3OGNA

Crystal structure of an odorant-binding protein from the southern house mosquito complexed with an oviposition pheromone
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
b'VTPRRDAEYPPPELLEALKPLHDICAKKTGVTDEAIIEFSDGKIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPNSMHDIAMHMGKRCLYPEGENLCEKAFWLHKCWKQADPKHYFLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant-binding protein
publication title Crystal and solution structures of an odorant-binding protein from the southern house mosquito complexed with an oviposition pheromone.
pubmed doi rcsb
source organism Culex quinquefasciatus
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3ognA01
1LS8A 3B7AA 3CZ2A 5EL2A 3R72A 1QWVA 3BFHA 3BFAA 3V2LA 3L47A 2GTEA 1C3ZA 3DY9A 3BJHA 1GM0A 1OW4A 1C3YA 3D77A 3D73A 2ERBA 3CDNA 2WCLA 3DZTA 3NHIA 3S0AA 3NGVA 3S0GA 3S0FA 3NHTA 3R1VA 3FE8A 3K1EA 2QDIA 1TUJA 3Q8IA 4FQTA 3DYEA 4F7FA 2PQLA 3B6XA 3CABA 3DXLA 3CYZA 3CZ0A 4JD9A 3VB1A 1OOIX 2WCHA 3B86A 3S0DA 2WCJA 3L4LA 1OOGA 3N7HA 3OGNA 3S0BA 2L2CA 3RZSA 3D75A 1P28A 2P70A 3S0EA 3BFBA 5DICA 2WC6A 4INXA 3FE6A 2QEHA 2H8VA 3D78A 3L4AA 2WCKA 1OOFA 3QMEA 2WC5A 3D76A 2QEVA 1ORGA 1DQEA 2KPHA 3FE9A 1XFRA 3B87A 4INWA 4OZDA 1TWOA 1T14A 3D74A 2QEOA 3R1PA 2JPOA 4PT1A 3B88A 3CZ1A 3PJIA 2QEBA 1OOHA 3R1OA 2P71A 2WCMA 2FJYA
chains in the Genus database with same CATH superfamily
1LS8A 1OMDA 3B7AA 3CGAA 2KI4C 1CFCA 2K0JA 3CZ2A 3O6BA 2LE9B 4MRXA 2RGIA 3R72A 1S26D 3H4SE 4ZCVA 3V2LA 2GTEA 2L51A 4PDZA 2HQ8A 2JOJA 3HCMA 5ER5A 1JF0A 1Y1AA 1KSOA 1QIWA 2M97A 2Q4UA 5CSIA 1PRWA 1WLZA 1C3YA 1B47A 1IRJA 2JNFA 3D73A 4PHMA 4CIDA 5HKWA 1FPWA 2K7BA 4YI9A 1NX0A 1WY9A 3I5FC 1W7JB 1JC2A 1ZACA 4I5JA 1W9ZA 1EG3A 2BNXA 3S0AA 2COLB 2FJUB 3OB2B 2JT3A 3TUYB 2KFGA 1XA5A 1UUSA 2KAXA 2LVVA 2LANA 1CFDA 1NWDA 1DJWA 1RECA 1B8RA 4I5NB 1SPYA 5CSFA 1XYDA 3HX4A 3ZWHA 1NUBA 2KBIA 1CTRA 2JQ6A 2LAPA 5KSZA 1R2UA 5D7FA 1SMGA 2H61A 2PVBA 2ZN9A 3CYZA 1F71A 2BCXA 2M8UA 2WCHA 2M7LA 2LP3A 1FW4A 3S0DA 3PM2A 3BYAA 1MWNA 5D69A 2F2PA 3KF9A 5HYDA 3BOWA 2LVKA 4PCWA 2BKHB 4MZLA 3O4XA 4JWQA 3SS3A 4AQJA 2DOQA 5AFPA 1A75A 3RZSA 5F6TA 1SRAA 2LLUA 4Q04A 2H61C 1DJIA 2BE4A 3A4UB 2KI6C 1AVSA 1DJZA 1EL4A 1NCYA 2PMYA 4PHKA 1SL7A 4YGDB 1S3PA 1KFXL 1S5GZ 1AJ5A 5DICA 5HLOA 1UHIA 2KI6D 1XFYO 4N5XA 1H4BA 3FE6A 3EVRA 2ZKMX 4AOMA 3AAJA 1J1EA 1TOPA 3O4YA 3TS5B 3SG3A 2JULA 3DVEA 1X02A 3L4AA 1FI5A 1CDPA 3IQQA 3OGNA 4XJKA 2ZN8A 4PE0A 1YUUA 5BPJA 5I2OA 