3OGNA

Crystal structure of an odorant-binding protein from the southern house mosquito complexed with an oviposition pheromone
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
VTPRRDAEYPPPELLEALKPLHDICAKKTGVTDEAIIEFSDGKIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPNSMHDIAMHMGKRCLYPEGENLCEKAFWLHKCWKQADPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant-binding protein
publication title Crystal and solution structures of an odorant-binding protein from the southern house mosquito complexed with an oviposition pheromone.
pubmed doi rcsb
source organism Culex quinquefasciatus
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3ognA01
4INXA 3D74A 3R1VA 1ORGA 3B6XA 3K1EA 3DZTA 3DYEA 3CZ0A 5EL2A 3Q8IA 2PQLA 1OOGA 3OGNA 3B87A 3FE9A 3CZ2A 3V2LA 1C3ZA 4PT1A 2QEHA 3CDNA 1TUJA 1QWVA 3BJHA 3NHIA 2WCKA 2GTEA 3VB1A 1TWOA 3NGVA 3NHTA 3L4LA 3FE8A 2WC6A 3FE6A 3R1PA 3S0DA 3S0FA 1DQEA 4OZDA 3BFHA 3BFAA 1T14A 1OW4A 2WCLA 2WCJA 2WCHA 3S0EA 4FQTA 5DICA 1P28A 4JD9A 3B7AA 1C3YA 3RZSA 4F7FA 3S0AA 1XFRA 2QEBA 1GM0A 2L2CA 3BFBA 3DXLA 3CYZA 1LS8A 3D73A 1OOFA 1OOHA 2QEOA 3B88A 3CABA 2KPHA 3D76A 3DY9A 3D78A 3PJIA 3CZ1A 3L4AA 3S0BA 2P71A 3B86A 3R72A 1OOIX 2QEVA 4INWA 2QDIA 2ERBA 3S0GA 2JPOA 2WC5A 2WCMA 2H8VA 3D75A 3R1OA 3N7HA 2P70A 3QMEA 2FJYA 3L47A 3D77A
chains in the Genus database with same CATH superfamily
4JPZB 1NUBA 3BUOB 1DF0B 2OS8B 4INXA 1XYDA 4F0ZB 1XFUO 4ICBA 1Z4HA 3OP0A 5D69A 1JUOA 4GGNA 1CM4A 1PALA 3AKBA 1ORGA 2MLEC 3EVRA 2IS9A 2Y1MA 3KEVA 2KFFA 1V1GA 1R2UA 2P6BB 2ZN9A 3F45A 3I5FB 4OV2A 4ZCVA 3EKJA 4A4CA 1GGZA 1K9UA 1CDMA 2HPSA 2LUCA 2L4IA 1OZOA 2PQLA 3OGNA 3VRNA 2M9GA 3VRRA 1F54A 1AK8A 3LCPC 1UP5A 3SG3A 2B1UA 2QEHA 3CDNA 1QWVA 3NHIA 1LINA 5FI6A 1SL8A 2M0RA 5FYXA 5HLVA 3TZ1A 5HKYA 2WNDA 5AXIA 2BNXA 1YUTA 2LANA 3L4LA 4OVNF 1CFCA 2PSRA 1UHIA 2AUCA 4E68A 5B8IB 1CDLA 1TNWA 2ZNEA 2G2BA 3M0WA 2MBXA 1K94A 1S26D 1WY9A 2PYQA 3ZWHA 1X02A 4XJKB 1YX8A 2WORA 3BFHA 2KI6D 2OTGC 4UPGA 3C1VA 1Z2CB 1S3PA 4PE7A 4DCKA 1F4QA 4YRUA 1SY9A 2ISDA 1WDCB 1N0YA 1T14A 4DS7A 3EK7A 1K96A 3KO0A 2NCOA 2FCEA 1UUSA 2WCHA 1TNQA 2BCXA 4PHJA 2PASA 3CR2A 5ER5A 1B7TZ 1JF2A 1DJWA 3D0YA 4NDDA 1DMOA 4I5NB 3O6BA 4QJ4B 1KQMB 3EK8A 1SK6D 2COLB 1JC2A 3I5IC 2GGZA 5DICA 1K2HA 5IBWA 4GNKB 3SG2A 1QXPA 4GGFA 3DVKA 1PSBA 1DGUA 3LK1A 3LK0A 4ETOA 4ZCUA 1KFXL 3BXKA 3SG7A 1AUIB 2LHLA 3SS3A 2L2CA 2LVIA 4QJ3B 5D3OA 4N1FA 2CTNA 1KK7Y 5PALA 4GUKA 3SG4A 1Y1UA 3CYZA 