3OGNA

Crystal structure of an odorant-binding protein from the southern house mosquito complexed with an oviposition pheromone
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
VTPRRDAEYPPPELLEALKPLHDICAKKTGVTDEAIIEFSDGKIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPNSMHDIAMHMGKRCLYPEGENLCEKAFWLHKCWKQADPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant-binding protein
publication title Crystal and solution structures of an odorant-binding protein from the southern house mosquito complexed with an oviposition pheromone.
pubmed doi rcsb
source organism Culex quinquefasciatus
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3ognA01
3D74A 3BFAA 1OOHA 1XFRA 1C3YA 3CZ1A 3FE6A 2PQLA 3S0FA 2QEBA 3B86A 2WC6A 1C3ZA 3S0DA 3R1PA 4INWA 3B6XA 3N7HA 2H8VA 3S0EA 3D76A 3R1VA 1OW4A 4PT1A 3NHTA 3FE9A 3BFBA 3D78A 3BFHA 1OOIX 4INXA 3VB1A 1OOGA 1GM0A 3DXLA 2QEOA 3S0GA 1P28A 2L2CA 3DZTA 2QEHA 3D75A 1T14A 3D73A 1LS8A 1DQEA 2QDIA 3L4LA 2P71A 1ORGA 2WCLA 5DICA 1OOFA 3B88A 4JD9A 1QWVA 2WCKA 2P70A 3R72A 3V2LA 2WCJA 2WCMA 3L4AA 3BJHA 4F7FA 4FQTA 2WC5A 1TWOA 3CZ0A 3CZ2A 2FJYA 2QEVA 2GTEA 3PJIA 3FE8A 3B87A 3Q8IA 3QMEA 3DY9A 3R1OA 3CYZA 3NGVA 3OGNA 3RZSA 2WCHA 5EL2A 2JPOA 3K1EA 3D77A 2KPHA 3DYEA 3L47A 4OZDA 3NHIA 2ERBA 3CDNA 1TUJA 3CABA 3B7AA 3S0AA 3S0BA
chains in the Genus database with same CATH superfamily
1GQMA 1PULA 1SSEB 1FI6A 3BFAA 1EJ3A 1OOJA 1BT6A 3BUOB 4PALA 1KWOB 1XFUO 1SNLA 4MSPA 3CZ1A 3FE6A 2PASA 4PE0A 3LK1A 1TOPA 2WCEA 2WOSA 2ZFDA 3B86A 3I5GB 1J1EA 3FIAA 1TRFA 1FF1A 3CZTX 3PN7C 1K96A 1CLLA 2NLNA 3EK4A 1UHHA 2BCXA 4WQ2A 2QACA 2KI4B 2OTGB 1U5IB 2JWWA 4HRHA 1WY9A 2KFFA 2CCMA 2KGBC 3BFBA 3VRPA 4PDZA 1QASA 4NDBA 2JC2A 5D69A 1OOIX 3VB1A 1KQMC 3DXLA 1TNQA 1Y1UA 1FBVA 2DOQA 4M2PA 1F55A 1ZUZA 3S0GA 4JQ0D 2L2CA 3PM8A 1Y1XA 4GFTA 3BQ3A 1WDCB 1LINA 2QEHA 4F0ZB 2LHIA 4WQ3A 5JOLA 3WXAA 4AOMA 3DF0B 5FI7A 3O78A 1YUSA 2QDIA 3LK0A 2BNXA 2P71A 2MLEC 2JNFA 1UHIA 1XFWO 2V53A 1CFPA 1EH2A 2KNEA 4GGNA 2KQYA 2BE6A 2KYCA 1G4YR 4PCWA 1DJIA 2B1UA 2LVJA 2ZRTA 3I5HB 1SRAA 3LLEA 2JU0A 3V2LA 3TUYC 2WCMA 3NSOA 1F8HA 1K9KA 3JVTB 2KOTA 1PK0D 4GBAA 1TUZA 4PE7A 3VRNA 3C1VA 1NP8A 1WLZA 1YRUB 1OQPA 4I5KA 3TS5C 4CFQA 1S36A 1JC2A 3EKHA 3DVKA 4OKHA 1MXEA 2KAYA 1XVJA 3CZ0A 3PFVA 2LV7A 4YBHB 3TDIA 2LANA 4NDDA 5HL1A 1XFXO 2FJUB 4ORAB 5B8IB 2K2AA 2EC6B 1KWOC 4PHKA 2R2IA 5AANA 2NXQA 1WLMA 1MWNA 3A8RA 3FE8A 3SG7A 1XFZO 2M97A 3BXKA 2ISDA 1C07A 1BU3A 