1S5GZ

Structure of scallop myosin s1 reveals a novel nucleotide conformation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
total genus 40
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gZ01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gZ02
2QACA 1GGZA 4ORAB 2MLFC 5I2OA 1KSMA 1S36A 3IF7A 1E8AA 4FQOA 4YRUA 1S3PA 1KWOB 1DF0B 1EG4A 3BYAA 1MWNA 1XFVO 1YUSA 1CMGA 2RGIA 3PSRA 4FTGA 4PHMA 1H8BA 2M97A 2KYFA 1SCMB 2JZIA 1S5GZ 2KQYA 2Y1NA 3I5FB 2LUCA 2KBMA 2HQ8A 1MR8A 3NXAA 1WLZA 1AJ4A 1WDCB 1BT6A 2MBXA 1RFJA 3PM8A 1B1GA 2KGBC 2AUCA 4GUKA 1H4BA 3O4YA 1DMOA 3IQOA 3PN7B 1NSHA 3DF0B 4PHJA 4I5JA 2KI4B 1K93D 1QASA 3PATA 3K21A 2LCPA 2LAPA 4N1GA 1NX3A 4C0LA 2O60A 1Q80A 2PALA 1UWOA 2K2AA 1M31A 4M2PA 1S5GY 2JT8A 1IRJA 4OCIA 1KWOC 1ZOTB 2JNFA 4WQ2A 1NWDA 4F0ZB 3AAKA 1NX1A 1A75A 1OSAA 2KNEA 4D1EA 1SCMC 2O5GA 4E68A 3FWCA 2EHBA 3I5FC 3LK0A 3I5HB 1OOJA 1SK6D 2M49B 3KO0A 1UURA 4QJ4B 3VRPA 1K9UA 1WDCC 1A4PA 2NCPA 4CLNA 2KBIA 2WORA 3PLFB 1CDPA 1LXFC 1TN4A 1MHOA 2K8MB 2LMTA 3DVKA 4UPGA 3KPXA 3KHEA 3PN7C 2L2EA 1NYAA 1EG3A 2KI4C 1XK4A 3EKHA 1B8LA 4WQ3A 3SG3A 2HPSA 1CDMA 1KFUL 1VRKA 5AANA 2LMUA 3IQQA 2ZRSA 1LINA 3OB2B 4MZLA 2Q91A 5D7FA 1OE9B 1BJFA 1JF2A 2OS8B 1KK7Z 1GJYA 1DJHA 3MSEB 4XJKA 3TDZA 1EXRA 3H4SE 4CIDA 2L0PA 1HQVA 1TCOB 1J7PA 1PULA 1B8RA 3AKAA 2OTGB 1DJGA 1RTP1 2IS9A 2H2KA 5G08A 1K94A 4ORCB 3TDIA 3I5HC 1C7VA 2F2PA 1K9KA 1NCXA 2PSRA 1CDNA 1KFXS 5DKQA 1S26D 2BCXA 1PVBA 1CFFA 1IQ3A 3DVJA 3TS5B 2F33A 3BXKA 3GOFA 4OR9B 1SKTA 1PK0D 5HKWA 1KK7Y 1OMDA 3AAJA 4GPLB 2V53A 1DJZA 2F3ZA 5F6TA 2A4JA 5ER4X 3EK8A 2LHLA 3CS1A 3NSKA 3DVEA 2ISDA 3SG2A 1J1EA 4M2OA 1SR6B 1TNXA 1TTXA 1QVIY 2NCOA 4AQJA 2CTNA 1K2HA 2LLTA 5HKZA 2GV5A 2OS8C 1YX7A 1K90D 3HX4A 1G4YR 2KI6C 3O2PA 1JF0A 2SASA 3GK4X 2KQ6A 1DJYA 5K89A 1A75B 2OTGC 1LA0A 4CFRA 3I5IB 2PVBA 1OZSA 4BY4A 5I2QA 1CMFA 3RM1A 1SL8A 1ZUZA 2WOSA 1C07A 1D1OA 2LVVA 1IG5A 5HLOA 2JULA 5PALA 2LLUA 2MA2A 3WHTB 2FJUB 3WXAA 4A4BA 3TS5C 1B4CA 2M7LA 1AJ5A 2I2RE 4HREE 1XFYO 5I8NA 1J1DA 1QTXA 2LLSA 3F45A 4YI9A 4OV2A 1ALWA 4GNKB 3EKJA 1Y0VH 3LL8B 1B8CA 4PE1A 4PHKA 4OKHA 4C0JA 2LHIA 2Y1MA 3OX6A 1NCZA 1QXPA 1SR6C 3HCMA 4XYNA 1DJWA 1K96A 1K9PA 1PRWA 3D10A 3VROA 4AOMA 4U8DA 1R2UA 3M0WA 2BBNA 1AVSA 1NX0A 4XJKB 5HYDA 3BUXB 5I2LA 4MRYA 1CFDA 5DKRA 1NCYA 2LNKA 1NPQA 2BECA 2JXLA 2D8NA 1QV0A 2F3YA 1YURA 1SPYA 4QJ3B 2LANA 2F2OA 1KFXL 4IL1A 1B7TZ 3I5IC 4YGBB 4DUQA 2MLEC 1DGUA 1MQ1A 2JT3A 1FI6A 1FF1A 1F4OA 3FWBA 1NX2A 4DS7A 1EL4A 1Y1XA 2K2FA 2BKHB 1SNLA 3SG6A 3JTDB 1OMRA 4NDDA 1YRTB 2LE9B 2L5XB 1JFKA 2WCBA 1K8UA 2CCMA 2LC5A 2JU0A 2PASA 3QRXA 1WRZA 2M0RA 1CDLA 1ZMZA 1XK4C 3E3RA 1UHJA 5JJGA 5D69A 2LM5A 2TN4A 2ZNEA 1TOPA 4ZCVA 4BY5A 1TNWA 4AQIA 2M1KB 1V1GA 4ORBB 1LVCD 2KGRA 1BG1A 5IBWA 2EC6B 2G9BA 1B7TY 5CPVA 1JSAA 1NIWA 2K7CA 3VGOA 1BR4B 1UP5A 1IKUA 5AERA 4MBEA 2PMYA 3OP0A 3OX5A 3FS7A 1UHHA 2L98A 2VRGA 1LKJA 2K0JA 3LK1A 5AXIA 1WRLA 1QX2A 3SG5A 1MXEA 4GBAA 4YGEB 1RK9A 1KK8B 2JWWA 1YUTA 4PE7A 5HLVA 2M29A 3OHMB 1QVIZ 1UHKA 4I5LB 1B47A 1TNQA 3JTDC 2KAXA 2ZN8A 4HRGA 1CM4A 1BOCA 5J3XA 1Y1AA 2JXCA 2KFFA 4GAOA 4GGFA 1IH0A 1W7IB 3D0YA 2SCPA 4HSZA 5FYXA 1BLQA 1SYMA 3SJSA 1C7WA 4ETOA 1F55A 3TZ1A 1PSBA 3SG4A 2LP3A 1AHRA 2EC6C 2WC8A 4YI8A 5GQQC 4PCWA 2I7AA 2ZRTA 1RECA 1M39A 2JOJA 2WCEA 1GGWA 2L51A 2F8PA 2BL0B 3A8RA 1A03A 1S6CA 1RROA 2R2IA 1BF5A 3TUYB 3CWGA 2BCBA 2FOTA 4L9MA 1RWYA 2CBLA 1NP8A 2H61A 3O78A 1MUXA 1IJ6A 2KI6D 3BOWA 1F54A 2JQ6A 2Y5IA 2L4HA 4MRXA 1BMOA 1KK8C 2LVKA 2I18A 1SRAA 3JVTB 2LP2A 3VRNA 1QIWA 1F8HA 1SL9A 4PE0A 1HT9A 3A4UB 1XFUO 1KSOA 4I5KA 3SG7A 1R6PA 1MXLC 4USLA 1ODBA 2HETA 2LV7A 3NSOA 4I5NB 3GK2A 1CTRA 4NDBA 1EH2A 1UUSA 2BCAA 2MJWB 1UHIA 1A2XA 1L2OB 1CFPA 1N65A 1F4QA 1J55A 1UHNA 2MHHA 3BUNB 4GFTA 4NDCA 2AAOA 1QS7A 2BE6A 1G8IA 1A29A 1KQVA 3CGAA 1CFCA 2BL0C 2M8UA 1FPWA 4ZCUA 4C0KA 2ZFDA 1OMVA 2HQWA 3TUYC 1KFUS 1AUIB 1J7OA 2L50A 2L4IA 1IQ5A 4MZKA 5KSZA 1XO5A 2COLB 2M1UA 4MN0A 2CNPA 5KU1A 1CLBA 1XFXO 2PRUA 2Q4UA 5CSFA 3JVTC 3BQ3A 1JC2A 3DD4A 2OPOA 1WY9A 3FIAA 1WRKA 2JTTA 1CB1A 1CLLA 2E30A 1OQPA 4M2QA 1M45A 4YBHB 5CSIA 5DKNA 2ZNDA 2ZN9A 1M63B 4JPZB 4CPVA 2BKIB 4N1FA 2KYCA 3C1VA 3D0YB 2NXQA 1AP4A 1FBVA 4PALA 3ZWHA 1YVLA 4N5XA 4PE4A 2JTZA 1L2OC 1SCVA 1QATA 1SBJA 2GGZA 3DVMA 3I5GB 3ZNIA 1CM1A 1SMGA 1YUUA 2KHNA 3PFVA 1SY9A 4JWQA 2CT9A 1QJTA 1QX5B 1YR5A 1FW4A 4MEWA 1U5IA 1WLMA 2K7OA 1DVIA 1CNPA 2FCDA 1J7QA 1NUBA 2KFGA 1K95A 1QLKA 1M46A 1QV1A 3EK7A 3SIAA 1TNPA 1OZOA 2I94A 4GGNA 3BOWB 5CSNA 1N2DA 3EVRA 3LCPC 4A4CA 1RJVA 1QLSA 1IJ5A 4Q04A 1CKKA 1MF8B 4YGAA 1QX7A 4MSPA 2JC2A 1FI5A 2EGDA 4OVNF 1W7JB 2LMVA 1ZFSA 5AFPA 2Y4QA 1DF0A 1IGVA 1S1EA 2JPTA 1JUOA 4QJ5B 4GGFC 1JWDA 2KSPA 2NZ0A 1ALVA 1EJ3A 3ICBA 3VRQA 3AKBA 3RLZA 4P2YB 4NQGA 1JBAA 1TIZA 1KQMB 1X02A 3GK1A 1SL7A 2FCEA 3OB1B 3I5GC 1Y6WA 1YVHA 5HKYA 2JNXA 4PHNA 1JFJA 2K61A 2KAVA 1DJXA 5JOLA 5BPJA 2JRFA 2WCFA 1XVJA 2KOTA 1XFZO 2KAYA 2LUXA 1PVAA 3KF9A 1DGVA 4P5OE 1YRUB 5KTYA 1PSRA 3DF0A 3EVVA 1G33A 1CLMA 1N0YA 2MRDA 1QIVA 3CR4X 4MZJA 2G2BA 3EVUA 4MLWA 2H61C 1F71A 2LVJA 3VRRA 2KDHA 2MAZA 1DT7B 3CLNA 2DOQA 1YTZC 3KEVA 1SW8A 4DCKA 3O6BA 4JQ0D 2ZKMX 2CXJA 3TDUA 3NSLA 2HF5A 1XFWO 2E6WA 1AK8A 4HRHA 1V1FA 1IWQA 2M9GA 3WNXB 3BUWB 1BR1B 3NSIA 2JT0A 3CZTX 3BUMB 4DRWA 1XYDA 2QPTA 4R1EA 5ER5A 2M7NA 5B8IB 1XA5A 2BE4A 1TRFA 5AEQA 2GGMA 1KQMC 3CTNA 5TNCA 4TNCA 3CR5X 4ICBA 2M3WA 2B1UA 4CFQA 2P6BB 1BU3A 1L7ZA 1DJIA 4YGDB 2LVIA 3WHUB 1DTLA 1S6JA 1U5IB 3PALA 1F70A 2K7BA 5CSJA 2NLNA 4MVFA 3EK4A 1BODA 3CR2A 2BBMA 2WNDA 1GQMA 1B9AA 1S6IA 1Y1UA 2KFHA 4YGCB 1KCYA 2K7DA 4PDZA 1YX8A 2AMIA 3SIBA 1J7RA 4DIRA 1LA3A 3BUOB 1TCFA 1ZACA 1PALA 4WRIA 3LLEA