3WNXB 1SCVA 1CLLA 2KFHA 1UHHA 1DJXA 4YBHB 2F2PA 1OOFA 1OOHA 2HF5A 3CGAA 3E3RA 5DKNA 1IWQA 1CMFA 1TUZA 1S5GY 1NIWA 4NQGA 2KBIA 3TDZA 3EKHA 1W9ZA 3HX4A 3BUMB 1ZUZA 2KPHA 4C0JA 1ZMZA 3D76A 3DY9A 1PRWA 3FWCA 4NDCA 1CB1A 3PM8A 1K90D 1QVIZ 1RWYA 2LE9B 3CZ1A 3IVTA 3JTDC 2K7DA 2EHBA 2G9BA 3CTNA 1KK8B 2KQYA 2D8NA 2AMIA 1XK4A 1MWNA 1UWOA 1NCXA 1SL9A 2LC5A 2TN4A 1UHNA 1DEKA 4ORAB 1S6JA 4ORBB 1NSHA 2H61C 3I5HB 1TOPA 1PULA 2JPOA 3S0GA 1CDPA 1WDCC 2K60A 2KNEA 2MHHA 4WRIA 2NLNA 3IF7A 4I5LB 1A03A 3BYAA 2BL0C 3CR4X 1PSRA 2KGBC 4KYNA 3QMEA 2CXJA 3EVVA 3DVJA 2FJYA 1YVHA 1A2XA 3D10A 2MJWB 3DVMA 1QV0A 1A75A 3L47A 1CTRA 1KQMC 3BOWA 3EVUA 4OR9B 2A4JA 2RGIA 3SG6A 3AAKA 1U5IB 2I18A 3TUYC 4HRHA 3R1VA 1OQPA 5KSZA 1HT9A 2NZ0A 2LNKA 1EG3A 1QIWA 3DZTA 2NCPA 2M1UA 2Q4UA 1MQ1A 4N5XA 1BF5A 3DYEA 5KU1A 1FF1A 1LA3A 4R1EA 1DJYA 1OOGA 1YX7A 4QJ5B 1GGWA 1IJ5A 1YRUB 2K7OA 3FE9A 3DF0B 1C3ZA 4MZLA 1Y0VH 3ZNIA 3GOFA 1TUJA 3ICBA 1DVIA 4HRGA 5DKQA 3VB1A 1QLKA 2CT9A 5HLOA 2KGRA 1V1FA 2KI4B 2LLSA 1DJZA 4C0KA 1SSEB 3NHTA 2LMUA 2LVJA 1B8LA 2WC6A 3FE8A 2M8UA 1B4CA 1CFFA 3R1PA 1KFXS 5DKRA 2CBLA 1R6PA 4JQ0D 4MRYA 1VRKA 4FTGA 1DJIA 1KK8C 4DIRA 2FJUB 5HL1A 1KSOA 2DOQA 1EL4A 3BQ3A 4M2QA 1TRFA 1G33A 2SASA 1UURA 2BAPA 1KWOB 1ZOTB 3SG5A 1ZACA 1NX3A 2K7CA 4U8DA 3OB1B 5G08A 1B8RA 5AERA 3O2PA 4M2OA 1G8IA 2O60A 3K21A 4YGEB 1QX5B 2ZFDA 4PHNA 4PHMA 1FPWA 1OMDA 1YUSA 3S0EA 1OMRA 2JT0A 2O5GA 4FQTA 1TTXA 1LKJA 1RECA 2BKHB 5I94A 4PCWA 3B7AA 2K2FA 2WC8A 3UNWA 1SR6B 3RZSA 1F8HA 1FBVA 1PK0D 3BUNB 3S0AA 1F70A 1Y1XA 5JJGA 2JC2A 3JVTB 2BKIB 4YGAA 2KAVA 1IH0A 2HQWA 1GM0A 1Y1AA 2HQ8A 3NXAA 4CIDA 1KFUL 4PE4A 1PVBA 3D0YB 1QS7A 2K61A 2M97A 2MAZA 3VRQA 3B88A 1C7VA 4MZKA 3PN7C 1B1GA 2YGUA 3OBVA 4MLWA 2LVKA 1CFPA 4JKTA 1G4YR 3D78A 2KI4C 2WCFA 2M1KB 2F33A 3H4SE 3PJIA 1J7OA 3OB2B 3HCMA 2I7AA 1NX2A 5D7FA 1MXLC 3KF9A 4CPVA 2E30A 2OS8C 1QX7A 2K2AA 1IQ5A 1RK9A 4I5JA 3WHTB 1OOJA 1QJTA 1RJVA 1ZFSA 2KAXA 2L4HA 3CR5X 4USLA 2FCDA 3I5GB 1CDNA 1IG5A 4OCIA 1IJ6A 2WOSA 1S36A 5KTYA 2KLDA 3I5FC 2KQ6A 1S6CA 2H8VA 4A4BA 1J1DA 2V53A 1SBJA 4MZJA 3SIAA 3N7HA 3VRPA 1OMVA 1ALWA 2KLEA 3FWBA 2PVBA 2EGDA 4YI9A 2JNXA 1KK7Z 2OPOA 1L7ZA 3O4YA 1L2OB 2KI6C 3D77A 4GPLB 1BT6A 1CFDA 1BR1B 2SCPA 4WQ3A 3UO9A 1S5GZ 3D74A 4DRWA 1SW8A 1TCFA 3WXAA 4D1EA 2BBMA 3NSLA 5TNCA 3B6XA 4GAOA 1W7JB 1TN4A 1AHRA 3O4XA 1XFWO 3JVTC 1XA5A 5EL2A 3Q8IA 4PALA 1LVCD 3EG5B 2JNFA 2KAYA 4CLNA 2F3YA 3OX6A 3CLNA 5FI2A 1CNPA 2GV5A 3CZ2A 1AP4A 3V2LA 4BY5A 