1S5GZ

Structure of scallop myosin s1 reveals a novel nucleotide conformation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
molecule tags Contractile protein
total genus 40
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gZ01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s5gZ02
3C1VA 1K93D 4R1EA 1BG1A 1ALWA 1A03A 2LHIA 1M31A 2G2BA 1QASA 3CGAA 1NIWA 4MRYA 5JOLA 4HSZA 1EL4A 2MLEC 2EC6C 2KSPA 4CFQA 4QJ3B 5JJGA 2KGRA 1LA3A 3DVEA 2BE6A 1BMOA 2ZNEA 1V1FA 3JTDB 4PHNA 3SG3A 3D0YB 1B7TY 2JZIA 1EG4A 3AKBA 2BCXA 4DRWA 2AUCA 1LA0A 1OZSA 1PULA 2JT3A 3ZWHA 3CWGA 1KSOA 3I5HC 4DS7A 4OV2A 5I2QA 5GQQC 3BUXB 4IL1A 1IRJA 2Y1MA 1B8CA 4YI9A 3ICBA 1B7TZ 4HREE 3I5FB 1XK4C 1NPQA 1QLSA 1BF5A 3FWCA 1ALVA 3GK4X 5F6TA 2LNKA 3HCMA 1EXRA 2H61C 1EH2A 2CTNA 1L7ZA 1CDMA 2GGMA 1J7QA 1AHRA 2M9GA 5HKYA 4XYNA 3I5GC 2CNPA 3NSOA 1E8AA 4BY4A 5I2OA 1FPWA 1WLMA 5I8NA 1BODA 1KWOC 2H61A 2KBIA 5AFPA 4C0KA 1CDPA 1SY9A 2AMIA 4WRIA 5CSFA 1F55A 2KOTA 1TCOB 2K7OA 3D10A 2M7NA 2KHNA 2KFFA 1XFYO 4FQOA 1SPYA 1KK7Z 2HETA 2M97A 2KAVA 3BOWA 1NUBA 1XFZO 1CTRA 1S1EA 2HQ8A 4PHMA 1YRUB 1QTXA 1L2OB 2R2IA 1A75B 1N65A 1CMFA 1PSBA 1OMVA 2L51A 1DVIA 3JTDC 2NZ0A 3CZTX 3DF0A 3RM1A 2EHBA 1OZOA 4Q04A 4AQJA 1B4CA 2K8MB 2NCOA 2LP3A 3DVMA 2LMVA 2LVVA 2F2PA 4P2YB 4YBHB 1AJ4A 4PE4A 3I5FC 1LINA 3VRQA 1CNPA 2ZRTA 4ORAB 2I2RE 1MQ1A 2VRGA 4XJKA 4YGEB 5DKNA 3IF7A 2KDHA 1FI5A 1SR6B 1QATA 2LLUA 2ZN9A 5D7FA 3IQOA 3EK7A 3SG5A 3PN7C 1Y1XA 1MUXA 2F2OA 1ZACA 1S6CA 3DD4A 1RECA 1TTXA 2ZNDA 2Q91A 1WDCB 3SIAA 4HRGA 3E3RA 4PALA 1UHNA 3BUMB 3CS1A 1JUOA 3VRRA 3AKAA 1TN4A 5CSNA 1PRWA 2JXLA 3LLEA 1K9PA 2LMUA 3WHUB 1QV0A 3TS5B 1LVCD 1SL9A 3OX5A 1J1DA 4NDCA 1B1GA 2BL0B 1CFDA 1L2OC 1M45A 2FOTA 2MBXA 1XFWO 2K2AA 2KAYA 1W7IB 3O4YA 3OP0A 3TZ1A 2FCDA 1YVHA 3WHTB 1OQPA 1CMGA 1SBJA 1JF0A 4DIRA 1FF1A 2WORA 2BBMA 2JOJA 2L4HA 5K89A 2WCFA 2LLTA 2LUXA 2K7DA 4NDDA 2LV7A 4CPVA 3SJSA 4DCKA 4GGFA 1KSMA 2KBMA 1TIZA 3CTNA 5KSZA 1FBVA 1S5GZ 2JRFA 4GGNA 1SNLA 4QJ4B 1PSRA 2P6BB 1SR6C 2PASA 1IJ6A 1OMDA 3PM8A 1DJGA 3RLZA 1IH0A 3EKJA 4YGCB 3KO0A 1CDNA 2LE9B 1BR1B 1NCZA 1ZFSA 1CLMA 2JXCA 3PLFB 1D1OA 1OOJA 2KYCA 3BYAA 2WNDA 1XFVO 1WDCC 3BXKA 4I5JA 1IGVA 2M49B 1QIVA 1TNXA 2L98A 2MLFC 2HQWA 4BY5A 3O2PA 1H4BA 2ISDA 2DOQA 3LK1A 1J55A 2LLSA 1UHHA 2CXJA 2LANA 3FIAA 4WQ2A 4PE7A 1SK6D 4E68A 1KQMB 3CR5X 1CLLA 2QACA 3EK4A 5KTYA 1NP8A 2KAXA 2LC5A 2BL0C 4YGBB 4TNCA 1RTP1 2CCMA 1BR4B 1JWDA 1AJ5A 2L50A 3KEVA 3TDZA 1W7JB 1NX0A 1A29A 2BCBA 4PCWA 1XFXO 5J3XA 3SG4A 1Y1AA 5KU1A 1F71A 4DUQA 1J7RA 1AVSA 1XYDA 2SASA 1C7VA 4MN0A 1XK4A 2EGDA 1NCYA 1DF0A 4CIDA 3VRNA 4GPLB 3A4UB 1IQ3A 1HQVA 4GFTA 3FS7A 2BE4A 1SMGA 1BT6A 4PE0A 5AANA 1KK7Y 4N1FA 3F45A 1YUUA 2F3ZA 2RGIA 2K0JA 2LM5A 1U5IB 1ZMZA 2MHHA 3CR2A 3EVRA 1CM1A 1OMRA 2F3YA 2MRDA 2KQYA 1F4OA 1KK8B 2ZN8A 3A8RA 1SL7A 2JPTA 5PALA 2LHLA 2M1KB 1QIWA 2D8NA 1M39A 5CPVA 1BU3A 2QPTA 2Y5IA 2WCBA 5CSIA 1S6IA 4YGDB 4A4CA 4NDBA 1KQMC 3EKHA 4OCIA 3K21A 2K2FA 1EG3A 5FYXA 4ETOA 2JQ6A 2KFHA 5HKWA 3D0YA 1MHOA 1JBAA 4CFRA 1IG5A 4MZKA 3TDUA 1NYAA 1PALA 2MJWB 4HRHA 1MWNA 1TNPA 2JNFA 2LP2A 1F54A 4ZCUA 1IQ5A 1R2UA 1BLQA 4PE1A 1FI6A 1HT9A 1XO5A 4PDZA 3PFVA 1SCVA 1R6PA 1A4PA 1N2DA 1ZUZA 2Q4UA 1KFUL 2OTGB 2M29A 5I2LA 2JC2A 2BKIB 3VRPA 4QJ5B 1NX1A 1GGWA 1MXEA 3TUYB 1CFPA 1CDLA 2I18A 2L5XB 5D69A 1J7PA 3SIBA 1G8IA 1KK8C 1YTZC 2KNEA 1DTLA 3JVTB 1G4YR 1DJHA 1UUSA 3KF9A 4GBAA 1KQVA 1DJIA 2GGZA 2G9BA 3OHMB 2KQ6A 2NCPA 2ZFDA 2KGBC 3OB1B 2EC6B 3VGOA 1UWOA 3BUWB 3PSRA 1WRLA 1DGVA 4P5OE 2LVIA 2LAPA 3WXAA 1YUTA 1M46A 3OX6A 2BECA 4GUKA 4OKHA 1ZOTB 2K7CA 1KFUS 1B8RA 1K9KA 2JT0A 4JPZB 5ER5A 1FW4A 1S5GY 1B47A 2E6WA 1A75A 1EJ3A 4D1EA 4ICBA 1MR8A 1K94A 1SCMB 3NSIA 1S3PA 1TOPA 3ZNIA 1AK8A 2Y1NA 4JQ0D 5B8IB 2LVKA 1CB1A 2ZRSA 1NCXA 5BPJA 2LVJA 2HF5A 3AAJA 1F8HA 1DF0B 1QJTA 4GNKB 2KYFA 1DJXA 4USLA 1OE9B 3OB2B 3HX4A 3QRXA 4MZLA 1YRTB 1RWYA 4PHJA 3I5IB 1NWDA 2F33A 3I5GB 1WY9A 1J1EA 2BBNA 2OTGC 2WC8A 1KFXS 1AUIB 2JWWA 4MRXA 2KI6C 5DKRA 1CFCA 1UHJA 1TRFA 2M7LA 1F70A 1DT7B 1YX8A 1XA5A 3TUYC 3BOWB 2OS8B 1B9AA 3TS5C 3SG7A 2HPSA 2MA2A 3JVTC 3KPXA 3EVUA 3KHEA 4C0JA 1QXPA 3DF0B 3NXAA 1QVIY 3CLNA 4YI8A 1UURA 5HLVA 5AEQA 1GJYA 2K61A 1IWQA 3BUNB 3LL8B 2KI4B 4JWQA 2CBLA 2M3WA 1UHKA 2NLNA 1F4QA 1GQMA 1B8LA 3DVKA 1CLBA 1QVIZ 2H2KA 3O78A 1J7OA 1GGZA 3BUOB 1SCMC 4XJKB 3VROA 4MLWA 1C07A 2MAZA 2JNXA 1AP4A 5CSJA 2TN4A 1S36A 1QX7A 3WNXB 1K8UA 1K96A 4I5KA 1K95A 4N5XA 1SW8A 1DJZA 1YURA 3EK8A 3LK0A 1Q80A 1X02A 4I5NB 3I5IC 3PN7B 1YX7A 1NX2A 5AERA 1V1GA 1DJYA 1WRZA 3EVVA 2L2EA 4C0LA 3PALA 4MSPA 1K9UA 3BQ3A 2ZKMX 4CLNA 4UPGA 4M2QA 2M1UA 1LKJA 2KI6D 2E30A 1JC2A 2OS8C 3MSEB 1NX3A 2M0RA 1TNQA 1OSAA 1IKUA 1BOCA 1KCYA 3SG6A 1RJVA 1XVJA 1YR5A 5HKZA 4I5LB 3H4SE 1DMOA 3GK1A 1RK9A 3DVJA 2M8UA 1S6JA 2KI4C 4PHKA 4N1GA 4U8DA 4M2OA 1BJFA 2NXQA 5TNCA 2LMTA 1SRAA 2PMYA 2PVBA 2FJUB 2I94A 2JTZA 3NSLA 2LUCA 1Y1UA 4A4BA 2BCAA 2L0PA 4M2PA 5ER4X 2Y4QA 2PSRA 4ORCB 2COLB 1RROA 1YVLA 3GOFA 2WCEA 5IBWA 2GV5A 1JF2A 1PVBA 1Y0VH 2PRUA 3M0WA 2I7AA 3CR4X 2B1UA 1JSAA 5DKQA 2JULA 2A4JA 1MF8B 5G08A 3NSKA 1QS7A 2FCEA 3AAKA 2L4IA 3O6BA 2CT9A 1S26D 4GAOA 1PVAA 1CFFA 1TCFA 1Y6WA 1UP5A 2O5GA 2KFGA 4FTGA 1JFJA 1UHIA 1VRKA 2F8PA 1CKKA 1U5IA 4L9MA 1DGUA 4OVNF 3LCPC 1QX2A 4WQ3A 2SCPA 1G33A 1SYMA 4MEWA 1SL8A 1LXFC 3FWBA 1XFUO 4NQGA 1K90D 2JT8A 2JU0A 1K2HA 2K7BA 1PK0D 1QX5B 5HLOA 1KFXL 1RFJA 2JTTA 1ODBA 3I5HB 4MBEA 1NSHA 1SKTA 4MVFA 4OR9B 1QV1A 1WLZA 1WRKA 2IS9A 1QLKA 2O60A 4YGAA 4AOMA 3IQQA 4MZJA 1C7WA 4YRUA 4AQIA 2LCPA 4ZCVA 3PATA 1M63B 1JFKA 1DJWA 1A2XA 3TDIA 4GGFC 1CM4A 2V53A 4F0ZB 1N0YA 4ORBB 5AXIA 1TNWA 1IJ5A 2AAOA 2PALA 2BKHB 2OPOA 1MXLC 1YUSA 1H8BA 3SG2A 1KWOB 3GK2A 2WOSA 5HYDA