1QX2A 2KGRA 1A4PA 3K21A 1XVJA 5ER4X 2KAVA 5AXIA 3C1VA 1NX1A 2LCPA 2NCPA 5KU1A 2KPHA 3JTDC 3BUMB 5I8NA 4MN0A 1SK6D 1N0YA 3RM1A 1KSMA 1BMOA 1KWOB 1XFRA 4MVFA 3B87A 3VRQA 2KHNA 1UHNA 4OZDA 4E68A 1TWOA 1Y1UA 2JT8A 4NDCA 1F70A 3FIAA 4ICBA 1M46A 4PT1A 1FBVA 3JVTC 3VRNA 5D3OA 5K89A 1YX7A 2HF5A 1BLQA 1NIWA 1WRZA 3R1OA 1B7TZ 2BBNA 2P71A 4ORCB 3WHUB 4MBEA 2KFFA 1SCMC 2CT9A 1TCOB 1K90D 2KQYA 1IH0A 2E6WA 2KQ6A 1BJFA 4YI8A 1Y6WA 3AKAA 1KQMC 4YGBB 2K60A 5EL2A 1QWVA 4OCIA 1ODBA 3SG2A 2BL0C 3BFAA 3VRPA 1SKTA 1YVLA 2M1KB 3NSOA 2KI4B 2JNXA 3L47A 4HRHA 2LVIA 1C3ZA 3LK0A 2SCPA 5DKQA 2KDHA 1JWDA 3BJHA 1F55A 1ALVA 4I5LB 3TDIA 1S36A 3ICBA 1FI6A 1ZMZA 2KGBC 2ISDA 1GM0A 1CFFA 1PSRA 1OW4A 1N2DA 2OTGC 1QIVA 4NQGA 3FS7A 1PVBA 1PVAA 1OSAA 2K8MB 2ERBA 3UO9A 1JBAA 3EKJA 2WCLA 3DZTA 3I5HC 3SS5A 3DVMA 2I7AA 1TNXA 1NSHA 3OHMB 2F3ZA 2M49B 4GGFA 1S5GY 2CBLA 2LMTA 5B8IB 5HKYA 2PRUA 3S0FA 3I5FB 2JXLA 3EVUA 2BCAA 1F4QA 4QJ5B 1VRKA 3KO0A 1MQ1A 3R1VA 1V1FA 1G33A 2BECA 2BCBA 1CMGA 1K9KA 2KFHA 1PALA 4KYNA 1SL8A 4DCKA 2MLFC 1KK7Y 3LK1A 4ORBB 2M3WA 1F8HA 2QDIA 4OV2A 4IJ7A 1RROA 1CLLA 1IQ5A 2JZIA 2KNEA 3BXKA 3IF7A 3O78A 4FQTA 1M45A 1OZOA 1MXEA 1G4YR 3DYEA 4DRWA 1M39A 2P6BB 2CNPA 3DXLA 4MSPA 1IG5A 4BY4A 4GNKB 1YUTA 3EVVA 1OMVA 2LC5A 2TN4A 1K96A 1AJ4A 3WXAA 3TDZA 2WC8A 2ZRSA 4P2YB 1DTLA 5AANA 2FCDA 1YX8A 1ALWA 2L2CA 2AUCA 1UWOA 1DJXA 3PLFB 1SYMA 2EGDA 4PE7A 1SBJA 4CFQA 4DIRA 1H8BA 1B7TY 1S6CA 2K61A 1DJGA 2Y4QA 2LHLA 1QX5B 2AMIA 1CMFA 3I5IC 1MF8B 3AKBA 2KYCA 1KK8C 1CNPA 1SCVA 1TN4A 1YVHA 5HL1A 2WCFA 1DVIA 1Y0VH 4DUQA 4C0KA 3BUWB 2QEHA 4GFTA 2JRFA 5CPVA 4ZCUA 1Z4HA 1FF1A 1K8UA 2L4HA 1AK8A 3OX6A 1OMRA 1PSBA 1Z2CB 3D78A 3PATA 4OR9B 3VRRA 4FQOA 1A75B 4F0ZB 1MHOA 5FYXA 1F4OA 2NCOA 2QPTA 1IWQA 2QACA 2ZNEA 3QMEA 3DF0B 1DQEA 2F3YA 3NXAA 2L2EA 2M0RA 1QX7A 2MLEC 1DEKA 3I5GC 1J7PA 1MR8A 4WQ2A 1SSEB 1XFXO 2BAPA 3FE9A 5HLVA 2JTZA 1CDMA 1ZFSA 4INWA 2NZ0A 2WCEA 1LXFC 3WNXB 3B88A 1J55A 1TTXA 2L50A 1NX2A 1DF0B 3PJIA 1LKJA 3EG5B 4WQ3A 2I2RE 1N65A 1IGVA 2O60A 2LUXA 4XJKB 1CDNA 1NX3A 1JFKA 3JVTB 1KK7Z 1CLBA 2H2KA 1R6PA 1BF5A 1EXRA 3D0YA 2KLEA 3IQOA 3BFHA 4JPZB 1SCMB 2MHHA 5CSNA 1UHHA 1XFWO 1DJHA 4PHJA 4USLA 1PK0D 2MJWB 4YBHB 1KQMB 4XYNA 3PFVA 2B1UA 1HQVA 1PULA 1K94A 1ZUZA 1WDCC 1GGZA 2HETA 4N1FA 2WNDA 3EK7A 2PSRA 1C7WA 1KQVA 1NCXA 1Q80A 1S6JA 2CCMA 1K2HA 3D77A 1YRUB 1QV0A 2OTGB 4NDBA 2KBMA 1BR1B 1KCYA 1XO5A 3NHIA 1AHRA 4YGAA 2Y1MA 3NGVA 5FI6A 1DELA 3O2PA 3PM8A 3I5HB 1B1GA 3NSKA 