chains in the Genus database with same CATH superfamily
2QACA 1GGZA 4ORAB 2MLFC 5I2OA 1KSMA 1S36A 3IF7A 1E8AA 4FQOA 4YRUA 1S3PA 3SS3A 1KWOB 1DF0B 1EG4A 2QEBA 1MWNA 1XFVO 1YUSA 3BYAA 3DXLA 1CMGA 2RGIA 2L2CA 3PSRA 4FTGA 4PHMA 1H8BA 2M97A 2KYFA 1SCMB 2JZIA 1S5GZ 2KQYA 2Y1NA 3I5FB 2LUCA 2KBMA 2HQ8A 1MR8A 3NXAA 1WLZA 1AJ4A 1WDCB 1BT6A 2MBXA 1RFJA 3PM8A 1B1GA 2KGBC 1OW4A 2AUCA 4GUKA 1H4BA 3O4YA 1DMOA 3IQOA 3PN7B 1NSHA 3DF0B 4PHJA 4I5JA 2KI4B 1K93D 1QASA 3PATA 5DICA 3K21A 2LCPA 3UNWA 2LAPA 4N1GA 1NX3A 4C0LA 2O60A 1Q80A 2PALA 3PM2A 1UWOA 2K2AA 2QDIA 1M31A 4M2PA 1S5GY 2JT8A 3L4AA 1IRJA 4OCIA 3R72A 1KWOC 1ZOTB 2KPHA 2JNFA 4WQ2A 1NWDA 4F0ZB 3AAKA 3D74A 1NX1A 1A75A 1OSAA 2KNEA 4D1EA 1SCMC 2O5GA 4E68A 3FWCA 2EHBA 3DYEA 3I5FC 3LK0A 3UO9A 3I5HB 1OOJA 1SK6D 2M49B 5FI2A 3KO0A 1UURA 4QJ4B 3VRPA 1K9UA 1WDCC 2H8VA 1A4PA 2NCPA 4CLNA 2KBIA 2WORA 3PLFB 1CDPA 1T14A 1LXFC 1TN4A 1MHOA 2K8MB 2LMTA 3DVKA 4UPGA 3KPXA 3KHEA 3PN7C 2L2EA 1NYAA 1EG3A 4INXA 3IVTA 1P28A 1XK4A 2KI4C 1B8LA 3EKHA 4WQ3A 3SG3A 3VB1A 3D75A 2HPSA 1CDMA 1KFUL 1VRKA 5AANA 3NHIA 2LMUA 3IQQA 2ZRSA 1LINA 3OB2B 4MZLA 2FJYA 2Q91A 5D7FA 1OE9B 1BJFA 1JF2A 3S0AA 2OS8B 1KK7Z 1GJYA 1DJHA 3MSEB 4XJKA 3TDZA 1EXRA 2P71A 3H4SE 4CIDA 2L0PA 1HQVA 1TCOB 1J7PA 1PULA 1C3YA 1B8RA 3AKAA 2OTGB 1DJGA 1RTP1 2IS9A 2H2KA 5G08A 1K94A 4ORCB 3TDIA 3I5HC 1C7VA 2F2PA 1OOFA 1K9KA 1NCXA 2PSRA 3S0FA 1CDNA 1KFXS 1ORGA 5DKQA 1S26D 2BCXA 1PVBA 1CFFA 1IQ3A 3DVJA 3TS5B 5HL1A 2F33A 3BXKA 3GOFA 4OR9B 1SKTA 1PK0D 5HKWA 1KK7Y 1OMDA 3AAJA 4GPLB 2V53A 1DJZA 2F3ZA 5F6TA 2A4JA 5ER4X 3EK8A 2LHLA 3CS1A 1Z4HA 3NSKA 3DVEA 2ISDA 4IJ7A 3SG2A 1J1EA 4M2OA 1SR6B 1TNXA 1OOHA 1QVIY 1TTXA 2NCOA 4AQJA 2CTNA 3CZ0A 4JD9A 1K2HA 2LLTA 5HKZA 2GV5A 1OOIX 2OS8C 3EG5B 1YX7A 3OBVA 1K90D 3HX4A 1G4YR 2KI6C 3O2PA 1JF0A 1W9ZA 2SASA 3GK4X 2KQ6A 1DJYA 5K89A 1A75B 3OGNA 2OTGC 1LA0A 4CFRA 3I5IB 2PVBA 1OZSA 4BY4A 5I2QA 1CMFA 3Q8IA 3RM1A 1SL8A 1ZUZA 2WOSA 1C07A 3RZSA 1D1OA 2LVVA 1IG5A 3D73A 5HLOA 2JULA 5PALA 3R1VA 2LLUA 2MA2A 3WHTB 2FJUB 3WXAA 4A4BA 3TS5C 1TUZA 1B4CA 3K1EA 2M7LA 1AJ5A 2I2RE 4HREE 1XFYO 5I8NA 1J1DA 1QTXA 2LLSA 3F45A 3FE9A 4YI9A 4OV2A 1ALWA 4GNKB 3EKJA 1IIOA 1Y0VH 3LL8B 1B8CA 2WCHA 4PHKA 4PE1A 4OKHA 4C0JA 2LHIA 3FE6A 2Y1MA 3OX6A 1NCZA 1QXPA 1SR6C 3HCMA 4XYNA 1DJWA 1K96A 1K9PA 1PRWA 3D10A 3VROA 4AOMA 4U8DA 1R2UA 3M0WA 2BBNA 1AVSA 1NX0A 4XJKB 5HYDA 3BUXB 5I2LA 4MRYA 4JKTA 1CFDA 3B7AA 1NCYA 2LNKA 1NPQA 5DKRA 2BECA 2JXLA 2D8NA 3O4XA 2QEHA 1QV0A 2F3YA 1YURA 1SPYA 4QJ3B 2LANA 2F2OA 1KFXL 4IL1A 1B7TZ 3I5IC 4YGBB 4DUQA 2MLEC 3DY9A 1DGUA 1MQ1A 2JT3A 1FI6A 3BFHA 1F4OA 1FF1A 3FWBA 1NX2A 4DS7A 1EL4A 1Y1XA 2K2FA 2BKHB 1SNLA 3SG6A 3JTDB 1OMRA 4NDDA 1YRTB 2LE9B 2L5XB 1JFKA 1DQEA 2WCBA 1K8UA 2CCMA 2LC5A 2JU0A 2PASA 3QRXA 1WRZA 2M0RA 1CDLA 1TWOA 1XK4C 1ZMZA 3E3RA 1UHJA 5JJGA 5D69A 2LM5A 2TN4A 2ZNEA 3B88A 1TOPA 4ZCVA 4BY5A 1TNWA 4AQIA 1DELA 1V1GA 2M1KB 1LVCD 2KGRA 4ORBB 1BG1A 5IBWA 2EC6B 2G9BA 1B7TY 5CPVA 3R1PA 3NGVA 1NIWA 1JSAA 2K7CA 3VGOA 3L4LA 1BR4B 1UP5A 1IKUA 5AERA 4MBEA 2PMYA 3OP0A 3OX5A 3FS7A 1UHHA 2L98A 2VRGA 1XFRA 1LKJA 2K0JA 3LK1A 5AXIA 1WRLA 4INWA 1DC1A 1QX2A 3SG5A 3B87A 3D78A 1MXEA 4GBAA 4YGEB 1RK9A 1KK8B 2JWWA 1YUTA 2WCJA 4PE7A 5HLVA 3L47A 2WCKA 2M29A 2GTEA 3OHMB 1QVIZ 1UHKA 3D77A 4I5LB 1B47A 1TNQA 3JTDC 3V2LA 2KAXA 2ZN8A 4HRGA 1CM4A 1BOCA 5J3XA 1Y1AA 2ERBA 2JXCA 2KFFA 3CDNA 4GAOA 4GGFA 3SS4A 1IH0A 1W7IB 3D0YA 2SCPA 4HSZA 5FYXA 1BLQA 1SYMA 3SJSA 1C7WA 4ETOA 1F55A 3TZ1A 1PSBA 3SG4A 2LP3A 1AHRA 2EC6C 2WC8A 4YI8A 5I94A 5GQQC 4PCWA 3DZTA 3PJIA 2I7AA 2ZRTA 1RECA 1M39A 2JOJA 2WCEA 1GGWA 2L51A 2F8PA 2BL0B 2QEOA 3A8RA 1A03A 1S6CA 1RROA 2R2IA 1BF5A 3BFBA 3TUYB 3CWGA 2BCBA 2FOTA 4L9MA 1RWYA 1Z2CB 2CBLA 1NP8A 2H61A 3O78A 4FQTA 1MUXA 1IJ6A 2KI6D 3BOWA 1F54A 3S0BA 2JQ6A 2Y5IA 2L4HA 4MRXA 1BMOA 1KK8C 1LS8A 2I18A 1OOGA 1SRAA 2LVKA 2LP2A 3JVTB 1QIWA 3VRNA 2K60A 3S0EA 1F8HA 1SL9A 4PE0A 1HT9A 3A4UB 1XFUO 1KSOA 2WC6A 4I5KA 3SG7A 1R6PA 1MXLC 4USLA 1ODBA 2HETA 2LV7A 3NSOA 4I5NB 3GK2A 4OZDA 1CTRA 2BAPA 4NDBA 1UUSA 2BCAA 2MJWB 5D3OA 1EH2A 1UHIA 1A2XA 4F7FA 1L2OB 1CFPA 1N65A 1F4QA 2WCLA 1J55A 1UHNA 2MHHA 3BUNB 4GFTA 4NDCA 2AAOA 1QS7A 2BE6A 1G8IA 1A29A 1KQVA 3CGAA 1CFCA 2BL0C 2M8UA 1FPWA 4ZCUA 3N7HA 4C0KA 2ZFDA 1OMVA 2HQWA 3TUYC 2PYQA 1KFUS 2KLEA 1AUIB 1J7OA 2L50A 2L4IA 3FE8A 1IQ5A 4MZKA 5KSZA 1XO5A 2COLB 2M1UA 4MN0A 2CNPA 5KU1A 1CLBA 1XFXO 2PRUA 2Q4UA 5CSFA 1SSEB 3JVTC 3BQ3A 1JC2A 3DD4A 2OPOA 1WY9A 2P70A 3FIAA 1WRKA 3CZ1A 2JTTA 1CB1A 1CLLA 2E30A 1OQPA 2BNXA 1M45A 4M2QA 4YBHB 5CSIA 5DKNA 2ZNDA 2PQLA 1M63B 2ZN9A 4JPZB 4CPVA 2BKIB 4N1FA 2KYCA 3C1VA 3D0YB 2NXQA 1AP4A 1FBVA 4PALA 3ZWHA 1YVLA 4N5XA 3R1OA 4PE4A 2JTZA 1L2OC 5FI7A 1SCVA 1QATA 1SBJA 2GGZA 3DVMA 3I5GB 3ZNIA 1CM1A 1SMGA 1YUUA 2KHNA 3PFVA 1SY9A 3D76A 2CT9A 1QJTA 1QX5B 4JWQA 1YR5A 1FW4A 4MEWA 2L5YA 1U5IA 1WLMA 3CZ2A 2K7OA 1DVIA 1CNPA 2FCDA 1J7QA 1NUBA 2KFGA 1K95A 3NHTA 1QLKA 1DEKA 1M46A 1QV1A 3EK7A 3SIAA 2WCMA 1TNPA 1OZOA 3S0GA 3CYZA 2I94A 4GGNA 3BOWB 5CSNA 1N2DA 3EVRA 3LCPC 3CABA 1TUJA 4A4CA 1RJVA 1QLSA 1IJ5A 4Q04A 1CKKA 1GM0A 1MF8B 4YGAA 1QX7A 4MSPA 2JC2A 1FI5A 