chains in the Genus database with same CATH superfamily
3C1VA 1K93D 2JPOA 4R1EA 1BG1A 1ALWA 1A03A 2LHIA 1M31A 2G2BA 1QASA 2KPHA 1NIWA 3CGAA 4MRYA 5JOLA 4HSZA 1EL4A 2MLEC 2EC6C 2KSPA 3S0EA 4QJ3B 4CFQA 5JJGA 2KGRA 1LA3A 3RZSA 3DVEA 2BE6A 1BMOA 2ZNEA 1V1FA 3JTDB 4PHNA 3SG3A 3D0YB 1B7TY 2JZIA 3L4LA 1EG4A 3AKBA 2BCXA 3BFBA 4DRWA 2AUCA 1LA0A 1OZSA 1PULA 2JT3A 3ZWHA 2L2CA 3CWGA 1KSOA 3I5HC 4DS7A 4OV2A 5I2QA 5GQQC 3BUXB 4IL1A 1IRJA 2Y1MA 1B8CA 4YI9A 3ICBA 1B7TZ 4HREE 3I5FB 1XK4C 1NPQA 1QLSA 3V2LA 1BF5A 3FWCA 1ALVA 2QEVA 3GK4X 4F7FA 5F6TA 1OOGA 2LNKA 3HCMA 1EXRA 3DY9A 2H61C 2K60A 2CTNA 1EH2A 1L7ZA 1CDMA 2GGMA 1J7QA 1AHRA 2M9GA 5HKYA 4XYNA 3I5GC 2CNPA 3NSOA 1E8AA 4PT1A 4BY4A 5I2OA 1FPWA 1WLMA 5I8NA 1QWVA 1BODA 1KWOC 2H61A 2FJYA 2KBIA 2PQLA 5AFPA 4C0KA 1CDPA 1SY9A 2AMIA 4WRIA 5CSFA 1F55A 2KOTA 5I94A 1TWOA 1TCOB 2K7OA 3D10A 2M7NA 3D78A 2KHNA 2KFFA 1XFYO 4FQOA 1SPYA 3CZ1A 1KK7Z 2HETA 2M97A 2KAVA 3BOWA 1NUBA 1XFZO 1CTRA 1S1EA 2HQ8A 4PHMA 1YRUB 1QTXA 1L2OB 2R2IA 1A75B 1N65A 1CMFA 1PSBA 1OMVA 2L51A 1DVIA 3DYEA 3JTDC 2NZ0A 3B6XA 3CZTX 3DF0A 3RM1A 2EHBA 1OZOA 4Q04A 4AQJA 1B4CA 2K8MB 3NHTA 3UNWA 2NCOA 2KLEA 2LP3A 3DVMA 2LMVA 3B86A 2LVVA 2F2PA 4P2YB 4YBHB 1AJ4A 4PE4A 3I5FC 1LINA 3VRQA 1CNPA 2ZRTA 4ORAB 2I2RE 1MQ1A 2VRGA 4XJKA 4YGEB 5DKNA 3IF7A 2KDHA 2KLDA 1FI5A 1SR6B 1QATA 2LLUA 2ZN9A 5D7FA 3IQOA 3EK7A 3SG5A 3PM2A 3PN7C 1Y1XA 3B88A 1MUXA 2F2OA 1ZACA 1S6CA 2WCKA 3DD4A 4INXA 1RECA 1TTXA 2ZNDA 2Q91A 1WDCB 3SIAA 4HRGA 3E3RA 4PALA 1UHNA 3BUMB 3CS1A 1JUOA 1T14A 3AKAA 1TN4A 3VRRA 5CSNA 1PRWA 2JXLA 3LLEA 1K9PA 2LMUA 1C3ZA 3WHUB 1QV0A 3TS5B 1LVCD 1SL9A 3OX5A 1J1DA 3S0AA 4NDCA 1B1GA 2BL0B 1CFDA 1L2OC 1M45A 2FOTA 2MBXA 1XFWO 2K2AA 3DXLA 2KAYA 1W7IB 3O4YA 3OP0A 3TZ1A 3FE8A 3FE6A 2FCDA 4JD9A 1YVHA 3WHTB 1OQPA 1CMGA 1SBJA 1JF0A 3BJHA 4DIRA 1FF1A 2WORA 2BBMA 2JOJA 2L4HA 2QDIA 5K89A 2WCFA 2LLTA 2LUXA 3CZ0A 2K7DA 4NDDA 2LV7A 4CPVA 3SJSA 3O4XA 3SS4A 4GGFA 4DCKA 1KSMA 2KBMA 3S0FA 1TIZA 2QEOA 3BFHA 3CTNA 5KSZA 1FBVA 1JFJA 1S5GZ 2JRFA 4GGNA 1SNLA 4QJ4B 1PSRA 2P6BB 1SR6C 2PASA 1IJ6A 1OMDA 3PM8A 1DJGA 3RLZA 1IH0A 3EKJA 4YGCB 3KO0A 1CDNA 2LE9B 3K1EA 1BR1B 1NCZA 1ZFSA 1CLMA 2JXCA 3PLFB 1D1OA 1OOJA 2KYCA 3BYAA 2WNDA 1XFVO 1WDCC 3BXKA 4I5JA 3D73A 1IGVA 2M49B 1QIVA 1TNXA 2L98A 2MLFC 2HQWA 4BY5A 4JKTA 3O2PA 1H4BA 2ISDA 3SS3A 2DOQA 3LK1A 1J55A 2LLSA 1UHHA 2CXJA 2LANA 3FIAA 4WQ2A 4PE7A 1SK6D 4E68A 1KQMB 3CR5X 1CLLA 2QACA 3EK4A 5KTYA 1NP8A 2KAXA 2LC5A 2BL0C 4YGBB 4TNCA 1RTP1 2CCMA 1BR4B 5EL2A 1JWDA 1AJ5A 2L50A 3KEVA 3TDZA 1W7JB 1NX0A 2YGUA 1A29A 2BCBA 3PJIA 1XFXO 4PCWA 5J3XA 3SG4A 1Y1AA 5KU1A 1F71A 4DUQA 1J7RA 3CDNA 1AVSA 1XYDA 2SASA 1C7VA 4MN0A 1XK4A 2EGDA 1NCYA 1DF0A 4CIDA 4OZDA 3VRNA 4GPLB 3A4UB 1IQ3A 1HQVA 4GFTA 3FS7A 2BE4A 1SMGA 1BT6A 4PE0A 5AANA 1KK7Y 4FQTA 4N1FA 2P71A 3F45A 1YUUA 2F3ZA 2RGIA 2K0JA 2LM5A 3KF9A 1U5IB 1ZMZA 2MHHA 3CR2A 3D77A 3EVRA 1CM1A 1OMRA 2F3YA 2MRDA 2KQYA 1F4OA 1KK8B 2ZN8A 3A8RA 1SL7A 2JPTA 5PALA 2LHLA 2M1KB 1QIWA 2D8NA 1DELA 1M39A 5CPVA 1BU3A 2WC5A 2QPTA 2QEHA 2Y5IA 2WCBA 5CSIA 1S6IA 4YGDB 4A4CA 5FI6A 3OBVA 1ORGA 4NDBA 1KQMC 3EKHA 4OCIA 3CABA 3K21A 2K2FA 1EG3A 5FYXA 1TUJA 4ETOA 4FTGA 2JQ6A 2KFHA 5HKWA 3D0YA 1MHOA 1JBAA 4CFRA 1IG5A 4MZKA 3TDUA 1NYAA 1PALA 2MJWB 4HRHA 1MWNA 1TNPA 2JNFA 2LP2A 1F54A 4ZCUA 1IQ5A 1R2UA 1BLQA 4PE1A 1FI6A 1HT9A 1XO5A 4PDZA 3PFVA 1SCVA 1R6PA 1A4PA 1N2DA 1ZUZA 2ERBA 2BAPA 2Q4UA 1KFUL 2P70A 1LS8A 2OTGB 5D3OA 2M29A 5I2LA 2JC2A 2BKIB 3VRPA 4QJ5B 3Q8IA 1NX1A 1GGWA 1MXEA 3TUYB 1CFPA 1CDLA 2I18A 2L5XB 5D69A 3SS5A 1J7PA 3SIBA 1G8IA 1KK8C 1YTZC 2KNEA 1DTLA 3JVTB 1G4YR 1DJHA 1UUSA 2WC6A 4GBAA 1KQVA 1DJIA 3D74A 2GGZA 2G9BA 2L5YA 3OHMB 5FI2A 2KQ6A 2NCPA 2ZFDA 2KGBC 3OB1B 2EC6B 3VGOA 1UWOA 3BUWB 3PSRA 1WRLA 1DGVA 4P5OE 2LVIA 2LAPA 3WXAA 1YUTA 1M46A 3OX6A 2BECA 4GUKA 4OKHA 1ZOTB 2K7CA 1KFUS 2WCHA 1B8RA 1K9KA 2JT0A 4JPZB 5DICA 5ER5A 1FW4A 1DC1A 1OOIX 1S5GY 1B47A 2E6WA 1A75A 1EJ3A 4D1EA 4ICBA 1MR8A 4KYNA 1K94A 1SCMB 3NSIA 1S3PA 1TOPA 1P28A 3ZNIA 1AK8A 2Y1NA 4JQ0D 1GM0A 5B8IB 1TUZA 2LVKA 3DZTA 1CB1A 2WCJA 3OGNA 2ZRSA 1NCXA 5BPJA 2LVJA 2HF5A 3AAJA 1F8HA 1DF0B 1QJTA 4GNKB 2KYFA 1DJXA 4USLA 3NGVA 1OE9B 3OB2B 3HX4A 3QRXA 4MZLA 1YRTB 1RWYA 4PHJA 3I5IB 1NWDA 2F33A 3NHIA 3I5GB 1WY9A 1J1EA 2BBNA 2OTGC 3CZ2A 2WC8A 1KFXS 1AUIB 2JWWA 4MRXA 2KI6C 5DKRA 1CFCA 1UHJA 1TRFA 2M7LA 1F70A 1DT7B 1YX8A 1XA5A 3TUYC 3BOWB 3BFAA 2OS8B 1B9AA 3TS5C 3SG7A 2HPSA 2MA2A 3S0BA 3JVTC 3IVTA 3EVUA 3KPXA 1SSEB 3KHEA 4C0JA 1QXPA 3DF0B 3NXAA 1QVIY 3CLNA 2WCMA 