1S5GZ

Structure of scallop myosin s1 reveals a novel nucleotide conformation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
molecule tags Contractile protein
total genus 40
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gZ01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gZ02
3OP0A 1ZMZA 2KAXA 2JU0A 2KSPA 2WCFA 1YRTB 1C07A 1EXRA 5DKNA 4QJ4B 4P5OE 1TOPA 1BT6A 2KNEA 1MF8B 1DJIA 2Y4QA 1TCFA 1V1GA 5TNCA 1KQMB 3C1VA 1IKUA 3VGOA 1GJYA 2E30A 2EHBA 3GK1A 1IG5A 1OMDA 5AFPA 1UHHA 1VRKA 1K9KA 5AEQA 1RTP1 2B1UA 1XFXO 3DVKA 4I5KA 3WHTB 4CFRA 2OTGB 3SG3A 1SCMB 1B7TY 2WCEA 1NIWA 3EK8A 3CR2A 2CT9A 2LLTA 1E8AA 1ZACA 2BCXA 3EKJA 3NSLA 1B8CA 3MSEB 2KI4B 1QIVA 1Q80A 1UHJA 4ORCB 2K7DA 2LVKA 1DJXA 2HQ8A 3H4SE 2FCEA 1AHRA 2ZN9A 3PALA 3A8RA 1QV1A 1CFDA 3IQOA 2LC5A 2BL0C 2H61A 1NCYA 1OZSA 1CLBA 1K9PA 1NCZA 3CR5X 2K0JA 2KAYA 3TZ1A 1QX7A 1SY9A 4GGNA 1KCYA 3BUOB 4L9MA 4A4CA 3JTDC 4BY5A 1LA0A 1SBJA 4XYNA 4D1EA 1ALWA 1Y1UA 2I94A 2LE9B 3NSOA 1K9UA 1SKTA 2JQ6A 1KSMA 2KFHA 1PULA 1BOCA 3PATA 4CPVA 1KFXS 1QS7A 3SJSA 2EC6B 1BODA 3EK4A 3TDZA 1UWOA 2LHIA 4MEWA 3DVJA 2F3YA 1LVCD 5B8IB 4QJ5B 3TUYC 4E68A 1DJYA 2HPSA 4MN0A 2NCOA 2LMUA 3VROA 1KQVA 2WORA 2GGZA 3DVMA 4GGFA 3I5HB 1KFUL 1NYAA 1BR4B 2CXJA 3EVRA 1TIZA 4GFTA 1NPQA 1F71A 1UHNA 5HKWA 3CGAA 2ZNDA 1FI6A 1J1DA 2PVBA 2M49B 1W7IB 1Y6WA 3DF0B 1OMVA 2VRGA 3GOFA 3HX4A 4M2OA 4ORAB 4WRIA 1B47A 2FJUB 5I2QA 4I5LB 1TNQA 3I5IC 2JOJA 4YBHB 1JWDA 2L0PA 5DKRA 1IH0A 1N0YA 3JVTB 5DKQA 3JVTC 3O4YA 1IWQA 1G33A 1MHOA 5PALA 2KGRA 1SL8A 2MLEC 1IJ6A 4ZCVA 1S5GZ 1NSHA 1K2HA 2JPTA 1DJZA 1CDPA 1Y1AA 2NLNA 3BUXB 5GQQC 2F3ZA 1QJTA 2BECA 5BPJA 1B1GA 5G08A 4MSPA 1NX3A 2PRUA 1KK8C 3ZWHA 1N65A 1A4PA 2Y1MA 4PHJA 3LLEA 1SR6C 4YGEB 4ICBA 5JOLA 2M8UA 4PCWA 4DCKA 2ZNEA 3I5FC 1GGZA 2AAOA 2JNXA 1B9AA 1S6CA 2IS9A 3CR4X 4AOMA 1CKKA 1AVSA 1QTXA 2NXQA 2JNFA 1CNPA 1PALA 1WRKA 4PE1A 1CDLA 2BL0B 1UHKA 1NX2A 2KYCA 3EK7A 4YGCB 1C7VA 2M97A 1WDCC 5ER4X 2GGMA 3TDIA 4I5JA 1NP8A 4MLWA 5IBWA 1KWOB 4M2PA 3QRXA 1FI5A 2K2AA 1JUOA 4GPLB 2KBIA 1KSOA 4CIDA 3PSRA 3FIAA 3PM8A 2KFFA 3ICBA 2CTNA 3TUYB 3WNXB 1UUSA 3AKBA 4WQ3A 3TDUA 1CMFA 1QX2A 1MWNA 1F4QA 1RK9A 2O5GA 1SNLA 1Y1XA 2L50A 2I7AA 5I8NA 1WLMA 2KDHA 1OOJA 1QATA 1M63B 5F6TA 1K94A 2LV7A 1S3PA 1ZUZA 4PE4A 2K7BA 2K7OA 5J3XA 1CB1A 1UURA 1R6PA 3GK2A 4JQ0D 4R1EA 1F54A 1YVHA 1TNPA 3BOWB 1HQVA 4USLA 4P2YB 4MBEA 3IF7A 1U5IA 4DIRA 3BQ3A 2MLFC 2JWWA 3I5IB 2BCAA 2V53A 3O2PA 1PVBA 2KQ6A 1YURA 2HQWA 2K7CA 2LAPA 1LXFC 2LNKA 4JPZB 1BF5A 2M0RA 1MXLC 4HREE 2NZ0A 4C0LA 1XA5A 2DOQA 3AKAA 2OS8C 3KEVA 2JT3A 1K90D 3VRQA 1YR5A 1RROA 3D0YB 4M2QA 4GBAA 1F70A 3BUMB 2LLUA 4QJ3B 4WQ2A 1XFVO 2AMIA 1C7WA 5D69A 2HF5A 1DF0A 1EH2A 3RM1A 3BUWB 4GAOA 1TN4A 1KK8B 2TN4A 1X02A 1B4CA 4ZCUA 3AAJA 1KFUS 1RWYA 1SR6B 2MBXA 4YI9A 1UP5A 2BE6A 1S36A 2LCPA 5I2OA 3I5FB 3O78A 1CMGA 2LM5A 1S1EA 1PSRA 2H61C 2RGIA 1L2OC 2KI6D 3HCMA 1OQPA 3SG7A 1DGUA 1YVLA 4FTGA 4N5XA 4TNCA 5I2LA 2PMYA 2Q4UA 5HKYA 2CBLA 1KQMC 2PALA 2ZRSA 1BJFA 2K61A 2M7NA 1EG4A 4NQGA 2ZRTA 1LKJA 1LA3A 2WNDA 4XJKB 1J1EA 3EVUA 3VRNA 1WDCB 1SW8A 3PN7C 1BG1A 2JTTA 2LP2A 2JXCA 1SCMC 2JT8A 4CLNA 2COLB 1YUTA 2LVVA 3SIAA 2NCPA 1AJ5A 5AXIA 1NX1A 1XFUO 1QASA 1DTLA 2JTZA 3FWBA 4MZJA 3FS7A 1FBVA 4GGFC 1Y0VH 3SG6A 1MXEA 1ZFSA 1A75B 2BKIB 4UPGA 1IQ5A 5HKZA 1AP4A 2BE4A 2L2EA 4DS7A 1PRWA 1DGVA 1DVIA 1AK8A 1K95A 1BLQA 1NCXA 2LLSA 1JFJA 1S6JA 2WCBA 3SG2A 1YUSA 1AUIB 1SL9A 1K8UA 1SMGA 3DF0A 1QVIZ 1MQ1A 1KK7Z 4OR9B 5HLOA 1IRJA 2LANA 4OKHA 1J7QA 3PFVA 5FYXA 1BMOA 1JF0A 1YUUA 3CTNA 2KHNA 1XFZO 1F55A 1PK0D 2ISDA 4DUQA 1CTRA 1QLKA 2KGBC 5JJGA 1A2XA 1FW4A 2BKHB 1G4YR 1EJ3A 1XYDA 1WY9A 3BXKA 3M0WA 4FQOA 3JTDB 1K96A 1SPYA 1SYMA 2OS8B 2Y5IA 4PHKA 5KSZA 4Q04A 3DVEA 1FF1A 3FWCA 4YGAA 2CNPA 1SL7A 4BY4A 1DJGA 1J55A 4N1GA 3EVVA 4MZLA 1BR1B 3VRRA 1D1OA 3CZTX 1M39A 2L51A 2MA2A 2O60A 1J7RA 1UHIA 1MR8A 1QVIY 2L98A 2E6WA 1KK7Y 1CM1A 3AAKA 2F2OA 4DRWA 3LL8B 1YTZC 2EGDA 4HRGA 4AQIA 3WXAA 2H2KA 3TS5C 4NDBA 3VRPA 1U5IB 1H8BA 1IGVA 4PE0A 1ZOTB 4MRYA 3RLZA 3I5GC 1L2OB 1SCVA 1DT7B 2M3WA 2JULA 3E3RA 2FCDA 1ALVA 1YRUB 1DJHA 1PSBA 1A29A 4OVNF 1JBAA 2WC8A 1SRAA 2G9BA 2KOTA 2P6BB 3OB2B 2MJWB 1XFWO 4HSZA 4MZKA 5HLVA 3PN7B 1XVJA 4PHNA 4YRUA 1K93D 1WLZA 2ZKMX 1J7OA 3KO0A 2I18A 1DF0B 2JRFA 3SG4A 4U8DA 1V1FA 2KFGA 2LP3A 1J7PA 4A4BA 2A4JA 5AERA 2QPTA 2BBNA 4OCIA 2MRDA 1OE9B 1QIWA 3CS1A 3NXAA 4PE7A 1HT9A 2LMTA 3CLNA 3KHEA 1QV0A 3LCPC 4GUKA 4PHMA 2JZIA 4ORBB 1ODBA 1M45A 3SIBA 2GV5A 4CFQA 3ZNIA 2JT0A 3BOWA 1XO5A 1B8RA 5CSJA 4C0JA 1CFPA 1TTXA 2FOTA 1RECA 2KBMA 2M1UA 1F4OA 2WOSA 5K89A 1A03A 1NWDA 2MHHA 3EKHA 4JWQA 2CCMA 1KFXL 1JFKA 1KWOC 1FPWA 3OX5A 2I2RE 5KU1A 2LVIA 2M29A 3BUNB 5ER5A 1XK4A 2KYFA 2LUCA 2L5XB 2AUCA 2ZFDA 2R2IA 4YGBB 1XFYO 5AANA 1LINA 1WRLA 3GK4X 2SCPA 2M9GA 1BU3A 4MVFA 1RJVA 1TNWA 3D0YA 2Y1NA 4MRXA 3LK0A 3OB1B 1B8LA 1CLMA 2OTGC 2F2PA 5CSIA 4NDCA 1OMRA 4YGDB 2BBMA 2KI6C 2JXLA 2LMVA 1IJ5A 1QX5B 1CDNA 1GQMA 1CM4A 2KI4C 4GNKB 1L7ZA 3LK1A 1YX7A 2SASA 2PSRA 1CFFA 2PASA 1EG3A 1OZOA 1S6IA 4YI8A 3WHUB 1DJWA 3K21A 1CDMA 1TCOB 3PLFB 2LUXA 2OPOA 4I5NB 3OHMB 3TS5B 1M31A 1XK4C 1S26D 4IL1A 1PVAA 3KF9A 2BCBA 5KTYA 1YX8A 1QLSA 3I5GB 1MUXA 2EC6C 2LVJA 4XJKA 3SG5A 3KPXA 1H4BA 5CPVA 3F45A 2K8MB 2L4IA 2MAZA 1WRZA 3NSKA 1AJ4A 1R2UA 2D8NA 1TNXA 2LHLA 3O6BA 2K2FA 4N1FA 4PDZA 5D7FA 2Q91A 2KAVA 1NX0A 3I5HC 4AQJA 1CFCA 1DMOA 1A75A 1CLLA 1NUBA 3BYAA 3NSIA 4ETOA 1QXPA 1RFJA 3DD4A 1OSAA 2ZN8A 1EL4A 4OV2A 1SK6D 1JF2A 3D10A 2JC2A 3IQQA 2M7LA 1JC2A 1JSAA 2G2BA 1B7TZ 1G8IA 4PALA 4F0ZB 2L4HA 4C0KA 1F8HA 1IQ3A 1W7JB 1M46A 2F8PA 2M1KB 4HRHA 1N2DA 5CSNA 1TRFA 2KQYA 2F33A 3OX6A 2QACA 5HYDA 3A4UB 1S5GY 4NDDA 5CSFA 1GGWA 3CWGA 2HETA