2EGDA 4OVNF 1W7JB 2LMVA 1QWVA 1ZFSA 5AFPA 2Y4QA 1DF0A 1IGVA 1S1EA 2JPTA 1JUOA 4QJ5B 4GGFC 1JWDA 2KSPA 2NZ0A 1ALVA 1EJ3A 3ICBA 3VRQA 3AKBA 3RLZA 4P2YB 4NQGA 1JBAA 1TIZA 1KQMB 1X02A 2JPOA 3GK1A 1SL7A 2FCEA 3OB1B 3I5GC 1Y6WA 1YVHA 5HKYA 2JNXA 4PHNA 1JFJA 2K61A 2KAVA 1DJXA 2QEVA 5JOLA 2YGUA 5BPJA 2JRFA 2WCFA 1XVJA 2KOTA 1XFZO 2KAYA 2LUXA 1PVAA 3KF9A 1DGVA 4P5OE 1YRUB 5KTYA 1PSRA 2WC5A 3DF0A 3EVVA 1G33A 1CLMA 1N0YA 2MRDA 1QIVA 3CR4X 3SS5A 4MZJA 2G2BA 3EVUA 4MLWA 2H61C 1F71A 2LVJA 3VRRA 2KDHA 2MAZA 1DT7B 3CLNA 2DOQA 5EL2A 1YTZC 3KEVA 1SW8A 4DCKA 3O6BA 4JQ0D 4KYNA 2ZKMX 2CXJA 3TDUA 3NSLA 2HF5A 1XFWO 2E6WA 1AK8A 4HRHA 1V1FA 1IWQA 2M9GA 3WNXB 3BUWB 1BR1B 3NSIA 2JT0A 3CZTX 3BUMB 3QMEA 4DRWA 1XYDA 2QPTA 4R1EA 5ER5A 2M7NA 4PT1A 5B8IB 1XA5A 3S0DA 2BE4A 1TRFA 5AEQA 3B86A 2GGMA 5FI6A 1KQMC 3CTNA 5TNCA 4TNCA 3CR5X 2KLDA 4ICBA 2M3WA 2B1UA 4CFQA 2P6BB 3BFAA 1BU3A 1L7ZA 1DJIA 4YGDB 2LVIA 3WHUB 1DTLA 1S6JA 1U5IB 3PALA 1F70A 2K7BA 5CSJA 2NLNA 4MVFA 3EK4A 1BODA 3CR2A 3BJHA 1C3ZA 2BBMA 2WNDA 1GQMA 1B9AA 1S6IA 1Y1UA 2KFHA 4YGCB 1KCYA 2K7DA 4PDZA 1YX8A 2AMIA 3SIBA 1J7RA 4DIRA 1LA3A 3BUOB 1TCFA 3B6XA 1ZACA 1PALA 4WRIA 3LLEA
chains in the Genus database with same CATH topology
2QACA 1GGZA 4ORAB 2MLFC 5I2OA 1KSMA 1S36A 3IF7A 1E8AA 4FQOA 4YRUA 1S3PA 1KWOB 1DF0B 1EG4A 3BYAA 1MWNA 1XFVO 1YUSA 1CMGA 2RGIA 3PSRA 4FTGA 4PHMA 1H8BA 2M97A 2KYFA 1SCMB 2JZIA 1S5GZ 2KQYA 2Y1NA 3I5FB 2LUCA 2KBMA 2HQ8A 1MR8A 3NXAA 1WLZA 1AJ4A 1WDCB 1BT6A 2MBXA 1RFJA 3PM8A 1B1GA 2KGBC 2AUCA 4GUKA 1H4BA 3O4YA 1DMOA 3IQOA 3PN7B 1NSHA 3DF0B 4PHJA 4I5JA 2KI4B 1K93D 1QASA 3PATA 3K21A 2LCPA 2LAPA 4N1GA 1NX3A 4C0LA 2O60A 1Q80A 2PALA 1UWOA 2K2AA 1M31A 4M2PA 1S5GY 2JT8A 1IRJA 4OCIA 1KWOC 1ZOTB 2JNFA 4WQ2A 1NWDA 4F0ZB 3AAKA 1NX1A 1A75A 1OSAA 2KNEA 4D1EA 1SCMC 2O5GA 4E68A 3FWCA 2EHBA 3I5FC 3LK0A 3I5HB 1OOJA 1SK6D 2M49B 3KO0A 1UURA 4QJ4B 3VRPA 1K9UA 1WDCC 1A4PA 2NCPA 4CLNA 2KBIA 2WORA 3PLFB 1CDPA 1LXFC 1TN4A 1MHOA 2K8MB 2LMTA 3DVKA 4UPGA 3KPXA 3KHEA 3PN7C 2L2EA 1NYAA 1EG3A 2KI4C 1XK4A 3EKHA 1B8LA 4WQ3A 3SG3A 2HPSA 1CDMA 1KFUL 1VRKA 5AANA 2LMUA 3IQQA 2ZRSA 1LINA 3OB2B 4MZLA 2Q91A 5D7FA 1OE9B 1BJFA 1JF2A 2OS8B 1KK7Z 1GJYA 1DJHA 3MSEB 4XJKA 3TDZA 1EXRA 3H4SE 4CIDA 2L0PA 1HQVA 1TCOB 1J7PA 1PULA 1B8RA 3AKAA 2OTGB 1DJGA 1RTP1 2IS9A 2H2KA 5G08A 1K94A 4ORCB 3TDIA 3I5HC 1C7VA 2F2PA 1K9KA 1NCXA 2PSRA 1CDNA 1KFXS 5DKQA 1S26D 2BCXA 1PVBA 1CFFA 1IQ3A 3DVJA 3TS5B 2F33A 3BXKA 3GOFA 4OR9B 1SKTA 1PK0D 5HKWA 1KK7Y 1OMDA 3AAJA 4GPLB 2V53A 1DJZA 2F3ZA 5F6TA 2A4JA 5ER4X 3EK8A 2LHLA 3CS1A 3NSKA 3DVEA 2ISDA 3SG2A 1J1EA 4M2OA 1SR6B 1TNXA 1TTXA 1QVIY 2NCOA 4AQJA 2CTNA 1K2HA 2LLTA 5HKZA 2GV5A 2OS8C 1YX7A 1K90D 3HX4A 1G4YR 2KI6C 3O2PA 1JF0A 2SASA 3GK4X 2KQ6A 1DJYA 5K89A 1A75B 2OTGC 1LA0A 4CFRA 3I5IB 2PVBA 1OZSA 4BY4A 5I2QA 1CMFA 3RM1A 1SL8A 1ZUZA 2WOSA 1C07A 1D1OA 2LVVA 1IG5A 5HLOA 2JULA 5PALA 2LLUA 2MA2A 3WHTB 2FJUB 3WXAA 4A4BA 3TS5C 1B4CA 2M7LA 1AJ5A 2I2RE 4HREE 1XFYO 5I8NA 1J1DA 1QTXA 2LLSA 3F45A 4YI9A 4OV2A 1ALWA 4GNKB 3EKJA 1Y0VH 3LL8B 1B8CA 4PE1A 4PHKA 4OKHA 4C0JA 2LHIA 2Y1MA 3OX6A 1NCZA 1QXPA 1SR6C 3HCMA 4XYNA 1DJWA 1K96A 1K9PA 1PRWA 3D10A 3VROA 4AOMA 4U8DA 1R2UA 3M0WA 2BBNA 1AVSA 1NX0A 4XJKB 5HYDA 3BUXB 5I2LA 4MRYA 1CFDA 5DKRA 1NCYA 2LNKA 1NPQA 2BECA 2JXLA 2D8NA 1QV0A 2F3YA 1YURA 1SPYA 4QJ3B 2LANA 2F2OA 1KFXL 4IL1A 1B7TZ 3I5IC 4YGBB 4DUQA 2MLEC 1DGUA 1MQ1A 2JT3A 1FI6A 1FF1A 1F4OA 3FWBA 1NX2A 4DS7A 1EL4A 1Y1XA 2K2FA 2BKHB 1SNLA 3SG6A 3JTDB 1OMRA 4NDDA 1YRTB 2LE9B 2L5XB 1JFKA 2WCBA 1K8UA 2CCMA 2LC5A 2JU0A 2PASA 3QRXA 1WRZA 2M0RA 1CDLA 1ZMZA 1XK4C 3E3RA 1UHJA 5JJGA 5D69A 2LM5A 2TN4A 2ZNEA 1TOPA 4ZCVA 4BY5A 1TNWA 4AQIA 2M1KB 1V1GA 4ORBB 1LVCD 2KGRA 1BG1A 5IBWA 2EC6B 2G9BA 1B7TY 5CPVA 1JSAA 1NIWA 2K7CA 3VGOA 1BR4B 1UP5A 1IKUA 5AERA 4MBEA 2PMYA 3OP0A 3OX5A 3FS7A 1UHHA 2L98A 2VRGA 1LKJA 2K0JA 3LK1A 5AXIA 1WRLA 1QX2A 3SG5A 1MXEA 4GBAA 4YGEB 1RK9A 1KK8B 2JWWA 1YUTA 4PE7A 5HLVA 2M29A 3OHMB 1QVIZ 1UHKA 4I5LB 1B47A 1TNQA 3JTDC 2KAXA 2ZN8A 4HRGA 1CM4A 1BOCA 5J3XA 1Y1AA 2JXCA 2KFFA 4GAOA 4GGFA 1IH0A 1W7IB 3D0YA 2SCPA 4HSZA 5FYXA 1BLQA 1SYMA 3SJSA 1C7WA 4ETOA 1F55A 3TZ1A 1PSBA 3SG4A 2LP3A 1AHRA 2EC6C 2WC8A 4YI8A 5GQQC 4PCWA 2I7AA 2ZRTA 1RECA 1M39A 2JOJA 2WCEA 1GGWA 2L51A 2F8PA 2BL0B 3A8RA 1A03A 1S6CA 1RROA 2R2IA 1BF5A 3TUYB 3CWGA 2BCBA 2FOTA 4L9MA 1RWYA 2CBLA 1NP8A 2H61A 3O78A 1MUXA 1IJ6A 2KI6D 3BOWA 1F54A 2JQ6A 2Y5IA 2L4HA 4MRXA 1BMOA 1KK8C 2LVKA 2I18A 1SRAA 3JVTB 2LP2A 3VRNA 1QIWA 1F8HA 1SL9A 4PE0A 1HT9A 3A4UB 1XFUO 1KSOA 4I5KA 3SG7A 1R6PA 1MXLC 4USLA 1ODBA 2HETA 2LV7A 3NSOA 4I5NB 3GK2A 1CTRA 4NDBA 1EH2A 1UUSA 2BCAA 2MJWB 1UHIA 1A2XA 1L2OB 1CFPA 1N65A 1F4QA 1J55A 1UHNA 2MHHA 3BUNB 4GFTA 4NDCA 2AAOA 1QS7A 2BE6A 1G8IA 1A29A 1KQVA 3CGAA 1CFCA 2BL0C 2M8UA 1FPWA 4ZCUA 4C0KA 2ZFDA 1OMVA 2HQWA 3TUYC 1KFUS 1AUIB 1J7OA 2L50A 2L4IA 1IQ5A 4MZKA 5KSZA 1XO5A 2COLB 2M1UA 4MN0A 2CNPA 5KU1A 1CLBA 1XFXO 2PRUA 2Q4UA 5CSFA 3JVTC 3BQ3A 1JC2A 3DD4A 2OPOA 1WY9A 3FIAA 1WRKA 2JTTA 1CB1A 1CLLA 2E30A 1OQPA 4M2QA 1M45A 4YBHB 5CSIA 5DKNA 2ZNDA 2ZN9A 1M63B 4JPZB 4CPVA 2BKIB 4N1FA 2KYCA 3C1VA 3D0YB 2NXQA 1AP4A 1FBVA 4PALA 3ZWHA 1YVLA 4N5XA 4PE4A 2JTZA 1L2OC 1SCVA 1QATA 1SBJA 2GGZA 3DVMA 3I5GB 3ZNIA 1CM1A 1SMGA 1YUUA 2KHNA 3PFVA 1SY9A 4JWQA 2CT9A 1QJTA 1QX5B 1YR5A 1FW4A 4MEWA 1U5IA 1WLMA 2K7OA 1DVIA 1CNPA 2FCDA 1J7QA 1NUBA 2KFGA 1K95A 1QLKA 