4YI8A 1UURA 5HLVA 5AEQA 1GJYA 2K61A 1IWQA 3R1OA 3BUNB 3LL8B 3R72A 3VB1A 2KI4B 4JWQA 2CBLA 3FE9A 2M3WA 1UHKA 2NLNA 1F4QA 1GQMA 1B8LA 3DVKA 1CLBA 1QVIZ 2H2KA 3B87A 3O78A 1J7OA 1GGZA 3BUOB 1SCMC 4XJKB 3VROA 4MLWA 1C07A 2MAZA 2JNXA 1AP4A 5CSJA 2TN4A 1S36A 1QX7A 3WNXB 2BNXA 1K8UA 1K96A 4I5KA 1K95A 4N5XA 1SW8A 1DJZA 1YURA 3EK8A 3LK0A 1Q80A 1X02A 4I5NB 3I5IC 1OOFA 1YX7A 1NX2A 3PN7B 5AERA 5HL1A 1V1GA 1DJYA 1WRZA 3EVVA 2L2EA 4C0LA 3PALA 4MSPA 1IIOA 1K9UA 2PYQA 3BQ3A 2ZKMX 4CLNA 4UPGA 4M2QA 2M1UA 3B7AA 1LKJA 2KI6D 2E30A 1JC2A 2OS8C 3MSEB 1NX3A 2M0RA 1TNQA 1OSAA 1IKUA 1BOCA 1KCYA 3SG6A 1RJVA 1XVJA 1YR5A 5HKZA 4I5LB 3H4SE 1DMOA 3GK1A 2QEBA 1RK9A 4INWA 3DVJA 2M8UA 1S6JA 2KI4C 3CYZA 4N1GA 4PHKA 4M2OA 1BJFA 2NXQA 4U8DA 5TNCA 2LMTA 1SRAA 2PMYA 2PVBA 2FJUB 2I94A 2JTZA 3NSLA 2LUCA 1Y1UA 4A4BA 3R1VA 2BCAA 2L0PA 4M2PA 5ER4X 2Y4QA 2PSRA 4ORCB 2COLB 1OW4A 1RROA 1YVLA 3GOFA 3L4AA 2WCEA 5IBWA 2GV5A 1JF2A 1PVBA 1Y0VH 2PRUA 3M0WA 2I7AA 3CR4X 2B1UA 3R1PA 5FI7A 5DKQA 3UO9A 1JSAA 2JULA 2A4JA 1MF8B 5G08A 3NSKA 1QS7A 2FCEA 3AAKA 3EG5B 2L4IA 3O6BA 2CT9A 1S26D 4GAOA 1PVAA 1CFFA 1TCFA 1Y6WA 1UP5A 1W9ZA 2KFGA 2O5GA 2WCLA 1UHIA 1VRKA 2F8PA 1CKKA 1U5IA 4L9MA 1DGUA 4OVNF 3D75A 3LCPC 1QX2A 1C3YA 4WQ3A 2SCPA 1G33A 1SYMA 4MEWA 1SL8A 1LXFC 3FWBA 1XFUO 4NQGA 1K90D 2JT8A 2JU0A 3D76A 1DQEA 1K2HA 2K7BA 2GTEA 1PK0D 1QX5B 5HLOA 1KFXL 1RFJA 2JTTA 4IJ7A 1ODBA 3I5HB 3QMEA 4MBEA 1NSHA 1XFRA 1SKTA 2H8VA 4MVFA 4OR9B 1QV1A 1WLZA 1WRKA 2IS9A 1QLKA 2O60A 4YGAA 3S0DA 4AOMA 3IQQA 4MZJA 1C7WA 4YRUA 1OOHA 4AQIA 2LCPA 3N7HA 4ZCVA 3PATA 1M63B 1JFKA 1DJWA 1Z2CB 1A2XA 1Z4HA 3TDIA 4GGFC 1CM4A 2V53A 4F0ZB 1N0YA 4ORBB 5AXIA 1TNWA 1IJ5A 3S0GA 2AAOA 2PALA 2BKHB 2OPOA 1MXLC 1DEKA 3L47A 1YUSA 1H8BA 3SG2A 1KWOB 3GK2A 2WOSA 5HYDA
chains in the Genus database with same CATH topology
3C1VA 1K93D 4R1EA 1BG1A 1ALWA 1A03A 2LHIA 1M31A 2G2BA 1QASA 3CGAA 1NIWA 4MRYA 5JOLA 4HSZA 1EL4A 2MLEC 2EC6C 2KSPA 4CFQA 4QJ3B 5JJGA 2KGRA 1LA3A 3DVEA 2BE6A 1BMOA 2ZNEA 1V1FA 3JTDB 4PHNA 3SG3A 3D0YB 1B7TY 2JZIA 1EG4A 3AKBA 2BCXA 4DRWA 2AUCA 1LA0A 1OZSA 1PULA 2JT3A 3ZWHA 3CWGA 1KSOA 3I5HC 4DS7A 4OV2A 5I2QA 5GQQC 3BUXB 4IL1A 1IRJA 2Y1MA 1B8CA 4YI9A 3ICBA 1B7TZ 4HREE 3I5FB 1XK4C 1NPQA 1QLSA 1BF5A 3FWCA 1ALVA 3GK4X 5F6TA 2LNKA 3HCMA 1EXRA 2H61C 1EH2A 2CTNA 1L7ZA 1CDMA 2GGMA 1J7QA 1AHRA 2M9GA 5HKYA 4XYNA 3I5GC 2CNPA 3NSOA 1E8AA 4BY4A 5I2OA 1FPWA 1WLMA 5I8NA 1BODA 1KWOC 2H61A 2KBIA 5AFPA 4C0KA 1CDPA 1SY9A 2AMIA 4WRIA 5CSFA 1F55A 2KOTA 1TCOB 2K7OA 3D10A 2M7NA 2KHNA 2KFFA 1XFYO 4FQOA 1SPYA 1KK7Z 2HETA 2M97A 2KAVA 3BOWA 1NUBA 1XFZO 1CTRA 1S1EA 2HQ8A 4PHMA 1YRUB 1QTXA 1L2OB 2R2IA 1A75B 1N65A 1CMFA 1PSBA 1OMVA 2L51A 1DVIA 3JTDC 2NZ0A 3CZTX 3DF0A 3RM1A 2EHBA 1OZOA 4Q04A 4AQJA 1B4CA 2K8MB 2NCOA 2LP3A 3DVMA 2LMVA 2LVVA 2F2PA 4P2YB 4YBHB 1AJ4A 4PE4A 3I5FC 1LINA 3VRQA 1CNPA 2ZRTA 4ORAB 2I2RE 1MQ1A 2VRGA 4XJKA 4YGEB 5DKNA 3IF7A 2KDHA 1FI5A 1SR6B 1QATA 2LLUA 2ZN9A 5D7FA 3IQOA 3EK7A 3SG5A 3PN7C 1Y1XA 1MUXA 2F2OA 1ZACA 1S6CA 3DD4A 1RECA 1TTXA 2ZNDA 2Q91A 1WDCB 3SIAA 4HRGA 3E3RA 4PALA 1UHNA 3BUMB 3CS1A 1JUOA 3VRRA 3AKAA 1TN4A 5CSNA 1PRWA 2JXLA 3LLEA 1K9PA 2LMUA 3WHUB 1QV0A 3TS5B 1LVCD 1SL9A 3OX5A 1J1DA 4NDCA 1B1GA 2BL0B 1CFDA 1L2OC 1M45A 2FOTA 2MBXA 1XFWO 2K2AA 2KAYA 1W7IB 3O4YA 3OP0A 3TZ1A 2FCDA 1YVHA 3WHTB 1OQPA 1CMGA 1SBJA 1JF0A 4DIRA 1FF1A 2WORA 2BBMA 2JOJA 2L4HA 5K89A 2WCFA 2LLTA 2LUXA 2K7DA 4NDDA 2LV7A 4CPVA 3SJSA 4DCKA 4GGFA 1KSMA 2KBMA 1TIZA 3CTNA 5KSZA 1FBVA 1S5GZ 2JRFA 4GGNA 1SNLA 4QJ4B 1PSRA 2P6BB 1SR6C 2PASA 1IJ6A 1OMDA 3PM8A 1DJGA 3RLZA 1IH0A 3EKJA 4YGCB 3KO0A 1CDNA 2LE9B 1BR1B 1NCZA 1ZFSA 1CLMA 2JXCA 3PLFB 1D1OA 1OOJA 2KYCA 3BYAA 2WNDA 1XFVO 1WDCC 3BXKA 4I5JA 1IGVA 2M49B 1QIVA 1TNXA 2L98A 2MLFC 2HQWA 4BY5A 3O2PA 1H4BA 2ISDA 2DOQA 3LK1A 1J55A 2LLSA 1UHHA 2CXJA 2LANA 3FIAA 4WQ2A 4PE7A 1SK6D 4E68A 1KQMB 3CR5X 1CLLA 2QACA 3EK4A 5KTYA 1NP8A 2KAXA 2LC5A 2BL0C 4YGBB 4TNCA 1RTP1 2CCMA 1BR4B 1JWDA 1AJ5A 2L50A 3KEVA 3TDZA 1W7JB 1NX0A 1A29A 2BCBA 4PCWA 1XFXO 5J3XA 3SG4A 1Y1AA 5KU1A 1F71A 4DUQA 1J7RA 1AVSA 1XYDA 2SASA 1C7VA 4MN0A 1XK4A 2EGDA 1NCYA 1DF0A 4CIDA 3VRNA 4GPLB 3A4UB 1IQ3A 1HQVA 4GFTA 3FS7A 2BE4A 1SMGA 1BT6A 4PE0A 5AANA 1KK7Y 4N1FA 3F45A 1YUUA 2F3ZA 2RGIA 2K0JA 2LM5A 1U5IB 1ZMZA 2MHHA 3CR2A 3EVRA 1CM1A 1OMRA 2F3YA 2MRDA 2KQYA 1F4OA 1KK8B 2ZN8A 3A8RA 1SL7A 2JPTA 5PALA 2LHLA 2M1KB 1QIWA 2D8NA 1M39A 5CPVA 1BU3A 2QPTA 2Y5IA 2WCBA 5CSIA 1S6IA 4YGDB 4A4CA 4NDBA 1KQMC 3EKHA 4OCIA 3K21A 2K2FA 1EG3A 5FYXA 4ETOA 2JQ6A 2KFHA 5HKWA 3D0YA 1MHOA 1JBAA 4CFRA 1IG5A 4MZKA 3TDUA 1NYAA 1PALA 2MJWB 4HRHA 1MWNA 1TNPA 2JNFA 2LP2A 1F54A 4ZCUA 1IQ5A 1R2UA 1BLQA 4PE1A 1FI6A 1HT9A 1XO5A 4PDZA 3PFVA 1SCVA 1R6PA 1A4PA 1N2DA 1ZUZA 2Q4UA 1KFUL 2OTGB 2M29A 5I2LA 2JC2A 2BKIB 3VRPA 4QJ5B 1NX1A 1GGWA 1MXEA 3TUYB 1CFPA 1CDLA 2I18A 2L5XB 5D69A 1J7PA 3SIBA 1G8IA 1KK8C 1YTZC 2KNEA 1DTLA 3JVTB 1G4YR 1DJHA 1UUSA 3KF9A 4GBAA 1KQVA 1DJIA 2GGZA 2G9BA 3OHMB 2KQ6A 2NCPA 2ZFDA 2KGBC 3OB1B 2EC6B 3VGOA 1UWOA 3BUWB 3PSRA 1WRLA 1DGVA 4P5OE 2LVIA 2LAPA 3WXAA 1YUTA 1M46A 3OX6A 2BECA 4GUKA 4OKHA 1ZOTB 