4DUQA 1A03A 1XFYO 2JULA 2L98A 1JFKA 1RK9A 2M7NA 2L2EA 2JTTA 3CYZA 2K2FA 3I5GC 4WRIA 3TZ1A 1KCYA 1UWOA 5ER4X 1FW4A 1TCFA 1XO5A 4ZCVA 1YUUA 2JOJA 3AKAA 2D8NA 1CB1A 1DGUA 2GGMA 1AJ4A 2KPHA 2FCDA 3K1EA 3EG5B 3L47A 1GJYA 1R6PA 1SL8A 1TTXA 1Y0VH 2OTGC 2BKIB 2KFGA 1QV1A 2JQ6A 2JNXA 5JJGA 4TNCA 2LLTA 3E3RA 2ZKMX 3M0WA 1IRJA 4OR9B 1SKTA 4YGEB 2LAPA 1B8LA 3LCPC 3NHIA 3OX6A 4YI8A 3S0AA 4MVFA 4XJKB 1QJTA 5J3XA 1DJZA 1OZSA 4M2OA 1EG4A 2SCPA 1DJHA 2K7DA 2MHHA 3D74A 5HYDA 2BE4A 1BLQA 2HPSA 5HKYA 1F71A 1QATA 1ZOTB 3TDUA 1NX1A 1XFRA 4P5OE 1C3YA 4D1EA 2MBXA 2H2KA 4I5JA 5HLVA 1S6IA 1JSAA 4HRGA 1YTZC 2ZN8A 1WRZA 2FCEA 1LA0A 3SG4A 2JXCA 3CLNA 3I5HC 3S0DA 1DJWA 1QX7A 5I2QA 2Y1MA 1UHKA 3D10A 1A75B 3GOFA 1IQ5A 3AAJA 2M0RA 3JVTC 1QX2A 1UHNA 4QJ3B 4OCIA 2JZIA 5AXIA 2LP2A 5BPJA 2GV5A 3S0EA 3EKJA 1UURA 1M39A 4JPZB 4XJKA 4PT1A 3NHTA 1YURA 1B4CA 2AMIA 1FI5A 4A4BA 2JTZA 4INXA 1OOGA 1JF2A 1DELA 1QIWA 4N1GA 1IJ6A 3ICBA 1HT9A 3CR4X 1P28A 3ZNIA 1J55A 1NYAA 1N65A 1TNPA 1RROA 2M29A 1LS8A 1B1GA 2G9BA 1NWDA 3WNXB 2JPTA 2Y1NA 2BBMA 4KYNA 4PHNA 5AERA 1ORGA 1A75A 1SW8A 2WCLA 1OOFA 4NQGA 2ZN9A 4PE4A 5DICA 5FYXA 4JD9A 1NCYA 2Q91A 4AQJA 2WCBA 3KO0A 3HCMA 1C7WA 1DJYA 1LA3A 1PVAA 1QVIZ 2RGIA 2WCJA 3OX5A 1W7IB 1SPYA 1QIVA 4FQOA 3SJSA 4USLA 1Z4HA 1DMOA 1M31A 1QVIY 4C0KA 2BL0C 2MAZA 3DD4A 3I5FB 2JT3A 4F7FA 5DKRA 3PALA 3BUNB 3SIAA 5KTYA 1NCXA 2F3YA 3UNWA 1MXLC 3FS7A 3CGAA 4JWQA 1CMFA 4GAOA 2OS8B 4MEWA 3CZ2A 2VRGA 2H61A 1FPWA 1SCMB 1KK8C 2MLFC 1CDPA 1DF0B 2L4IA 4I5NB 2ZNEA 3B87A 1IQ3A 1E8AA 2BAPA 3I5IB 4M2QA 2QPTA 2TN4A 4I5LB 1U5IA 2CBLA 3O2PA 1KK7Z 3SS3A 1RFJA 1BODA 2KFHA 3H4SE 2K60A 5ER5A 5IBWA 3CWGA 1BOCA 1SBJA 2L5YA 1A29A 1AUIB 3OGNA 4FTGA 1IKUA 3PSRA 2O5GA 1BF5A 2Y5IA 1BJFA 1KK7Y 3BUXB 1TCOB 2NCPA 3FWBA 3KF9A 1QTXA 1CLBA 2KI6C 2NZ0A 1K93D 1KSOA 1L7ZA 2BKHB 2CXJA 1NX3A 2KAVA 2L4HA 5G08A 3KEVA 4U8DA 3BUWB 4OZDA 5DKNA 1YVLA 2GGZA 3UO9A 1EXRA 1JBAA 3SG5A 3DF0A 4YGDB 1SY9A 2HQ8A 3EK8A 1YRTB 1WRKA 1TNXA 2KQ6A 1ALWA 4MZLA 1AJ5A 1A4PA 1NSHA 1DF0A 2O60A 2KDHA 1SL9A 4MLWA 3AKBA 3BUMB 3SG2A 1OOHA 2SASA 1W7JB 1DGVA 1CM1A 1IJ5A 3VROA 1K9PA 3HX4A 3NSKA 1Y1AA 2H61C 5CSJA 3NXAA 2PQLA 1JF0A 1VRKA 5HLOA 3S0FA 3F45A 1G33A 2QEBA 1RECA 1WRLA 3IQQA 1GGWA 4MRXA 5KSZA 4ORCB 2PMYA 1K2HA 3EVRA 3D0YB 5CPVA 3IQOA 1QX5B 2KI4C 2WC6A 1K90D 2LUXA 4INWA 5K89A 1X02A 2M1KB 3B6XA 2K0JA 3IF7A 1J7OA 4DIRA 1L2OB 1MHOA 2F2PA 2ZRSA 2KAXA 2H8VA 4GPLB 3D76A 3R1VA 3I5FC 1B9AA 2MA2A 1IWQA 1OW4A 1F4QA 