1M46A 1QV1A 3EK7A 3SIAA 1TNPA 1OZOA 2I94A 4GGNA 3BOWB 5CSNA 1N2DA 3EVRA 3LCPC 4A4CA 1RJVA 1QLSA 1IJ5A 4Q04A 1CKKA 1MF8B 4YGAA 1QX7A 4MSPA 2JC2A 1FI5A 2EGDA 4OVNF 1W7JB 2LMVA 1ZFSA 5AFPA 2Y4QA 1DF0A 1IGVA 1S1EA 2JPTA 1JUOA 4QJ5B 4GGFC 1JWDA 2KSPA 2NZ0A 1ALVA 1EJ3A 3ICBA 3VRQA 3AKBA 3RLZA 4P2YB 4NQGA 1JBAA 1TIZA 1KQMB 1X02A 3GK1A 1SL7A 2FCEA 3OB1B 3I5GC 1Y6WA 1YVHA 5HKYA 2JNXA 4PHNA 1JFJA 2K61A 2KAVA 1DJXA 5JOLA 5BPJA 2JRFA 2WCFA 1XVJA 2KOTA 1XFZO 2KAYA 2LUXA 1PVAA 3KF9A 1DGVA 4P5OE 1YRUB 5KTYA 1PSRA 3DF0A 3EVVA 1G33A 1CLMA 1N0YA 2MRDA 1QIVA 3CR4X 4MZJA 2G2BA 3EVUA 4MLWA 2H61C 1F71A 2LVJA 3VRRA 2KDHA 2MAZA 1DT7B 3CLNA 2DOQA 1YTZC 3KEVA 1SW8A 4DCKA 3O6BA 4JQ0D 2ZKMX 2CXJA 3TDUA 3NSLA 2HF5A 1XFWO 2E6WA 1AK8A 4HRHA 1V1FA 1IWQA 2M9GA 3WNXB 3BUWB 1BR1B 3NSIA 2JT0A 3CZTX 3BUMB 4DRWA 1XYDA 2QPTA 4R1EA 5ER5A 2M7NA 5B8IB 1XA5A 2BE4A 1TRFA 5AEQA 2GGMA 1KQMC 3CTNA 5TNCA 4TNCA 3CR5X 4ICBA 2M3WA 2B1UA 4CFQA 2P6BB 1BU3A 1L7ZA 1DJIA 4YGDB 2LVIA 3WHUB 1DTLA 1S6JA 1U5IB 3PALA 1F70A 2K7BA 5CSJA 2NLNA 4MVFA 3EK4A 1BODA 3CR2A 2BBMA 2WNDA 1GQMA 1B9AA 1S6IA 1Y1UA 2KFHA 4YGCB 1KCYA 2K7DA 4PDZA 1YX8A 2AMIA 3SIBA 1J7RA 4DIRA 1LA3A 3BUOB 1TCFA 1ZACA 1PALA 4WRIA 3LLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAC A;  1GGZ A;  4ORA B;  2MLF C;  5I2O A;  1KSM A;  1S36 A;  3IF7 A;  1E8A A;  4FQO A;  4YRU A;  1S3P A;  1KWO B;  1DF0 B;  1EG4 A;  3BYA A;  1MWN A;  1XFV O;  1YUS A;  1CMG A;  2RGI A;  3PSR A;  4FTG A;  4PHM A;  1H8B A;  2M97 A;  2KYF A;  1SCM B;  2JZI A;  1S5G Z;  2KQY A;  2Y1N A;  3I5F B;  2LUC A;  2KBM A;  2HQ8 A;  1MR8 A;  3NXA A;  1WLZ A;  1AJ4 A;  1WDC B;  1BT6 A;  2MBX A;  1RFJ A;  3PM8 A;  1B1G A;  2KGB C;  2AUC A;  4GUK A;  1H4B A;  3O4Y A;  1DMO A;  3IQO A;  3PN7 B;  1NSH A;  3DF0 B;  4PHJ A;  4I5J A;  2KI4 B;  1K93 D;  1QAS A;  3PAT A;  3K21 A;  2LCP A;  2LAP A;  4N1G A;  1NX3 A;  4C0L A;  2O60 A;  1Q80 A;  2PAL A;  1UWO A;  2K2A A;  1M31 A;  4M2P A;  1S5G Y;  2JT8 A;  1IRJ A;  4OCI A;  1KWO C;  1ZOT B;  2JNF A;  4WQ2 A;  1NWD A;  4F0Z B;  3AAK A;  1NX1 A;  1A75 A;  1OSA A;  2KNE A;  4D1E A;  1SCM C;  2O5G A;  4E68 A;  3FWC A;  2EHB A;  3I5F C;  3LK0 A;  3I5H B;  1OOJ A;  1SK6 D;  2M49 B;  3KO0 A;  1UUR A;  4QJ4 B;  3VRP A;  1K9U A;  1WDC C;  1A4P A;  2NCP A;  4CLN A;  2KBI A;  2WOR A;  3PLF B;  1CDP A;  1LXF C;  1TN4 A;  1MHO A;  2K8M B;  2LMT A;  3DVK A;  4UPG A;  3KPX A;  3KHE A;  3PN7 C;  2L2E A;  1NYA A;  1EG3 A;  2KI4 C;  1XK4 A;  3EKH A;  1B8L A;  4WQ3 A;  3SG3 A;  2HPS A;  1CDM A;  1KFU L;  1VRK A;  5AAN A;  2LMU A;  3IQQ A;  2ZRS A;  1LIN A;  3OB2 B;  4MZL A;  2Q91 A;  5D7F A;  1OE9 B;  1BJF A;  1JF2 A;  2OS8 B;  1KK7 Z;  1GJY A;  1DJH A;  3MSE B;  4XJK A;  3TDZ A;  1EXR A;  3H4S E;  4CID A;  2L0P A;  1HQV A;  1TCO B;  1J7P A;  1PUL A;  1B8R A;  3AKA A;  2OTG B;  1DJG A;  1RTP 1;  2IS9 A;  2H2K A;  5G08 A;  1K94 A;  4ORC B;  3TDI A;  3I5H C;  1C7V A;  2F2P A;  1K9K A;  1NCX A;  2PSR A;  1CDN A;  1KFX S;  5DKQ A;  1S26 D;  2BCX A;  1PVB A;  1CFF A;  1IQ3 A;  3DVJ A;  3TS5 B;  2F33 A;  3BXK A;  3GOF A;  4OR9 B;  1SKT A;  1PK0 D;  5HKW A;  1KK7 Y;  1OMD A;  3AAJ A;  4GPL B;  2V53 A;  1DJZ A;  2F3Z A;  5F6T A;  2A4J A;  5ER4 X;  3EK8 A;  2LHL A;  3CS1 A;  3NSK A;  3DVE A;  2ISD A;  3SG2 A;  1J1E A;  4M2O A;  1SR6 B;  1TNX A;  1TTX A;  1QVI Y;  2NCO A;  4AQJ A;  2CTN A;  1K2H A;  2LLT A;  5HKZ A;  2GV5 A;  2OS8 C;  1YX7 A;  1K90 D;  3HX4 A;  1G4Y R;  2KI6 C;  3O2P A;  1JF0 A;  2SAS A;  3GK4 X;  2KQ6 A;  1DJY A;  5K89 A;  1A75 B;  2OTG C;  1LA0 A;  4CFR A;  3I5I B;  2PVB A;  1OZS A;  4BY4 A;  5I2Q A;  1CMF A;  3RM1 A;  1SL8 A;  1ZUZ A;  2WOS A;  1C07 A;  1D1O A;  2LVV A;  1IG5 A;  5HLO A;  2JUL A;  5PAL A;  2LLU A;  2MA2 A;  3WHT B;  2FJU B;  3WXA A;  4A4B A;  3TS5 C;  1B4C A;  2M7L A;  1AJ5 A;  2I2R E;  4HRE E;  1XFY O;  5I8N A;  1J1D A;  1QTX A;  2LLS A;  3F45 A;  4YI9 A;  4OV2 A;  1ALW A;  4GNK B;  3EKJ A;  1Y0V H;  3LL8 B;  1B8C A;  4PE1 A;  4PHK A;  4OKH A;  4C0J A;  2LHI A;  2Y1M A;  3OX6 A;  1NCZ A;  1QXP A;  1SR6 C;  3HCM A;  4XYN A;  1DJW A;  1K96 A;  1K9P A;  1PRW A;  3D10 A;  3VRO A;  4AOM A;  4U8D A;  1R2U A;  3M0W A;  2BBN A;  1AVS A;  1NX0 A;  4XJK B;  5HYD A;  3BUX B;  5I2L A;  4MRY A;  1CFD A;  5DKR A;  1NCY A;  2LNK A;  1NPQ A;  2BEC A;  2JXL A;  2D8N A;  1QV0 A;  2F3Y A;  1YUR A;  1SPY A;  4QJ3 B;  2LAN A;  2F2O A;  1KFX L;  4IL1 A;  1B7T Z;  3I5I C;  4YGB B;  4DUQ A;  2MLE C;  1DGU A;  1MQ1 A;  2JT3 A;  1FI6 A;  1FF1 A;  1F4O A;  3FWB A;  1NX2 A;  4DS7 A;  1EL4 A;  1Y1X A;  2K2F A;  2BKH B;  1SNL A;  3SG6 A;  3JTD B;  1OMR A;  4NDD A;  1YRT B;  2LE9 B;  2L5X B;  1JFK A;  2WCB A;  1K8U A;  2CCM A;  2LC5 A;  2JU0 A;  2PAS A;  3QRX A;  1WRZ A;  2M0R A;  1CDL A;  1ZMZ A;  1XK4 C;  3E3R A;  1UHJ A;  5JJG A;  5D69 A;  2LM5 A;  2TN4 A;  2ZNE A;  1TOP A;  4ZCV A;  4BY5 A;  1TNW A;  4AQI A;  2M1K B;  1V1G A;  4ORB B;  1LVC D;  2KGR A;  1BG1 A;  5IBW A;  2EC6 B;  2G9B A;  1B7T Y;  5CPV A;  1JSA A;  1NIW A;  2K7C A;  3VGO A;  1BR4 B;  1UP5 A;  1IKU A;  5AER A;  4MBE A;  2PMY A;  3OP0 A;  3OX5 A;  3FS7 A;  1UHH A;  2L98 A;  2VRG A;  1LKJ A;  2K0J A;  3LK1 A;  5AXI A;  1WRL A;  1QX2 A;  3SG5 A;  1MXE A;  4GBA A;  4YGE B;  1RK9 A;  1KK8 B;  2JWW A;  1YUT A;  4PE7 A;  5HLV A;  2M29 A;  3OHM B;  1QVI Z;  