2K7CA 1KFUS 1B8RA 1K9KA 2JT0A 4JPZB 5ER5A 1FW4A 1S5GY 1B47A 2E6WA 1A75A 1EJ3A 4D1EA 4ICBA 1MR8A 1K94A 1SCMB 3NSIA 1S3PA 1TOPA 3ZNIA 1AK8A 2Y1NA 4JQ0D 5B8IB 2LVKA 1CB1A 2ZRSA 1NCXA 5BPJA 2LVJA 2HF5A 3AAJA 1F8HA 1DF0B 1QJTA 4GNKB 2KYFA 1DJXA 4USLA 1OE9B 3OB2B 3HX4A 3QRXA 4MZLA 1YRTB 1RWYA 4PHJA 3I5IB 1NWDA 2F33A 3I5GB 1WY9A 1J1EA 2BBNA 2OTGC 2WC8A 1KFXS 1AUIB 2JWWA 4MRXA 2KI6C 5DKRA 1CFCA 1UHJA 1TRFA 2M7LA 1F70A 1DT7B 1YX8A 1XA5A 3TUYC 3BOWB 2OS8B 1B9AA 3TS5C 3SG7A 2HPSA 2MA2A 3JVTC 3KPXA 3EVUA 3KHEA 4C0JA 1QXPA 3DF0B 3NXAA 1QVIY 3CLNA 4YI8A 1UURA 5HLVA 5AEQA 1GJYA 2K61A 1IWQA 3BUNB 3LL8B 2KI4B 4JWQA 2CBLA 2M3WA 1UHKA 2NLNA 1F4QA 1GQMA 1B8LA 3DVKA 1CLBA 1QVIZ 2H2KA 3O78A 1J7OA 1GGZA 3BUOB 1SCMC 4XJKB 3VROA 4MLWA 1C07A 2MAZA 2JNXA 1AP4A 5CSJA 2TN4A 1S36A 1QX7A 3WNXB 1K8UA 1K96A 4I5KA 1K95A 4N5XA 1SW8A 1DJZA 1YURA 3EK8A 3LK0A 1Q80A 1X02A 4I5NB 3I5IC 3PN7B 1YX7A 1NX2A 5AERA 1V1GA 1DJYA 1WRZA 3EVVA 2L2EA 4C0LA 3PALA 4MSPA 1K9UA 3BQ3A 2ZKMX 4CLNA 4UPGA 4M2QA 2M1UA 1LKJA 2KI6D 2E30A 1JC2A 2OS8C 3MSEB 1NX3A 2M0RA 1TNQA 1OSAA 1IKUA 1BOCA 1KCYA 3SG6A 1RJVA 1XVJA 1YR5A 5HKZA 4I5LB 3H4SE 1DMOA 3GK1A 1RK9A 3DVJA 2M8UA 1S6JA 2KI4C 4PHKA 4N1GA 4U8DA 4M2OA 1BJFA 2NXQA 5TNCA 2LMTA 1SRAA 2PMYA 2PVBA 2FJUB 2I94A 2JTZA 3NSLA 2LUCA 1Y1UA 4A4BA 2BCAA 2L0PA 4M2PA 5ER4X 2Y4QA 2PSRA 4ORCB 2COLB 1RROA 1YVLA 3GOFA 2WCEA 5IBWA 2GV5A 1JF2A 1PVBA 1Y0VH 2PRUA 3M0WA 2I7AA 3CR4X 2B1UA 1JSAA 5DKQA 2JULA 2A4JA 1MF8B 5G08A 3NSKA 1QS7A 2FCEA 3AAKA 2L4IA 3O6BA 2CT9A 1S26D 4GAOA 1PVAA 1CFFA 1TCFA 1Y6WA 1UP5A 2O5GA 2KFGA 4FTGA 1JFJA 1UHIA 1VRKA 2F8PA 1CKKA 1U5IA 4L9MA 1DGUA 4OVNF 3LCPC 1QX2A 4WQ3A 2SCPA 1G33A 1SYMA 4MEWA 1SL8A 1LXFC 3FWBA 1XFUO 4NQGA 1K90D 2JT8A 2JU0A 1K2HA 2K7BA 1PK0D 1QX5B 5HLOA 1KFXL 1RFJA 2JTTA 1ODBA 3I5HB 4MBEA 1NSHA 1SKTA 4MVFA 4OR9B 1QV1A 1WLZA 1WRKA 2IS9A 1QLKA 2O60A 4YGAA 4AOMA 3IQQA 4MZJA 1C7WA 4YRUA 4AQIA 2LCPA 4ZCVA 3PATA 1M63B 1JFKA 1DJWA 1A2XA 3TDIA 4GGFC 1CM4A 2V53A 4F0ZB 1N0YA 4ORBB 5AXIA 1TNWA 1IJ5A 2AAOA 2PALA 2BKHB 2OPOA 1MXLC 1YUSA 1H8BA 3SG2A 1KWOB 3GK2A 2WOSA 5HYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1V A;  1K93 D;  4R1E A;  1BG1 A;  1ALW A;  1A03 A;  2LHI A;  1M31 A;  2G2B A;  1QAS A;  3CGA A;  1NIW A;  4MRY A;  5JOL A;  4HSZ A;  1EL4 A;  2MLE C;  2EC6 C;  2KSP A;  4CFQ A;  4QJ3 B;  5JJG A;  2KGR A;  1LA3 A;  3DVE A;  2BE6 A;  1BMO A;  2ZNE A;  1V1F A;  3JTD B;  4PHN A;  3SG3 A;  3D0Y B;  1B7T Y;  2JZI A;  1EG4 A;  3AKB A;  2BCX A;  4DRW A;  2AUC A;  1LA0 A;  1OZS A;  1PUL A;  2JT3 A;  3ZWH A;  3CWG A;  1KSO A;  3I5H C;  4DS7 A;  4OV2 A;  5I2Q A;  5GQQ C;  3BUX B;  4IL1 A;  1IRJ A;  2Y1M A;  1B8C A;  4YI9 A;  3ICB A;  1B7T Z;  4HRE E;  3I5F B;  1XK4 C;  1NPQ A;  1QLS A;  1BF5 A;  3FWC A;  1ALV A;  3GK4 X;  5F6T A;  2LNK A;  3HCM A;  1EXR A;  2H61 C;  1EH2 A;  2CTN A;  1L7Z A;  1CDM A;  2GGM A;  1J7Q A;  1AHR A;  2M9G A;  5HKY A;  4XYN A;  3I5G C;  2CNP A;  3NSO A;  1E8A A;  4BY4 A;  5I2O A;  1FPW A;  1WLM A;  5I8N A;  1BOD A;  1KWO C;  2H61 A;  2KBI A;  5AFP A;  4C0K A;  1CDP A;  1SY9 A;  2AMI A;  4WRI A;  5CSF A;  1F55 A;  2KOT A;  1TCO B;  2K7O A;  3D10 A;  2M7N A;  2KHN A;  2KFF A;  1XFY O;  4FQO A;  1SPY A;  1KK7 Z;  2HET A;  2M97 A;  2KAV A;  3BOW A;  1NUB A;  1XFZ O;  1CTR A;  1S1E A;  2HQ8 A;  4PHM A;  1YRU B;  1QTX A;  1L2O B;  2R2I A;  1A75 B;  1N65 A;  1CMF A;  1PSB A;  1OMV A;  2L51 A;  1DVI A;  3JTD C;  2NZ0 A;  3CZT X;  3DF0 A;  3RM1 A;  2EHB A;  1OZO A;  4Q04 A;  4AQJ A;  1B4C A;  2K8M B;  2NCO A;  2LP3 A;  3DVM A;  2LMV A;  2LVV A;  2F2P A;  4P2Y B;  4YBH B;  1AJ4 A;  4PE4 A;  3I5F C;  1LIN A;  3VRQ A;  1CNP A;  2ZRT A;  4ORA B;  2I2R E;  1MQ1 A;  2VRG A;  4XJK A;  4YGE B;  5DKN A;  3IF7 A;  2KDH A;  1FI5 A;  1SR6 B;  1QAT A;  2LLU A;  2ZN9 A;  5D7F A;  3IQO A;  3EK7 A;  3SG5 A;  3PN7 C;  1Y1X A;  1MUX A;  2F2O A;  1ZAC A;  1S6C A;  3DD4 A;  1REC A;  1TTX A;  2ZND A;  2Q91 A;  1WDC B;  3SIA A;  4HRG A;  3E3R A;  4PAL A;  1UHN A;  3BUM B;  3CS1 A;  1JUO A;  3VRR A;  3AKA A;  1TN4 A;  5CSN A;  1PRW A;  2JXL A;  3LLE A;  1K9P A;  2LMU A;  3WHU B;  1QV0 A;  3TS5 B;  1LVC D;  1SL9 A;  3OX5 A;  1J1D A;  4NDC A;  1B1G A;  2BL0 B;  1CFD A;  1L2O C;  1M45 A;  2FOT A;  2MBX A;  1XFW O;  2K2A A;  2KAY A;  1W7I B;  3O4Y A;  3OP0 A;  3TZ1 A;  2FCD A;  1YVH A;  3WHT B;  1OQP A;  1CMG A;  1SBJ A;  1JF0 A;  4DIR A;  1FF1 A;  2WOR A;  2BBM A;  2JOJ A;  2L4H A;  5K89 A;  2WCF A;  2LLT A;  2LUX A;  2K7D A;  4NDD A;  2LV7 A;  4CPV A;  3SJS A;  4DCK A;  4GGF A;  1KSM A;  2KBM A;  1TIZ A;  3CTN A;  5KSZ A;  1FBV A;  1S5G Z;  2JRF A;  4GGN A;  1SNL A;  4QJ4 B;  1PSR A;  2P6B B;  1SR6 C;  2PAS A;  1IJ6 A;  1OMD A;  3PM8 A;  1DJG A;  3RLZ A;  1IH0 A;  3EKJ A;  4YGC B;  3KO0 A;  1CDN A;  2LE9 B;  1BR1 B;  1NCZ A;  1ZFS A;  1CLM A;  2JXC A;  3PLF B;  1D1O A;  1OOJ A;  2KYC A;  3BYA A;  2WND A;  1XFV O;  1WDC C;  3BXK A;  4I5J A;  1IGV A;  2M49 B;  1QIV A;  1TNX A;  2L98 A;  2MLF C;  2HQW A;  4BY5 A;  3O2P A;  1H4B A;  2ISD A;  2DOQ A;  3LK1 A;  1J55 