1UHJA 1Y1XA 3LCPC 2L4IA 1TNPA 1U5IB 1WLMA 2CXJA 1YR5A 3K1EA 1SW8A 1QTXA 3EK8A 2CTNA 2JU0A 2Y1NA 1CLMA 5JJGA 1TUJA 1W7IB 1WRKA 1DT7B 1TUZA 2BE6A 4F7FA 1CDLA 4MZKA 1A03A 1SNLA 2PQLA 2F8PA 4JD9A 1SR6C 3PN7C 1TNQA 4HSZA 2EC6C 2JC2A 1OOIX 1WRLA 2E30A 4R1EA 2OS8C 2BKIB 2I18A 2KOTA 3PSRA 2FCEA 1RK9A 1UP5A 1XK4A 3RLZA 2JXCA 1K93D 2LNKA 3AAKA 4CLNA 2G9BA 1V1GA 3CLNA 2LLTA 1KFUS 1P28A 1L2OC 2P70A 2R2IA 3CTNA 3CS1A 3S0EA 4GPLB 4N1GA 1CB1A 3FWCA 1MUXA 3VGOA 4QJ3B 2JWWA 3NSLA 2LUCA 1XK4C 4GGFC 2HQWA 3SG6A 1EG4A 4GAOA 1BG1A 1IJ6A 1BU3A 1B8CA 1S1EA 2FOTA 3F45A 1IIOA 1OZSA 2H8VA 5G08A 3TZ1A 2YGUA 3CR4X 3D10A 2WCKA 1XFZO 2KYFA 4BY5A 2SASA 5KTYA 5I2LA 2WC5A 3D76A 1ORGA 5I2QA 1J7OA 5FI7A 2AAOA 1XFUO 2LP2A 4YGEB 5DKRA 1XFVO 1B8LA 2ZNDA 5AERA 1A29A 3I5GB 1NYAA 1JUOA 3BUNB 2QEOA 2JPOA 1LA0A 4MEWA 4D1EA 2LHIA 1D1OA 2QEBA 1IQ3A 1OOHA 3OB1B 4YGCB 4C0LA 3BOWB 1YURA 2OPOA 3LL8B 3SS4A 1QASA 2KLDA 1TCFA 2M1UA 2LVJA 1QATA 3NSIA 3S0BA 2L98A 1QVIY 2PASA 4PE1A 1SY9A 1CFPA 4DS7A 4ETOA 2K2FA 4C0JA 1J7QA 2I94A 2K7OA 2KAYA 1RJVA 3DY9A 1ZOTB 4GUKA 2LV7A 1OOJA 5HKZA 3BUXB 2M9GA 3GK2A 1CM1A 3SG4A 3SIBA 2Q91A 1J1DA 4AQIA 3JTDB 4HREE 4M2OA 4CFRA 1JF2A 1WDCB 2NXQA 3E3RA 4JKTA 2D8NA 1NP8A 2L5XB 3CDNA 4L9MA 1K9PA 3TUYC 2K7CA 1DGUA 1CM4A 3EK4A 3ZNIA 1M63B 1IJ5A 3D0YB 1L7ZA 5FI2A 3S0GA 1LVCD 1RWYA 1BT6A 3MSEB 3SJSA 1BODA 1BR4B 4A4BA 3NHTA 1B9AA 3DF0A 4OKHA 3FE8A 4U8DA 3GK4X 1LA3A 2ZFDA 4GGNA 3DVJA 4MLWA 2A4JA 1M31A 1S6IA 2IS9A 2L0PA 4WRIA 5JOLA 2MRDA 2PALA 3Q8IA 2GV5A 2BL0B 3BUOB 1EH2A 1CKKA 1K9UA 5CSJA 4PALA 3VROA 3B6XA 3CABA 4YRUA 1YTZC 2LMVA 4M2PA 3CZ0A 3VB1A 1TRFA 1YUSA 1DF0A 3B86A 2V53A 2WCJA 3L4LA 2WORA 4IL1A 5DKNA 3SIAA 1KFUL 1OOGA 1DMOA 1F54A 2EHBA 3N7HA 1SR6B 1DGVA 1OE9B 2F33A 2EC6B 2JTTA 2LM5A 2PYQA 3BQ3A 3PN7B 1GJYA 5GQQC 1RTP1 1UURA 2HPSA 2LLSA 2OS8B 3M0WA 1C7VA 1AP4A 3DD4A 1UHKA 1QS7A 1J7RA 1HT9A 1QXPA 3D75A 2F2OA 2KSPA 4M2QA 2G2BA 4JQ0D 5TNCA 1A2XA 2M7NA 3CR5X 3KHEA 3DVKA 1G8IA 3OP0A 2MBXA 1GGWA 1DJYA 3BFBA 1L2OB 2Y5IA 5J3XA 3GOFA 3TS5C 1RFJA 2WC6A 3SG5A 1QLKA 4INXA 4I5KA 3SG7A 2MA2A 3LLEA 1QJTA 2GGMA 3OBVA 1QVIZ 1YRTB 3WHTB 2M29A 4P5OE 5PALA 1KFXS 1B4CA 1QV1A 2ZRTA 1QLSA 4HRGA 1NCZA 1OOFA 4ORAB 3EKHA 1EJ3A 4MRYA 3FWBA 2LMUA 3KEVA 4MZJA 1TNWA 2MAZA 2QEVA 4PHNA 1TIZA 1KWOC 2WOSA 3KPXA 3IVTA 2K2AA 3A8RA 1NPQA 3OX5A 4TNCA 2BBMA 1GQMA 4UPGA 4QJ4B 5IBWA 3CR2A 3QRXA 1MXLC 1E8AA 1U5IA 2WCBA 4CPVA 5I94A 3PALA 4PE4A 3CWGA 1SL9A 4A4CA 1JSAA 2O5GA 4FTGA 1DC1A 2JT0A 1C07A 1T14A 3D74A 1AUIB 3UNWA 1LINA 2VRGA 3R1PA 3CZTX 2K7DA 1BOCA 3GK1A 4OVNF 2NLNA 3CZ1A 3I5IB 1K95A 2GGZA 1KK8B 5AEQA 1OQPA 1IKUA 3TDUA 2WCMA 2FJYA 2L5YA 4NDDA 1JFJA 4GBAA 2JPTA