chains in the Genus database with same CATH superfamily
3OP0A 1ZMZA 2KAXA 2JU0A 2KSPA 2WCFA 1YRTB 1C07A 1EXRA 5DKNA 4QJ4B 4P5OE 1TOPA 1BT6A 3SS4A 2KNEA 1MF8B 1DJIA 2Y4QA 1TCFA 1V1GA 1LS8A 5TNCA 1KQMB 3C1VA 1IKUA 3VGOA 1GJYA 2L2CA 2E30A 2EHBA 3GK1A 1IG5A 1OMDA 3D74A 1UHHA 1VRKA 1K9KA 5AFPA 1TWOA 5AEQA 1RTP1 2B1UA 1XFXO 3DVKA 4I5KA 3L47A 3WHTB 4CFRA 2OTGB 5EL2A 3SG3A 1SCMB 1B7TY 2WCEA 3D78A 2PQLA 1NIWA 3EK8A 3CR2A 2CT9A 2LLTA 1E8AA 1ZACA 2BCXA 3EKJA 3NSLA 1B8CA 3MSEB 2KI4B 1QIVA 3D75A 1Q80A 1UHJA 4ORCB 2K7DA 2LVKA 1DJXA 2HQ8A 3H4SE 2FCEA 1AHRA 2ZN9A 3PALA 3A8RA 1QV1A 1CFDA 3IQOA 2LC5A 2BL0C 2H61A 1NCYA 3IVTA 1OZSA 1CLBA 1K9PA 1NCZA 3CR5X 2K0JA 2KAYA 3D73A 1QX7A 1SY9A 4GGNA 3TZ1A 1KCYA 2WCHA 3BUOB 4L9MA 3JTDC 4A4CA 1LA0A 4BY5A 1SBJA 4XYNA 4D1EA 1ALWA 1Y1UA 2I94A 2LE9B 3N7HA 3NSOA 1K9UA 1SKTA 3BFHA 2JQ6A 1KSMA 2KFHA 1PULA 1BOCA 3PATA 4CPVA 1KFXS 1QS7A 2BAPA 3SJSA 2EC6B 3D77A 1BODA 3EK4A 3TDZA 1UWOA 2LHIA 4MEWA 3DVJA 3B88A 2F3YA 1LVCD 5B8IB 4QJ5B 3TUYC 4E68A 1DJYA 1XFRA 2HPSA 4MN0A 2NCOA 2LMUA 3VROA 1KQVA 2WORA 2GGZA 3DVMA 4GGFA 3I5HB 1KFUL 1NYAA 1BR4B 2CXJA 3EVRA 1TIZA 4GFTA 1NPQA 2K60A 1F71A 3R72A 1UHNA 5HKWA 3CGAA 2ZNDA 1FI6A 1J1DA 2PVBA 2M49B 1W7IB 1Y6WA 3DF0B 1OMVA 2VRGA 3GOFA 3HX4A 4M2OA 4ORAB 4WRIA 1B47A 2FJUB 3S0BA 5I2QA 4I5LB 1TNQA 3I5IC 2JOJA 2QEVA 4YBHB 2H8VA 2WC6A 1JWDA 2L0PA 2WCJA 5DKRA 1N0YA 1IH0A 3JVTB 5DKQA 3DZTA 3JVTC 3NHTA 3O4YA 1IWQA 1G33A 1MHOA 5PALA 5HL1A 2KGRA 1SL8A 2MLEC 1IJ6A 4ZCVA 1S5GZ 1NSHA 1K2HA 2JPTA 1DJZA 3RZSA 1CDPA 1Y1AA 2NLNA 3BUXB 5GQQC 2F3ZA 1QJTA 2BECA 5BPJA 1B1GA 5G08A 4MSPA 3B7AA 1NX3A 3DYEA 2PRUA 1KK8C 3ZWHA 1N65A 1A4PA 2Y1MA 4PHJA 3LLEA 1SR6C 4YGEB 4ICBA 5JOLA 2M8UA 4PCWA 1T14A 2ZNEA 4DCKA 3I5FC 1GGZA 2AAOA 2JNXA 3SS5A 1B9AA 1S6CA 2IS9A 3CR4X 4AOMA 1CKKA 1AVSA 1QTXA 2NXQA 2JNFA 1CNPA 3R1PA 1PALA 2P70A 1WRKA 4PE1A 1CDLA 2BL0B 1UHKA 3NGVA 1NX2A 1ORGA 2KYCA 3EK7A 4OZDA 4YGCB 1SSEB 1C7VA 2M97A 1WDCC 5ER4X 2GGMA 3CABA 3TDIA 4I5JA 1NP8A 1OOFA 4MLWA 5IBWA 1KWOB 3CDNA 3QRXA 4M2PA 3S0GA 1FI5A 5FI7A 2K2AA 1JUOA 4GPLB 2KBIA 1KSOA 4CIDA 3PSRA 3FIAA 3PM8A 2KFFA 3ICBA 2CTNA 4FQTA 3TUYB 1DQEA 3WNXB 1UUSA 3AKBA 4WQ3A 3TDUA 1CMFA 1QX2A 1MWNA 1F4QA 1RK9A 2O5GA 1SNLA 1Y1XA 2L50A 2I7AA 5I8NA 1WLMA 2KDHA 1OOJA 1QATA 1M63B 3B86A 5F6TA 1K94A 2LV7A 3V2LA 1S3PA 1ZUZA 4PE4A 2K7BA 2K7OA 5J3XA 1CB1A 1UURA 1R6PA 3GK2A 4JQ0D 4R1EA 1F54A 1YVHA 1TNPA 3BOWB 1HQVA 4USLA 4P2YB 4MBEA 3IF7A 1U5IA 4DIRA 3BQ3A 2MLFC 2JWWA 3I5IB 2BCAA 2V53A 3O2PA 1PVBA 2KQ6A 1YURA 2HQWA 2K7CA 2LAPA 1LXFC 2LNKA 4JPZB 1BF5A 3K1EA 2M0RA 1MXLC 4HREE 2NZ0A 4C0LA 1XA5A 2DOQA 3AKAA 2OS8C 3KEVA 2JT3A 1K90D 3VRQA 1YR5A 3OBVA 1DC1A 1RROA 3D0YB 4M2QA 4GBAA 1F70A 5FI2A 3BUMB 2LLUA 4QJ3B 4WQ2A 1XFVO 2AMIA 1C7WA 5D69A 2HF5A 1DF0A 1EH2A 3RM1A 3BUWB 4GAOA 1TN4A 1KK8B 2TN4A 1X02A 1B4CA 4ZCUA 3AAJA 1KFUS 1RWYA 1SR6B 2MBXA 4YI9A 1UP5A 2BE6A 1S36A 2LCPA 3R1VA 5I2OA 3I5FB 3O78A 1CMGA 2LM5A 1S1EA 1PSRA 2H61C 2RGIA 3S0EA 1L2OC 2KI6D 2QEHA 3HCMA 1OQPA 3SG7A 1DGUA 1YVLA 4FTGA 4N5XA 3CZ2A 4TNCA 5I2LA 2PMYA 2Q4UA 5HKYA 2CBLA 1KQMC 2PALA 3DXLA 2ZRSA 1BJFA 2K61A 1GM0A 2M7NA 1EG4A 4JKTA 4NQGA 2ZRTA 1LKJA 3SS3A 3S0DA 1LA3A 2WNDA 4XJKB 1J1EA 3EVUA 3VRNA 2L5YA 2ERBA 1WDCB 1SW8A 3PN7C 1BG1A 2JTTA 3B6XA 2LP2A 3CZ1A 2JXCA 1SCMC 2JT8A 4CLNA 2COLB 2WCMA 1YUTA 2LVVA 5I94A 3SIAA 2NCPA 1AJ5A 5AXIA 1NX1A 1XFUO 1QASA 1DTLA 2JTZA 3FWBA 4MZJA 2YGUA 1FBVA 3FS7A 1Y0VH 4GGFC 3SG6A 1MXEA 1ZFSA 1A75B 2BKIB 4UPGA 1IQ5A 5HKZA 1AP4A 2BE4A 2L2EA 3L4LA 4DS7A 1PRWA 1DGVA 1DVIA 1AK8A 1K95A 2PYQA 1BLQA 1NCXA 2LLSA 1JFJA 1S6JA 2WCBA 3SG2A 1YUSA 1AUIB 1SL9A 1K8UA 1SMGA 3DF0A 3FE9A 1QVIZ 1MQ1A 2QEBA 1KK7Z 4OR9B 5HLOA 5FI6A 1IRJA 2LANA 4OKHA 1J7QA 3PFVA 5FYXA 1BMOA 1JF0A 1YUUA 3CTNA 2KHNA 1XFZO 1F55A 1OW4A 1PK0D 3CZ0A 2ISDA 4DUQA 1CTRA 1QLKA 2KGBC 3B87A 5JJGA 2JPOA 1A2XA 1FW4A 2BKHB 1G4YR 2KLEA 1EJ3A 2QEOA 1XYDA 1WY9A 3BXKA 3M0WA 4FQOA 3JTDB 1K96A 1OOHA 1SPYA 1SYMA 3VB1A 2OS8B 2Y5IA 3NHIA 3QMEA 4PHKA 5KSZA 4Q04A 3DVEA 1FF1A 3FWCA 4YGAA 2CNPA 1SL7A 4BY4A 1DJGA 1J55A 4INXA 4N1GA 1C3YA 3EVVA 4MZLA 1BR1B 3VRRA 1D1OA 3CZTX 1M39A 2L51A 2MA2A 2O60A 1J7RA 1UHIA 1MR8A 1QVIY 2L98A 2E6WA 1KK7Y 1CM1A 3AAKA 2F2OA 4DRWA 3LL8B 1YTZC 2EGDA 3D76A 4HRGA 4AQIA 3WXAA 1DELA 2H2KA 3TS5C 1TUZA 4NDBA 3VRPA 1U5IB 1H8BA 1IGVA 4PE0A 1ZOTB 4MRYA 3RLZA 3FE8A 3I5GC 2WCKA 1L2OB 1W9ZA 1SCVA 3S0FA 1DT7B 2M3WA 2JULA 1QWVA 3E3RA 1Z2CB 2FCDA 2FJYA 1ALVA 1YRUB 1DJHA 4IJ7A 1PSBA 1A29A 4OVNF 1JBAA 2WC8A 3OGNA 1SRAA 2G9BA 2KOTA 2P6BB 3OB2B 2MJWB 1XFWO 4HSZA 3CYZA 4KYNA 4MZKA 5HLVA 3PN7B 1XVJA 4PHNA 4YRUA 1K93D 1WLZA 2ZKMX 1J7OA 3KO0A 2I18A 1DF0B 3R1OA 2JRFA 3SG4A 4U8DA 1OOGA 1V1FA 2KFGA 2LP3A 1J7PA 4A4BA 2A4JA 5AERA 2QPTA 2BBNA 4OCIA 2MRDA 1OE9B 1QIWA 3CS1A 3NXAA 4PE7A 1HT9A 1P28A 2LMTA 3CLNA 3KHEA 1QV0A 3LCPC 4GUKA 4PHMA 2JZIA 4ORBB 1ODBA 3DY9A 1M45A 4INWA 3SIBA 1IIOA 2GV5A 4CFQA 3ZNIA 2JT0A 3BOWA 1XO5A 1B8RA 5CSJA 4C0JA 1CFPA 1TTXA 2FOTA 1RECA 2KBMA 2M1UA 1F4OA 2WOSA 5K89A 1A03A 1NWDA 2MHHA 3EKHA 3FE6A 2CCMA 4JWQA 1KFXL 1JFKA 1KWOC 1FPWA 2KLDA 1Z4HA 3OX5A 2I2RE 