A;  2LLS A;  1UHH A;  2CXJ A;  2LAN A;  3FIA A;  4WQ2 A;  4PE7 A;  1SK6 D;  4E68 A;  1KQM B;  3CR5 X;  1CLL A;  2QAC A;  3EK4 A;  5KTY A;  1NP8 A;  2KAX A;  2LC5 A;  2BL0 C;  4YGB B;  4TNC A;  1RTP 1;  2CCM A;  1BR4 B;  1JWD A;  1AJ5 A;  2L50 A;  3KEV A;  3TDZ A;  1W7J B;  1NX0 A;  1A29 A;  2BCB A;  4PCW A;  1XFX O;  5J3X A;  3SG4 A;  1Y1A A;  5KU1 A;  1F71 A;  4DUQ A;  1J7R A;  1AVS A;  1XYD A;  2SAS A;  1C7V A;  4MN0 A;  1XK4 A;  2EGD A;  1NCY A;  1DF0 A;  4CID A;  3VRN A;  4GPL B;  3A4U B;  1IQ3 A;  1HQV A;  4GFT A;  3FS7 A;  2BE4 A;  1SMG A;  1BT6 A;  4PE0 A;  5AAN A;  1KK7 Y;  4N1F A;  3F45 A;  1YUU A;  2F3Z A;  2RGI A;  2K0J A;  2LM5 A;  1U5I B;  1ZMZ A;  2MHH A;  3CR2 A;  3EVR A;  1CM1 A;  1OMR A;  2F3Y A;  2MRD A;  2KQY A;  1F4O A;  1KK8 B;  2ZN8 A;  3A8R A;  1SL7 A;  2JPT A;  5PAL A;  2LHL A;  2M1K B;  1QIW A;  2D8N A;  1M39 A;  5CPV A;  1BU3 A;  2QPT A;  2Y5I A;  2WCB A;  5CSI A;  1S6I A;  4YGD B;  4A4C A;  4NDB A;  1KQM C;  3EKH A;  4OCI A;  3K21 A;  2K2F A;  1EG3 A;  5FYX A;  4ETO A;  2JQ6 A;  2KFH A;  5HKW A;  3D0Y A;  1MHO A;  1JBA A;  4CFR A;  1IG5 A;  4MZK A;  3TDU A;  1NYA A;  1PAL A;  2MJW B;  4HRH A;  1MWN A;  1TNP A;  2JNF A;  2LP2 A;  1F54 A;  4ZCU A;  1IQ5 A;  1R2U A;  1BLQ A;  4PE1 A;  1FI6 A;  1HT9 A;  1XO5 A;  4PDZ A;  3PFV A;  1SCV A;  1R6P A;  1A4P A;  1N2D A;  1ZUZ A;  2Q4U A;  1KFU L;  2OTG B;  2M29 A;  5I2L A;  2JC2 A;  2BKI B;  3VRP A;  4QJ5 B;  1NX1 A;  1GGW A;  1MXE A;  3TUY B;  1CFP A;  1CDL A;  2I18 A;  2L5X B;  5D69 A;  1J7P A;  3SIB A;  1G8I A;  1KK8 C;  1YTZ C;  2KNE A;  1DTL A;  3JVT B;  1G4Y R;  1DJH A;  1UUS A;  3KF9 A;  4GBA A;  1KQV A;  1DJI A;  2GGZ A;  2G9B A;  3OHM B;  2KQ6 A;  2NCP A;  2ZFD A;  2KGB C;  3OB1 B;  2EC6 B;  3VGO A;  1UWO A;  3BUW B;  3PSR A;  1WRL A;  1DGV A;  4P5O E;  2LVI A;  2LAP A;  3WXA A;  1YUT A;  1M46 A;  3OX6 A;  2BEC A;  4GUK A;  4OKH A;  1ZOT B;  2K7C A;  1KFU S;  1B8R A;  1K9K A;  2JT0 A;  4JPZ B;  5ER5 A;  1FW4 A;  1S5G Y;  1B47 A;  2E6W A;  1A75 A;  1EJ3 A;  4D1E A;  4ICB A;  1MR8 A;  1K94 A;  1SCM B;  3NSI A;  1S3P A;  1TOP A;  3ZNI A;  1AK8 A;  2Y1N A;  4JQ0 D;  5B8I B;  2LVK A;  1CB1 A;  2ZRS A;  1NCX A;  5BPJ A;  2LVJ A;  2HF5 A;  3AAJ A;  1F8H A;  1DF0 B;  1QJT A;  4GNK B;  2KYF A;  1DJX A;  4USL A;  1OE9 B;  3OB2 B;  3HX4 A;  3QRX A;  4MZL A;  1YRT B;  1RWY A;  4PHJ A;  3I5I B;  1NWD A;  2F33 A;  3I5G B;  1WY9 A;  1J1E A;  2BBN A;  2OTG C;  2WC8 A;  1KFX S;  1AUI B;  2JWW A;  4MRX A;  2KI6 C;  5DKR A;  1CFC A;  1UHJ A;  1TRF A;  2M7L A;  1F70 A;  1DT7 B;  1YX8 A;  1XA5 A;  3TUY C;  3BOW B;  2OS8 B;  1B9A A;  3TS5 C;  3SG7 A;  2HPS A;  2MA2 A;  3JVT C;  3KPX A;  3EVU A;  3KHE A;  4C0J A;  1QXP A;  3DF0 B;  3NXA A;  1QVI Y;  3CLN A;  4YI8 A;  1UUR A;  5HLV A;  5AEQ A;  1GJY A;  2K61 A;  1IWQ A;  3BUN B;  3LL8 B;  2KI4 B;  4JWQ A;  2CBL A;  2M3W A;  1UHK A;  2NLN A;  1F4Q A;  1GQM A;  1B8L A;  3DVK A;  1CLB A;  1QVI Z;  2H2K A;  3O78 A;  1J7O A;  1GGZ A;  3BUO B;  1SCM C;  4XJK B;  3VRO A;  4MLW A;  1C07 A;  2MAZ A;  2JNX A;  1AP4 A;  5CSJ A;  2TN4 A;  1S36 A;  1QX7 A;  3WNX B;  1K8U A;  1K96 A;  4I5K A;  1K95 A;  4N5X A;  1SW8 A;  1DJZ A;  1YUR A;  3EK8 A;  3LK0 A;  1Q80 A;  1X02 A;  4I5N B;  3I5I C;  3PN7 B;  1YX7 A;  1NX2 A;  5AER A;  1V1G A;  1DJY A;  1WRZ A;  3EVV A;  2L2E A;  4C0L A;  3PAL A;  4MSP A;  1K9U A;  3BQ3 A;  2ZKM X;  4CLN A;  4UPG A;  4M2Q A;  2M1U A;  1LKJ A;  2KI6 D;  2E30 A;  1JC2 A;  2OS8 C;  3MSE B;  1NX3 A;  2M0R A;  1TNQ A;  1OSA A;  1IKU A;  1BOC A;  1KCY A;  3SG6 A;  1RJV A;  1XVJ A;  1YR5 A;  5HKZ A;  4I5L B;  3H4S E;  1DMO A;  3GK1 A;  1RK9 A;  3DVJ A;  2M8U A;  1S6J A;  2KI4 C;  4PHK A;  4N1G A;  4U8D A;  4M2O A;  1BJF A;  2NXQ A;  5TNC A;  2LMT A;  1SRA A;  2PMY A;  2PVB A;  2FJU B;  2I94 A;  2JTZ A;  3NSL A;  2LUC A;  1Y1U A;  4A4B A;  2BCA A;  2L0P A;  4M2P A;  5ER4 X;  2Y4Q A;  2PSR A;  4ORC B;  2COL B;  1RRO A;  1YVL A;  3GOF A;  2WCE A;  5IBW A;  2GV5 A;  1JF2 A;  1PVB A;  1Y0V H;  2PRU A;  3M0W A;  2I7A A;  3CR4 X;  2B1U A;  1JSA A;  5DKQ A;  2JUL A;  2A4J A;  1MF8 B;  5G08 A;  3NSK A;  1QS7 A;  2FCE A;  3AAK A;  2L4I A;  3O6B A;  2CT9 A;  1S26 D;  4GAO A;  1PVA A;  1CFF A;  1TCF A;  1Y6W A;  1UP5 A;  2O5G A;  2KFG A;  4FTG A;  1JFJ A;  1UHI A;  1VRK A;  2F8P A;  1CKK A;  1U5I A;  4L9M A;  1DGU A;  4OVN F;  3LCP C;  1QX2 A;  4WQ3 A;  2SCP A;  1G33 A;  1SYM A;  4MEW A;  1SL8 A;  1LXF C;  3FWB A;  1XFU O;  4NQG A;  1K90 D;  2JT8 A;  2JU0 A;  1K2H A;  2K7B A;  1PK0 D;  1QX5 B;  5HLO A;  1KFX L;  1RFJ A;  2JTT A;  1ODB A;  3I5H B;  4MBE A;  1NSH A;  1SKT A;  4MVF A;  4OR9 B;  1QV1 A;  1WLZ A;  1WRK A;  2IS9 A;  1QLK A;  2O60 A;  4YGA A;  4AOM A;  3IQQ A;  4MZJ A;  1C7W A;  4YRU A;  4AQI A;  2LCP A;  4ZCV A;  3PAT A;  1M63 B;  1JFK A;  1DJW A;  1A2X A;  3TDI A;  4GGF C;  1CM4 A;  2V53 A;  4F0Z B;  1N0Y A;  4ORB B;  5AXI A;  1TNW A;  1IJ5 A;  2AAO A;  2PAL A;  2BKH B;  2OPO A;  1MXL C;  1YUS A;  1H8B A;  3SG2 A;  1KWO B;  3GK2 A;  2WOS A;  5HYD A; 