2CNPA 3BJHA 1A75B 2L98A 3BOWB 2LV7A 2WCKA 3FIAA 1WRZA 1CLBA 1M63B 2MRDA 1NWDA 4C0LA 5ER4X 1QTXA 1YURA 1QATA 3PLFB 3S0FA 1QASA 2LAPA 2BCBA 1SL7A 2ZN8A 4OZDA 4P2YB 2EC6B 2JWWA 1KFUS 5J3XA 4NDBA 1QLSA 2PMYA 1GJYA 2MLFC 4I5KA 3I5GC 4AQIA 2L5YA 3TDUA 1IQ3A 3NSOA 3A4UB 3BFAA 2BE4A 2GGMA 3OHMB 1EH2A 1JWDA 1DGVA 1ODBA 2M49B 3FS7A 1KCYA 3CWGA 2JOJA 2JULA 2LLTA 5BPJA 1JSAA 2E6WA 4AOMA 5FI7A 4MEWA 3OX5A 1XFVO 5GQQC 1NX1A 1J55A 1YUUA 5CPVA 1C7WA 3A8RA 5CSNA 1L2OC 4JD9A 1W7IB 1EJ3A 2KYFA 1XK4C 2K0JA 1S6IA 1C3YA 2OTGB 4F7FA 1M31A 2L2EA 1K9PA 2JTZA 4MBEA 2Q91A 2F2OA 4PHKA 1AJ4A 1NYAA 1F71A 1SNLA 1LA0A 1IIOA 1XFRA 4Q04A 1B47A 3BFBA 1H8BA 3DXLA 5HYDA 2LUXA 1LS8A 1M39A 3I5HC 3D73A 1WLMA 1MHOA 5K89A 1CKKA 1CLMA 2LVVA 1XVJA 3IQOA 3GK2A 1YRTB 1A29A 2WCBA 3I5IB 1A4PA 4FQOA 2I94A 4ORCB 1K93D 4PDZA 1B9AA 3VROA 3AAJA 1SCMB 1TNPA 3GK1A 3L4AA 5AANA 1PVAA 1N65A 3TS5B 2K7BA 1BMOA 1E8AA 3DD4A 1WLZA 4JWQA 4XYNA 5HKWA 3TDIA 1DF0A 3IQQA 1XFZO 4GBAA 3PALA 3KPXA 2EC6C 4MSPA 1XFXO 2QPTA 3PFVA 3VGOA 2ERBA 4YGDB 4CFRA 2LLUA 1MXEA 2WC5A 3DVEA 1QIVA 4AQJA 2LP3A 1AJ5A 2JPTA 1JF0A 2JTTA 2KFGA 2Y1NA 3R1OA 4HSZA 2CCMA 1EXRA 2JZIA 2PALA 1OZSA 1Y6WA 4MRXA 4PE0A 1LXFC 1FW4A 3JTDB 4GFTA 5HKZA 2ZKMX 1C07A 2LCPA 1M46A 2M7NA 1DJGA 2LP2A 1YTZC 2WCEA 1Q80A 1WRLA 1RTP1 1IRJA 1F4OA 1OSAA 3SJSA 1SPYA 1BR4B 3KHEA 5CSJA 3K1EA 5CSIA 1J7PA 2M7LA 2R2IA 3GK4X 1TIZA 4XJKA 2MA2A 3CZ0A 1B7TY 2F8PA 4M2PA 1K8UA 1GQMA 1KWOC 4HREE 2VRGA 1SKTA 1TNXA 2BL0B 2H61A 2KHNA 1SMGA 1WRKA 3B87A 4YGBB 4DUQA 1TCOB 4PT1A 1DC1A 1H4BA 4N1GA 1DELA 1NCZA 2KBMA 1N2DA 2GTEA 3NSIA 1TWOA 4P5OE 3NGVA 1HQVA 4YGCB 3FE6A 3WHUB 2KOTA 3TUYB 1SCMC 1XO5A 3S0DA 3TS5C 5AFPA 2BBNA 2BECA 1BOCA 1DQEA 1UHJA 1SR6C 2KDHA 1MR8A 4OKHA 1OE9B 2QACA 1BG1A 1CM1A 1EG4A 2BE6A 1CMGA 1MF8B 3BUWB 2L51A 1OW4A 2LMVA 2WCLA 1S1EA 2WCJA 2K8MB 2ZRTA 1QVIY 2M3WA 4BY4A 1QX2A 3AKAA 2JT8A 3CZTX 1J1EA 2L5XB 2LMTA 4PE1A 1DT7B 1YR5A 1NX0A 4YI8A 2F3ZA 3LL8B 1RFJA 2PRUA 2JU0A 5I2LA 3EK4A 4MVFA 1K95A 4IJ7A 2L50A 1P28A 4GGFC 1NP8A 1M45A 3RM1A 1F55A 2KSPA 4IL1A 3QRXA 5I8NA 2M29A 2JRFA 5CSFA 5I2OA 1UHKA 1DTLA 2QEBA 2JQ6A 4L9MA 2JXLA 3SS4A 2JXCA 3O78A 1D1OA 1JFKA 3BUXB 1AVSA 2ZNDA 3MSEB 1BJFA 4TNCA 2QEOA 3CABA 1NCYA 1IGVA 1KSMA 1SYMA 1BODA 1FI5A 5JOLA 4MN0A 1YVLA 1MUXA 3RLZA 3PSRA 3PM2A 2FOTA 2AAOA 4CFQA 1KQVA 2LHIA 2NXQA 1QV1A 2JT3A 1FI6A 3SIBA 3S0BA 2P71A 3B86A 3R72A 1J7QA 2H2KA 1K9KA 3LLEA 5AEQA 1U5IA 1BU3A 1JFJA 1ALVA 1OOIX 2QEVA 3PATA 1DJHA 2QDIA 4INWA 2Y5IA 1IKUA 2KYCA 1B8CA 2HETA 4WQ2A 2I2RE 1J7RA 2WCMA 3PN7B 2L0PA 3NSKA 3D75A 1BLQA 5I2QA 1RROA 1XFYO 2LM5A 1JBAA 2P70A 2ZRSA 3SS5A 1SRAA 5F6TA 2BCAA 3DF0A 2Y4QA 3CS1A 1NPQA