5KU1A 2LVIA 2M29A 3BUNB 5ER5A 3BFBA 1XK4A 2KYFA 2LUCA 3Q8IA 2L5XB 2AUCA 4JD9A 2ZFDA 2R2IA 4YGBB 1XFYO 5AANA 1LINA 1WRLA 3GK4X 2SCPA 2M9GA 1BU3A 4MVFA 1RJVA 1OOIX 1TNWA 3D0YA 2Y1NA 4MRXA 3LK0A 3OB1B 1B8LA 1C3ZA 1CLMA 2OTGC 2F2PA 5CSIA 4NDCA 3UNWA 1OMRA 4YGDB 2BBMA 2KI6C 2JXLA 2LMVA 2WCLA 1IJ5A 1QX5B 1CDNA 1GQMA 1CM4A 2KI4C 4GNKB 1L7ZA 3LK1A 1YX7A 2SASA 2PSRA 2WC5A 1CFFA 3PM2A 2PASA 4F7FA 3PJIA 1EG3A 1OZOA 1S6IA 4YI8A 1TUJA 3WHUB 1DJWA 3K21A 1CDMA 3S0AA 1TCOB 3PLFB 2LUXA 2OPOA 4I5NB 3BFAA 3OHMB 3TS5B 1M31A 1XK4C 1S26D 5D3OA 4IL1A 1PVAA 3KF9A 2BCBA 5KTYA 1YX8A 1QLSA 3I5GB 1MUXA 2EC6C 2LVJA 4XJKA 3O4XA 3SG5A 3KPXA 1H4BA 5CPVA 3F45A 2K8MB 2L4IA 4PT1A 3L4AA 2MAZA 1WRZA 3NSKA 1AJ4A 1R2UA 2D8NA 1TNXA 2LHLA 3O6BA 2K2FA 4N1FA 4PDZA 5D7FA 2Q91A 2KAVA 1NX0A 3I5HC 5DICA 4AQJA 3EG5B 3UO9A 1A75A 1CFCA 1DMOA 1CLLA 1NUBA 3BYAA 3NSIA 4ETOA 2P71A 1QXPA 1RFJA 3DD4A 1OSAA 2GTEA 1EL4A 2ZN8A 4OV2A 1SK6D 1JF2A 3D10A 2JC2A 3IQQA 2M7LA 1JC2A 1JSAA 2G2BA 1B7TZ 1G8IA 4PALA 4F0ZB 2KPHA 2L4HA 4C0KA 1F8HA 1DEKA 1IQ3A 1W7JB 1M46A 2F8PA 2M1KB 3BJHA 4HRHA 1N2DA 5CSNA 1TRFA 2KQYA 2QDIA 2F33A 2BNXA 2QACA 3OX6A 5HYDA 3A4UB 1S5GY 4NDDA 5CSFA 1GGWA 3CWGA 2HETA
chains in the Genus database with same CATH topology
3OP0A 1ZMZA 2KAXA 2JU0A 2KSPA 2WCFA 1YRTB 1C07A 1EXRA 5DKNA 4QJ4B 4P5OE 1TOPA 1BT6A 2KNEA 1MF8B 1DJIA 2Y4QA 1TCFA 1V1GA 5TNCA 1KQMB 3C1VA 1IKUA 3VGOA 1GJYA 2E30A 2EHBA 3GK1A 1IG5A 1OMDA 5AFPA 1UHHA 1VRKA 1K9KA 5AEQA 1RTP1 2B1UA 1XFXO 3DVKA 4I5KA 3WHTB 4CFRA 2OTGB 3SG3A 1SCMB 1B7TY 2WCEA 1NIWA 3EK8A 3CR2A 2CT9A 2LLTA 1E8AA 1ZACA 2BCXA 3EKJA 3NSLA 1B8CA 3MSEB 2KI4B 1QIVA 1Q80A 1UHJA 4ORCB 2K7DA 2LVKA 1DJXA 2HQ8A 3H4SE 2FCEA 1AHRA 2ZN9A 3PALA 3A8RA 1QV1A 1CFDA 3IQOA 2LC5A 2BL0C 2H61A 1NCYA 1OZSA 1CLBA 1K9PA 1NCZA 3CR5X 2K0JA 2KAYA 3TZ1A 1QX7A 1SY9A 4GGNA 1KCYA 3BUOB 4L9MA 4A4CA 3JTDC 4BY5A 1LA0A 1SBJA 4XYNA 4D1EA 1ALWA 1Y1UA 2I94A 2LE9B 3NSOA 1K9UA 1SKTA 2JQ6A 1KSMA 2KFHA 1PULA 1BOCA 3PATA 4CPVA 1KFXS 1QS7A 3SJSA 2EC6B 1BODA 3EK4A 3TDZA 1UWOA 2LHIA 4MEWA 3DVJA 2F3YA 1LVCD 5B8IB 4QJ5B 3TUYC 4E68A 1DJYA 2HPSA 4MN0A 2NCOA 2LMUA 3VROA 1KQVA 2WORA 2GGZA 3DVMA 4GGFA 3I5HB 1KFUL 1NYAA 1BR4B 2CXJA 3EVRA 1TIZA 4GFTA 1NPQA 1F71A 1UHNA 5HKWA 3CGAA 2ZNDA 1FI6A 1J1DA 2PVBA 2M49B 1W7IB 1Y6WA 3DF0B 1OMVA 2VRGA 3GOFA 3HX4A 4M2OA 4ORAB 4WRIA 1B47A 2FJUB 5I2QA 4I5LB 1TNQA 3I5IC 2JOJA 4YBHB 1JWDA 2L0PA 5DKRA 1IH0A 1N0YA 3JVTB 5DKQA 3JVTC 3O4YA 1IWQA 1G33A 1MHOA 5PALA 2KGRA 1SL8A 2MLEC 1IJ6A 4ZCVA 1S5GZ 1NSHA 1K2HA 2JPTA 1DJZA 1CDPA 1Y1AA 2NLNA 3BUXB 5GQQC 2F3ZA 1QJTA 2BECA 5BPJA 1B1GA 5G08A 4MSPA 1NX3A 2PRUA 1KK8C 3ZWHA 1N65A 1A4PA 2Y1MA 4PHJA 3LLEA 1SR6C 4YGEB 4ICBA 5JOLA 2M8UA 4PCWA 4DCKA 2ZNEA 3I5FC 1GGZA 2AAOA 2JNXA 1B9AA 1S6CA 2IS9A 3CR4X 4AOMA 1CKKA 1AVSA 1QTXA 2NXQA 2JNFA 1CNPA 1PALA 1WRKA 4PE1A 1CDLA 2BL0B 1UHKA 1NX2A 2KYCA 3EK7A 4YGCB 1C7VA 2M97A 1WDCC 5ER4X 2GGMA 3TDIA 4I5JA 1NP8A 4MLWA 5IBWA 1KWOB 4M2PA 3QRXA 1FI5A 2K2AA 1JUOA 4GPLB 2KBIA 1KSOA 4CIDA 3PSRA 3FIAA 3PM8A 2KFFA 3ICBA 2CTNA 3TUYB 3WNXB 1UUSA 3AKBA 4WQ3A 3TDUA 1CMFA 1QX2A 1MWNA 1F4QA 1RK9A 2O5GA 1SNLA 1Y1XA 2L50A 2I7AA 5I8NA 1WLMA 2KDHA 1OOJA 1QATA 1M63B 5F6TA 1K94A 2LV7A 1S3PA 1ZUZA 4PE4A 2K7BA 2K7OA 5J3XA 1CB1A 1UURA 1R6PA 3GK2A 4JQ0D 4R1EA 1F54A 1YVHA 1TNPA 3BOWB 1HQVA 4USLA 4P2YB 4MBEA 3IF7A 1U5IA 4DIRA 3BQ3A 2MLFC 2JWWA 3I5IB 2BCAA 2V53A 3O2PA 1PVBA 2KQ6A 1YURA 2HQWA 2K7CA 2LAPA 1LXFC 2LNKA 4JPZB 1BF5A 2M0RA 1MXLC 4HREE 2NZ0A 4C0LA 1XA5A 2DOQA 3AKAA 2OS8C 3KEVA 2JT3A 1K90D 3VRQA 1YR5A 1RROA 3D0YB 4M2QA 4GBAA 1F70A 3BUMB 2LLUA 4QJ3B 4WQ2A 1XFVO 2AMIA 1C7WA 5D69A 2HF5A 1DF0A 1EH2A 3RM1A 3BUWB 4GAOA 1TN4A 1KK8B 2TN4A 1X02A 1B4CA 4ZCUA 3AAJA 1KFUS 1RWYA 1SR6B 2MBXA 4YI9A 1UP5A 2BE6A 1S36A 2LCPA 5I2OA 3I5FB 3O78A 1CMGA 2LM5A 1S1EA 1PSRA 2H61C 2RGIA 1L2OC 2KI6D 3HCMA 1OQPA 3SG7A 1DGUA 1YVLA 4FTGA 4N5XA 4TNCA 5I2LA 2PMYA 2Q4UA 5HKYA 2CBLA 1KQMC 2PALA 2ZRSA 1BJFA 2K61A 2M7NA 1EG4A 4NQGA 2ZRTA 1LKJA 1LA3A 2WNDA 4XJKB 1J1EA 3EVUA 3VRNA 1WDCB 1SW8A 3PN7C 1BG1A 2JTTA 2LP2A 2JXCA 1SCMC 2JT8A 4CLNA 2COLB 1YUTA 2LVVA 3SIAA 2NCPA 1AJ5A 5AXIA 1NX1A 1XFUO 1QASA 1DTLA 2JTZA 3FWBA 4MZJA 3FS7A 1FBVA 4GGFC 1Y0VH 3SG6A 1MXEA 1ZFSA 1A75B 2BKIB 4UPGA 1IQ5A 5HKZA 1AP4A 2BE4A 2L2EA 4DS7A 1PRWA 1DGVA 1DVIA 1AK8A 1K95A 1BLQA 1NCXA 2LLSA 1JFJA 1S6JA 2WCBA 3SG2A 1YUSA 1AUIB 1SL9A 1K8UA 1SMGA 3DF0A 1QVIZ 1MQ1A 1KK7Z 4OR9B 5HLOA 1IRJA 2LANA 4OKHA 1J7QA 3PFVA 5FYXA 1BMOA 1JF0A 1YUUA 3CTNA 2KHNA 1XFZO 1F55A 1PK0D 2ISDA 4DUQA 1CTRA 1QLKA 2KGBC 5JJGA 1A2XA 1FW4A 2BKHB 1G4YR 1EJ3A 1XYDA 1WY9A 3BXKA 3M0WA 4FQOA 3JTDB 1K96A 1SPYA 1SYMA 2OS8B 2Y5IA 4PHKA 5KSZA 4Q04A 3DVEA 1FF1A 3FWCA 4YGAA 2CNPA 1SL7A 4BY4A 1DJGA 1J55A 4N1GA 3EVVA 4MZLA 1BR1B 3VRRA 1D1OA 3CZTX 1M39A 2L51A 2MA2A 2O60A 1J7RA 1UHIA 1MR8A 1QVIY 2L98A 2E6WA 1KK7Y 1CM1A 3AAKA 2F2OA 4DRWA 3LL8B 1YTZC 2EGDA 4HRGA 4AQIA 3WXAA 2H2KA 3TS5C 4NDBA 3VRPA 1U5IB 1H8BA 1IGVA 4PE0A 1ZOTB 4MRYA 3RLZA 3I5GC 1L2OB 1SCVA 1DT7B 2M3WA 2JULA 3E3RA 2FCDA 1ALVA 1YRUB 1DJHA 1PSBA 1A29A 4OVNF 1JBAA 2WC8A 1SRAA 2G9BA 2KOTA 2P6BB 3OB2B 2MJWB 1XFWO 4HSZA 4MZKA 5HLVA 3PN7B 1XVJA 4PHNA 4YRUA 1K93D 1WLZA 2ZKMX 1J7OA 3KO0A 2I18A 1DF0B 2JRFA 3SG4A 4U8DA 1V1FA 2KFGA 2LP3A 1J7PA 4A4BA 2A4JA 5AERA 2QPTA 2BBNA 4OCIA 2MRDA 1OE9B 1QIWA 3CS1A 3NXAA 4PE7A 1HT9A 2LMTA 3CLNA 3KHEA 1QV0A 3LCPC 4GUKA 4PHMA 