#chains in the Genus database with same CATH topology
 3C1V A;  1K93 D;  2JPO A;  4R1E A;  1BG1 A;  1ALW A;  1A03 A;  2LHI A;  1M31 A;  2G2B A;  1QAS A;  2KPH A;  1NIW A;  3CGA A;  4MRY A;  5JOL A;  4HSZ A;  1EL4 A;  2MLE C;  2EC6 C;  2KSP A;  3S0E A;  4QJ3 B;  4CFQ A;  5JJG A;  2KGR A;  1LA3 A;  3RZS A;  3DVE A;  2BE6 A;  1BMO A;  2ZNE A;  1V1F A;  3JTD B;  4PHN A;  3SG3 A;  3D0Y B;  1B7T Y;  2JZI A;  3L4L A;  1EG4 A;  3AKB A;  2BCX A;  3BFB A;  4DRW A;  2AUC A;  1LA0 A;  1OZS A;  1PUL A;  2JT3 A;  3ZWH A;  2L2C A;  3CWG A;  1KSO A;  3I5H C;  4DS7 A;  4OV2 A;  5I2Q A;  5GQQ C;  3BUX B;  4IL1 A;  1IRJ A;  2Y1M A;  1B8C A;  4YI9 A;  3ICB A;  1B7T Z;  4HRE E;  3I5F B;  1XK4 C;  1NPQ A;  1QLS A;  3V2L A;  1BF5 A;  3FWC A;  1ALV A;  2QEV A;  3GK4 X;  4F7F A;  5F6T A;  1OOG A;  2LNK A;  3HCM A;  1EXR A;  3DY9 A;  2H61 C;  2K60 A;  2CTN A;  1EH2 A;  1L7Z A;  1CDM A;  2GGM A;  1J7Q A;  1AHR A;  2M9G A;  5HKY A;  4XYN A;  3I5G C;  2CNP A;  3NSO A;  1E8A A;  4PT1 A;  4BY4 A;  5I2O A;  1FPW A;  1WLM A;  5I8N A;  1QWV A;  1BOD A;  1KWO C;  2H61 A;  2FJY A;  2KBI A;  2PQL A;  5AFP A;  4C0K A;  1CDP A;  1SY9 A;  2AMI A;  4WRI A;  5CSF A;  1F55 A;  2KOT A;  5I94 A;  1TWO A;  1TCO B;  2K7O A;  3D10 A;  2M7N A;  3D78 A;  2KHN A;  2KFF A;  1XFY O;  4FQO A;  1SPY A;  3CZ1 A;  1KK7 Z;  2HET A;  2M97 A;  2KAV A;  3BOW A;  1NUB A;  1XFZ O;  1CTR A;  1S1E A;  2HQ8 A;  4PHM A;  1YRU B;  1QTX A;  1L2O B;  2R2I A;  1A75 B;  1N65 A;  1CMF A;  1PSB A;  1OMV A;  2L51 A;  1DVI A;  3DYE A;  3JTD C;  2NZ0 A;  3B6X A;  3CZT X;  3DF0 A;  3RM1 A;  2EHB A;  1OZO A;  4Q04 A;  4AQJ A;  1B4C A;  2K8M B;  3NHT A;  3UNW A;  2NCO A;  2KLE A;  2LP3 A;  3DVM A;  2LMV A;  3B86 A;  2LVV A;  2F2P A;  4P2Y B;  4YBH B;  1AJ4 A;  4PE4 A;  3I5F C;  1LIN A;  3VRQ A;  1CNP A;  2ZRT A;  4ORA B;  2I2R E;  1MQ1 A;  2VRG A;  4XJK A;  4YGE B;  5DKN A;  3IF7 A;  2KDH A;  2KLD A;  1FI5 A;  1SR6 B;  1QAT A;  2LLU A;  2ZN9 A;  5D7F A;  3IQO A;  3EK7 A;  3SG5 A;  3PM2 A;  3PN7 C;  1Y1X A;  3B88 A;  1MUX A;  2F2O A;  1ZAC A;  1S6C A;  2WCK A;  3DD4 A;  4INX A;  1REC A;  1TTX A;  2ZND A;  2Q91 A;  1WDC B;  3SIA A;  4HRG A;  3E3R A;  4PAL A;  1UHN A;  3BUM B;  3CS1 A;  1JUO A;  1T14 A;  3AKA A;  1TN4 A;  3VRR A;  5CSN A;  1PRW A;  2JXL A;  3LLE A;  1K9P A;  2LMU A;  1C3Z A;  3WHU B;  1QV0 A;  3TS5 B;  1LVC D;  1SL9 A;  3OX5 A;  1J1D A;  3S0A A;  4NDC A;  1B1G A;  2BL0 B;  1CFD A;  1L2O C;  1M45 A;  2FOT A;  2MBX A;  1XFW O;  2K2A A;  3DXL A;  2KAY A;  1W7I B;  3O4Y A;  3OP0 A;  3TZ1 A;  3FE8 A;  3FE6 A;  2FCD A;  4JD9 A;  1YVH A;  3WHT B;  1OQP A;  1CMG A;  1SBJ A;  1JF0 A;  3BJH A;  4DIR A;  1FF1 A;  2WOR A;  2BBM A;  2JOJ A;  2L4H A;  2QDI A;  5K89 A;  2WCF A;  2LLT A;  2LUX A;  3CZ0 A;  2K7D A;  4NDD A;  2LV7 A;  4CPV A;  3SJS A;  3O4X A;  3SS4 A;  4GGF A;  4DCK A;  1KSM A;  2KBM A;  3S0F A;  1TIZ A;  2QEO A;  3BFH A;  3CTN A;  5KSZ A;  1FBV A;  1JFJ A;  1S5G Z;  2JRF A;  4GGN A;  1SNL A;  4QJ4 B;  1PSR A;  2P6B B;  1SR6 C;  2PAS A;  1IJ6 A;  1OMD A;  3PM8 A;  1DJG A;  3RLZ A;  1IH0 A;  3EKJ A;  4YGC B;  3KO0 A;  1CDN A;  2LE9 B;  3K1E A;  1BR1 B;  1NCZ A;  1ZFS A;  1CLM A;  2JXC A;  3PLF B;  1D1O A;  1OOJ A;  2KYC A;  3BYA A;  2WND A;  1XFV O;  1WDC C;  3BXK A;  4I5J A;  3D73 A;  1IGV A;  2M49 B;  1QIV A;  1TNX A;  2L98 A;  2MLF C;  2HQW A;  4BY5 A;  4JKT A;  3O2P A;  1H4B A;  2ISD A;  3SS3 A;  2DOQ A;  3LK1 A;  1J55 A;  2LLS A;  1UHH A;  2CXJ A;  2LAN A;  3FIA A;  4WQ2 A;  4PE7 A;  1SK6 D;  4E68 A;  1KQM B;  3CR5 X;  1CLL A;  2QAC A;  3EK4 A;  5KTY A;  1NP8 A;  2KAX A;  2LC5 A;  2BL0 C;  4YGB B;  4TNC A;  1RTP 1;  2CCM A;  1BR4 B;  5EL2 A;  1JWD A;  1AJ5 A;  2L50 A;  3KEV A;  3TDZ A;  1W7J B;  1NX0 A;  2YGU A;  1A29 A;  2BCB A;  3PJI A;  1XFX O;  4PCW A;  5J3X A;  3SG4 A;  1Y1A A;  5KU1 A;  1F71 A;  4DUQ A;  1J7R A;  3CDN A;  1AVS A;  1XYD A;  2SAS A;  1C7V A;  4MN0 A;  1XK4 A;  2EGD A;  1NCY A;  1DF0 A;  4CID A;  4OZD A;  3VRN A;  4GPL B;  3A4U B;  1IQ3 A;  1HQV A;  4GFT A;  3FS7 A;  2BE4 A;  1SMG A;  1BT6 A;  4PE0 A;  5AAN A;  1KK7 Y;  4FQT A;  4N1F A;  2P71 A;  3F45 A;  1YUU A;  2F3Z A;  2RGI A;  2K0J A;  2LM5 A;  3KF9 A;  1U5I B;  1ZMZ A;  2MHH A;  3CR2 A;  3D77 A;  3EVR A;  1CM1 A;  1OMR A;  2F3Y A;  2MRD A;  2KQY A;  1F4O A;  1KK8 B;  2ZN8 A;  3A8R A;  1SL7 A;  2JPT A;  5PAL A;  2LHL A;  2M1K B;  1QIW A;  2D8N A;  1DEL A;  1M39 A;  5CPV A;  1BU3 A;  2WC5 A;  2QPT A;  2QEH A;  2Y5I A;  2WCB A;  5CSI A;  1S6I A;  4YGD B;  4A4C A;  5FI6 A;  3OBV A;  1ORG A;  4NDB A;  1KQM C;  3EKH A;  4OCI A;  3CAB A;  3K21 A;  2K2F A;  1EG3 A;  5FYX A;  1TUJ A;  4ETO A;  4FTG A;  2JQ6 A;  2KFH A;  5HKW A;  3D0Y A;  1MHO A;  1JBA A;  4CFR A;  1IG5 A;  4MZK A;  3TDU A;  1NYA A;  1PAL A;  2MJW B;  4HRH A;  1MWN A;  1TNP A;  2JNF A;  2LP2 A;  1F54 A;  4ZCU A;  1IQ5 A;  1R2U A;  1BLQ A;  4PE1 A;  1FI6 A;  1HT9 A;  1XO5 A;  4PDZ A;  3PFV A;  1SCV A;  1R6P A;  1A4P A;  1N2D A;  1ZUZ A;  2ERB A;  2BAP A;  2Q4U A;  1KFU