1UHK A;  4I5L B;  1B47 A;  1TNQ A;  3JTD C;  2KAX A;  2ZN8 A;  4HRG A;  1CM4 A;  1BOC A;  5J3X A;  1Y1A A;  2JXC A;  2KFF A;  4GAO A;  4GGF A;  1IH0 A;  1W7I B;  3D0Y A;  2SCP A;  4HSZ A;  5FYX A;  1BLQ A;  1SYM A;  3SJS A;  1C7W A;  4ETO A;  1F55 A;  3TZ1 A;  1PSB A;  3SG4 A;  2LP3 A;  1AHR A;  2EC6 C;  2WC8 A;  4YI8 A;  5GQQ C;  4PCW A;  2I7A A;  2ZRT A;  1REC A;  1M39 A;  2JOJ A;  2WCE A;  1GGW A;  2L51 A;  2F8P A;  2BL0 B;  3A8R A;  1A03 A;  1S6C A;  1RRO A;  2R2I A;  1BF5 A;  3TUY B;  3CWG A;  2BCB A;  2FOT A;  4L9M A;  1RWY A;  2CBL A;  1NP8 A;  2H61 A;  3O78 A;  1MUX A;  1IJ6 A;  2KI6 D;  3BOW A;  1F54 A;  2JQ6 A;  2Y5I A;  2L4H A;  4MRX A;  1BMO A;  1KK8 C;  2LVK A;  2I18 A;  1SRA A;  3JVT B;  2LP2 A;  3VRN A;  1QIW A;  1F8H A;  1SL9 A;  4PE0 A;  1HT9 A;  3A4U B;  1XFU O;  1KSO A;  4I5K A;  3SG7 A;  1R6P A;  1MXL C;  4USL A;  1ODB A;  2HET A;  2LV7 A;  3NSO A;  4I5N B;  3GK2 A;  1CTR A;  4NDB A;  1EH2 A;  1UUS A;  2BCA A;  2MJW B;  1UHI A;  1A2X A;  1L2O B;  1CFP A;  1N65 A;  1F4Q A;  1J55 A;  1UHN A;  2MHH A;  3BUN B;  4GFT A;  4NDC A;  2AAO A;  1QS7 A;  2BE6 A;  1G8I A;  1A29 A;  1KQV A;  3CGA A;  1CFC A;  2BL0 C;  2M8U A;  1FPW A;  4ZCU A;  4C0K A;  2ZFD A;  1OMV A;  2HQW A;  3TUY C;  1KFU S;  1AUI B;  1J7O A;  2L50 A;  2L4I A;  1IQ5 A;  4MZK A;  5KSZ A;  1XO5 A;  2COL B;  2M1U A;  4MN0 A;  2CNP A;  5KU1 A;  1CLB A;  1XFX O;  2PRU A;  2Q4U A;  5CSF A;  3JVT C;  3BQ3 A;  1JC2 A;  3DD4 A;  2OPO A;  1WY9 A;  3FIA A;  1WRK A;  2JTT A;  1CB1 A;  1CLL A;  2E30 A;  1OQP A;  4M2Q A;  1M45 A;  4YBH B;  5CSI A;  5DKN A;  2ZND A;  2ZN9 A;  1M63 B;  4JPZ B;  4CPV A;  2BKI B;  4N1F A;  2KYC A;  3C1V A;  3D0Y B;  2NXQ A;  1AP4 A;  1FBV A;  4PAL A;  3ZWH A;  1YVL A;  4N5X A;  4PE4 A;  2JTZ A;  1L2O C;  1SCV A;  1QAT A;  1SBJ A;  2GGZ A;  3DVM A;  3I5G B;  3ZNI A;  1CM1 A;  1SMG A;  1YUU A;  2KHN A;  3PFV A;  1SY9 A;  4JWQ A;  2CT9 A;  1QJT A;  1QX5 B;  1YR5 A;  1FW4 A;  4MEW A;  1U5I A;  1WLM A;  2K7O A;  1DVI A;  1CNP A;  2FCD A;  1J7Q A;  1NUB A;  2KFG A;  1K95 A;  1QLK A;  1M46 A;  1QV1 A;  3EK7 A;  3SIA A;  1TNP A;  1OZO A;  2I94 A;  4GGN A;  3BOW B;  5CSN A;  1N2D A;  3EVR A;  3LCP C;  4A4C A;  1RJV A;  1QLS A;  1IJ5 A;  4Q04 A;  1CKK A;  1MF8 B;  4YGA A;  1QX7 A;  4MSP A;  2JC2 A;  1FI5 A;  2EGD A;  4OVN F;  1W7J B;  2LMV A;  1ZFS A;  5AFP A;  2Y4Q A;  1DF0 A;  1IGV A;  1S1E A;  2JPT A;  1JUO A;  4QJ5 B;  4GGF C;  1JWD A;  2KSP A;  2NZ0 A;  1ALV A;  1EJ3 A;  3ICB A;  3VRQ A;  3AKB A;  3RLZ A;  4P2Y B;  4NQG A;  1JBA A;  1TIZ A;  1KQM B;  1X02 A;  3GK1 A;  1SL7 A;  2FCE A;  3OB1 B;  3I5G C;  1Y6W A;  1YVH A;  5HKY A;  2JNX A;  4PHN A;  1JFJ A;  2K61 A;  2KAV A;  1DJX A;  5JOL A;  5BPJ A;  2JRF A;  2WCF A;  1XVJ A;  2KOT A;  1XFZ O;  2KAY A;  2LUX A;  1PVA A;  3KF9 A;  1DGV A;  4P5O E;  1YRU B;  5KTY A;  1PSR A;  3DF0 A;  3EVV A;  1G33 A;  1CLM A;  1N0Y A;  2MRD A;  1QIV A;  3CR4 X;  4MZJ A;  2G2B A;  3EVU A;  4MLW A;  2H61 C;  1F71 A;  2LVJ A;  3VRR A;  2KDH A;  2MAZ A;  1DT7 B;  3CLN A;  2DOQ A;  1YTZ C;  3KEV A;  1SW8 A;  4DCK A;  3O6B A;  4JQ0 D;  2ZKM X;  2CXJ A;  3TDU A;  3NSL A;  2HF5 A;  1XFW O;  2E6W A;  1AK8 A;  4HRH A;  1V1F A;  1IWQ A;  2M9G A;  3WNX B;  3BUW B;  1BR1 B;  3NSI A;  2JT0 A;  3CZT X;  3BUM B;  4DRW A;  1XYD A;  2QPT A;  4R1E A;  5ER5 A;  2M7N A;  5B8I B;  1XA5 A;  2BE4 A;  1TRF A;  5AEQ A;  2GGM A;  1KQM C;  3CTN A;  5TNC A;  4TNC A;  3CR5 X;  4ICB A;  2M3W A;  2B1U A;  4CFQ A;  2P6B B;  1BU3 A;  1L7Z A;  1DJI A;  4YGD B;  2LVI A;  3WHU B;  1DTL A;  1S6J A;  1U5I B;  3PAL A;  1F70 A;  2K7B A;  5CSJ A;  2NLN A;  4MVF A;  3EK4 A;  1BOD A;  3CR2 A;  2BBM A;  2WND A;  1GQM A;  1B9A A;  1S6I A;  1Y1U A;  2KFH A;  4YGC B;  1KCY A;  2K7D A;  4PDZ A;  1YX8 A;  2AMI A;  3SIB A;  1J7R A;  4DIR A;  1LA3 A;  3BUO B;  1TCF A;  1ZAC A;  1PAL A;  4WRI A;  3LLE A; 
#chains in the Genus database with same CATH topology
 2QAC A;  1GGZ A;  4ORA B;  2MLF C;  5I2O A;  1KSM A;  1S36 A;  3IF7 A;  1E8A A;  4FQO A;  4YRU A;  1S3P A;  3SS3 A;  1KWO B;  1DF0 B;  1EG4 A;  2QEB A;  1MWN A;  1XFV O;  1YUS A;  3BYA A;  3DXL A;  1CMG A;  2RGI A;  2L2C A;  3PSR A;  4FTG A;  4PHM A;  1H8B A;  2M97 A;  2KYF A;  1SCM B;  2JZI A;  1S5G Z;  2KQY A;  2Y1N A;  3I5F B;  2LUC A;  2KBM A;  2HQ8 A;  1MR8 A;  3NXA A;  1WLZ A;  1AJ4 A;  1WDC B;  1BT6 A;  2MBX A;  1RFJ A;  3PM8 A;  1B1G A;  2KGB C;  1OW4 A;  2AUC A;  4GUK A;  1H4B A;  3O4Y A;  1DMO A;  3IQO A;  3PN7 B;  1NSH A;  3DF0 B;  4PHJ A;  4I5J A;  2KI4 B;  1K93 D;  1QAS A;  3PAT A;  5DIC A;  3K21 A;  2LCP A;  3UNW A;  2LAP A;  4N1G A;  1NX3 A;  4C0L A;  2O60 A;  1Q80 A;  2PAL A;  3PM2 A;  1UWO A;  2K2A A;  2QDI A;  1M31 A;  4M2P A;  1S5G Y;  2JT8 A;  3L4A A;  1IRJ A;  4OCI A;  3R72 A;  1KWO C;  1ZOT B;  2KPH A;  2JNF A;  4WQ2 A;  1NWD A;  4F0Z B;  3AAK A;  3D74 A;  1NX1 A;  1A75 A;  1OSA A;  2KNE A;  4D1E A;  1SCM C;  2O5G A;  4E68 A;  3FWC A;  2EHB A;  3DYE A;  3I5F C;  3LK0 A;  3UO9 A;  3I5H B;  1OOJ A;  1SK6 D;  2M49 B;  5FI2 A;  3KO0 A;  1UUR A;  4QJ4 B;  3VRP A;  1K9U A;  1WDC C;  2H8V A;  1A4P A;  2NCP A;  4CLN A;  2KBI A;  2WOR A;  3PLF B;  1CDP A;  1T14 A;  1LXF C;  1TN4 A;  1MHO A;  2K8M B;  2LMT A;  3DVK A;  4UPG A;  3KPX A;  3KHE A;  3PN7 C;  2L2E A;  1NYA A;  