2JZIA 4ORBB 1ODBA 1M45A 3SIBA 2GV5A 4CFQA 3ZNIA 2JT0A 3BOWA 1XO5A 1B8RA 5CSJA 4C0JA 1CFPA 1TTXA 2FOTA 1RECA 2KBMA 2M1UA 1F4OA 2WOSA 5K89A 1A03A 1NWDA 2MHHA 3EKHA 4JWQA 2CCMA 1KFXL 1JFKA 1KWOC 1FPWA 3OX5A 2I2RE 5KU1A 2LVIA 2M29A 3BUNB 5ER5A 1XK4A 2KYFA 2LUCA 2L5XB 2AUCA 2ZFDA 2R2IA 4YGBB 1XFYO 5AANA 1LINA 1WRLA 3GK4X 2SCPA 2M9GA 1BU3A 4MVFA 1RJVA 1TNWA 3D0YA 2Y1NA 4MRXA 3LK0A 3OB1B 1B8LA 1CLMA 2OTGC 2F2PA 5CSIA 4NDCA 1OMRA 4YGDB 2BBMA 2KI6C 2JXLA 2LMVA 1IJ5A 1QX5B 1CDNA 1GQMA 1CM4A 2KI4C 4GNKB 1L7ZA 3LK1A 1YX7A 2SASA 2PSRA 1CFFA 2PASA 1EG3A 1OZOA 1S6IA 4YI8A 3WHUB 1DJWA 3K21A 1CDMA 1TCOB 3PLFB 2LUXA 2OPOA 4I5NB 3OHMB 3TS5B 1M31A 1XK4C 1S26D 4IL1A 1PVAA 3KF9A 2BCBA 5KTYA 1YX8A 1QLSA 3I5GB 1MUXA 2EC6C 2LVJA 4XJKA 3SG5A 3KPXA 1H4BA 5CPVA 3F45A 2K8MB 2L4IA 2MAZA 1WRZA 3NSKA 1AJ4A 1R2UA 2D8NA 1TNXA 2LHLA 3O6BA 2K2FA 4N1FA 4PDZA 5D7FA 2Q91A 2KAVA 1NX0A 3I5HC 4AQJA 1CFCA 1DMOA 1A75A 1CLLA 1NUBA 3BYAA 3NSIA 4ETOA 1QXPA 1RFJA 3DD4A 1OSAA 2ZN8A 1EL4A 4OV2A 1SK6D 1JF2A 3D10A 2JC2A 3IQQA 2M7LA 1JC2A 1JSAA 2G2BA 1B7TZ 1G8IA 4PALA 4F0ZB 2L4HA 4C0KA 1F8HA 1IQ3A 1W7JB 1M46A 2F8PA 2M1KB 4HRHA 1N2DA 5CSNA 1TRFA 2KQYA 2F33A 3OX6A 2QACA 5HYDA 3A4UB 1S5GY 4NDDA 5CSFA 1GGWA 3CWGA 2HETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP0 A;  1ZMZ A;  2KAX A;  2JU0 A;  2KSP A;  2WCF A;  1YRT B;  1C07 A;  1EXR A;  5DKN A;  4QJ4 B;  4P5O E;  1TOP A;  1BT6 A;  2KNE A;  1MF8 B;  1DJI A;  2Y4Q A;  1TCF A;  1V1G A;  5TNC A;  1KQM B;  3C1V A;  1IKU A;  3VGO A;  1GJY A;  2E30 A;  2EHB A;  3GK1 A;  1IG5 A;  1OMD A;  5AFP A;  1UHH A;  1VRK A;  1K9K A;  5AEQ A;  1RTP 1;  2B1U A;  1XFX O;  3DVK A;  4I5K A;  3WHT B;  4CFR A;  2OTG B;  3SG3 A;  1SCM B;  1B7T Y;  2WCE A;  1NIW A;  3EK8 A;  3CR2 A;  2CT9 A;  2LLT A;  1E8A A;  1ZAC A;  2BCX A;  3EKJ A;  3NSL A;  1B8C A;  3MSE B;  2KI4 B;  1QIV A;  1Q80 A;  1UHJ A;  4ORC B;  2K7D A;  2LVK A;  1DJX A;  2HQ8 A;  3H4S E;  2FCE A;  1AHR A;  2ZN9 A;  3PAL A;  3A8R A;  1QV1 A;  1CFD A;  3IQO A;  2LC5 A;  2BL0 C;  2H61 A;  1NCY A;  1OZS A;  1CLB A;  1K9P A;  1NCZ A;  3CR5 X;  2K0J A;  2KAY A;  3TZ1 A;  1QX7 A;  1SY9 A;  4GGN A;  1KCY A;  3BUO B;  4L9M A;  4A4C A;  3JTD C;  4BY5 A;  1LA0 A;  1SBJ A;  4XYN A;  4D1E A;  1ALW A;  1Y1U A;  2I94 A;  2LE9 B;  3NSO A;  1K9U A;  1SKT A;  2JQ6 A;  1KSM A;  2KFH A;  1PUL A;  1BOC A;  3PAT A;  4CPV A;  1KFX S;  1QS7 A;  3SJS A;  2EC6 B;  1BOD A;  3EK4 A;  3TDZ A;  1UWO A;  2LHI A;  4MEW A;  3DVJ A;  2F3Y A;  1LVC D;  5B8I B;  4QJ5 B;  3TUY C;  4E68 A;  1DJY A;  2HPS A;  4MN0 A;  2NCO A;  2LMU A;  3VRO A;  1KQV A;  2WOR A;  2GGZ A;  3DVM A;  4GGF A;  3I5H B;  1KFU L;  1NYA A;  1BR4 B;  2CXJ A;  3EVR A;  1TIZ A;  4GFT A;  1NPQ A;  1F71 A;  1UHN A;  5HKW A;  3CGA A;  2ZND A;  1FI6 A;  1J1D A;  2PVB A;  2M49 B;  1W7I B;  1Y6W A;  3DF0 B;  1OMV A;  2VRG A;  3GOF A;  3HX4 A;  4M2O A;  4ORA B;  4WRI A;  1B47 A;  2FJU B;  5I2Q A;  4I5L B;  1TNQ A;  3I5I C;  2JOJ A;  4YBH B;  1JWD A;  2L0P A;  5DKR A;  1IH0 A;  1N0Y A;  3JVT B;  5DKQ A;  3JVT C;  3O4Y A;  1IWQ A;  1G33 A;  1MHO A;  5PAL A;  2KGR A;  1SL8 A;  2MLE C;  1IJ6 A;  4ZCV A;  1S5G Z;  1NSH A;  1K2H A;  2JPT A;  1DJZ A;  1CDP A;  1Y1A A;  2NLN A;  3BUX B;  5GQQ C;  2F3Z A;  1QJT A;  2BEC A;  5BPJ A;  1B1G A;  5G08 A;  4MSP A;  1NX3 A;  2PRU A;  1KK8 C;  3ZWH A;  1N65 A;  1A4P A;  2Y1M A;  4PHJ A;  3LLE A;  1SR6 C;  4YGE B;  4ICB A;  5JOL A;  2M8U A;  4PCW A;  4DCK A;  2ZNE A;  3I5F C;  1GGZ A;  2AAO A;  2JNX A;  1B9A A;  1S6C A;  2IS9 A;  3CR4 X;  4AOM A;  1CKK A;  1AVS A;  1QTX A;  2NXQ A;  2JNF A;  1CNP A;  1PAL A;  1WRK A;  4PE1 A;  1CDL A;  2BL0 B;  1UHK A;  1NX2 A;  2KYC A;  3EK7 A;  4YGC B;  1C7V A;  2M97 A;  1WDC C;  5ER4 X;  2GGM A;  3TDI A;  4I5J A;  1NP8 A;  4MLW A;  5IBW A;  1KWO B;  4M2P A;  3QRX A;  1FI5 A;  2K2A A;  1JUO A;  4GPL B;  2KBI A;  1KSO A;  4CID A;  3PSR A;  3FIA A;  3PM8 A;  2KFF A;  3ICB A;  2CTN A;  3TUY B;  3WNX B;  1UUS A;  3AKB A;  4WQ3 A;  3TDU A;  1CMF A;  1QX2 A;  1MWN A;  1F4Q A;  1RK9 A;  2O5G A;  1SNL A;  1Y1X A;  2L50 A;  2I7A A;  5I8N A;  1WLM A;  2KDH A;  1OOJ A;  1QAT A;  1M63 B;  5F6T A;  1K94 A;  2LV7 A;  1S3P A;  1ZUZ A;  4PE4 A;  2K7B A;  2K7O A;  5J3X A;  1CB1 A;  1UUR A;  1R6P A;  3GK2 A;  4JQ0 D;  4R1E A;  1F54 A;  1YVH A;  1TNP A;  3BOW B;  1HQV A;  4USL A;  4P2Y B;  4MBE A;  3IF7 A;  1U5I A;  4DIR A;  3BQ3 A;  2MLF C;  2JWW A;  3I5I B;  2BCA A;  2V53 A;  3O2P A;  1PVB A;  2KQ6 A;  1YUR A;  2HQW A;  2K7C A;  2LAP A;  1LXF C;  2LNK A;  4JPZ B;  1BF5 A;  2M0R A;  1MXL C;  4HRE E;  2NZ0 A;  4C0L A;  1XA5 A;  2DOQ A;  3AKA A;  2OS8 C;  3KEV A;  2JT3 A;  1K90 D;  3VRQ A;  1YR5 A;  1RRO A;  3D0Y B;  4M2Q A;  4GBA A;  1F70 A;  3BUM B;  2LLU A;  4QJ3 B;  4WQ2 A;  1XFV O;  2AMI A;  1C7W A;  5D69 A;  2HF5 A;  1DF0 A;  1EH2 A;  3RM1 A;  3BUW B;  4GAO A;  1TN4 A;  1KK8 B;  2TN4 A;  1X02 A;  1B4C A;  4ZCU A;  3AAJ A;  1KFU S;  1RWY A;  1SR6 B;  2MBX A;  4YI9 A;  1UP5 A;  2BE6 A;  1S36 A;  2LCP A;  5I2O A;  3I5F B;  3O78 A;  1CMG A;  2LM5 A;  1S1E A;  1PSR A;  2H61 C;  2RGI A;  1L2O C;  2KI6 D;  3HCM A;  1OQP A;  3SG7 A;  1DGU A;  1YVL A;  4FTG A;  4N5X A;  4TNC A;  5I2L A;  2PMY A;  2Q4U A;  5HKY A;  2CBL A;  1KQM C;  2PAL A;  2ZRS A;  1BJF A;  2K61 A;  2M7N A;  1EG4 A;  4NQG A;  2ZRT A;  