chains in the Genus database with same CATH topology
4INXA 3D74A 3R1VA 1ORGA 3B6XA 3K1EA 3DZTA 3DYEA 3CZ0A 5EL2A 3Q8IA 2PQLA 1OOGA 3OGNA 3B87A 3FE9A 3CZ2A 3V2LA 1C3ZA 4PT1A 2QEHA 3CDNA 1TUJA 1QWVA 3BJHA 3NHIA 2WCKA 2GTEA 3VB1A 1TWOA 3NGVA 3NHTA 3L4LA 3FE8A 2WC6A 3FE6A 3R1PA 3S0DA 3S0FA 1DQEA 4OZDA 3BFHA 3BFAA 1T14A 1OW4A 2WCLA 2WCJA 2WCHA 3S0EA 4FQTA 5DICA 1P28A 4JD9A 3B7AA 1C3YA 3RZSA 4F7FA 3S0AA 1XFRA 2QEBA 1GM0A 2L2CA 3BFBA 3DXLA 3CYZA 1LS8A 3D73A 1OOFA 1OOHA 2QEOA 3B88A 3CABA 2KPHA 3D76A 3DY9A 3D78A 3PJIA 3CZ1A 3L4AA 3S0BA 2P71A 3B86A 3R72A 1OOIX 2QEVA 4INWA 2QDIA 2ERBA 3S0GA 2JPOA 2WC5A 2WCMA 2H8VA 3D75A 3R1OA 3N7HA 2P70A 3QMEA 2FJYA 3L47A 3D77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4INX A;  3D74 A;  3R1V A;  1ORG A;  3B6X A;  3K1E A;  3DZT A;  3DYE A;  3CZ0 A;  5EL2 A;  3Q8I A;  2PQL A;  1OOG A;  3OGN A;  3B87 A;  3FE9 A;  3CZ2 A;  3V2L A;  1C3Z A;  4PT1 A;  2QEH A;  3CDN A;  1TUJ A;  1QWV A;  3BJH A;  3NHI A;  2WCK A;  2GTE A;  3VB1 A;  1TWO A;  3NGV A;  3NHT A;  3L4L A;  3FE8 A;  2WC6 A;  3FE6 A;  3R1P A;  3S0D A;  3S0F A;  1DQE A;  4OZD A;  3BFH A;  3BFA A;  1T14 A;  1OW4 A;  2WCL A;  2WCJ A;  2WCH A;  3S0E A;  4FQT A;  5DIC A;  1P28 A;  4JD9 A;  3B7A A;  1C3Y A;  3RZS A;  4F7F A;  3S0A A;  1XFR A;  2QEB A;  1GM0 A;  2L2C A;  3BFB A;  3DXL A;  3CYZ A;  1LS8 A;  3D73 A;  1OOF A;  1OOH A;  2QEO A;  3B88 A;  3CAB A;  2KPH A;  3D76 A;  3DY9 A;  3D78 A;  3PJI A;  3CZ1 A;  3L4A A;  3S0B A;  2P71 A;  3B86 A;  3R72 A;  1OOI X;  2QEV A;  4INW A;  2QDI A;  2ERB A;  3S0G A;  2JPO A;  2WC5 A;  2WCM A;  2H8V A;  3D75 A;  3R1O A;  3N7H A;  2P70 A;  3QME A;  2FJY A;  3L47 A;  3D77 A; 
#chains in the Genus database with same CATH topology
 4JPZ B;  1NUB A;  3BUO B;  1DF0 B;  2OS8 B;  4INX A;  1XYD A;  4F0Z B;  1XFU O;  4ICB A;  1Z4H A;  3OP0 A;  5D69 A;  1JUO A;  4GGN A;  1CM4 A;  1PAL A;  3AKB A;  1ORG A;  2MLE C;  3EVR A;  2IS9 A;  2Y1M A;  3KEV A;  2KFF A;  1V1G A;  1R2U A;  2P6B B;  2ZN9 A;  3F45 A;  3I5F B;  4OV2 A;  4ZCV A;  3EKJ A;  4A4C A;  1GGZ A;  1K9U A;  1CDM A;  2HPS A;  2LUC A;  2L4I A;  1OZO A;  2PQL A;  3OGN A;  3VRN A;  2M9G A;  3VRR A;  1F54 A;  1AK8 A;  3LCP C;  1UP5 A;  3SG3 A;  2B1U A;  2QEH A;  