1EG3 A;  4INX A;  3IVT A;  1P28 A;  1XK4 A;  2KI4 C;  1B8L A;  3EKH A;  4WQ3 A;  3SG3 A;  3VB1 A;  3D75 A;  2HPS A;  1CDM A;  1KFU L;  1VRK A;  5AAN A;  3NHI A;  2LMU A;  3IQQ A;  2ZRS A;  1LIN A;  3OB2 B;  4MZL A;  2FJY A;  2Q91 A;  5D7F A;  1OE9 B;  1BJF A;  1JF2 A;  3S0A A;  2OS8 B;  1KK7 Z;  1GJY A;  1DJH A;  3MSE B;  4XJK A;  3TDZ A;  1EXR A;  2P71 A;  3H4S E;  4CID A;  2L0P A;  1HQV A;  1TCO B;  1J7P A;  1PUL A;  1C3Y A;  1B8R A;  3AKA A;  2OTG B;  1DJG A;  1RTP 1;  2IS9 A;  2H2K A;  5G08 A;  1K94 A;  4ORC B;  3TDI A;  3I5H C;  1C7V A;  2F2P A;  1OOF A;  1K9K A;  1NCX A;  2PSR A;  3S0F A;  1CDN A;  1KFX S;  1ORG A;  5DKQ A;  1S26 D;  2BCX A;  1PVB A;  1CFF A;  1IQ3 A;  3DVJ A;  3TS5 B;  5HL1 A;  2F33 A;  3BXK A;  3GOF A;  4OR9 B;  1SKT A;  1PK0 D;  5HKW A;  1KK7 Y;  1OMD A;  3AAJ A;  4GPL B;  2V53 A;  1DJZ A;  2F3Z A;  5F6T A;  2A4J A;  5ER4 X;  3EK8 A;  2LHL A;  3CS1 A;  1Z4H A;  3NSK A;  3DVE A;  2ISD A;  4IJ7 A;  3SG2 A;  1J1E A;  4M2O A;  1SR6 B;  1TNX A;  1OOH A;  1QVI Y;  1TTX A;  2NCO A;  4AQJ A;  2CTN A;  3CZ0 A;  4JD9 A;  1K2H A;  2LLT A;  5HKZ A;  2GV5 A;  1OOI X;  2OS8 C;  3EG5 B;  1YX7 A;  3OBV A;  1K90 D;  3HX4 A;  1G4Y R;  2KI6 C;  3O2P A;  1JF0 A;  1W9Z A;  2SAS A;  3GK4 X;  2KQ6 A;  1DJY A;  5K89 A;  1A75 B;  3OGN A;  2OTG C;  1LA0 A;  4CFR A;  3I5I B;  2PVB A;  1OZS A;  4BY4 A;  5I2Q A;  1CMF A;  3Q8I A;  3RM1 A;  1SL8 A;  1ZUZ A;  2WOS A;  1C07 A;  3RZS A;  1D1O A;  2LVV A;  1IG5 A;  3D73 A;  5HLO A;  2JUL A;  5PAL A;  3R1V A;  2LLU A;  2MA2 A;  3WHT B;  2FJU B;  3WXA A;  4A4B A;  3TS5 C;  1TUZ A;  1B4C A;  3K1E A;  2M7L A;  1AJ5 A;  2I2R E;  4HRE E;  1XFY O;  5I8N A;  1J1D A;  1QTX A;  2LLS A;  3F45 A;  3FE9 A;  4YI9 A;  4OV2 A;  1ALW A;  4GNK B;  3EKJ A;  1IIO A;  1Y0V H;  3LL8 B;  1B8C A;  2WCH A;  4PHK A;  4PE1 A;  4OKH A;  4C0J A;  2LHI A;  3FE6 A;  2Y1M A;  3OX6 A;  1NCZ A;  1QXP A;  1SR6 C;  3HCM A;  4XYN A;  1DJW A;  1K96 A;  1K9P A;  1PRW A;  3D10 A;  3VRO A;  4AOM A;  4U8D A;  1R2U A;  3M0W A;  2BBN A;  1AVS A;  1NX0 A;  4XJK B;  5HYD A;  3BUX B;  5I2L A;  4MRY A;  4JKT A;  1CFD A;  3B7A A;  1NCY A;  2LNK A;  1NPQ A;  5DKR A;  2BEC A;  2JXL A;  2D8N A;  3O4X A;  2QEH A;  1QV0 A;  2F3Y A;  1YUR A;  1SPY A;  4QJ3 B;  2LAN A;  2F2O A;  1KFX L;  4IL1 A;  1B7T Z;  3I5I C;  4YGB B;  4DUQ A;  2MLE C;  3DY9 A;  1DGU A;  1MQ1 A;  2JT3 A;  1FI6 A;  3BFH A;  1F4O A;  1FF1 A;  3FWB A;  1NX2 A;  4DS7 A;  1EL4 A;  1Y1X A;  2K2F A;  2BKH B;  1SNL A;  3SG6 A;  3JTD B;  1OMR A;  4NDD A;  1YRT B;  2LE9 B;  2L5X B;  1JFK A;  1DQE A;  2WCB A;  1K8U A;  2CCM A;  2LC5 A;  2JU0 A;  2PAS A;  3QRX A;  1WRZ A;  2M0R A;  1CDL A;  1TWO A;  1XK4 C;  1ZMZ A;  3E3R A;  1UHJ A;  5JJG A;  5D69 A;  2LM5 A;  2TN4 A;  2ZNE A;  3B88 A;  1TOP A;  4ZCV A;  4BY5 A;  1TNW A;  4AQI A;  1DEL A;  1V1G A;  2M1K B;  1LVC D;  2KGR A;  4ORB B;  1BG1 A;  5IBW A;  2EC6 B;  2G9B A;  1B7T Y;  5CPV A;  3R1P A;  3NGV A;  1NIW A;  1JSA A;  2K7C A;  3VGO A;  3L4L A;  1BR4 B;  1UP5 A;  1IKU A;  5AER A;  4MBE A;  2PMY A;  3OP0 A;  3OX5 A;  3FS7 A;  1UHH A;  2L98 A;  2VRG A;  1XFR A;  1LKJ A;  2K0J A;  3LK1 A;  5AXI A;  1WRL A;  4INW A;  1DC1 A;  1QX2 A;  3SG5 A;  3B87 A;  3D78 A;  1MXE A;  4GBA A;  4YGE B;  1RK9 A;  1KK8 B;  2JWW A;  1YUT A;  2WCJ A;  4PE7 A;  5HLV A;  3L47 A;  2WCK A;  2M29 A;  2GTE A;  3OHM B;  1QVI Z;  1UHK A;  3D77 A;  4I5L B;  1B47 A;  1TNQ A;  3JTD C;  3V2L A;  2KAX A;  2ZN8 A;  4HRG A;  1CM4 A;  1BOC A;  5J3X A;  1Y1A A;  2ERB A;  2JXC A;  2KFF A;  3CDN A;  4GAO A;  4GGF A;  3SS4 A;  1IH0 A;  1W7I B;  3D0Y A;  2SCP A;  4HSZ A;  5FYX A;  1BLQ A;  1SYM A;  3SJS A;  1C7W A;  4ETO A;  1F55 A;  3TZ1 A;  1PSB A;  3SG4 A;  2LP3 A;  1AHR A;  2EC6 C;  2WC8 A;  4YI8 A;  5I94 A;  5GQQ C;  4PCW A;  3DZT A;  3PJI A;  2I7A A;  2ZRT A;  1REC A;  1M39 A;  2JOJ A;  2WCE A;  1GGW A;  2L51 A;  2F8P A;  2BL0 B;  2QEO A;  3A8R A;  1A03 A;  1S6C A;  1RRO A;  2R2I A;  1BF5 A;  3BFB A;  3TUY B;  3CWG A;  2BCB A;  2FOT A;  4L9M A;  1RWY A;  1Z2C B;  2CBL A;  1NP8 A;  2H61 A;  3O78 A;  4FQT A;  1MUX A;  1IJ6 A;  2KI6 D;  3BOW A;  1F54 A;  3S0B A;  2JQ6 A;  2Y5I A;  2L4H A;  4MRX A;  1BMO A;  1KK8 C;  1LS8 A;  2I18 A;  1OOG A;  1SRA A;  2LVK A;  2LP2 A;  3JVT B;  1QIW A;  3VRN A;  2K60 A;  3S0E A;  1F8H A;  1SL9 A;  4PE0 A;  1HT9 A;  3A4U B;  1XFU O;  1KSO A;  2WC6 A;  4I5K A;  3SG7 A;  1R6P A;  1MXL C;  4USL A;  1ODB A;  2HET A;  2LV7 A;  3NSO A;  4I5N B;  3GK2 A;  4OZD A;  1CTR A;  2BAP A;  4NDB A;  1UUS A;  2BCA A;  2MJW B;  5D3O A;  1EH2 A;  1UHI A;  1A2X A;  4F7F A;  1L2O B;  1CFP A;  1N65 A;  1F4Q A;  2WCL A;  1J55 A;  1UHN A;  2MHH A;  3BUN B;  4GFT A;  4NDC A;  2AAO A;  1QS7 A;  2BE6 A;  1G8I A;  1A29 A;  1KQV A;  3CGA A;  1CFC A;  2BL0 C;  2M8U A;  1FPW A;  4ZCU A;  3N7H A;  4C0K A;  2ZFD A;  1OMV A;  2HQW A;  3TUY C;  2PYQ A;  1KFU S;  2KLE A;  1AUI B;  1J7O A;  2L50 A;  2L4I A;  3FE8 A;  1IQ5 A;  4MZK A;  5KSZ A;  1XO5 A;  2COL B;  2M1U A;  4MN0 A;  2CNP A;  5KU1 A;  1CLB A;  1XFX O;  2PRU A;  2Q4U A;  5CSF A;  1SSE B;  3JVT C;  3BQ3 A;  1JC2 A;  3DD4 A;  2OPO A;  1WY9 A;  2P70 A;  3FIA A;  1WRK A;  3CZ1 A;  2JTT A;  1CB1 A;  1CLL A;  2E30 A;  1OQP A;  2BNX A;  1M45 A;  4M2Q A;  4YBH B;  5CSI A;  5DKN A;  2ZND A;  2PQL A;  