L;  2P70 A;  1LS8 A;  2OTG B;  5D3O A;  2M29 A;  5I2L A;  2JC2 A;  2BKI B;  3VRP A;  4QJ5 B;  3Q8I A;  1NX1 A;  1GGW A;  1MXE A;  3TUY B;  1CFP A;  1CDL A;  2I18 A;  2L5X B;  5D69 A;  3SS5 A;  1J7P A;  3SIB A;  1G8I A;  1KK8 C;  1YTZ C;  2KNE A;  1DTL A;  3JVT B;  1G4Y R;  1DJH A;  1UUS A;  2WC6 A;  4GBA A;  1KQV A;  1DJI A;  3D74 A;  2GGZ A;  2G9B A;  2L5Y A;  3OHM B;  5FI2 A;  2KQ6 A;  2NCP A;  2ZFD A;  2KGB C;  3OB1 B;  2EC6 B;  3VGO A;  1UWO A;  3BUW B;  3PSR A;  1WRL A;  1DGV A;  4P5O E;  2LVI A;  2LAP A;  3WXA A;  1YUT A;  1M46 A;  3OX6 A;  2BEC A;  4GUK A;  4OKH A;  1ZOT B;  2K7C A;  1KFU S;  2WCH A;  1B8R A;  1K9K A;  2JT0 A;  4JPZ B;  5DIC A;  5ER5 A;  1FW4 A;  1DC1 A;  1OOI X;  1S5G Y;  1B47 A;  2E6W A;  1A75 A;  1EJ3 A;  4D1E A;  4ICB A;  1MR8 A;  4KYN A;  1K94 A;  1SCM B;  3NSI A;  1S3P A;  1TOP A;  1P28 A;  3ZNI A;  1AK8 A;  2Y1N A;  4JQ0 D;  1GM0 A;  5B8I B;  1TUZ A;  2LVK A;  3DZT A;  1CB1 A;  2WCJ A;  3OGN A;  2ZRS A;  1NCX A;  5BPJ A;  2LVJ A;  2HF5 A;  3AAJ A;  1F8H A;  1DF0 B;  1QJT A;  4GNK B;  2KYF A;  1DJX A;  4USL A;  3NGV A;  1OE9 B;  3OB2 B;  3HX4 A;  3QRX A;  4MZL A;  1YRT B;  1RWY A;  4PHJ A;  3I5I B;  1NWD A;  2F33 A;  3NHI A;  3I5G B;  1WY9 A;  1J1E A;  2BBN A;  2OTG C;  3CZ2 A;  2WC8 A;  1KFX S;  1AUI B;  2JWW A;  4MRX A;  2KI6 C;  5DKR A;  1CFC A;  1UHJ A;  1TRF A;  2M7L A;  1F70 A;  1DT7 B;  1YX8 A;  1XA5 A;  3TUY C;  3BOW B;  3BFA A;  2OS8 B;  1B9A A;  3TS5 C;  3SG7 A;  2HPS A;  2MA2 A;  3S0B A;  3JVT C;  3IVT A;  3EVU A;  3KPX A;  1SSE B;  3KHE A;  4C0J A;  1QXP A;  3DF0 B;  3NXA A;  1QVI Y;  3CLN A;  2WCM A;  4YI8 A;  1UUR A;  5HLV A;  5AEQ A;  1GJY A;  2K61 A;  1IWQ A;  3R1O A;  3BUN B;  3LL8 B;  3R72 A;  3VB1 A;  2KI4 B;  4JWQ A;  2CBL A;  3FE9 A;  2M3W A;  1UHK A;  2NLN A;  1F4Q A;  1GQM A;  1B8L A;  3DVK A;  1CLB A;  1QVI Z;  2H2K A;  3B87 A;  3O78 A;  1J7O A;  1GGZ A;  3BUO B;  1SCM C;  4XJK B;  3VRO A;  4MLW A;  1C07 A;  2MAZ A;  2JNX A;  1AP4 A;  5CSJ A;  2TN4 A;  1S36 A;  1QX7 A;  3WNX B;  2BNX A;  1K8U A;  1K96 A;  4I5K A;  1K95 A;  4N5X A;  1SW8 A;  1DJZ A;  1YUR A;  3EK8 A;  3LK0 A;  1Q80 A;  1X02 A;  4I5N B;  3I5I C;  1OOF A;  1YX7 A;  1NX2 A;  3PN7 B;  5AER A;  5HL1 A;  1V1G A;  1DJY A;  1WRZ A;  3EVV A;  2L2E A;  4C0L A;  3PAL A;  4MSP A;  1IIO A;  1K9U A;  2PYQ A;  3BQ3 A;  2ZKM X;  4CLN A;  4UPG A;  4M2Q A;  2M1U A;  3B7A A;  1LKJ A;  2KI6 D;  2E30 A;  1JC2 A;  2OS8 C;  3MSE B;  1NX3 A;  2M0R A;  1TNQ A;  1OSA A;  1IKU A;  1BOC A;  1KCY A;  3SG6 A;  1RJV A;  1XVJ A;  1YR5 A;  5HKZ A;  4I5L B;  3H4S E;  1DMO A;  3GK1 A;  2QEB A;  1RK9 A;  4INW A;  3DVJ A;  2M8U A;  1S6J A;  2KI4 C;  3CYZ A;  4N1G A;  4PHK A;  4M2O A;  1BJF A;  2NXQ A;  4U8D A;  5TNC A;  2LMT A;  1SRA A;  2PMY A;  2PVB A;  2FJU B;  2I94 A;  2JTZ A;  3NSL A;  2LUC A;  1Y1U A;  4A4B A;  3R1V A;  2BCA A;  2L0P A;  4M2P A;  5ER4 X;  2Y4Q A;  2PSR A;  4ORC B;  2COL B;  1OW4 A;  1RRO A;  1YVL A;  3GOF A;  3L4A A;  2WCE A;  5IBW A;  2GV5 A;  1JF2 A;  1PVB A;  1Y0V H;  2PRU A;  3M0W A;  2I7A A;  3CR4 X;  2B1U A;  3R1P A;  5FI7 A;  5DKQ A;  3UO9 A;  1JSA A;  2JUL A;  2A4J A;  1MF8 B;  5G08 A;  3NSK A;  1QS7 A;  2FCE A;  3AAK A;  3EG5 B;  2L4I A;  3O6B A;  2CT9 A;  1S26 D;  4GAO A;  1PVA A;  1CFF A;  1TCF A;  1Y6W A;  1UP5 A;  1W9Z A;  2KFG A;  2O5G A;  2WCL A;  1UHI A;  1VRK A;  2F8P A;  1CKK A;  1U5I A;  4L9M A;  1DGU A;  4OVN F;  3D75 A;  3LCP C;  1QX2 A;  1C3Y A;  4WQ3 A;  2SCP A;  1G33 A;  1SYM A;  4MEW A;  1SL8 A;  1LXF C;  3FWB A;  1XFU O;  4NQG A;  1K90 D;  2JT8 A;  2JU0 A;  3D76 A;  1DQE A;  1K2H A;  2K7B A;  2GTE A;  1PK0 D;  1QX5 B;  5HLO A;  1KFX L;  1RFJ A;  2JTT A;  4IJ7 A;  1ODB A;  3I5H B;  3QME A;  4MBE A;  1NSH A;  1XFR A;  1SKT A;  2H8V A;  4MVF A;  4OR9 B;  1QV1 A;  1WLZ A;  1WRK A;  2IS9 A;  1QLK A;  2O60 A;  4YGA A;  3S0D A;  4AOM A;  3IQQ A;  4MZJ A;  1C7W A;  4YRU A;  1OOH A;  4AQI A;  2LCP A;  3N7H A;  4ZCV A;  3PAT A;  1M63 B;  1JFK A;  1DJW A;  1Z2C B;  1A2X A;  1Z4H A;  3TDI A;  4GGF C;  1CM4 A;  2V53 A;  4F0Z B;  1N0Y A;  4ORB B;  5AXI A;  1TNW A;  1IJ5 A;  3S0G A;  2AAO A;  2PAL A;  2BKH B;  2OPO A;  1MXL C;  1DEK A;  3L47 A;  1YUS A;  1H8B A;  3SG2 A;  1KWO B;  3GK2 A;  2WOS A;  5HYD A; 
#chains in the Genus database with same CATH homology