1LKJ A;  1LA3 A;  2WND A;  4XJK B;  1J1E A;  3EVU A;  3VRN A;  1WDC B;  1SW8 A;  3PN7 C;  1BG1 A;  2JTT A;  2LP2 A;  2JXC A;  1SCM C;  2JT8 A;  4CLN A;  2COL B;  1YUT A;  2LVV A;  3SIA A;  2NCP A;  1AJ5 A;  5AXI A;  1NX1 A;  1XFU O;  1QAS A;  1DTL A;  2JTZ A;  3FWB A;  4MZJ A;  3FS7 A;  1FBV A;  4GGF C;  1Y0V H;  3SG6 A;  1MXE A;  1ZFS A;  1A75 B;  2BKI B;  4UPG A;  1IQ5 A;  5HKZ A;  1AP4 A;  2BE4 A;  2L2E A;  4DS7 A;  1PRW A;  1DGV A;  1DVI A;  1AK8 A;  1K95 A;  1BLQ A;  1NCX A;  2LLS A;  1JFJ A;  1S6J A;  2WCB A;  3SG2 A;  1YUS A;  1AUI B;  1SL9 A;  1K8U A;  1SMG A;  3DF0 A;  1QVI Z;  1MQ1 A;  1KK7 Z;  4OR9 B;  5HLO A;  1IRJ A;  2LAN A;  4OKH A;  1J7Q A;  3PFV A;  5FYX A;  1BMO A;  1JF0 A;  1YUU A;  3CTN A;  2KHN A;  1XFZ O;  1F55 A;  1PK0 D;  2ISD A;  4DUQ A;  1CTR A;  1QLK A;  2KGB C;  5JJG A;  1A2X A;  1FW4 A;  2BKH B;  1G4Y R;  1EJ3 A;  1XYD A;  1WY9 A;  3BXK A;  3M0W A;  4FQO A;  3JTD B;  1K96 A;  1SPY A;  1SYM A;  2OS8 B;  2Y5I A;  4PHK A;  5KSZ A;  4Q04 A;  3DVE A;  1FF1 A;  3FWC A;  4YGA A;  2CNP A;  1SL7 A;  4BY4 A;  1DJG A;  1J55 A;  4N1G A;  3EVV A;  4MZL A;  1BR1 B;  3VRR A;  1D1O A;  3CZT X;  1M39 A;  2L51 A;  2MA2 A;  2O60 A;  1J7R A;  1UHI A;  1MR8 A;  1QVI Y;  2L98 A;  2E6W A;  1KK7 Y;  1CM1 A;  3AAK A;  2F2O A;  4DRW A;  3LL8 B;  1YTZ C;  2EGD A;  4HRG A;  4AQI A;  3WXA A;  2H2K A;  3TS5 C;  4NDB A;  3VRP A;  1U5I B;  1H8B A;  1IGV A;  4PE0 A;  1ZOT B;  4MRY A;  3RLZ A;  3I5G C;  1L2O B;  1SCV A;  1DT7 B;  2M3W A;  2JUL A;  3E3R A;  2FCD A;  1ALV A;  1YRU B;  1DJH A;  1PSB A;  1A29 A;  4OVN F;  1JBA A;  2WC8 A;  1SRA A;  2G9B A;  2KOT A;  2P6B B;  3OB2 B;  2MJW B;  1XFW O;  4HSZ A;  4MZK A;  5HLV A;  3PN7 B;  1XVJ A;  4PHN A;  4YRU A;  1K93 D;  1WLZ A;  2ZKM X;  1J7O A;  3KO0 A;  2I18 A;  1DF0 B;  2JRF A;  3SG4 A;  4U8D A;  1V1F A;  2KFG A;  2LP3 A;  1J7P A;  4A4B A;  2A4J A;  5AER A;  2QPT A;  2BBN A;  4OCI A;  2MRD A;  1OE9 B;  1QIW A;  3CS1 A;  3NXA A;  4PE7 A;  1HT9 A;  2LMT A;  3CLN A;  3KHE A;  1QV0 A;  3LCP C;  4GUK A;  4PHM A;  2JZI A;  4ORB B;  1ODB A;  1M45 A;  3SIB A;  2GV5 A;  4CFQ A;  3ZNI A;  2JT0 A;  3BOW A;  1XO5 A;  1B8R A;  5CSJ A;  4C0J A;  1CFP A;  1TTX A;  2FOT A;  1REC A;  2KBM A;  2M1U A;  1F4O A;  2WOS A;  5K89 A;  1A03 A;  1NWD A;  2MHH A;  3EKH A;  4JWQ A;  2CCM A;  1KFX L;  1JFK A;  1KWO C;  1FPW A;  3OX5 A;  2I2R E;  5KU1 A;  2LVI A;  2M29 A;  3BUN B;  5ER5 A;  1XK4 A;  2KYF A;  2LUC A;  2L5X B;  2AUC A;  2ZFD A;  2R2I A;  4YGB B;  1XFY O;  5AAN A;  1LIN A;  1WRL A;  3GK4 X;  2SCP A;  2M9G A;  1BU3 A;  4MVF A;  1RJV A;  1TNW A;  3D0Y A;  2Y1N A;  4MRX A;  3LK0 A;  3OB1 B;  1B8L A;  1CLM A;  2OTG C;  2F2P A;  5CSI A;  4NDC A;  1OMR A;  4YGD B;  2BBM A;  2KI6 C;  2JXL A;  2LMV A;  1IJ5 A;  1QX5 B;  1CDN A;  1GQM A;  1CM4 A;  2KI4 C;  4GNK B;  1L7Z A;  3LK1 A;  1YX7 A;  2SAS A;  2PSR A;  1CFF A;  2PAS A;  1EG3 A;  1OZO A;  1S6I A;  4YI8 A;  3WHU B;  1DJW A;  3K21 A;  1CDM A;  1TCO B;  3PLF B;  2LUX A;  2OPO A;  4I5N B;  3OHM B;  3TS5 B;  1M31 A;  1XK4 C;  1S26 D;  4IL1 A;  1PVA A;  3KF9 A;  2BCB A;  5KTY A;  1YX8 A;  1QLS A;  3I5G B;  1MUX A;  2EC6 C;  2LVJ A;  4XJK A;  3SG5 A;  3KPX A;  1H4B A;  5CPV A;  3F45 A;  2K8M B;  2L4I A;  2MAZ A;  1WRZ A;  3NSK A;  1AJ4 A;  1R2U A;  2D8N A;  1TNX A;  2LHL A;  3O6B A;  2K2F A;  4N1F A;  4PDZ A;  5D7F A;  2Q91 A;  2KAV A;  1NX0 A;  3I5H C;  4AQJ A;  1CFC A;  1DMO A;  1A75 A;  1CLL A;  1NUB A;  3BYA A;  3NSI A;  4ETO A;  1QXP A;  1RFJ A;  3DD4 A;  1OSA A;  2ZN8 A;  1EL4 A;  4OV2 A;  1SK6 D;  1JF2 A;  3D10 A;  2JC2 A;  3IQQ A;  2M7L A;  1JC2 A;  1JSA A;  2G2B A;  1B7T Z;  1G8I A;  4PAL A;  4F0Z B;  2L4H A;  4C0K A;  1F8H A;  1IQ3 A;  1W7J B;  1M46 A;  2F8P A;  2M1K B;  4HRH A;  1N2D A;  5CSN A;  1TRF A;  2KQY A;  2F33 A;  3OX6 A;  2QAC A;  5HYD A;  3A4U B;  1S5G Y;  4NDD A;  5CSF A;  1GGW A;  3CWG A;  2HET A; 
#chains in the Genus database with same CATH topology
 3OP0 A;  1ZMZ A;  2KAX A;  2JU0 A;  2KSP A;  2WCF A;  1YRT B;  1C07 A;  1EXR A;  5DKN A;  4QJ4 B;  4P5O E;  1TOP A;  1BT6 A;  3SS4 A;  2KNE A;  1MF8 B;  1DJI A;  2Y4Q A;  1TCF A;  1V1G A;  1LS8 A;  5TNC A;  1KQM B;  3C1V A;  1IKU A;  3VGO A;  1GJY A;  2L2C A;  2E30 A;  2EHB A;  3GK1 A;  1IG5 A;  1OMD A;  3D74 A;  1UHH A;  1VRK A;  1K9K A;  5AFP A;  1TWO A;  5AEQ A;  1RTP 1;  2B1U A;  1XFX O;  3DVK A;  4I5K A;  3L47 A;  3WHT B;  4CFR A;  2OTG B;  5EL2 A;  3SG3 A;  1SCM B;  1B7T Y;  2WCE A;  3D78 A;  2PQL A;  1NIW A;  3EK8 A;  3CR2 A;  2CT9 A;  2LLT A;  1E8A A;  1ZAC A;  2BCX A;  3EKJ A;  3NSL A;  1B8C A;  3MSE B;  2KI4 B;  1QIV A;  3D75 A;  1Q80 A;  1UHJ A;  4ORC B;  2K7D A;  2LVK A;  1DJX A;  2HQ8 A;  3H4S E;  2FCE A;  1AHR A;  2ZN9 A;  3PAL A;  3A8R A;  1QV1 A;  1CFD A;  3IQO A;  2LC5 A;  2BL0 C;  2H61 A;  1NCY A;  3IVT A;  1OZS A;  1CLB A;  1K9P A;  1NCZ A;  3CR5 X;  2K0J A;  2KAY A;  3D73 A;  1QX7 A;  1SY9 A;  4GGN A;  3TZ1 A;  1KCY A;  2WCH A;  3BUO B;  4L9M A;  3JTD C;  4A4C A;  1LA0 A;  4BY5 A;  1SBJ A;  4XYN A;  4D1E A;  1ALW A;  1Y1U A;  2I94 A;  2LE9 B;  3N7H A;  3NSO A;  1K9U A;  1SKT A;  3BFH A;  2JQ6 A;  1KSM A;  2KFH A;  1PUL A;  1BOC A;  3PAT A;  4CPV A;  1KFX S;  1QS7 A;  2BAP A;  3SJS A;  2EC6 B;  3D77 A;  1BOD A;  3EK4 A;  3TDZ A;  1UWO A;  2LHI A;  4MEW