3CDN A;  1QWV A;  3NHI A;  1LIN A;  5FI6 A;  1SL8 A;  2M0R A;  5FYX A;  5HLV A;  3TZ1 A;  5HKY A;  2WND A;  5AXI A;  2BNX A;  1YUT A;  2LAN A;  3L4L A;  4OVN F;  1CFC A;  2PSR A;  1UHI A;  2AUC A;  4E68 A;  5B8I B;  1CDL A;  1TNW A;  2ZNE A;  2G2B A;  3M0W A;  2MBX A;  1K94 A;  1S26 D;  1WY9 A;  2PYQ A;  3ZWH A;  1X02 A;  4XJK B;  1YX8 A;  2WOR A;  3BFH A;  2KI6 D;  2OTG C;  4UPG A;  3C1V A;  1Z2C B;  1S3P A;  4PE7 A;  4DCK A;  1F4Q A;  4YRU A;  1SY9 A;  2ISD A;  1WDC B;  1N0Y A;  1T14 A;  4DS7 A;  3EK7 A;  1K96 A;  3KO0 A;  2NCO A;  2FCE A;  1UUS A;  2WCH A;  1TNQ A;  2BCX A;  4PHJ A;  2PAS A;  3CR2 A;  5ER5 A;  1B7T Z;  1JF2 A;  1DJW A;  3D0Y A;  4NDD A;  1DMO A;  4I5N B;  3O6B A;  4QJ4 B;  1KQM B;  3EK8 A;  1SK6 D;  2COL B;  1JC2 A;  3I5I C;  2GGZ A;  5DIC A;  1K2H A;  5IBW A;  4GNK B;  3SG2 A;  1QXP A;  4GGF A;  3DVK A;  1PSB A;  1DGU A;  3LK1 A;  3LK0 A;  4ETO A;  4ZCU A;  1KFX L;  3BXK A;  3SG7 A;  1AUI B;  2LHL A;  3SS3 A;  2L2C A;  2LVI A;  4QJ3 B;  5D3O A;  4N1F A;  2CTN A;  1KK7 Y;  5PAL A;  4GUK A;  3SG4 A;  1Y1U A;  3CYZ A;  3WNX B;  1SCV A;  1CLL A;  2KFH A;  1UHH A;  1DJX A;  4YBH B;  2F2P A;  1OOF A;  1OOH A;  2HF5 A;  3CGA A;  3E3R A;  5DKN A;  1IWQ A;  1CMF A;  1TUZ A;  1S5G Y;  1NIW A;  4NQG A;  2KBI A;  3TDZ A;  3EKH A;  1W9Z A;  3HX4 A;  3BUM B;  1ZUZ A;  2KPH A;  4C0J A;  1ZMZ A;  3D76 A;  3DY9 A;  1PRW A;  3FWC A;  4NDC A;  1CB1 A;  3PM8 A;  1K90 D;  1QVI Z;  1RWY A;  2LE9 B;  3CZ1 A;  3IVT A;  3JTD C;  2K7D A;  2EHB A;  2G9B A;  3CTN A;  1KK8 B;  2KQY A;  2D8N A;  2AMI A;  1XK4 A;  1MWN A;  1UWO A;  1NCX A;  1SL9 A;  2LC5 A;  2TN4 A;  1UHN A;  1DEK A;  4ORA B;  1S6J A;  4ORB B;  1NSH A;  2H61 C;  3I5H B;  1TOP A;  1PUL A;  2JPO A;  3S0G A;  1CDP A;  1WDC C;  2K60 A;  2KNE A;  2MHH A;  4WRI A;  2NLN A;  3IF7 A;  4I5L B;  1A03 A;  3BYA A;  2BL0 C;  3CR4 X;  1PSR A;  2KGB C;  4KYN A;  3QME A;  2CXJ A;  3EVV A;  3DVJ A;  2FJY A;  1YVH A;  1A2X A;  3D10 A;  2MJW B;  3DVM A;  1QV0 A;  1A75 A;  3L47 A;  1CTR A;  1KQM C;  3BOW A;  3EVU A;  4OR9 B;  2A4J A;  2RGI A;  3SG6 A;  3AAK A;  1U5I B;  2I18 A;  3TUY C;  4HRH A;  3R1V A;  1OQP A;  5KSZ A;  1HT9 A;  2NZ0 A;  2LNK A;  1EG3 A;  1QIW A;  3DZT A;  2NCP A;  2M1U A;  2Q4U A;  1MQ1 A;  4N5X A;  1BF5 A;  3DYE A;  5KU1 A;  1FF1 A;  1LA3 A;  4R1E A;  1DJY A;  1OOG A;  1YX7 A;  4QJ5 B;  1GGW A;  1IJ5 A;  1YRU B;  2K7O A;  3FE9 A;  3DF0 B;  1C3Z A;  4MZL