1S3PA 1KFUS 3FE9A 3LL8B 1V1FA 4C0LA 2I18A 5F6TA 1K95A 1QLKA 3PN7B 2PVBA 2LVKA 1WDCC 3RLZA 3BYAA 1GM0A 4PE1A 2LLSA 1H8BA 2OS8C 1CDNA 2I7AA 3BOWB 1LXFC 1D1OA 1S1EA 1SK6D 1M46A 3DZTA 4PHMA 3D75A 1T14A 3D73A 1KQMB 5GQQC 1QV0A 3L4LA 2KLEA 1CFCA 1YX7A 3IVTA 2F8PA 5FI6A 2BBNA 4UPGA 2L0PA 2KBMA 1YR5A 2KLDA 1EL4A 2L51A 1N0YA 2LVIA 3KHEA 1EG3A 4NDCA 1RJVA 1CDMA 1CFDA 1DJXA 1J7PA 1XA5A 2M1UA 2CNPA 5PALA 1IIOA 1Q80A 3OB2B 1CLMA 1OSAA 3MSEB 4ICBA 4BY5A 4FQTA 1OE9B 1IGVA 3O4XA 4E68A 2EC6C 2WC5A 2Y4QA 3TUYB 3BOWA 5HKWA 1F4OA 2CTNA 1CTRA 3GK2A 1DJGA 5I8NA 1IG5A 4MZKA 1DC1A 5DKQA 1AHRA 4HREE 4GGFA 1MF8B 1NCZA 2LLUA 4Q04A 1UP5A 4DS7A 2M9GA 1JFJA 2FJYA 2MRDA 2AAOA 4OVNF 1SL7A 2PALA 3PJIA 3K21A 1TN4A 2F33A 2ZNDA 1KFXS 2MJWB 1YX8A 2WORA 1KQVA 1CNPA 1J1DA 1RTP1 5HKZA 3SS4A 1ZFSA 3VRRA 3OB1B 3RZSA 1PALA 3NSIA 2NCOA 3PM2A 1F54A 2JPOA 2JT0A 3DVMA 1DVIA 1L2OC 1TIZA 2HQWA 3JTDB 4JKTA 1UUSA 2LM5A 4N5XA 5D3OA 2LCPA 4YRUA 2WC8A 3EK7A 1G8IA 2LP3A 4ORBB 2KSPA 3EVVA 2KI6D 1KFUL 1B8RA 3GK4X 3VRQA 1ALVA 1CM4A 2BCAA 2K61A 1SMGA 1XYDA 4MBEA 1TUJA 1DEKA 1N2DA 2KHNA 3PATA 5CSIA 3RM1A 3S0BA 2K8MB 2K7OA 4N1FA 2K7BA 4GGFC 1C7VA 1F70A 2BCBA 1A2XA 3AAKA 3OBVA 4YGBB 1ODBA 1Z2CB 2LMTA 2L50A 4MZJA 2FOTA 1M63B 4HSZA 2HETA 3WHUB 1YVHA 2A4JA 1B47A 2L5XB 4XYNA 1C3ZA 2LMUA 2M49B 4YGCB 3R1PA 4OV2A 2P6BB 4YI9A 5KU1A 1SR6B 3EVUA 3DVJA 4BY4A 1YUTA 4AQIA 4ETOA 3FWCA 1SYMA 4ZCUA 1PVBA 1HQVA 3N7HA 3OHMB 5AEQA 1SCVA 2PRUA 2YGUA 1NPQA 1S5GZ 2PSRA 2OPOA 4MN0A 1MQ1A 2F3ZA 3D78A 2CT9A 1QXPA 2PYQA 2WNDA 3BFHA 4GNKB 1DT7B 1V1GA 2M8UA 3TDZA 1MUXA 2JXLA 1S5GY 2QEOA 1IH0A 1KSMA 2COLB 1PSRA 1BR4B 1XFVO 4P2YB 1OMDA 1QS7A 2EHBA 1AK8A 1XK4A 3SG6A 1CFFA 1J7QA 2M7LA 1PRWA 3KPXA 3QRXA 4CIDA 1B8CA 1DQEA 1KFXL 3NSLA 1BMOA 1H4BA 5CSNA 1ZACA 3SS5A 1DTLA 1S6CA 2LMVA 3CTNA 2K7CA 1LVCD 1J7RA 1K8UA 1S6JA 2KGRA 3B88A 4QJ5B 1QWVA 4IL1A 5I2OA 3A4UB 1OMRA 2WCKA 2KBIA 2P70A 3JTDC 3R72A 3PLFB 5I2LA 3VGOA 3L4AA 5I94A 2AUCA 2KYFA 1JWDA 3BJHA 3CR2A 2EGDA 2I2RE 1MR8A 3O4YA 1LKJA 2LHLA 1NIWA 1B7TZ 2LE9B 2HF5A 3CR5X 3DVEA 2E6WA 1M45A 1TWOA 1ZMZA 4IJ7A 1AVSA 1SCMC 3ZWHA 1JUOA 4CLNA 1CMGA 1GGZA 4DRWA 1B7TY 2LVVA 5TNCA 4C0JA 1TNWA 1K9UA 2I94A 1BR1B 1OMVA 2BL0B 2M3WA 3D0YA 3I5IC 3O6BA 1NX2A 2G2BA 4L9MA 2QEVA 2GTEA 4A4CA 3GK1A 2F2OA 4MRYA 3Q8IA 1XK4C 5FI2A 1NUBA 1OZOA 3QMEA 5D7FA 1NX0A 3DY9A 3R1OA 1CKKA 5AFPA 2Q4UA 1KK8B 2LUCA 3OP0A 4DCKA 3NGVA 1R2UA 2WCFA 1SR6C 2WCHA 5EL2A 5CSFA 3D77A 1RWYA 4GUKA 3DYEA 1S26D 2BECA 1PSBA 2E30A 2LC5A 2LNKA 1W9ZA 4R1EA 1Y6WA 4YGAA 2JT8A 1BG1A 2ERBA 4CFRA 1UHJA 1QLSA 3CDNA 1CDLA 3CS1A 3CABA 3B7AA 4PHJA 3SIBA 3TS5B 3WHTB 1AP4A 2IS9A 3SG3A 2JRFA 1K94A 4QJ4B 4CPVA