A;  3DVJ A;  3B88 A;  2F3Y A;  1LVC D;  5B8I B;  4QJ5 B;  3TUY C;  4E68 A;  1DJY A;  1XFR A;  2HPS A;  4MN0 A;  2NCO A;  2LMU A;  3VRO A;  1KQV A;  2WOR A;  2GGZ A;  3DVM A;  4GGF A;  3I5H B;  1KFU L;  1NYA A;  1BR4 B;  2CXJ A;  3EVR A;  1TIZ A;  4GFT A;  1NPQ A;  2K60 A;  1F71 A;  3R72 A;  1UHN A;  5HKW A;  3CGA A;  2ZND A;  1FI6 A;  1J1D A;  2PVB A;  2M49 B;  1W7I B;  1Y6W A;  3DF0 B;  1OMV A;  2VRG A;  3GOF A;  3HX4 A;  4M2O A;  4ORA B;  4WRI A;  1B47 A;  2FJU B;  3S0B A;  5I2Q A;  4I5L B;  1TNQ A;  3I5I C;  2JOJ A;  2QEV A;  4YBH B;  2H8V A;  2WC6 A;  1JWD A;  2L0P A;  2WCJ A;  5DKR A;  1N0Y A;  1IH0 A;  3JVT B;  5DKQ A;  3DZT A;  3JVT C;  3NHT A;  3O4Y A;  1IWQ A;  1G33 A;  1MHO A;  5PAL A;  5HL1 A;  2KGR A;  1SL8 A;  2MLE C;  1IJ6 A;  4ZCV A;  1S5G Z;  1NSH A;  1K2H A;  2JPT A;  1DJZ A;  3RZS A;  1CDP A;  1Y1A A;  2NLN A;  3BUX B;  5GQQ C;  2F3Z A;  1QJT A;  2BEC A;  5BPJ A;  1B1G A;  5G08 A;  4MSP A;  3B7A A;  1NX3 A;  3DYE A;  2PRU A;  1KK8 C;  3ZWH A;  1N65 A;  1A4P A;  2Y1M A;  4PHJ A;  3LLE A;  1SR6 C;  4YGE B;  4ICB A;  5JOL A;  2M8U A;  4PCW A;  1T14 A;  2ZNE A;  4DCK A;  3I5F C;  1GGZ A;  2AAO A;  2JNX A;  3SS5 A;  1B9A A;  1S6C A;  2IS9 A;  3CR4 X;  4AOM A;  1CKK A;  1AVS A;  1QTX A;  2NXQ A;  2JNF A;  1CNP A;  3R1P A;  1PAL A;  2P70 A;  1WRK A;  4PE1 A;  1CDL A;  2BL0 B;  1UHK A;  3NGV A;  1NX2 A;  1ORG A;  2KYC A;  3EK7 A;  4OZD A;  4YGC B;  1SSE B;  1C7V A;  2M97 A;  1WDC C;  5ER4 X;  2GGM A;  3CAB A;  3TDI A;  4I5J A;  1NP8 A;  1OOF A;  4MLW A;  5IBW A;  1KWO B;  3CDN A;  3QRX A;  4M2P A;  3S0G A;  1FI5 A;  5FI7 A;  2K2A A;  1JUO A;  4GPL B;  2KBI A;  1KSO A;  4CID A;  3PSR A;  3FIA A;  3PM8 A;  2KFF A;  3ICB A;  2CTN A;  4FQT A;  3TUY B;  1DQE A;  3WNX B;  1UUS A;  3AKB A;  4WQ3 A;  3TDU A;  1CMF A;  1QX2 A;  1MWN A;  1F4Q A;  1RK9 A;  2O5G A;  1SNL A;  1Y1X A;  2L50 A;  2I7A A;  5I8N A;  1WLM A;  2KDH A;  1OOJ A;  1QAT A;  1M63 B;  3B86 A;  5F6T A;  1K94 A;  2LV7 A;  3V2L A;  1S3P A;  1ZUZ A;  4PE4 A;  2K7B A;  2K7O A;  5J3X A;  1CB1 A;  1UUR A;  1R6P A;  3GK2 A;  4JQ0 D;  4R1E A;  1F54 A;  1YVH A;  1TNP A;  3BOW B;  1HQV A;  4USL A;  4P2Y B;  4MBE A;  3IF7 A;  1U5I A;  4DIR A;  3BQ3 A;  2MLF C;  2JWW A;  3I5I B;  2BCA A;  2V53 A;  3O2P A;  1PVB A;  2KQ6 A;  1YUR A;  2HQW A;  2K7C A;  2LAP A;  1LXF C;  2LNK A;  4JPZ B;  1BF5 A;  3K1E A;  2M0R A;  1MXL C;  4HRE E;  2NZ0 A;  4C0L A;  1XA5 A;  2DOQ A;  3AKA A;  2OS8 C;  3KEV A;  2JT3 A;  1K90 D;  3VRQ A;  1YR5 A;  3OBV A;  1DC1 A;  1RRO A;  3D0Y B;  4M2Q A;  4GBA A;  1F70 A;  5FI2 A;  3BUM B;  2LLU A;  4QJ3 B;  4WQ2 A;  1XFV O;  2AMI A;  1C7W A;  5D69 A;  2HF5 A;  1DF0 A;  1EH2 A;  3RM1 A;  3BUW B;  4GAO A;  1TN4 A;  1KK8 B;  2TN4 A;  1X02 A;  1B4C A;  4ZCU A;  3AAJ A;  1KFU S;  1RWY A;  1SR6 B;  2MBX A;  4YI9 A;  1UP5 A;  2BE6 A;  1S36 A;  2LCP A;  3R1V A;  5I2O A;  3I5F B;  3O78 A;  1CMG A;  2LM5 A;  1S1E A;  1PSR A;  2H61 C;  2RGI A;  3S0E A;  1L2O C;  2KI6 D;  2QEH A;  3HCM A;  1OQP A;  3SG7 A;  1DGU A;  1YVL A;  4FTG A;  4N5X A;  3CZ2 A;  4TNC A;  5I2L A;  2PMY A;  2Q4U A;  5HKY A;  2CBL A;  1KQM C;  2PAL A;  3DXL A;  2ZRS A;  1BJF A;  2K61 A;  1GM0 A;  2M7N A;  1EG4 A;  4JKT A;  4NQG A;  2ZRT A;  1LKJ A;  3SS3 A;  3S0D A;  1LA3 A;  2WND A;  4XJK B;  1J1E A;  3EVU A;  3VRN A;  2L5Y A;  2ERB A;  1WDC B;  1SW8 A;  3PN7 C;  1BG1 A;  2JTT A;  3B6X A;  2LP2 A;  3CZ1 A;  2JXC A;  1SCM C;  2JT8 A;  4CLN A;  2COL B;  2WCM A;  1YUT A;  2LVV A;  5I94 A;  3SIA A;  2NCP A;  1AJ5 A;  5AXI A;  1NX1 A;  1XFU O;  1QAS A;  1DTL A;  2JTZ A;  3FWB A;  4MZJ A;  2YGU A;  1FBV A;  3FS7 A;  1Y0V H;  4GGF C;  3SG6 A;  1MXE A;  1ZFS A;  1A75 B;  2BKI B;  4UPG A;  1IQ5 A;  5HKZ A;  1AP4 A;  2BE4 A;  2L2E A;  3L4L A;  4DS7 A;  1PRW A;  1DGV A;  1DVI A;  1AK8 A;  1K95 A;  2PYQ A;  1BLQ A;  1NCX A;  2LLS A;  1JFJ A;  1S6J A;  2WCB A;  3SG2 A;  1YUS A;  1AUI B;  1SL9 A;  1K8U A;  1SMG A;  3DF0 A;  3FE9 A;  1QVI Z;  1MQ1 A;  2QEB A;  1KK7 Z;  4OR9 B;  5HLO A;  5FI6 A;  1IRJ A;  2LAN A;  4OKH A;  1J7Q A;  3PFV A;  5FYX A;  1BMO A;  1JF0 A;  1YUU A;  3CTN A;  2KHN A;  1XFZ O;  1F55 A;  1OW4 A;  1PK0 D;  3CZ0 A;  2ISD A;  4DUQ A;  1CTR A;  1QLK A;  2KGB C;  3B87 A;  5JJG A;  2JPO A;  1A2X A;  1FW4 A;  2BKH B;  1G4Y R;  2KLE A;  1EJ3 A;  2QEO A;  1XYD A;  1WY9 A;  3BXK A;  3M0W A;  4FQO A;  3JTD B;  1K96 A;  1OOH A;  1SPY A;  1SYM A;  3VB1 A;  2OS8 B;  2Y5I A;  3NHI A;  3QME A;  4PHK A;  5KSZ A;  4Q04 A;  3DVE A;  1FF1 A;  3FWC A;  4YGA A;  2CNP A;  1SL7 A;  4BY4 A;  1DJG A;  1J55 A;  4INX A;  4N1G A;  1C3Y A;  3EVV A;  4MZL A;  1BR1 B;  3VRR A;  1D1O A;  3CZT X;  1M39 A;  2L51 A;  2MA2 A;  2O60 A;  1J7R A;  1UHI A;  1MR8 A;  1QVI Y;  2L98 A;  2E6W A;  1KK7 Y;  1CM1 A;  3AAK A;  2F2O A;  4DRW A;  3LL8 B;  1YTZ C;  2EGD A;  3D76 A;  4HRG A;  4AQI A;  3WXA A;  1DEL A;  2H2K A;  3TS5 C;  1TUZ A;  4NDB A;  3VRP A;  1U5I B;  1H8B A;  1IGV A;  4PE0 A;  1ZOT B;  4MRY A;  3RLZ A;  3FE8 A;  3I5G C;  2WCK A;  1L2O B;  1W9Z A;  1SCV A;  3S0F A;  1DT7 B;  2M3W A;  2JUL A;  1QWV A;  3E3R A;  1Z2C B;  2FCD A;  2FJY A;  1ALV A;  1YRU B;  1DJH A;  4IJ7 A;  1PSB A;  1A29 A;  4OVN F;  1JBA A;  2WC8 A;  3OGN A;  1SRA A;  2G9B A;  2KOT A;  2P6B B;  3OB2 B;  2MJW B;  1XFW O;  4HSZ A;  3CYZ A;  4KYN