A;  2WC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...