chains in the Genus database with same CATH topology
3D74A 3BFAA 1OOHA 1XFRA 1C3YA 3CZ1A 3FE6A 2PQLA 3S0FA 2QEBA 3B86A 2WC6A 1C3ZA 3S0DA 3R1PA 4INWA 3B6XA 3N7HA 2H8VA 3S0EA 3D76A 3R1VA 1OW4A 4PT1A 3NHTA 3FE9A 3BFBA 3D78A 3BFHA 1OOIX 4INXA 3VB1A 1OOGA 1GM0A 3DXLA 2QEOA 3S0GA 1P28A 2L2CA 3DZTA 2QEHA 3D75A 1T14A 3D73A 1LS8A 1DQEA 2QDIA 3L4LA 2P71A 1ORGA 2WCLA 5DICA 1OOFA 3B88A 4JD9A 1QWVA 2WCKA 2P70A 3R72A 3V2LA 2WCJA 2WCMA 3L4AA 3BJHA 4F7FA 4FQTA 2WC5A 1TWOA 3CZ0A 3CZ2A 2FJYA 2QEVA 2GTEA 3PJIA 3FE8A 3B87A 3Q8IA 3QMEA 3DY9A 3R1OA 3CYZA 3NGVA 3OGNA 3RZSA 2WCHA 5EL2A 2JPOA 3K1EA 3D77A 2KPHA 3DYEA 3L47A 4OZDA 3NHIA 2ERBA 3CDNA 1TUJA 3CABA 3B7AA 3S0AA 3S0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D74 A;  3BFA A;  1OOH A;  1XFR A;  1C3Y A;  3CZ1 A;  3FE6 A;  2PQL A;  3S0F A;  2QEB A;  3B86 A;  2WC6 A;  1C3Z A;  3S0D A;  3R1P A;  4INW A;  3B6X A;  3N7H A;  2H8V A;  3S0E A;  3D76 A;  3R1V A;  1OW4 A;  4PT1 A;  3NHT A;  3FE9 A;  3BFB A;  3D78 A;  3BFH A;  1OOI X;  4INX A;  3VB1 A;  1OOG A;  1GM0 A;  3DXL A;  2QEO A;  3S0G A;  1P28 A;  2L2C A;  3DZT A;  2QEH A;  3D75 A;  1T14 A;  3D73 A;  1LS8 A;  1DQE A;  2QDI A;  3L4L A;  2P71 A;  1ORG A;  2WCL A;  5DIC A;  1OOF A;  3B88 A;  4JD9 A;  1QWV A;  2WCK A;  2P70 A;  3R72 A;  3V2L A;  2WCJ A;  2WCM A;  3L4A A;  3BJH A;  4F7F A;  4FQT A;  2WC5 A;  1TWO A;  3CZ0 A;  3CZ2 A;  2FJY A;  2QEV A;  2GTE A;  3PJI A;  3FE8 A;  3B87 A;  3Q8I A;  3QME A;  3DY9 A;  3R1O A;  3CYZ A;  3NGV A;  3OGN A;  3RZS A;  2WCH A;  5EL2 A;  2JPO A;  3K1E A;  3D77 A;  2KPH A;  3DYE A;  3L47 A;  4OZD A;  3NHI A;  2ERB A;  3CDN A;  1TUJ A;  3CAB A;  3B7A A;  3S0A A;  3S0B A; 
#chains in the Genus database with same CATH topology
 1GQM A;  1PUL A;  1SSE B;  1FI6 A;  3BFA A;  1EJ3 A;  1OOJ A;  1BT6 A;  3BUO B;  4PAL A;  1KWO B;  1XFU O;  1SNL A;  4MSP A;  3CZ1 A;  3FE6 A;  2PAS A;  4PE0 A;  3LK1 A;  1TOP A;  2WCE A;  2WOS A;  2ZFD A;  3B86 A;  3I5G B;  1J1E A;  3FIA A;  1TRF A;  1FF1 A;  3CZT X;  3PN7 C;  1K96 A;  1CLL A;  2NLN A;  3EK4 A;  1UHH A;  2BCX A;  4WQ2 A;  2QAC A;  2KI4 B;  2OTG B;  1U5I B;  2JWW A;  4HRH A;  1WY9 A;  2KFF A;  2CCM A;  2KGB C;  3BFB A;  3VRP A;  4PDZ A;  1QAS A;  4NDB A;  2JC2 A;  