chains in the Genus database with same CATH topology
1LS8A 3B7AA 3CZ2A 5EL2A 3R72A 1QWVA 3BFHA 3BFAA 3V2LA 3L47A 2GTEA 1C3ZA 3DY9A 3BJHA 1GM0A 1OW4A 1C3YA 3D77A 3D73A 2ERBA 3CDNA 2WCLA 3DZTA 3NHIA 3S0AA 3NGVA 3S0GA 3S0FA 3NHTA 3R1VA 3FE8A 3K1EA 2QDIA 1TUJA 3Q8IA 4FQTA 3DYEA 4F7FA 2PQLA 3B6XA 3CABA 3DXLA 3CYZA 3CZ0A 4JD9A 3VB1A 1OOIX 2WCHA 3B86A 3S0DA 2WCJA 3L4LA 1OOGA 3N7HA 3OGNA 3S0BA 2L2CA 3RZSA 3D75A 1P28A 2P70A 3S0EA 3BFBA 5DICA 2WC6A 4INXA 3FE6A 2QEHA 2H8VA 3D78A 3L4AA 2WCKA 1OOFA 3QMEA 2WC5A 3D76A 2QEVA 1ORGA 1DQEA 2KPHA 3FE9A 1XFRA 3B87A 4INWA 4OZDA 1TWOA 1T14A 3D74A 2QEOA 3R1PA 2JPOA 4PT1A 3B88A 3CZ1A 3PJIA 2QEBA 1OOHA 3R1OA 2P71A 2WCMA 2FJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS8 A;  3B7A A;  3CZ2 A;  5EL2 A;  3R72 A;  1QWV A;  3BFH A;  3BFA A;  3V2L A;  3L47 A;  2GTE A;  1C3Z A;  3DY9 A;  3BJH A;  1GM0 A;  1OW4 A;  1C3Y A;  3D77 A;  3D73 A;  2ERB A;  3CDN A;  2WCL A;  3DZT A;  3NHI A;  3S0A A;  3NGV A;  3S0G A;  3S0F A;  3NHT A;  3R1V A;  3FE8 A;  3K1E A;  2QDI A;  1TUJ A;  3Q8I A;  4FQT A;  3DYE A;  4F7F A;  2PQL A;  3B6X A;  3CAB A;  3DXL A;  3CYZ A;  3CZ0 A;  4JD9 A;  3VB1 A;  1OOI X;  2WCH A;  3B86 A;  3S0D A;  2WCJ A;  3L4L A;  1OOG A;  3N7H A;  3OGN A;  3S0B A;  2L2C A;  3RZS A;  3D75 A;  1P28 A;  2P70 A;  3S0E A;  3BFB A;  5DIC A;  2WC6 A;  4INX A;  3FE6 A;  2QEH A;  2H8V A;  3D78 A;  3L4A A;  2WCK A;  1OOF A;  3QME A;  2WC5 A;  3D76 A;  2QEV A;  1ORG A;  1DQE A;  2KPH A;  3FE9 A;  1XFR A;  3B87 A;  4INW A;  4OZD A;  1TWO A;  1T14 A;  3D74 A;  2QEO A;  3R1P A;  2JPO A;  4PT1 A;  3B88 A;  3CZ1 A;  3PJI A;  2QEB A;  1OOH A;  3R1O A;  2P71 A;  2WCM A;  2FJY A; 
#chains in the Genus database with same CATH topology
 1LS8 A;  1OMD A;  3B7A A;  3CGA A;  2KI4 C;  1CFC A;  2K0J A;  3CZ2 A;  3O6B A;  2LE9 B;  4MRX A;  2RGI A;  3R72 A;  1S26 D;  3H4S E;  4ZCV A;  3V2L A;  2GTE A;  2L51 A;  4PDZ A;  2HQ8 A;  2JOJ A;  3HCM A;  5ER5 A;  1JF0 A;  1Y1A A;  1KSO A;  1QIW A;  2M97 A;  2Q4U A;  5CSI A;  1PRW A;  1WLZ A;  1C3Y A;  1B47 A;  1IRJ A;  2JNF A;  3D73 A;  4PHM A;  4CID A;  5HKW A;  1FPW A;  2K7B A;  4YI9 A;  1NX0 A;  1WY9 A;  3I5F C;  1W7J B;  1JC2 A;  1ZAC A;  4I5J A;  1W9Z A;  1EG3 A;  2BNX A;  