A;  1Y0V H;  3ZNI A;  3GOF A;  1TUJ A;  3ICB A;  1DVI A;  4HRG A;  5DKQ A;  3VB1 A;  1QLK A;  2CT9 A;  5HLO A;  2KGR A;  1V1F A;  2KI4 B;  2LLS A;  1DJZ A;  4C0K A;  1SSE B;  3NHT A;  2LMU A;  2LVJ A;  1B8L A;  2WC6 A;  3FE8 A;  2M8U A;  1B4C A;  1CFF A;  3R1P A;  1KFX S;  5DKR A;  2CBL A;  1R6P A;  4JQ0 D;  4MRY A;  1VRK A;  4FTG A;  1DJI A;  1KK8 C;  4DIR A;  2FJU B;  5HL1 A;  1KSO A;  2DOQ A;  1EL4 A;  3BQ3 A;  4M2Q A;  1TRF A;  1G33 A;  2SAS A;  1UUR A;  2BAP A;  1KWO B;  1ZOT B;  3SG5 A;  1ZAC A;  1NX3 A;  2K7C A;  4U8D A;  3OB1 B;  5G08 A;  1B8R A;  5AER A;  3O2P A;  4M2O A;  1G8I A;  2O60 A;  3K21 A;  4YGE B;  1QX5 B;  2ZFD A;  4PHN A;  4PHM A;  1FPW A;  1OMD A;  1YUS A;  3S0E A;  1OMR A;  2JT0 A;  2O5G A;  4FQT A;  1TTX A;  1LKJ A;  1REC A;  2BKH B;  5I94 A;  4PCW A;  3B7A A;  2K2F A;  2WC8 A;  3UNW A;  1SR6 B;  3RZS A;  1F8H A;  1FBV A;  1PK0 D;  3BUN B;  3S0A A;  1F70 A;  1Y1X A;  5JJG A;  2JC2 A;  3JVT B;  2BKI B;  4YGA A;  2KAV A;  1IH0 A;  2HQW A;  1GM0 A;  1Y1A A;  2HQ8 A;  3NXA A;  4CID A;  1KFU L;  4PE4 A;  1PVB A;  3D0Y B;  1QS7 A;  2K61 A;  2M97 A;  2MAZ A;  3VRQ A;  3B88 A;  1C7V A;  4MZK A;  3PN7 C;  1B1G A;  2YGU A;  3OBV A;  4MLW A;  2LVK A;  1CFP A;  4JKT A;  1G4Y R;  3D78 A;  2KI4 C;  2WCF A;  2M1K B;  2F33 A;  3H4S E;  3PJI A;  1J7O A;  3OB2 B;  3HCM A;  2I7A A;  1NX2 A;  5D7F A;  1MXL C;  3KF9 A;  4CPV A;  2E30 A;  2OS8 C;  1QX7 A;  2K2A A;  1IQ5 A;  1RK9 A;  4I5J A;  3WHT B;  1OOJ A;  1QJT A;  1RJV A;  1ZFS A;  2KAX A;  2L4H A;  3CR5 X;  4USL A;  2FCD A;  3I5G B;  1CDN A;  1IG5 A;  4OCI A;  1IJ6 A;  2WOS A;  1S36 A;  5KTY A;  2KLD A;  3I5F C;  2KQ6 A;  1S6C A;  2H8V A;  4A4B A;  1J1D A;  2V53 A;  1SBJ A;  4MZJ A;  3SIA A;  3N7H A;  3VRP A;  1OMV A;  1ALW A;  2KLE A;  3FWB A;  2PVB A;  2EGD A;  4YI9 A;  2JNX A;  1KK7 Z;  2OPO A;  1L7Z A;  3O4Y A;  1L2O B;  2KI6 C;  3D77 A;  4GPL B;  1BT6 A;  1CFD A;  1BR1 B;  2SCP A;  4WQ3 A;  3UO9 A;  1S5G Z;  3D74 A;  4DRW A;  1SW8 A;  1TCF A;  3WXA A;  4D1E A;  2BBM A;  3NSL A;  5TNC A;  3B6X A;  4GAO A;  1W7J B;  1TN4 A;  1AHR A;  3O4X A;  1XFW O;  3JVT C;  1XA5 A;  5EL2 A;  3Q8I A;  4PAL A;  1LVC D;  3EG5 B;  2JNF A;  2KAY A;  4CLN A;  2F3Y A;  3OX6 A;  3CLN A;  5FI2 A;  1CNP A;  2GV5 A;  3CZ2 A;  1AP4 A;  3V2L A;  4BY5 A;  2CNP A;  3BJH A;  1A75 B;  2L98 A;  3BOW B;  2LV7 A;  2WCK A;  3FIA A;  1WRZ A;  1CLB A;  1M63 B;  2MRD A;  1NWD A;  4C0L