5D69 A;  1OOI X;  3VB1 A;  1KQM C;  3DXL A;  1TNQ A;  1Y1U A;  1FBV A;  2DOQ A;  4M2P A;  1F55 A;  1ZUZ A;  3S0G A;  4JQ0 D;  2L2C A;  3PM8 A;  1Y1X A;  4GFT A;  3BQ3 A;  1WDC B;  1LIN A;  2QEH A;  4F0Z B;  2LHI A;  4WQ3 A;  5JOL A;  3WXA A;  4AOM A;  3DF0 B;  5FI7 A;  3O78 A;  1YUS A;  2QDI A;  3LK0 A;  2BNX A;  2P71 A;  2MLE C;  2JNF A;  1UHI A;  1XFW O;  2V53 A;  1CFP A;  1EH2 A;  2KNE A;  4GGN A;  2KQY A;  2BE6 A;  2KYC A;  1G4Y R;  4PCW A;  1DJI A;  2B1U A;  2LVJ A;  2ZRT A;  3I5H B;  1SRA A;  3LLE A;  2JU0 A;  3V2L A;  3TUY C;  2WCM A;  3NSO A;  1F8H A;  1K9K A;  3JVT B;  2KOT A;  1PK0 D;  4GBA A;  1TUZ A;  4PE7 A;  3VRN A;  3C1V A;  1NP8 A;  1WLZ A;  1YRU B;  1OQP A;  4I5K A;  3TS5 C;  4CFQ A;  1S36 A;  1JC2 A;  3EKH A;  3DVK A;  4OKH A;  1MXE A;  2KAY A;  1XVJ A;  3CZ0 A;  3PFV A;  2LV7 A;  4YBH B;  3TDI A;  2LAN A;  4NDD A;  5HL1 A;  1XFX O;  2FJU B;  4ORA B;  5B8I B;  2K2A A;  2EC6 B;  1KWO C;  4PHK A;  2R2I A;  5AAN A;  2NXQ A;  1WLM A;  1MWN A;  3A8R A;  3FE8 A;  3SG7 A;  1XFZ O;  2M97 A;  3BXK A;  2ISD A;  1C07 A;  1BU3 A;  4DUQ A;  1A03 A;  1XFY O;  2JUL A;  2L98 A;  1JFK A;  1RK9 A;  2M7N A;  2L2E A;  2JTT A;  3CYZ A;  2K2F A;  3I5G C;  4WRI A;  3TZ1 A;  1KCY A;  1UWO A;  5ER4 X;  1FW4 A;  1TCF A;  1XO5 A;  4ZCV A;  1YUU A;  2JOJ A;  3AKA A;  2D8N A;  1CB1 A;  1DGU A;  2GGM A;  1AJ4 A;  2KPH A;  2FCD A;  3K1E A;  3EG5 B;  3L47 A;  1GJY A;  1R6P A;  1SL8 A;  1TTX A;  1Y0V H;  2OTG C;  2BKI B;  2KFG A;  1QV1 A;  2JQ6 A;  2JNX A;  5JJG A;  4TNC A;  2LLT A;  3E3R A;  2ZKM X;  3M0W A;  1IRJ A;  4OR9 B;  1SKT A;  4YGE B;  2LAP A;  1B8L A;  3LCP C;  3NHI A;  3OX6 A;  4YI8 A;  3S0A A;  4MVF A;  4XJK B;  1QJT A;  5J3X A;  1DJZ A;  1OZS A;  4M2O A;  1EG4 A;  2SCP A;  1DJH A;  2K7D A;  2MHH A;  3D74 A;  5HYD A;  2BE4 A;  1BLQ A;  2HPS A;  5HKY A;  1F71 A;  1QAT A;  1ZOT B;  3TDU A;  1NX1 A;  1XFR A;  4P5O E;  1C3Y A;  4D1E A;  2MBX A;  2H2K A;  4I5J A;  5HLV A;  1S6I A;  1JSA A;  4HRG A;  1YTZ C;  2ZN8 A;  1WRZ A;  2FCE A;  1LA0 A;  3SG4 A;  2JXC A;  3CLN A;  3I5H C;  3S0D A;  1DJW A;  1QX7 A;  5I2Q A;  2Y1M A;  1UHK A;  3D10 A;  1A75 B;  3GOF A;  1IQ5 A;  3AAJ A;  2M0R A;  3JVT C;  1QX2 A;  1UHN A;  4QJ3 B;  4OCI A;  2JZI A;  5AXI A;  2LP2 A;  5BPJ A;  2GV5 A;  3S0E A;  3EKJ A;  1UUR A;  1M39 A;  4JPZ B;  4XJK A;  4PT1 A;  3NHT A;  1YUR A;  1B4C A;  2AMI A;  1FI5 A;  4A4B A;  2JTZ A;  4INX A;  1OOG A;  1JF2 