1M63 B;  2ZN9 A;  4JPZ B;  4CPV A;  2BKI B;  4N1F A;  2KYC A;  3C1V A;  3D0Y B;  2NXQ A;  1AP4 A;  1FBV A;  4PAL A;  3ZWH A;  1YVL A;  4N5X A;  3R1O A;  4PE4 A;  2JTZ A;  1L2O C;  5FI7 A;  1SCV A;  1QAT A;  1SBJ A;  2GGZ A;  3DVM A;  3I5G B;  3ZNI A;  1CM1 A;  1SMG A;  1YUU A;  2KHN A;  3PFV A;  1SY9 A;  3D76 A;  2CT9 A;  1QJT A;  1QX5 B;  4JWQ A;  1YR5 A;  1FW4 A;  4MEW A;  2L5Y A;  1U5I A;  1WLM A;  3CZ2 A;  2K7O A;  1DVI A;  1CNP A;  2FCD A;  1J7Q A;  1NUB A;  2KFG A;  1K95 A;  3NHT A;  1QLK A;  1DEK A;  1M46 A;  1QV1 A;  3EK7 A;  3SIA A;  2WCM A;  1TNP A;  1OZO A;  3S0G A;  3CYZ A;  2I94 A;  4GGN A;  3BOW B;  5CSN A;  1N2D A;  3EVR A;  3LCP C;  3CAB A;  1TUJ A;  4A4C A;  1RJV A;  1QLS A;  1IJ5 A;  4Q04 A;  1CKK A;  1GM0 A;  1MF8 B;  4YGA A;  1QX7 A;  4MSP A;  2JC2 A;  1FI5 A;  2EGD A;  4OVN F;  1W7J B;  2LMV A;  1QWV A;  1ZFS A;  5AFP A;  2Y4Q A;  1DF0 A;  1IGV A;  1S1E A;  2JPT A;  1JUO A;  4QJ5 B;  4GGF C;  1JWD A;  2KSP A;  2NZ0 A;  1ALV A;  1EJ3 A;  3ICB A;  3VRQ A;  3AKB A;  3RLZ A;  4P2Y B;  4NQG A;  1JBA A;  1TIZ A;  1KQM B;  1X02 A;  2JPO A;  3GK1 A;  1SL7 A;  2FCE A;  3OB1 B;  3I5G C;  1Y6W A;  1YVH A;  5HKY A;  2JNX A;  4PHN A;  1JFJ A;  2K61 A;  2KAV A;  1DJX A;  2QEV A;  5JOL A;  2YGU A;  5BPJ A;  2JRF A;  2WCF A;  1XVJ A;  2KOT A;  1XFZ O;  2KAY A;  2LUX A;  1PVA A;  3KF9 A;  1DGV A;  4P5O E;  1YRU B;  5KTY A;  1PSR A;  2WC5 A;  3DF0 A;  3EVV A;  1G33 A;  1CLM A;  1N0Y A;  2MRD A;  1QIV A;  3CR4 X;  3SS5 A;  4MZJ A;  2G2B A;  3EVU A;  4MLW A;  2H61 C;  1F71 A;  2LVJ A;  3VRR A;  2KDH A;  2MAZ A;  1DT7 B;  3CLN A;  2DOQ A;  5EL2 A;  1YTZ C;  3KEV A;  1SW8 A;  4DCK A;  3O6B A;  4JQ0 D;  4KYN A;  2ZKM X;  2CXJ A;  3TDU A;  3NSL A;  2HF5 A;  1XFW O;  2E6W A;  1AK8 A;  4HRH A;  1V1F A;  1IWQ A;  2M9G A;  3WNX B;  3BUW B;  1BR1 B;  3NSI A;  2JT0 A;  3CZT X;  3BUM B;  3QME A;  4DRW A;  1XYD A;  2QPT A;  4R1E A;  5ER5 A;  2M7N A;  4PT1 A;  5B8I B;  1XA5 A;  3S0D A;  2BE4 A;  1TRF A;  5AEQ A;  3B86 A;  2GGM A;  5FI6 A;  1KQM C;  3CTN A;  5TNC A;  4TNC A;  3CR5 X;  2KLD A;  4ICB A;  2M3W A;  2B1U A;  4CFQ A;  2P6B B;  3BFA A;  1BU3 A;  1L7Z A;  1DJI A;  4YGD B;  2LVI A;  3WHU B;  1DTL A;  1S6J A;  1U5I B;  3PAL A;  1F70 A;  2K7B A;  5CSJ A;  2NLN A;  4MVF A;  3EK4 A;  1BOD A;  3CR2 A;  3BJH A;  1C3Z A;  2BBM A;  2WND A;  1GQM A;  1B9A A;  1S6I A;  1Y1U A;  2KFH A;  4YGC B;  1KCY A;  2K7D A;  4PDZ A;  1YX8 A;  2AMI A;  3SIB A;  1J7R A;  4DIR A;  1LA3 A;  3BUO B;  1TCF A;  3B6X A;  1ZAC A;  1PAL A;  4WRI A;  3LLE A; 
#chains in the Genus database with same CATH homology
 2QAC A;  1GGZ A;  4ORA B;  2MLF C;  5I2O A;  1KSM A;  1S36 A;  3IF7 A;  1E8A A;  4FQO A;  4YRU A;  1S3P A;  1KWO B;  1DF0 B;  1EG4 A;  3BYA A;  1MWN A;  1XFV O;  1YUS A;  1CMG A;  2RGI A;  3PSR A;  4FTG A;  4PHM A;  1H8B A;  2M97 A;  2KYF A;  1SCM B;  2JZI A;  1S5G Z;  2KQY A;  2Y1N A;  3I5F B;  2LUC A;  2KBM A;  2HQ8 A;  1MR8 A;  3NXA A;  1WLZ A;  1AJ4 A;  1WDC B;  1BT6 A;  2MBX A;  1RFJ A;  3PM8 A;  1B1G A;  2KGB C;  2AUC A;  4GUK A;  1H4B A;  3O4Y A;  1DMO A;  3IQO A;  3PN7 B;  1NSH A;  3DF0 B;  4PHJ A;  4I5J A;  2KI4 B;  1K93 D;  1QAS A;  3PAT A;  3K21 A;  2LCP A;  2LAP A;  4N1G A;  1NX3 A;  4C0L A;  2O60 A;  1Q80 A;  2PAL A;  1UWO A;  2K2A A;  1M31 A;  4M2P A;  1S5G Y;  2JT8 A;  1IRJ A;  4OCI A;  1KWO C;  1ZOT B;  2JNF A;  4WQ2 A;  1NWD A;  4F0Z B;  3AAK A;  1NX1 A;  1A75 A;  1OSA A;  2KNE A;  4D1E A;  1SCM C;  2O5G A;  4E68 A;  3FWC A;  2EHB A;  3I5F C;  3LK0 A;  3I5H B;  1OOJ A;  1SK6 D;  2M49 B;  3KO0 A;  1UUR A;  4QJ4 B;  3VRP A;  1K9U A;  1WDC C;  1A4P A;  2NCP A;  4CLN A;  2KBI A;  2WOR A;  3PLF B;  1CDP A;  1LXF C;  1TN4 A;  1MHO A;  2K8M B;  2LMT A;  3DVK A;  4UPG A;  3KPX A;  3KHE A;  3PN7 C;  2L2E A;  1NYA A;  1EG3 A;  2KI4 C;  1XK4 A;  3EKH A;  1B8L A;  4WQ3 A;  3SG3 A;  2HPS A;  1CDM A;  1KFU L;  1VRK A;  5AAN A;  2LMU A;  3IQQ A;  2ZRS A;  1LIN A;  3OB2 B;  4MZL A;  2Q91 A;  5D7F A;  1OE9 B;  1BJF A;  1JF2 A;  2OS8 B;  1KK7 Z;  1GJY A;  1DJH A;  3MSE B;  4XJK A;  3TDZ A;  1EXR A;  3H4S E;  4CID A;  2L0P A;  1HQV A;  1TCO B;  1J7P A;  1PUL A;  1B8R A;  3AKA A;  2OTG B;  1DJG A;  1RTP 1;  2IS9 A;  2H2K A;  5G08 A;  1K94 A;  4ORC B;  3TDI A;  3I5H C;  1C7V A;  2F2P A;  1K9K A;  1NCX A;  2PSR A;  1CDN A;  1KFX S;  5DKQ A;  1S26 D;  2BCX A;  1PVB A;  1CFF A;  1IQ3 A;  3DVJ A;  3TS5 B;  2F33 A;  3BXK A;  3GOF A;  4OR9 B;  1SKT A;  1PK0 D;  5HKW A;  1KK7 Y;  1OMD A;  3AAJ A;  4GPL B;  2V53 A;  1DJZ A;  2F3Z A;  5F6T A;  2A4J A;  5ER4 X;  3EK8 A;  2LHL A;  3CS1 A;  3NSK A;  3DVE A;  2ISD A;  3SG2 A;  1J1E A;  4M2O A;  1SR6 B;  1TNX A;  1TTX A;  1QVI Y;  2NCO A;  4AQJ A;  2CTN A;  1K2H A;  2LLT A;  5HKZ A;  2GV5 A;  2OS8 C;  1YX7 A;  1K90 D;  3HX4 A;  1G4Y R;  2KI6 C;  3O2P A;  1JF0 A;  2SAS A;  3GK4 X;  2KQ6 A;  1DJY A;  5K89 A;  1A75 B;  2OTG C;  1LA0 A;  4CFR A;  3I5I B;  2PVB A;  1OZS A;  4BY4 A;  5I2Q A;  1CMF A;  3RM1 A;  1SL8 A;  1ZUZ A;  2WOS A;  1C07 A;  1D1O A;  2LVV A;  1IG5 A;  5HLO A;  2JUL A;  5PAL A;  2LLU A;  2MA2 A;  3WHT B;  2FJU B;  3WXA A;  4A4B A;  3TS5 C;  1B4C A;  2M7L A;  1AJ5 A;  2I2R E;  4HRE E;  1XFY O;  5I8N A;  1J1D A;  1QTX A;  2LLS A;  3F45 A;  4YI9 A;  4OV2 A;  1ALW A;  4GNK B;  3EKJ A;  1Y0V H;  3LL8 