A;  5ER4 X;  1QTX A;  1YUR A;  1QAT A;  3PLF B;  3S0F A;  1QAS A;  2LAP A;  2BCB A;  1SL7 A;  2ZN8 A;  4OZD A;  4P2Y B;  2EC6 B;  2JWW A;  1KFU S;  5J3X A;  4NDB A;  1QLS A;  2PMY A;  1GJY A;  2MLF C;  4I5K A;  3I5G C;  4AQI A;  2L5Y A;  3TDU A;  1IQ3 A;  3NSO A;  3A4U B;  3BFA A;  2BE4 A;  2GGM A;  3OHM B;  1EH2 A;  1JWD A;  1DGV A;  1ODB A;  2M49 B;  3FS7 A;  1KCY A;  3CWG A;  2JOJ A;  2JUL A;  2LLT A;  5BPJ A;  1JSA A;  2E6W A;  4AOM A;  5FI7 A;  4MEW A;  3OX5 A;  1XFV O;  5GQQ C;  1NX1 A;  1J55 A;  1YUU A;  5CPV A;  1C7W A;  3A8R A;  5CSN A;  1L2O C;  4JD9 A;  1W7I B;  1EJ3 A;  2KYF A;  1XK4 C;  2K0J A;  1S6I A;  1C3Y A;  2OTG B;  4F7F A;  1M31 A;  2L2E A;  1K9P A;  2JTZ A;  4MBE A;  2Q91 A;  2F2O A;  4PHK A;  1AJ4 A;  1NYA A;  1F71 A;  1SNL A;  1LA0 A;  1IIO A;  1XFR A;  4Q04 A;  1B47 A;  3BFB A;  1H8B A;  3DXL A;  5HYD A;  2LUX A;  1LS8 A;  1M39 A;  3I5H C;  3D73 A;  1WLM A;  1MHO A;  5K89 A;  1CKK A;  1CLM A;  2LVV A;  1XVJ A;  3IQO A;  3GK2 A;  1YRT B;  1A29 A;  2WCB A;  3I5I B;  1A4P A;  4FQO A;  2I94 A;  4ORC B;  1K93 D;  4PDZ A;  1B9A A;  3VRO A;  3AAJ A;  1SCM B;  1TNP A;  3GK1 A;  3L4A A;  5AAN A;  1PVA A;  1N65 A;  3TS5 B;  2K7B A;  1BMO A;  1E8A A;  3DD4 A;  1WLZ A;  4JWQ A;  4XYN A;  5HKW A;  3TDI A;  1DF0 A;  3IQQ A;  1XFZ O;  4GBA A;  3PAL A;  3KPX A;  2EC6 C;  4MSP A;  1XFX O;  2QPT A;  3PFV A;  3VGO A;  2ERB A;  4YGD B;  4CFR A;  2LLU A;  1MXE A;  2WC5 A;  3DVE A;  1QIV A;  4AQJ A;  2LP3 A;  1AJ5 A;  2JPT A;  1JF0 A;  2JTT A;  2KFG A;  2Y1N A;  3R1O A;  4HSZ A;  2CCM A;  1EXR A;  2JZI A;  2PAL A;  1OZS A;  1Y6W A;  4MRX A;  4PE0 A;  1LXF C;  1FW4 A;  3JTD B;  4GFT A;  5HKZ A;  2ZKM X;  1C07 A;  2LCP A;  1M46 A;  2M7N A;  1DJG A;  2LP2 A;  1YTZ C;  2WCE A;  1Q80 A;  1WRL A;  1RTP 1;  1IRJ A;  1F4O A;  1OSA A;  3SJS A;  1SPY A;  1BR4 B;  3KHE A;  5CSJ A;  3K1E A;  5CSI A;  1J7P A;  2M7L A;  2R2I A;  3GK4 X;  1TIZ A;  4XJK A;  2MA2 A;  3CZ0 A;  1B7T Y;  2F8P A;  4M2P A;  1K8U A;  1GQM A;  1KWO C;  4HRE E;  2VRG A;  1SKT A;  1TNX A;  2BL0 B;  2H61 A;  2KHN A;  1SMG A;  1WRK A;  3B87 A;  4YGB B;  4DUQ A;  1TCO B;  4PT1 A;  1DC1 A;  1H4B A;  4N1G A;  1DEL A;  1NCZ A;  2KBM A;  1N2D A;  2GTE A;  3NSI A;  1TWO A;  4P5O E;  3NGV A;  1HQV A;  4YGC B;  3FE6 A;  3WHU B;  2KOT A;  3TUY B;  1SCM C;  1XO5 A;  3S0D A;  3TS5 C;  5AFP A;  2BBN A;  2BEC A;  1BOC A;  1DQE A;  1UHJ A;  1SR6 C;  2KDH A;  1MR8 