3S0A A;  2COL B;  2FJU B;  3OB2 B;  2JT3 A;  3TUY B;  2KFG A;  1XA5 A;  1UUS A;  2KAX A;  2LVV A;  2LAN A;  1CFD A;  1NWD A;  1DJW A;  1REC A;  1B8R A;  4I5N B;  1SPY A;  5CSF A;  1XYD A;  3HX4 A;  3ZWH A;  1NUB A;  2KBI A;  1CTR A;  2JQ6 A;  2LAP A;  5KSZ A;  1R2U A;  5D7F A;  1SMG A;  2H61 A;  2PVB A;  2ZN9 A;  3CYZ A;  1F71 A;  2BCX A;  2M8U A;  2WCH A;  2M7L A;  2LP3 A;  1FW4 A;  3S0D A;  3PM2 A;  3BYA A;  1MWN A;  5D69 A;  2F2P A;  3KF9 A;  5HYD A;  3BOW A;  2LVK A;  4PCW A;  2BKH B;  4MZL A;  3O4X A;  4JWQ A;  3SS3 A;  4AQJ A;  2DOQ A;  5AFP A;  1A75 A;  3RZS A;  5F6T A;  1SRA A;  2LLU A;  4Q04 A;  2H61 C;  1DJI A;  2BE4 A;  3A4U B;  2KI6 C;  1AVS A;  1DJZ A;  1EL4 A;  1NCY A;  2PMY A;  4PHK A;  1SL7 A;  4YGD B;  1S3P A;  1KFX L;  1S5G Z;  1AJ5 A;  5DIC A;  5HLO A;  1UHI A;  2KI6 D;  1XFY O;  4N5X A;  1H4B A;  3FE6 A;  3EVR A;  2ZKM X;  4AOM A;  3AAJ A;  1J1E A;  1TOP A;  3O4Y A;  3TS5 B;  3SG3 A;  2JUL A;  3DVE A;  1X02 A;  3L4A A;  1FI5 A;  1CDP A;  3IQQ A;  3OGN A;  4XJK A;  2ZN8 A;  4PE0 A;  1YUU A;  5BPJ A;  5I2O A;  1QX2 A;  2KGR A;  1A4P A;  3K21 A;  1XVJ A;  5ER4 X;  2KAV A;  5AXI A;  3C1V A;  1NX1 A;  2LCP A;  2NCP A;  5KU1 A;  2KPH A;  3JTD C;  3BUM B;  5I8N A;  4MN0 A;  1SK6 D;  1N0Y A;  3RM1 A;  1KSM A;  1BMO A;  1KWO B;  1XFR A;  4MVF A;  3B87 A;  3VRQ A;  2KHN A;  1UHN A;  4OZD A;  4E68 A;  1TWO A;  1Y1U A;  2JT8 A;  4NDC A;  1F70 A;  3FIA A;  4ICB A;  1M46 A;  4PT1 A;  1FBV A;  3JVT C;  3VRN A;  5D3O A;  5K89 A;  1YX7 A;  2HF5 A;  1BLQ A;  1NIW A;  1WRZ A;  3R1O A;  1B7T Z;  2BBN A;  2P71 A;  4ORC B;  3WHU B;  4MBE A;  2KFF A;  1SCM C;  2CT9 A;  1TCO B;  1K90 D;  2KQY A;  1IH0 A;  2E6W A;  2KQ6 A;  1BJF A;  4YI8 A;  1Y6W A;  3AKA A;  1KQM C;  4YGB B;  2K60 A;  5EL2 A;  1QWV A;  4OCI A;  1ODB A;  3SG2 A;  2BL0 C;  3BFA A;  3VRP A;  1SKT A;  1YVL A;  2M1K B;  3NSO A;  2KI4 B;  2JNX A;  3L47 A;  4HRH A;  2LVI A;  1C3Z A;  3LK0 A;  2SCP A;  5DKQ A;  2KDH A;  1JWD A;  3BJH A;  1F55 A;  1ALV A;  4I5L B;  3TDI A;  1S36 A;  3ICB A;  1FI6 A;  1ZMZ A;  2KGB C;  2ISD A;  1GM0 A;  1CFF A;  1PSR A;  1OW4 A;  1N2D A;  2OTG C;  1QIV A;  4NQG A;  3FS7 A;  1PVB A;  1PVA A;  1OSA A;  2K8M B;  2ERB A;  3UO9 A;  1JBA A;  3EKJ A;  2WCL A;  3DZT A;  3I5H C;  3SS5 A;  3DVM A;  2I7A A;  1TNX A;  1NSH A;  3OHM B;  2F3Z A;  2M49 B;  4GGF A;  1S5G Y;  2CBL A;  2LMT A;  5B8I B;  5HKY A;  2PRU A;  3S0F A;  3I5F B;  