B;  1B8C A;  4PE1 A;  4PHK A;  4OKH A;  4C0J A;  2LHI A;  2Y1M A;  3OX6 A;  1NCZ A;  1QXP A;  1SR6 C;  3HCM A;  4XYN A;  1DJW A;  1K96 A;  1K9P A;  1PRW A;  3D10 A;  3VRO A;  4AOM A;  4U8D A;  1R2U A;  3M0W A;  2BBN A;  1AVS A;  1NX0 A;  4XJK B;  5HYD A;  3BUX B;  5I2L A;  4MRY A;  1CFD A;  5DKR A;  1NCY A;  2LNK A;  1NPQ A;  2BEC A;  2JXL A;  2D8N A;  1QV0 A;  2F3Y A;  1YUR A;  1SPY A;  4QJ3 B;  2LAN A;  2F2O A;  1KFX L;  4IL1 A;  1B7T Z;  3I5I C;  4YGB B;  4DUQ A;  2MLE C;  1DGU A;  1MQ1 A;  2JT3 A;  1FI6 A;  1FF1 A;  1F4O A;  3FWB A;  1NX2 A;  4DS7 A;  1EL4 A;  1Y1X A;  2K2F A;  2BKH B;  1SNL A;  3SG6 A;  3JTD B;  1OMR A;  4NDD A;  1YRT B;  2LE9 B;  2L5X B;  1JFK A;  2WCB A;  1K8U A;  2CCM A;  2LC5 A;  2JU0 A;  2PAS A;  3QRX A;  1WRZ A;  2M0R A;  1CDL A;  1ZMZ A;  1XK4 C;  3E3R A;  1UHJ A;  5JJG A;  5D69 A;  2LM5 A;  2TN4 A;  2ZNE A;  1TOP A;  4ZCV A;  4BY5 A;  1TNW A;  4AQI A;  2M1K B;  1V1G A;  4ORB B;  1LVC D;  2KGR A;  1BG1 A;  5IBW A;  2EC6 B;  2G9B A;  1B7T Y;  5CPV A;  1JSA A;  1NIW A;  2K7C A;  3VGO A;  1BR4 B;  1UP5 A;  1IKU A;  5AER A;  4MBE A;  2PMY A;  3OP0 A;  3OX5 A;  3FS7 A;  1UHH A;  2L98 A;  2VRG A;  1LKJ A;  2K0J A;  3LK1 A;  5AXI A;  1WRL A;  1QX2 A;  3SG5 A;  1MXE A;  4GBA A;  4YGE B;  1RK9 A;  1KK8 B;  2JWW A;  1YUT A;  4PE7 A;  5HLV A;  2M29 A;  3OHM B;  1QVI Z;  1UHK A;  4I5L B;  1B47 A;  1TNQ A;  3JTD C;  2KAX A;  2ZN8 A;  4HRG A;  1CM4 A;  1BOC A;  5J3X A;  1Y1A A;  2JXC A;  2KFF A;  4GAO A;  4GGF A;  1IH0 A;  1W7I B;  3D0Y A;  2SCP A;  4HSZ A;  5FYX A;  1BLQ A;  1SYM A;  3SJS A;  1C7W A;  4ETO A;  1F55 A;  3TZ1 A;  1PSB A;  3SG4 A;  2LP3 A;  1AHR A;  2EC6 C;  2WC8 A;  4YI8 A;  5GQQ C;  4PCW A;  2I7A A;  2ZRT A;  1REC A;  1M39 A;  2JOJ A;  2WCE A;  1GGW A;  2L51 A;  2F8P A;  2BL0 B;  3A8R A;  1A03 A;  1S6C A;  1RRO A;  2R2I A;  1BF5 A;  3TUY B;  3CWG A;  2BCB A;  2FOT A;  4L9M A;  1RWY A;  2CBL A;  1NP8 A;  2H61 A;  3O78 A;  1MUX A;  1IJ6 A;  2KI6 D;  3BOW A;  1F54 A;  2JQ6 A;  2Y5I A;  2L4H A;  4MRX A;  1BMO A;  1KK8 C;  2LVK A;  2I18 A;  1SRA A;  3JVT B;  2LP2 A;  3VRN A;  1QIW A;  1F8H A;  1SL9 A;  4PE0 A;  1HT9 A;  3A4U B;  1XFU O;  1KSO A;  4I5K A;  3SG7 A;  1R6P A;  1MXL C;  4USL A;  1ODB A;  2HET A;  2LV7 A;  3NSO A;  4I5N B;  3GK2 A;  1CTR A;  4NDB A;  1EH2 A;  1UUS A;  2BCA A;  2MJW B;  1UHI A;  1A2X A;  1L2O B;  1CFP A;  1N65 A;  1F4Q A;  1J55 A;  1UHN A;  2MHH A;  3BUN B;  4GFT A;  4NDC A;  2AAO A;  1QS7 A;  2BE6 A;  1G8I A;  1A29 A;  1KQV A;  3CGA A;  1CFC A;  2BL0 C;  2M8U A;  1FPW A;  4ZCU A;  4C0K A;  2ZFD A;  1OMV A;  2HQW A;  3TUY C;  1KFU S;  1AUI B;  1J7O A;  2L50 A;  2L4I A;  1IQ5 A;  4MZK A;  5KSZ A;  1XO5 A;  2COL B;  2M1U A;  4MN0 A;  2CNP A;  5KU1 A;  1CLB A;  1XFX O;  2PRU A;  2Q4U A;  5CSF A;  3JVT C;  3BQ3 A;  1JC2 A;  3DD4 A;  2OPO A;  1WY9 A;  3FIA A;  1WRK A;  2JTT A;  1CB1 A;  1CLL A;  2E30 A;  1OQP A;  4M2Q A;  1M45 A;  4YBH B;  5CSI A;  5DKN A;  2ZND A;  2ZN9 A;  1M63 B;  4JPZ B;  4CPV A;  2BKI B;  4N1F A;  2KYC A;  3C1V A;  3D0Y B;  2NXQ A;  1AP4 A;  1FBV A;  4PAL A;  3ZWH A;  1YVL A;  4N5X A;  4PE4 A;  2JTZ A;  1L2O C;  1SCV A;  1QAT A;  1SBJ A;  2GGZ A;  3DVM A;  3I5G B;  3ZNI A;  1CM1 A;  1SMG A;  1YUU A;  2KHN A;  3PFV A;  1SY9 A;  4JWQ A;  2CT9 A;  1QJT A;  1QX5 B;  1YR5 A;  1FW4 A;  4MEW A;  1U5I A;  1WLM A;  2K7O A;  1DVI A;  1CNP A;  2FCD A;  1J7Q A;  1NUB A;  2KFG A;  1K95 A;  1QLK A;  1M46 A;  1QV1 A;  3EK7 A;  3SIA A;  1TNP A;  1OZO A;  2I94 A;  4GGN A;  3BOW B;  5CSN A;  1N2D A;  3EVR A;  3LCP C;  4A4C A;  1RJV A;  1QLS A;  1IJ5 A;  4Q04 A;  1CKK A;  1MF8 B;  4YGA A;  1QX7 A;  4MSP A;  2JC2 A;  1FI5 A;  2EGD A;  4OVN F;  1W7J B;  2LMV A;  1ZFS A;  5AFP A;  2Y4Q A;  1DF0 A;  1IGV A;  1S1E A;  2JPT A;  1JUO A;  4QJ5 B;  4GGF C;  1JWD A;  2KSP A;  2NZ0 A;  1ALV A;  1EJ3 A;  3ICB A;  3VRQ A;  3AKB A;  3RLZ A;  4P2Y B;  4NQG A;  1JBA A;  1TIZ A;  1KQM B;  1X02 A;  3GK1 A;  1SL7 A;  2FCE A;  3OB1 B;  3I5G C;  1Y6W A;  1YVH A;  5HKY A;  2JNX A;  4PHN A;  1JFJ A;  2K61 A;  2KAV A;  1DJX A;  5JOL A;  5BPJ A;  2JRF A;  2WCF A;  1XVJ A;  2KOT A;  1XFZ O;  2KAY A;  2LUX A;  1PVA A;  3KF9 A;  1DGV A;  4P5O E;  1YRU B;  5KTY A;  1PSR A;  3DF0 A;  3EVV A;  1G33 A;  1CLM A;  1N0Y A;  2MRD A;  1QIV A;  3CR4 X;  4MZJ A;  2G2B A;  3EVU A;  4MLW A;  2H61 C;  1F71 A;  2LVJ A;  3VRR A;  2KDH A;  2MAZ A;  1DT7 B;  3CLN A;  2DOQ A;  1YTZ C;  3KEV A;  1SW8 A;  4DCK A;  3O6B A;  4JQ0 D;  2ZKM X;  2CXJ A;  3TDU A;  3NSL A;  2HF5 A;  1XFW O;  2E6W A;  1AK8 A;  4HRH A;  1V1F A;  1IWQ A;  2M9G A;  3WNX B;  3BUW B;  1BR1 B;  3NSI A;  2JT0 A;  3CZT X;  3BUM B;  4DRW A;  1XYD A;  2QPT A;  4R1E A;  5ER5 A;  2M7N A;  5B8I B;  1XA5 A;  2BE4 A;  1TRF A;  5AEQ A;  2GGM A;  1KQM C;  3CTN A;  5TNC A;  4TNC A;  3CR5 X;  4ICB A;  2M3W A;  2B1U A;  4CFQ A;  2P6B B;  1BU3 A;  1L7Z A;  1DJI A;  4YGD B;  2LVI A;  3WHU B;  1DTL A;  1S6J A;  1U5I B;  3PAL A;  1F70 A;  2K7B A;  5CSJ A;  2NLN A;  4MVF A;  3EK4 A;  1BOD A;  3CR2 A;  2BBM A;  2WND A;  1GQM A;  1B9A A;  1S6I A;  1Y1U A;  2KFH A;  4YGC B;  1KCY A;  2K7D A;  4PDZ A;  1YX8 A;  2AMI A;  3SIB A;  1J7R A;  4DIR A;  1LA3 A;  3BUO B;  1TCF A;  1ZAC A;  1PAL A;  4WRI A;  3LLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...