A;  4OKH A;  1OE9 B;  2QAC A;  1BG1 A;  1CM1 A;  1EG4 A;  2BE6 A;  1CMG A;  1MF8 B;  3BUW B;  2L51 A;  1OW4 A;  2LMV A;  2WCL A;  1S1E A;  2WCJ A;  2K8M B;  2ZRT A;  1QVI Y;  2M3W A;  4BY4 A;  1QX2 A;  3AKA A;  2JT8 A;  3CZT X;  1J1E A;  2L5X B;  2LMT A;  4PE1 A;  1DT7 B;  1YR5 A;  1NX0 A;  4YI8 A;  2F3Z A;  3LL8 B;  1RFJ A;  2PRU A;  2JU0 A;  5I2L A;  3EK4 A;  4MVF A;  1K95 A;  4IJ7 A;  2L50 A;  1P28 A;  4GGF C;  1NP8 A;  1M45 A;  3RM1 A;  1F55 A;  2KSP A;  4IL1 A;  3QRX A;  5I8N A;  2M29 A;  2JRF A;  5CSF A;  5I2O A;  1UHK A;  1DTL A;  2QEB A;  2JQ6 A;  4L9M A;  2JXL A;  3SS4 A;  2JXC A;  3O78 A;  1D1O A;  1JFK A;  3BUX B;  1AVS A;  2ZND A;  3MSE B;  1BJF A;  4TNC A;  2QEO A;  3CAB A;  1NCY A;  1IGV A;  1KSM A;  1SYM A;  1BOD A;  1FI5 A;  5JOL A;  4MN0 A;  1YVL A;  1MUX A;  3RLZ A;  3PSR A;  3PM2 A;  2FOT A;  2AAO A;  4CFQ A;  1KQV A;  2LHI A;  2NXQ A;  1QV1 A;  2JT3 A;  1FI6 A;  3SIB A;  3S0B A;  2P71 A;  3B86 A;  3R72 A;  1J7Q A;  2H2K A;  1K9K A;  3LLE A;  5AEQ A;  1U5I A;  1BU3 A;  1JFJ A;  1ALV A;  1OOI X;  2QEV A;  3PAT A;  1DJH A;  2QDI A;  4INW A;  2Y5I A;  1IKU A;  2KYC A;  1B8C A;  2HET A;  4WQ2 A;  2I2R E;  1J7R A;  2WCM A;  3PN7 B;  2L0P A;  3NSK A;  3D75 A;  1BLQ A;  5I2Q A;  1RRO A;  1XFY O;  2LM5 A;  1JBA A;  2P70 A;  2ZRS A;  3SS5 A;  1SRA A;  5F6T A;  2BCA A;  3DF0 A;  2Y4Q A;  3CS1 A;  1NPQ A; 
#chains in the Genus database with same CATH homology
 4INX A;  3D74 A;  3R1V A;  1ORG A;  3B6X A;  3K1E A;  3DZT A;  3DYE A;  3CZ0 A;  5EL2 A;  3Q8I A;  2PQL A;  1OOG A;  3OGN A;  3B87 A;  3FE9 A;  3CZ2 A;  3V2L A;  1C3Z A;  4PT1 A;  2QEH A;  3CDN A;  1TUJ A;  1QWV A;  3BJH A;  3NHI A;  2WCK A;  2GTE A;  3VB1 A;  1TWO A;  3NGV A;  3NHT A;  3L4L A;  3FE8 A;  2WC6 A;  3FE6 A;  3R1P A;  3S0D A;  3S0F A;  1DQE A;  4OZD A;  3BFH A;  3BFA A;  1T14 A;  1OW4 A;  2WCL A;  2WCJ A;  2WCH A;  3S0E A;  4FQT A;  5DIC A;  1P28 A;  4JD9 A;  3B7A A;  1C3Y A;  3RZS A;  4F7F A;  3S0A A;  1XFR A;  2QEB A;  1GM0 A;  2L2C A;  3BFB A;  3DXL A;  3CYZ A;  1LS8 A;  3D73 A;  1OOF A;  1OOH A;  2QEO A;  3B88 A;  3CAB A;  2KPH A;  3D76 A;  3DY9 A;  3D78 A;  3PJI A;  3CZ1 A;  3L4A A;  3S0B A;  2P71 A;  3B86 A;  3R72 A;  1OOI X;  2QEV A;  4INW A;  2QDI A;  2ERB A;  3S0G A;  2JPO A;  2WC5 A;  2WCM A;  2H8V A;  3D75 A;  3R1O A;  3N7H A;  2P70 A;  3QME A;  2FJY A;  3L47 A;  3D77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...