2JXL A;  3EVU A;  2BCA A;  1F4Q A;  4QJ5 B;  1VRK A;  3KO0 A;  1MQ1 A;  3R1V A;  1V1F A;  1G33 A;  2BEC A;  2BCB A;  1CMG A;  1K9K A;  2KFH A;  1PAL A;  4KYN A;  1SL8 A;  4DCK A;  2MLF C;  1KK7 Y;  3LK1 A;  4ORB B;  2M3W A;  1F8H A;  2QDI A;  4OV2 A;  4IJ7 A;  1RRO A;  1CLL A;  1IQ5 A;  2JZI A;  2KNE A;  3BXK A;  3IF7 A;  3O78 A;  4FQT A;  1M45 A;  1OZO A;  1MXE A;  1G4Y R;  3DYE A;  4DRW A;  1M39 A;  2P6B B;  2CNP A;  3DXL A;  4MSP A;  1IG5 A;  4BY4 A;  4GNK B;  1YUT A;  3EVV A;  1OMV A;  2LC5 A;  2TN4 A;  1K96 A;  1AJ4 A;  3WXA A;  3TDZ A;  2WC8 A;  2ZRS A;  4P2Y B;  1DTL A;  5AAN A;  2FCD A;  1YX8 A;  1ALW A;  2L2C A;  2AUC A;  1UWO A;  1DJX A;  3PLF B;  1SYM A;  2EGD A;  4PE7 A;  1SBJ A;  4CFQ A;  4DIR A;  1H8B A;  1B7T Y;  1S6C A;  2K61 A;  1DJG A;  2Y4Q A;  2LHL A;  1QX5 B;  2AMI A;  1CMF A;  3I5I C;  1MF8 B;  3AKB A;  2KYC A;  1KK8 C;  1CNP A;  1SCV A;  1TN4 A;  1YVH A;  5HL1 A;  2WCF A;  1DVI A;  1Y0V H;  4DUQ A;  4C0K A;  3BUW B;  2QEH A;  4GFT A;  2JRF A;  5CPV A;  4ZCU A;  1Z4H A;  1FF1 A;  1K8U A;  2L4H A;  1AK8 A;  3OX6 A;  1OMR A;  1PSB A;  1Z2C B;  3D78 A;  3PAT A;  4OR9 B;  3VRR A;  4FQO A;  1A75 B;  4F0Z B;  1MHO A;  5FYX A;  1F4O A;  2NCO A;  2QPT A;  1IWQ A;  2QAC A;  2ZNE A;  3QME A;  3DF0 B;  1DQE A;  2F3Y A;  3NXA A;  2L2E A;  2M0R A;  1QX7 A;  2MLE C;  1DEK A;  3I5G C;  1J7P A;  1MR8 A;  4WQ2 A;  1SSE B;  1XFX O;  2BAP A;  3FE9 A;  5HLV A;  2JTZ A;  1CDM A;  1ZFS A;  4INW A;  2NZ0 A;  2WCE A;  1LXF C;  3WNX B;  3B88 A;  1J55 A;  1TTX A;  2L50 A;  1NX2 A;  1DF0 B;  3PJI A;  1LKJ A;  3EG5 B;  4WQ3 A;  2I2R E;  1N65 A;  1IGV A;  2O60 A;  2LUX A;  4XJK B;  1CDN A;  1NX3 A;  1JFK A;  3JVT B;  1KK7 Z;  1CLB A;  2H2K A;  1R6P A;  1BF5 A;  1EXR A;  3D0Y A;  2KLE A;  3IQO A;  3BFH A;  4JPZ B;  1SCM B;  2MHH A;  5CSN A;  1UHH A;  1XFW O;  1DJH A;  4PHJ A;  4USL A;  1PK0 D;  2MJW B;  4YBH B;  1KQM B;  4XYN A;  3PFV A;  2B1U A;  1HQV A;  1PUL A;  1K94 A;  1ZUZ A;  1WDC C;  1GGZ A;  2HET A;  4N1F A;  2WND A;  3EK7 A;  2PSR A;  1C7W A;  1KQV A;  1NCX A;  1Q80 A;  1S6J A;  2CCM A;  1K2H A;  3D77 A;  1YRU B;  1QV0 A;  2OTG B;  4NDB A;  2KBM A;  1BR1 B;  1KCY A;  1XO5 A;  3NHI A;  1AHR A;  4YGA A;  2Y1M A;  3NGV A;  5FI6 A;  1DEL A;  3O2P A;  3PM8 A;  3I5H B;  1B1G A;  3NSK A;  1UHJ A;  1Y1X A;  3LCP C;  2L4I A;  1TNP A;  1U5I B;  1WLM A;  2CXJ A;  1YR5 A;  3K1E A;  1SW8 A;  1QTX A;  3EK8 A;  2CTN A;  2JU0 