A;  4MZK A;  5HLV A;  3PN7 B;  1XVJ A;  4PHN A;  4YRU A;  1K93 D;  1WLZ A;  2ZKM X;  1J7O A;  3KO0 A;  2I18 A;  1DF0 B;  3R1O A;  2JRF A;  3SG4 A;  4U8D A;  1OOG A;  1V1F A;  2KFG A;  2LP3 A;  1J7P A;  4A4B A;  2A4J A;  5AER A;  2QPT A;  2BBN A;  4OCI A;  2MRD A;  1OE9 B;  1QIW A;  3CS1 A;  3NXA A;  4PE7 A;  1HT9 A;  1P28 A;  2LMT A;  3CLN A;  3KHE A;  1QV0 A;  3LCP C;  4GUK A;  4PHM A;  2JZI A;  4ORB B;  1ODB A;  3DY9 A;  1M45 A;  4INW A;  3SIB A;  1IIO A;  2GV5 A;  4CFQ A;  3ZNI A;  2JT0 A;  3BOW A;  1XO5 A;  1B8R A;  5CSJ A;  4C0J A;  1CFP A;  1TTX A;  2FOT A;  1REC A;  2KBM A;  2M1U A;  1F4O A;  2WOS A;  5K89 A;  1A03 A;  1NWD A;  2MHH A;  3EKH A;  3FE6 A;  2CCM A;  4JWQ A;  1KFX L;  1JFK A;  1KWO C;  1FPW A;  2KLD A;  1Z4H A;  3OX5 A;  2I2R E;  5KU1 A;  2LVI A;  2M29 A;  3BUN B;  5ER5 A;  3BFB A;  1XK4 A;  2KYF A;  2LUC A;  3Q8I A;  2L5X B;  2AUC A;  4JD9 A;  2ZFD A;  2R2I A;  4YGB B;  1XFY O;  5AAN A;  1LIN A;  1WRL A;  3GK4 X;  2SCP A;  2M9G A;  1BU3 A;  4MVF A;  1RJV A;  1OOI X;  1TNW A;  3D0Y A;  2Y1N A;  4MRX A;  3LK0 A;  3OB1 B;  1B8L A;  1C3Z A;  1CLM A;  2OTG C;  2F2P A;  5CSI A;  4NDC A;  3UNW A;  1OMR A;  4YGD B;  2BBM A;  2KI6 C;  2JXL A;  2LMV A;  2WCL A;  1IJ5 A;  1QX5 B;  1CDN A;  1GQM A;  1CM4 A;  2KI4 C;  4GNK B;  1L7Z A;  3LK1 A;  1YX7 A;  2SAS A;  2PSR A;  2WC5 A;  1CFF A;  3PM2 A;  2PAS A;  4F7F A;  3PJI A;  1EG3 A;  1OZO A;  1S6I A;  4YI8 A;  1TUJ A;  3WHU B;  1DJW A;  3K21 A;  1CDM A;  3S0A A;  1TCO B;  3PLF B;  2LUX A;  2OPO A;  4I5N B;  3BFA A;  3OHM B;  3TS5 B;  1M31 A;  1XK4 C;  1S26 D;  5D3O A;  4IL1 A;  1PVA A;  3KF9 A;  2BCB A;  5KTY A;  1YX8 A;  1QLS A;  3I5G B;  1MUX A;  2EC6 C;  2LVJ A;  4XJK A;  3O4X A;  3SG5 A;  3KPX A;  1H4B A;  5CPV A;  3F45 A;  2K8M B;  2L4I A;  4PT1 A;  3L4A A;  2MAZ A;  1WRZ A;  3NSK A;  1AJ4 A;  1R2U A;  2D8N A;  1TNX A;  2LHL A;  3O6B A;  2K2F A;  4N1F A;  4PDZ A;  5D7F A;  2Q91 A;  2KAV A;  1NX0 A;  3I5H C;  5DIC A;  4AQJ A;  3EG5 B;  3UO9 A;  1A75 A;  1CFC A;  1DMO A;  1CLL A;  1NUB A;  3BYA A;  3NSI A;  4ETO A;  2P71 A;  1QXP A;  1RFJ A;  3DD4 A;  1OSA A;  2GTE A;  1EL4 A;  2ZN8 A;  4OV2 A;  1SK6 D;  1JF2 A;  3D10 A;  2JC2 A;  3IQQ A;  2M7L A;  1JC2 A;  1JSA A;  2G2B A;  1B7T Z;  1G8I A;  4PAL A;  4F0Z B;  2KPH A;  2L4H A;  4C0K A;  1F8H A;  1DEK A;  1IQ3 A;  1W7J B;  1M46 A;  2F8P A;  2M1K B;  3BJH A;  4HRH A;  1N2D A;  5CSN A;  1TRF A;  2KQY A;  2QDI A;  2F33 A;  2BNX A;  2QAC A;  3OX6 A;  5HYD A;  3A4U B;  1S5G Y;  4NDD A;  5CSF A;  1GGW A;  3CWG A;  2HET A; 
#chains in the Genus database with same CATH homology
 3OP0 A;  1ZMZ A;  2KAX A;  2JU0 A;  2KSP A;  2WCF A;  1YRT B;  1C07 A;  1EXR A;  5DKN A;  4QJ4 B;  4P5O E;  1TOP A;  1BT6 A;  2KNE A;  1MF8 B;  1DJI A;  2Y4Q A;  1TCF A;  1V1G A;  5TNC A;  1KQM B;  3C1V A;  1IKU A;  3VGO A;  1GJY A;  2E30 A;  2EHB A;  3GK1 A;  1IG5 A;  1OMD A;  5AFP A;  1UHH A;  1VRK A;  1K9K A;  5AEQ A;  1RTP 1;  2B1U A;  1XFX O;  3DVK A;  4I5K A;  3WHT B;  4CFR A;  2OTG B;  3SG3 A;  1SCM B;  1B7T Y;  2WCE A;  1NIW A;  3EK8 A;  3CR2 A;  2CT9 A;  2LLT A;  1E8A A;  1ZAC A;  2BCX A;  3EKJ A;  3NSL A;  1B8C A;  3MSE B;  2KI4 B;  1QIV A;  1Q80 A;  1UHJ A;  4ORC B;  2K7D A;  2LVK A;  1DJX A;  2HQ8 A;  3H4S E;  2FCE A;  1AHR A;  2ZN9 A;  3PAL A;  3A8R A;  1QV1 A;  1CFD A;  3IQO A;  2LC5 A;  2BL0 C;  2H61 A;  1NCY A;  1OZS A;  1CLB A;  1K9P A;  1NCZ A;  3CR5 X;  2K0J A;  2KAY A;  3TZ1 A;  1QX7 A;  1SY9 A;  4GGN A;  1KCY A;  3BUO B;  4L9M A;  4A4C A;  3JTD C;  4BY5 A;  1LA0 A;  1SBJ A;  4XYN A;  4D1E A;  1ALW A;  1Y1U A;  2I94 A;  2LE9 B;  3NSO A;  1K9U A;  1SKT A;  2JQ6 A;  1KSM A;  2KFH A;  1PUL A;  1BOC A;  3PAT A;  4CPV A;  1KFX S;  1QS7 A;  3SJS A;  2EC6 B;  1BOD A;  3EK4 A;  3TDZ A;  1UWO A;  2LHI A;  4MEW A;  3DVJ A;  2F3Y A;  1LVC D;  5B8I B;  4QJ5 B;  3TUY C;  4E68 A;  1DJY A;  2HPS A;  4MN0 A;  2NCO A;  2LMU A;  3VRO A;  1KQV A;  2WOR A;  2GGZ A;  3DVM A;  4GGF A;  3I5H B;  1KFU L;  1NYA A;  1BR4 B;  2CXJ A;  3EVR A;  1TIZ A;  4GFT A;  1NPQ A;  1F71 A;  1UHN A;  5HKW A;  3CGA A;  2ZND A;  1FI6 A;  1J1D A;  2PVB A;  2M49 B;  1W7I B;  1Y6W A;  3DF0 B;  1OMV A;  2VRG A;  3GOF A;  3HX4 A;  4M2O A;  4ORA B;  4WRI A;  1B47 A;  2FJU B;  5I2Q A;  4I5L B;  1TNQ A;  3I5I C;  2JOJ A;  4YBH B;  1JWD A;  2L0P A;  5DKR A;  1IH0 A;  1N0Y A;  3JVT B;  5DKQ A;  3JVT C;  3O4Y A;  1IWQ A;  1G33 A;  1MHO A;  5PAL A;  2KGR A;  1SL8 A;  2MLE C;  1IJ6 A;  4ZCV A;  1S5G Z;  1NSH A;  1K2H A;  2JPT A;  1DJZ A;  1CDP A;  1Y1A A;  2NLN A;  3BUX B;  5GQQ C;  2F3Z A;  1QJT A;  2BEC A;  5BPJ A;  1B1G A;  5G08 A;  4MSP A;  1NX3 A;  2PRU A;  1KK8 C;  3ZWH A;  1N65 A;  1A4P A;  2Y1M A;  4PHJ A;  3LLE A;  1SR6 C;  4YGE B;  4ICB A;  5JOL A;  2M8U A;  4PCW A;  4DCK A;  2ZNE A;  3I5F C;  1GGZ A;  2AAO A;  2JNX A;  1B9A A;  1S6C A;  2IS9 A;  3CR4 X;  4AOM A;  1CKK A;  1AVS A;  1QTX A;  2NXQ A;  2JNF A;  1CNP A;  1PAL A;  1WRK A;  4PE1 A;  1CDL A;  2BL0 B;  1UHK A;  1NX2 A;  2KYC A;  3EK7 A;  4YGC B;  1C7V A;  2M97 A;  1WDC C;  5ER4 X;  2GGM A;  3TDI A;  4I5J A;  1NP8 A;  4MLW A;  5IBW A;  1KWO B;  4M2P A;  3QRX A;  1FI5 A;  2K2A A;  1JUO A;  4GPL B;  2KBI A;  1KSO A;  4CID A;  3PSR A;  3FIA A;  3PM8 A;  2KFF A;  3ICB A;  2CTN A;  3TUY B;  3WNX B;  1UUS A;  