A;  1DEL A;  1QIW A;  4N1G A;  1IJ6 A;  3ICB A;  1HT9 A;  3CR4 X;  1P28 A;  3ZNI A;  1J55 A;  1NYA A;  1N65 A;  1TNP A;  1RRO A;  2M29 A;  1LS8 A;  1B1G A;  2G9B A;  1NWD A;  3WNX B;  2JPT A;  2Y1N A;  2BBM A;  4KYN A;  4PHN A;  5AER A;  1ORG A;  1A75 A;  1SW8 A;  2WCL A;  1OOF A;  4NQG A;  2ZN9 A;  4PE4 A;  5DIC A;  5FYX A;  4JD9 A;  1NCY A;  2Q91 A;  4AQJ A;  2WCB A;  3KO0 A;  3HCM A;  1C7W A;  1DJY A;  1LA3 A;  1PVA A;  1QVI Z;  2RGI A;  2WCJ A;  3OX5 A;  1W7I B;  1SPY A;  1QIV A;  4FQO A;  3SJS A;  4USL A;  1Z4H A;  1DMO A;  1M31 A;  1QVI Y;  4C0K A;  2BL0 C;  2MAZ A;  3DD4 A;  3I5F B;  2JT3 A;  4F7F A;  5DKR A;  3PAL A;  3BUN B;  3SIA A;  5KTY A;  1NCX A;  2F3Y A;  3UNW A;  1MXL C;  3FS7 A;  3CGA A;  4JWQ A;  1CMF A;  4GAO A;  2OS8 B;  4MEW A;  3CZ2 A;  2VRG A;  2H61 A;  1FPW A;  1SCM B;  1KK8 C;  2MLF C;  1CDP A;  1DF0 B;  2L4I A;  4I5N B;  2ZNE A;  3B87 A;  1IQ3 A;  1E8A A;  2BAP A;  3I5I B;  4M2Q A;  2QPT A;  2TN4 A;  4I5L B;  1U5I A;  2CBL A;  3O2P A;  1KK7 Z;  3SS3 A;  1RFJ A;  1BOD A;  2KFH A;  3H4S E;  2K60 A;  5ER5 A;  5IBW A;  3CWG A;  1BOC A;  1SBJ A;  2L5Y A;  1A29 A;  1AUI B;  3OGN A;  4FTG A;  1IKU A;  3PSR A;  2O5G A;  1BF5 A;  2Y5I A;  1BJF A;  1KK7 Y;  3BUX B;  1TCO B;  2NCP A;  3FWB A;  3KF9 A;  1QTX A;  1CLB A;  2KI6 C;  2NZ0 A;  1K93 D;  1KSO A;  1L7Z A;  2BKH B;  2CXJ A;  1NX3 A;  2KAV A;  2L4H A;  5G08 A;  3KEV A;  4U8D A;  3BUW B;  4OZD A;  5DKN A;  1YVL A;  2GGZ A;  3UO9 A;  1EXR A;  1JBA A;  3SG5 A;  3DF0 A;  4YGD B;  1SY9 A;  2HQ8 A;  3EK8 A;  1YRT B;  1WRK A;  1TNX A;  2KQ6 A;  1ALW A;  4MZL A;  1AJ5 A;  1A4P A;  1NSH A;  1DF0 A;  2O60 A;  2KDH A;  1SL9 A;  4MLW A;  3AKB A;  3BUM B;  3SG2 A;  1OOH A;  2SAS A;  1W7J B;  1DGV A;  1CM1 A;  1IJ5 A;  3VRO A;  1K9P A;  3HX4 A;  3NSK A;  1Y1A A;  2H61 C;  5CSJ A;  3NXA A;  2PQL A;  1JF0 A;  1VRK A;  5HLO A;  3S0F A;  3F45 A;  1G33 A;  2QEB A;  1REC A;  1WRL A;  3IQQ A;  1GGW A;  4MRX A;  5KSZ A;  4ORC B;  2PMY A;  1K2H A;  3EVR A;  3D0Y B;  5CPV A;  3IQO A;  1QX5 B;  2KI4 C;  2WC6 A;  1K90 D;  2LUX A;  4INW A;  5K89 A;  1X02 A;  2M1K B;  3B6X A;  2K0J A;  3IF7 A;  1J7O A;  4DIR A;  1L2O B;  1MHO A;  2F2P A;  2ZRS A;  2KAX A;  2H8V A;  4GPL B;  3D76 A;  3R1V A;  3I5F C;  1B9A A;  2MA2 A;  1IWQ A;  1OW4 A;  1F4Q A;  1S3P A;  1KFU S;  3FE9 A;  3LL8 B;  1V1F A;  4C0L A;  2I18 A;  5F6T A;  1K95 A;  1QLK A;  3PN7 B;  2PVB A;  2LVK A;  1WDC