A;  2Y1N A;  1CLM A;  5JJG A;  1TUJ A;  1W7I B;  1WRK A;  1DT7 B;  1TUZ A;  2BE6 A;  4F7F A;  1CDL A;  4MZK A;  1A03 A;  1SNL A;  2PQL A;  2F8P A;  4JD9 A;  1SR6 C;  3PN7 C;  1TNQ A;  4HSZ A;  2EC6 C;  2JC2 A;  1OOI X;  1WRL A;  2E30 A;  4R1E A;  2OS8 C;  2BKI B;  2I18 A;  2KOT A;  3PSR A;  2FCE A;  1RK9 A;  1UP5 A;  1XK4 A;  3RLZ A;  2JXC A;  1K93 D;  2LNK A;  3AAK A;  4CLN A;  2G9B A;  1V1G A;  3CLN A;  2LLT A;  1KFU S;  1P28 A;  1L2O C;  2P70 A;  2R2I A;  3CTN A;  3CS1 A;  3S0E A;  4GPL B;  4N1G A;  1CB1 A;  3FWC A;  1MUX A;  3VGO A;  4QJ3 B;  2JWW A;  3NSL A;  2LUC A;  1XK4 C;  4GGF C;  2HQW A;  3SG6 A;  1EG4 A;  4GAO A;  1BG1 A;  1IJ6 A;  1BU3 A;  1B8C A;  1S1E A;  2FOT A;  3F45 A;  1IIO A;  1OZS A;  2H8V A;  5G08 A;  3TZ1 A;  2YGU A;  3CR4 X;  3D10 A;  2WCK A;  1XFZ O;  2KYF A;  4BY5 A;  2SAS A;  5KTY A;  5I2L A;  2WC5 A;  3D76 A;  1ORG A;  5I2Q A;  1J7O A;  5FI7 A;  2AAO A;  1XFU O;  2LP2 A;  4YGE B;  5DKR A;  1XFV O;  1B8L A;  2ZND A;  5AER A;  1A29 A;  3I5G B;  1NYA A;  1JUO A;  3BUN B;  2QEO A;  2JPO A;  1LA0 A;  4MEW A;  4D1E A;  2LHI A;  1D1O A;  2QEB A;  1IQ3 A;  1OOH A;  3OB1 B;  4YGC B;  4C0L A;  3BOW B;  1YUR A;  2OPO A;  3LL8 B;  3SS4 A;  1QAS A;  2KLD A;  1TCF A;  2M1U A;  2LVJ A;  1QAT A;  3NSI A;  3S0B A;  2L98 A;  1QVI Y;  2PAS A;  4PE1 A;  1SY9 A;  1CFP A;  4DS7 A;  4ETO A;  2K2F A;  4C0J A;  1J7Q A;  2I94 A;  2K7O A;  2KAY A;  1RJV A;  3DY9 A;  1ZOT B;  4GUK A;  2LV7 A;  1OOJ A;  5HKZ A;  3BUX B;  2M9G A;  3GK2 A;  1CM1 A;  3SG4 A;  3SIB A;  2Q91 A;  1J1D A;  4AQI A;  3JTD B;  4HRE E;  4M2O A;  4CFR A;  1JF2 A;  1WDC B;  2NXQ A;  3E3R A;  4JKT A;  2D8N A;  1NP8 A;  2L5X B;  3CDN A;  4L9M A;  1K9P A;  3TUY C;  2K7C A;  1DGU A;  1CM4 A;  3EK4 A;  3ZNI A;  1M63 B;  1IJ5 A;  3D0Y B;  1L7Z A;  5FI2 A;  3S0G A;  1LVC D;  1RWY A;  1BT6 A;  3MSE B;  3SJS A;  1BOD A;  1BR4 B;  4A4B A;  3NHT A;  1B9A A;  3DF0 A;  4OKH A;  3FE8 A;  4U8D A;  3GK4 X;  1LA3 A;  2ZFD A;  4GGN A;  3DVJ A;  4MLW A;  2A4J A;  1M31 A;  1S6I A;  2IS9 A;  2L0P A;  4WRI A;  5JOL A;  2MRD A;  2PAL A;  3Q8I A;  2GV5 A;  2BL0 B;  3BUO B;  1EH2 A;  1CKK A;  1K9U A;  5CSJ A;  4PAL A;  3VRO A;  3B6X A;  3CAB A;  4YRU A;  1YTZ C;  2LMV A;  4M2P A;  3CZ0 A;  3VB1 A;  1TRF A;  1YUS A;  1DF0 A;  3B86 A;  2V53 A;  2WCJ A;  3L4L A;  2WOR A;  4IL1 A;  5DKN A;  3SIA A;  1KFU L;  1OOG A;  1DMO A;  1F54 A;  2EHB A;  3N7H A;  1SR6 B;  1DGV