3AKB A;  4WQ3 A;  3TDU A;  1CMF A;  1QX2 A;  1MWN A;  1F4Q A;  1RK9 A;  2O5G A;  1SNL A;  1Y1X A;  2L50 A;  2I7A A;  5I8N A;  1WLM A;  2KDH A;  1OOJ A;  1QAT A;  1M63 B;  5F6T A;  1K94 A;  2LV7 A;  1S3P A;  1ZUZ A;  4PE4 A;  2K7B A;  2K7O A;  5J3X A;  1CB1 A;  1UUR A;  1R6P A;  3GK2 A;  4JQ0 D;  4R1E A;  1F54 A;  1YVH A;  1TNP A;  3BOW B;  1HQV A;  4USL A;  4P2Y B;  4MBE A;  3IF7 A;  1U5I A;  4DIR A;  3BQ3 A;  2MLF C;  2JWW A;  3I5I B;  2BCA A;  2V53 A;  3O2P A;  1PVB A;  2KQ6 A;  1YUR A;  2HQW A;  2K7C A;  2LAP A;  1LXF C;  2LNK A;  4JPZ B;  1BF5 A;  2M0R A;  1MXL C;  4HRE E;  2NZ0 A;  4C0L A;  1XA5 A;  2DOQ A;  3AKA A;  2OS8 C;  3KEV A;  2JT3 A;  1K90 D;  3VRQ A;  1YR5 A;  1RRO A;  3D0Y B;  4M2Q A;  4GBA A;  1F70 A;  3BUM B;  2LLU A;  4QJ3 B;  4WQ2 A;  1XFV O;  2AMI A;  1C7W A;  5D69 A;  2HF5 A;  1DF0 A;  1EH2 A;  3RM1 A;  3BUW B;  4GAO A;  1TN4 A;  1KK8 B;  2TN4 A;  1X02 A;  1B4C A;  4ZCU A;  3AAJ A;  1KFU S;  1RWY A;  1SR6 B;  2MBX A;  4YI9 A;  1UP5 A;  2BE6 A;  1S36 A;  2LCP A;  5I2O A;  3I5F B;  3O78 A;  1CMG A;  2LM5 A;  1S1E A;  1PSR A;  2H61 C;  2RGI A;  1L2O C;  2KI6 D;  3HCM A;  1OQP A;  3SG7 A;  1DGU A;  1YVL A;  4FTG A;  4N5X A;  4TNC A;  5I2L A;  2PMY A;  2Q4U A;  5HKY A;  2CBL A;  1KQM C;  2PAL A;  2ZRS A;  1BJF A;  2K61 A;  2M7N A;  1EG4 A;  4NQG A;  2ZRT A;  1LKJ A;  1LA3 A;  2WND A;  4XJK B;  1J1E A;  3EVU A;  3VRN A;  1WDC B;  1SW8 A;  3PN7 C;  1BG1 A;  2JTT A;  2LP2 A;  2JXC A;  1SCM C;  2JT8 A;  4CLN A;  2COL B;  1YUT A;  2LVV A;  3SIA A;  2NCP A;  1AJ5 A;  5AXI A;  1NX1 A;  1XFU O;  1QAS A;  1DTL A;  2JTZ A;  3FWB A;  4MZJ A;  3FS7 A;  1FBV A;  4GGF C;  1Y0V H;  3SG6 A;  1MXE A;  1ZFS A;  1A75 B;  2BKI B;  4UPG A;  1IQ5 A;  5HKZ A;  1AP4 A;  2BE4 A;  2L2E A;  4DS7 A;  1PRW A;  1DGV A;  1DVI A;  1AK8 A;  1K95 A;  1BLQ A;  1NCX A;  2LLS A;  1JFJ A;  1S6J A;  2WCB A;  3SG2 A;  1YUS A;  1AUI B;  1SL9 A;  1K8U A;  1SMG A;  3DF0 A;  1QVI Z;  1MQ1 A;  1KK7 Z;  4OR9 B;  5HLO A;  1IRJ A;  2LAN A;  4OKH A;  1J7Q A;  3PFV A;  5FYX A;  1BMO A;  1JF0 A;  1YUU A;  3CTN A;  2KHN A;  1XFZ O;  1F55 A;  1PK0 D;  2ISD A;  4DUQ A;  1CTR A;  1QLK A;  2KGB C;  5JJG A;  1A2X A;  1FW4 A;  2BKH B;  1G4Y R;  1EJ3 A;  1XYD A;  1WY9 A;  3BXK A;  3M0W A;  4FQO A;  3JTD B;  1K96 A;  1SPY A;  1SYM A;  2OS8 B;  2Y5I A;  4PHK A;  5KSZ A;  4Q04 A;  3DVE A;  1FF1 A;  3FWC A;  4YGA A;  2CNP A;  1SL7 A;  4BY4 A;  1DJG A;  1J55 A;  4N1G A;  3EVV A;  4MZL A;  1BR1 B;  3VRR A;  1D1O A;  3CZT X;  1M39 A;  2L51 A;  2MA2 A;  2O60 A;  1J7R A;  1UHI A;  1MR8 A;  1QVI Y;  2L98 A;  2E6W A;  1KK7 Y;  1CM1 A;  3AAK A;  2F2O A;  4DRW A;  3LL8 B;  1YTZ C;  2EGD A;  4HRG A;  4AQI A;  3WXA A;  2H2K A;  3TS5 C;  4NDB A;  3VRP A;  1U5I B;  1H8B A;  1IGV A;  4PE0 A;  1ZOT B;  4MRY A;  3RLZ A;  3I5G C;  1L2O B;  1SCV A;  1DT7 B;  2M3W A;  2JUL A;  3E3R A;  2FCD A;  1ALV A;  1YRU B;  1DJH A;  1PSB A;  1A29 A;  4OVN F;  1JBA A;  2WC8 A;  1SRA A;  2G9B A;  2KOT A;  2P6B B;  3OB2 B;  2MJW B;  1XFW O;  4HSZ A;  4MZK A;  5HLV A;  3PN7 B;  1XVJ A;  4PHN A;  4YRU A;  1K93 D;  1WLZ A;  2ZKM X;  1J7O A;  3KO0 A;  2I18 A;  1DF0 B;  2JRF A;  3SG4 A;  4U8D A;  1V1F A;  2KFG A;  2LP3 A;  1J7P A;  4A4B A;  2A4J A;  5AER A;  2QPT A;  2BBN A;  4OCI A;  2MRD A;  1OE9 B;  1QIW A;  3CS1 A;  3NXA A;  4PE7 A;  1HT9 A;  2LMT A;  3CLN A;  3KHE A;  1QV0 A;  3LCP C;  4GUK A;  4PHM A;  2JZI A;  4ORB B;  1ODB A;  1M45 A;  3SIB A;  2GV5 A;  4CFQ A;  3ZNI A;  2JT0 A;  3BOW A;  1XO5 A;  1B8R A;  5CSJ A;  4C0J A;  1CFP A;  1TTX A;  2FOT A;  1REC A;  2KBM A;  2M1U A;  1F4O A;  2WOS A;  5K89 A;  1A03 A;  1NWD A;  2MHH A;  3EKH A;  4JWQ A;  2CCM A;  1KFX L;  1JFK A;  1KWO C;  1FPW A;  3OX5 A;  2I2R E;  5KU1 A;  2LVI A;  2M29 A;  3BUN B;  5ER5 A;  1XK4 A;  2KYF A;  2LUC A;  2L5X B;  2AUC A;  2ZFD A;  2R2I A;  4YGB B;  1XFY O;  5AAN A;  1LIN A;  1WRL A;  3GK4 X;  2SCP A;  2M9G A;  1BU3 A;  4MVF A;  1RJV A;  1TNW A;  3D0Y A;  2Y1N A;  4MRX A;  3LK0 A;  3OB1 B;  1B8L A;  1CLM A;  2OTG C;  2F2P A;  5CSI A;  4NDC A;  1OMR A;  4YGD B;  2BBM A;  2KI6 C;  2JXL A;  2LMV A;  1IJ5 A;  1QX5 B;  1CDN A;  1GQM A;  1CM4 A;  2KI4 C;  4GNK B;  1L7Z A;  3LK1 A;  1YX7 A;  2SAS A;  2PSR A;  1CFF A;  2PAS A;  1EG3 A;  1OZO A;  1S6I A;  4YI8 A;  3WHU B;  1DJW A;  3K21 A;  1CDM A;  1TCO B;  3PLF B;  2LUX A;  2OPO A;  4I5N B;  3OHM B;  3TS5 B;  1M31 A;  1XK4 C;  1S26 D;  4IL1 A;  1PVA A;  3KF9 A;  2BCB A;  5KTY A;  1YX8 A;  1QLS A;  3I5G B;  1MUX A;  2EC6 C;  2LVJ A;  4XJK A;  3SG5 A;  3KPX A;  1H4B A;  5CPV A;  3F45 A;  2K8M B;  2L4I A;  2MAZ A;  1WRZ A;  3NSK A;  1AJ4 A;  1R2U A;  2D8N A;  1TNX A;  2LHL A;  3O6B A;  2K2F A;  4N1F A;  4PDZ A;  5D7F A;  2Q91 A;  2KAV A;  1NX0 A;  3I5H C;  4AQJ A;  1CFC A;  1DMO A;  1A75 A;  1CLL A;  1NUB A;  3BYA A;  3NSI A;  4ETO A;  1QXP A;  1RFJ A;  3DD4 A;  1OSA A;  2ZN8 A;  1EL4 A;  4OV2 A;  1SK6 D;  1JF2 A;  3D10 A;  2JC2 A;  3IQQ A;  2M7L A;  1JC2 A;  1JSA A;  2G2B A;  1B7T Z;  1G8I A;  4PAL A;  4F0Z B;  2L4H A;  4C0K A;  1F8H A;  1IQ3 A;  1W7J B;  1M46 A;  2F8P A;  2M1K B;  4HRH A;  1N2D A;  5CSN A;  1TRF A;  2KQY A;  2F33 A;  3OX6 A;  2QAC A;  5HYD A;  3A4U B;  1S5G Y;  4NDD A;  5CSF A;  1GGW A;  3CWG A;  2HET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...