C;  3RLZ A;  3BYA A;  1GM0 A;  4PE1 A;  2LLS A;  1H8B A;  2OS8 C;  1CDN A;  2I7A A;  3BOW B;  1LXF C;  1D1O A;  1S1E A;  1SK6 D;  1M46 A;  3DZT A;  4PHM A;  3D75 A;  1T14 A;  3D73 A;  1KQM B;  5GQQ C;  1QV0 A;  3L4L A;  2KLE A;  1CFC A;  1YX7 A;  3IVT A;  2F8P A;  5FI6 A;  2BBN A;  4UPG A;  2L0P A;  2KBM A;  1YR5 A;  2KLD A;  1EL4 A;  2L51 A;  1N0Y A;  2LVI A;  3KHE A;  1EG3 A;  4NDC A;  1RJV A;  1CDM A;  1CFD A;  1DJX A;  1J7P A;  1XA5 A;  2M1U A;  2CNP A;  5PAL A;  1IIO A;  1Q80 A;  3OB2 B;  1CLM A;  1OSA A;  3MSE B;  4ICB A;  4BY5 A;  4FQT A;  1OE9 B;  1IGV A;  3O4X A;  4E68 A;  2EC6 C;  2WC5 A;  2Y4Q A;  3TUY B;  3BOW A;  5HKW A;  1F4O A;  2CTN A;  1CTR A;  3GK2 A;  1DJG A;  5I8N A;  1IG5 A;  4MZK A;  1DC1 A;  5DKQ A;  1AHR A;  4HRE E;  4GGF A;  1MF8 B;  1NCZ A;  2LLU A;  4Q04 A;  1UP5 A;  4DS7 A;  2M9G A;  1JFJ A;  2FJY A;  2MRD A;  2AAO A;  4OVN F;  1SL7 A;  2PAL A;  3PJI A;  3K21 A;  1TN4 A;  2F33 A;  2ZND A;  1KFX S;  2MJW B;  1YX8 A;  2WOR A;  1KQV A;  1CNP A;  1J1D A;  1RTP 1;  5HKZ A;  3SS4 A;  1ZFS A;  3VRR A;  3OB1 B;  3RZS A;  1PAL A;  3NSI A;  2NCO A;  3PM2 A;  1F54 A;  2JPO A;  2JT0 A;  3DVM A;  1DVI A;  1L2O C;  1TIZ A;  2HQW A;  3JTD B;  4JKT A;  1UUS A;  2LM5 A;  4N5X A;  5D3O A;  2LCP A;  4YRU A;  2WC8 A;  3EK7 A;  1G8I A;  2LP3 A;  4ORB B;  2KSP A;  3EVV A;  2KI6 D;  1KFU L;  1B8R A;  3GK4 X;  3VRQ A;  1ALV A;  1CM4 A;  2BCA A;  2K61 A;  1SMG A;  1XYD A;  4MBE A;  1TUJ A;  1DEK A;  1N2D A;  2KHN A;  3PAT A;  5CSI A;  3RM1 A;  3S0B A;  2K8M B;  2K7O A;  4N1F A;  2K7B A;  4GGF C;  1C7V A;  1F70 A;  2BCB A;  1A2X A;  3AAK A;  3OBV A;  4YGB B;  1ODB A;  1Z2C B;  2LMT A;  2L50 A;  4MZJ A;  2FOT A;  1M63 B;  4HSZ A;  2HET A;  3WHU B;  1YVH A;  2A4J A;  1B47 A;  2L5X B;  4XYN A;  1C3Z A;  2LMU A;  2M49 B;  4YGC B;  3R1P A;  4OV2 A;  2P6B B;  4YI9 A;  5KU1 A;  1SR6 B;  3EVU A;  3DVJ A;  4BY4 A;  1YUT A;  4AQI A;  4ETO A;  3FWC A;  1SYM A;  4ZCU A;  1PVB A;  1HQV A;  3N7H A;  3OHM B;  5AEQ A;  1SCV A;  2PRU A;  2YGU A;  1NPQ A;  1S5G Z;  2PSR A;  2OPO A;  4MN0 A;  1MQ1 A;  2F3Z A;  3D78 A;  2CT9 A;  1QXP A;  2PYQ A;  2WND A;  3BFH A;  4GNK B;  1DT7 B;  1V1G A;  2M8U A;  3TDZ A;  1MUX A;  2JXL A;  1S5G Y;  2QEO A;  1IH0 A;  1KSM A;  2COL B;  1PSR A;  1BR4 B;  1XFV O;  4P2Y B;  1OMD A;  1QS7 A;  2EHB A;  1AK8 A;  1XK4 A;  3SG6 A;  1CFF A;  1J7Q A;  2M7L A;  1PRW A;  3KPX A;  3QRX A;  4CID A;  1B8C