A;  1OE9 B;  2F33 A;  2EC6 B;  2JTT A;  2LM5 A;  2PYQ A;  3BQ3 A;  3PN7 B;  1GJY A;  5GQQ C;  1RTP 1;  1UUR A;  2HPS A;  2LLS A;  2OS8 B;  3M0W A;  1C7V A;  1AP4 A;  3DD4 A;  1UHK A;  1QS7 A;  1J7R A;  1HT9 A;  1QXP A;  3D75 A;  2F2O A;  2KSP A;  4M2Q A;  2G2B A;  4JQ0 D;  5TNC A;  1A2X A;  2M7N A;  3CR5 X;  3KHE A;  3DVK A;  1G8I A;  3OP0 A;  2MBX A;  1GGW A;  1DJY A;  3BFB A;  1L2O B;  2Y5I A;  5J3X A;  3GOF A;  3TS5 C;  1RFJ A;  2WC6 A;  3SG5 A;  1QLK A;  4INX A;  4I5K A;  3SG7 A;  2MA2 A;  3LLE A;  1QJT A;  2GGM A;  3OBV A;  1QVI Z;  1YRT B;  3WHT B;  2M29 A;  4P5O E;  5PAL A;  1KFX S;  1B4C A;  1QV1 A;  2ZRT A;  1QLS A;  4HRG A;  1NCZ A;  1OOF A;  4ORA B;  3EKH A;  1EJ3 A;  4MRY A;  3FWB A;  2LMU A;  3KEV A;  4MZJ A;  1TNW A;  2MAZ A;  2QEV A;  4PHN A;  1TIZ A;  1KWO C;  2WOS A;  3KPX A;  3IVT A;  2K2A A;  3A8R A;  1NPQ A;  3OX5 A;  4TNC A;  2BBM A;  1GQM A;  4UPG A;  4QJ4 B;  5IBW A;  3CR2 A;  3QRX A;  1MXL C;  1E8A A;  1U5I A;  2WCB A;  4CPV A;  5I94 A;  3PAL A;  4PE4 A;  3CWG A;  1SL9 A;  4A4C A;  1JSA A;  2O5G A;  4FTG A;  1DC1 A;  2JT0 A;  1C07 A;  1T14 A;  3D74 A;  1AUI B;  3UNW A;  1LIN A;  2VRG A;  3R1P A;  3CZT X;  2K7D A;  1BOC A;  3GK1 A;  4OVN F;  2NLN A;  3CZ1 A;  3I5I B;  1K95 A;  2GGZ A;  1KK8 B;  5AEQ A;  1OQP A;  1IKU A;  3TDU A;  2WCM A;  2FJY A;  2L5Y A;  4NDD A;  1JFJ A;  4GBA A;  2JPT A; 
#chains in the Genus database with same CATH homology
 1LS8 A;  3B7A A;  3CZ2 A;  5EL2 A;  3R72 A;  1QWV A;  3BFH A;  3BFA A;  3V2L A;  3L47 A;  2GTE A;  1C3Z A;  3DY9 A;  3BJH A;  1GM0 A;  1OW4 A;  1C3Y A;  3D77 A;  3D73 A;  2ERB A;  3CDN A;  2WCL A;  3DZT A;  3NHI A;  3S0A A;  3NGV A;  3S0G A;  3S0F A;  3NHT A;  3R1V A;  3FE8 A;  3K1E A;  2QDI A;  1TUJ A;  3Q8I A;  4FQT A;  3DYE A;  4F7F A;  2PQL A;  3B6X A;  3CAB A;  3DXL A;  3CYZ A;  3CZ0 A;  4JD9 A;  3VB1 A;  1OOI X;  2WCH A;  3B86 A;  3S0D A;  2WCJ A;  3L4L A;  1OOG A;  3N7H A;  3OGN A;  3S0B A;  2L2C A;  3RZS A;  3D75 A;  1P28 A;  2P70 A;  3S0E A;  3BFB A;  5DIC A;  2WC6 A;  4INX A;  3FE6 A;  2QEH A;  2H8V A;  3D78 A;  3L4A A;  2WCK A;  1OOF A;  3QME A;  2WC5 A;  3D76 A;  2QEV A;  1ORG A;  1DQE A;  2KPH A;  3FE9 A;  1XFR A;  3B87 A;  4INW A;  4OZD A;  1TWO A;  1T14 A;  3D74 A;  2QEO A;  3R1P A;  2JPO A;  4PT1 A;  3B88 A;  3CZ1 A;  3PJI A;  2QEB A;  1OOH A;  3R1O A;  2P71 A;  2WCM A;  2FJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...