A;  1DQE A;  1KFX L;  3NSL A;  1BMO A;  1H4B A;  5CSN A;  1ZAC A;  3SS5 A;  1DTL A;  1S6C A;  2LMV A;  3CTN A;  2K7C A;  1LVC D;  1J7R A;  1K8U A;  1S6J A;  2KGR A;  3B88 A;  4QJ5 B;  1QWV A;  4IL1 A;  5I2O A;  3A4U B;  1OMR A;  2WCK A;  2KBI A;  2P70 A;  3JTD C;  3R72 A;  3PLF B;  5I2L A;  3VGO A;  3L4A A;  5I94 A;  2AUC A;  2KYF A;  1JWD A;  3BJH A;  3CR2 A;  2EGD A;  2I2R E;  1MR8 A;  3O4Y A;  1LKJ A;  2LHL A;  1NIW A;  1B7T Z;  2LE9 B;  2HF5 A;  3CR5 X;  3DVE A;  2E6W A;  1M45 A;  1TWO A;  1ZMZ A;  4IJ7 A;  1AVS A;  1SCM C;  3ZWH A;  1JUO A;  4CLN A;  1CMG A;  1GGZ A;  4DRW A;  1B7T Y;  2LVV A;  5TNC A;  4C0J A;  1TNW A;  1K9U A;  2I94 A;  1BR1 B;  1OMV A;  2BL0 B;  2M3W A;  3D0Y A;  3I5I C;  3O6B A;  1NX2 A;  2G2B A;  4L9M A;  2QEV A;  2GTE A;  4A4C A;  3GK1 A;  2F2O A;  4MRY A;  3Q8I A;  1XK4 C;  5FI2 A;  1NUB A;  1OZO A;  3QME A;  5D7F A;  1NX0 A;  3DY9 A;  3R1O A;  1CKK A;  5AFP A;  2Q4U A;  1KK8 B;  2LUC A;  3OP0 A;  4DCK A;  3NGV A;  1R2U A;  2WCF A;  1SR6 C;  2WCH A;  5EL2 A;  5CSF A;  3D77 A;  1RWY A;  4GUK A;  3DYE A;  1S26 D;  2BEC A;  1PSB A;  2E30 A;  2LC5 A;  2LNK A;  1W9Z A;  4R1E A;  1Y6W A;  4YGA A;  2JT8 A;  1BG1 A;  2ERB A;  4CFR A;  1UHJ A;  1QLS A;  3CDN A;  1CDL A;  3CS1 A;  3CAB A;  3B7A A;  4PHJ A;  3SIB A;  3TS5 B;  3WHT B;  1AP4 A;  2IS9 A;  3SG3 A;  2JRF A;  1K94 A;  4QJ4 B;  4CPV A; 
#chains in the Genus database with same CATH homology
 3D74 A;  3BFA A;  1OOH A;  1XFR A;  1C3Y A;  3CZ1 A;  3FE6 A;  2PQL A;  3S0F A;  2QEB A;  3B86 A;  2WC6 A;  1C3Z A;  3S0D A;  3R1P A;  4INW A;  3B6X A;  3N7H A;  2H8V A;  3S0E A;  3D76 A;  3R1V A;  1OW4 A;  4PT1 A;  3NHT A;  3FE9 A;  3BFB A;  3D78 A;  3BFH A;  1OOI X;  4INX A;  3VB1 A;  1OOG A;  1GM0 A;  3DXL A;  2QEO A;  3S0G A;  1P28 A;  2L2C A;  3DZT A;  2QEH A;  3D75 A;  1T14 A;  3D73 A;  1LS8 A;  1DQE A;  2QDI A;  3L4L A;  2P71 A;  1ORG A;  2WCL A;  5DIC A;  1OOF A;  3B88 A;  4JD9 A;  1QWV A;  2WCK A;  2P70 A;  3R72 A;  3V2L A;  2WCJ A;  2WCM A;  3L4A A;  3BJH A;  4F7F A;  4FQT A;  2WC5 A;  1TWO A;  3CZ0 A;  3CZ2 A;  2FJY A;  2QEV A;  2GTE A;  3PJI A;  3FE8 A;  3B87 A;  3Q8I A;  3QME A;  3DY9 A;  3R1O A;  3CYZ A;  3NGV A;  3OGN A;  3RZS A;  2WCH A;  5EL2 A;  2JPO A;  3K1E A;  3D77 A;  2KPH A;  3DYE A;  3L47 A;  4OZD A;  3NHI A;  2ERB A;  3CDN A;  1TUJ A;  3CAB A;  3B7A A;  3S0A A;  3S0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...