 3C1V A;  1K93 D;  4R1E A;  1BG1 A;  1ALW A;  1A03 A;  2LHI A;  1M31 A;  2G2B A;  1QAS A;  3CGA A;  1NIW A;  4MRY A;  5JOL A;  4HSZ A;  1EL4 A;  2MLE C;  2EC6 C;  2KSP A;  4CFQ A;  4QJ3 B;  5JJG A;  2KGR A;  1LA3 A;  3DVE A;  2BE6 A;  1BMO A;  2ZNE A;  1V1F A;  3JTD B;  4PHN A;  3SG3 A;  3D0Y B;  1B7T Y;  2JZI A;  1EG4 A;  3AKB A;  2BCX A;  4DRW A;  2AUC A;  1LA0 A;  1OZS A;  1PUL A;  2JT3 A;  3ZWH A;  3CWG A;  1KSO A;  3I5H C;  4DS7 A;  4OV2 A;  5I2Q A;  5GQQ C;  3BUX B;  4IL1 A;  1IRJ A;  2Y1M A;  1B8C A;  4YI9 A;  3ICB A;  1B7T Z;  4HRE E;  3I5F B;  1XK4 C;  1NPQ A;  1QLS A;  1BF5 A;  3FWC A;  1ALV A;  3GK4 X;  5F6T A;  2LNK A;  3HCM A;  1EXR A;  2H61 C;  1EH2 A;  2CTN A;  1L7Z A;  1CDM A;  2GGM A;  1J7Q A;  1AHR A;  2M9G A;  5HKY A;  4XYN A;  3I5G C;  2CNP A;  3NSO A;  1E8A A;  4BY4 A;  5I2O A;  1FPW A;  1WLM A;  5I8N A;  1BOD A;  1KWO C;  2H61 A;  2KBI A;  5AFP A;  4C0K A;  1CDP A;  1SY9 A;  2AMI A;  4WRI A;  5CSF A;  1F55 A;  2KOT A;  1TCO B;  2K7O A;  3D10 A;  2M7N A;  2KHN A;  2KFF A;  1XFY O;  4FQO A;  1SPY A;  1KK7 Z;  2HET A;  2M97 A;  2KAV A;  3BOW A;  1NUB A;  1XFZ O;  1CTR A;  1S1E A;  2HQ8 A;  4PHM A;  1YRU B;  1QTX A;  1L2O B;  2R2I A;  1A75 B;  1N65 A;  1CMF A;  1PSB A;  1OMV A;  2L51 A;  1DVI A;  3JTD C;  2NZ0 A;  3CZT X;  3DF0 A;  3RM1 A;  2EHB A;  1OZO A;  4Q04 A;  4AQJ A;  1B4C A;  2K8M B;  2NCO A;  2LP3 A;  3DVM A;  2LMV A;  2LVV A;  2F2P A;  4P2Y B;  4YBH B;  1AJ4 A;  4PE4 A;  3I5F C;  1LIN A;  3VRQ A;  1CNP A;  2ZRT A;  4ORA B;  2I2R E;  1MQ1 A;  2VRG A;  4XJK A;  4YGE B;  5DKN A;  3IF7 A;  2KDH A;  1FI5 A;  1SR6 B;  1QAT A;  2LLU A;  2ZN9 A;  5D7F A;  3IQO A;  3EK7 A;  3SG5 A;  3PN7 C;  1Y1X A;  1MUX A;  2F2O A;  1ZAC A;  1S6C A;  3DD4 A;  1REC A;  1TTX A;  2ZND A;  2Q91 A;  1WDC B;  3SIA A;  4HRG A;  3E3R A;  4PAL A;  1UHN A;  3BUM B;  3CS1 A;  1JUO A;  3VRR A;  3AKA A;  1TN4 A;  5CSN A;  1PRW A;  2JXL A;  3LLE A;  1K9P A;  2LMU A;  3WHU B;  1QV0 A;  3TS5 B;  1LVC D;  1SL9 A;  3OX5 A;  1J1D A;  4NDC A;  1B1G A;  2BL0 B;  1CFD A;  1L2O C;  1M45 A;  2FOT A;  2MBX A;  1XFW O;  2K2A A;  2KAY A;  1W7I B;  3O4Y A;  3OP0 A;  3TZ1 A;  2FCD A;  1YVH A;  3WHT B;  1OQP A;  1CMG A;  1SBJ A;  1JF0 A;  4DIR A;  1FF1 A;  2WOR A;  2BBM A;  2JOJ A;  2L4H A;  5K89 A;  2WCF A;  2LLT A;  2LUX A;  2K7D A;  4NDD A;  2LV7 A;  4CPV A;  3SJS A;  4DCK A;  4GGF A;  1KSM A;  2KBM A;  1TIZ A;  3CTN A;  5KSZ A;  1FBV A;  1S5G Z;  2JRF A;  4GGN A;  1SNL A;  4QJ4 B;  1PSR A;  2P6B B;  1SR6 C;  2PAS A;  1IJ6 A;  1OMD A;  3PM8 A;  1DJG A;  3RLZ A;  1IH0 A;  3EKJ A;  4YGC B;  3KO0 A;  1CDN A;  2LE9 B;  1BR1 B;  1NCZ A;  1ZFS A;  1CLM A;  2JXC A;  3PLF B;  1D1O A;  1OOJ A;  2KYC A;  3BYA A;  2WND A;  1XFV O;  1WDC C;  3BXK A;  4I5J A;  1IGV A;  2M49 B;  1QIV A;  1TNX A;  2L98 A;  2MLF C;  2HQW A;  4BY5 A;  3O2P A;  1H4B A;  2ISD A;  2DOQ A;  3LK1 A;  1J55 A;  2LLS A;  1UHH A;  2CXJ A;  2LAN A;  3FIA A;  4WQ2 A;  4PE7 A;  1SK6 D;  4E68 A;  1KQM B;  3CR5 X;  1CLL A;  2QAC A;  3EK4 A;  5KTY A;  1NP8 A;  2KAX A;  2LC5 A;  2BL0 C;  4YGB B;  4TNC A;  1RTP 1;  2CCM A;  1BR4 B;  1JWD A;  1AJ5 A;  2L50 A;  3KEV A;  3TDZ A;  1W7J B;  1NX0 A;  1A29 A;  2BCB A;  4PCW A;  1XFX O;  5J3X A;  3SG4 A;  1Y1A A;  5KU1 A;  1F71 A;  4DUQ A;  1J7R A;  1AVS A;  1XYD A;  2SAS A;  1C7V A;  4MN0 A;  1XK4 A;  2EGD A;  1NCY A;  1DF0 A;  4CID A;  3VRN A;  4GPL B;  3A4U B;  1IQ3 A;  1HQV A;  4GFT A;  3FS7 A;  2BE4 A;  1SMG A;  1BT6 A;  4PE0 A;  5AAN A;  1KK7 Y;  4N1F A;  3F45 A;  1YUU A;  2F3Z A;  2RGI A;  2K0J A;  2LM5 A;  1U5I B;  1ZMZ A;  2MHH A;  3CR2 A;  3EVR A;  1CM1 A;  1OMR A;  2F3Y A;  2MRD A;  2KQY A;  1F4O A;  1KK8 B;  2ZN8 A;  3A8R A;  1SL7 A;  2JPT A;  5PAL A;  2LHL A;  2M1K B;  1QIW A;  2D8N A;  1M39 A;  5CPV A;  1BU3 A;  2QPT A;  2Y5I A;  2WCB A;  5CSI A;  1S6I A;  4YGD B;  4A4C A;  4NDB A;  1KQM C;  3EKH A;  4OCI A;  3K21 A;  2K2F A;  1EG3 A;  5FYX A;  4ETO A;  2JQ6 A;  2KFH A;  5HKW A;  3D0Y A;  1MHO A;  1JBA A;  4CFR A;  1IG5 A;  4MZK A;  3TDU A;  1NYA A;  1PAL A;  2MJW B;  4HRH A;  1MWN A;  1TNP A;  2JNF A;  2LP2 A;  1F54 A;  4ZCU A;  1IQ5 A;  1R2U A;  1BLQ A;  4PE1 A;  1FI6 A;  1HT9 A;  1XO5 A;  4PDZ A;  3PFV A;  1SCV A;  1R6P A;  1A4P A;  1N2D A;  1ZUZ A;  2Q4U A;  1KFU L;  2OTG B;  2M29 A;  5I2L A;  2JC2 A;  2BKI B;  3VRP A;  4QJ5 B;  1NX1 A;  1GGW A;  1MXE A;  3TUY B;  1CFP A;  1CDL A;  2I18 A;  2L5X B;  5D69 A;  1J7P A;  3SIB A;  1G8I A;  1KK8 C;  1YTZ C;  2KNE A;  1DTL A;  3JVT B;  1G4Y R;  1DJH A;  1UUS A;  3KF9 A;  4GBA A;  1KQV A;  1DJI A;  2GGZ A;  2G9B A;  3OHM B;  2KQ6 A;  2NCP A;  2ZFD A;  2KGB C;  3OB1 B;  2EC6 B;  3VGO A;  1UWO A;  3BUW B;  3PSR A;  1WRL A;  1DGV A;  4P5O E;  2LVI A;  2LAP A;  3WXA A;  1YUT A;  1M46 A;  3OX6 A;  2BEC A;  4GUK A;  4OKH A;  1ZOT B;  2K7C A;  1KFU S;  1B8R A;  1K9K A;  2JT0 A;  4JPZ B;  5ER5 A;  1FW4 A;  1S5G Y;  1B47 A;  2E6W A;  1A75 A;  1EJ3 A;  4D1E A;  4ICB A;  1MR8 A;  1K94 A;  1SCM B;  3NSI A;  1S3P A;  1TOP A;  3ZNI A;  1AK8 A;  2Y1N A;  4JQ0 D;  5B8I B;  2LVK A;  1CB1 A;  2ZRS A;  1NCX A;  5BPJ A;  2LVJ A;  2HF5 A;  3AAJ A;  1F8H A;  1DF0 B;  1QJT A;  4GNK B;  2KYF A;  1DJX A;  4USL A;  1OE9 B;  3OB2 B;  3HX4 A;  3QRX A;  4MZL A;  1YRT B;  1RWY A;  4PHJ A;  3I5I B;  1NWD A;  2F33 A;  3I5G B;  1WY9 A;  1J1E A;  2BBN A;  2OTG C;  2WC8 A;  1KFX S;  1AUI B;  2JWW A;  4MRX A;  2KI6 C;  5DKR A;  1CFC A;  1UHJ A;  1TRF A;  2M7L A;  1F70 A;  1DT7 B;  1YX8 A;  1XA5 A;  3TUY C;  3BOW B;  2OS8 B;  1B9A A;  3TS5 C;  3SG7 A;  2HPS A;  2MA2 A;  3JVT C;  3KPX A;  3EVU A;  3KHE A;  4C0J A;  1QXP A;  3DF0 B;  3NXA A;  1QVI Y;  3CLN A;  4YI8 A;  1UUR A;  5HLV A;  5AEQ A;  1GJY A;  2K61 A;  1IWQ A;  3BUN B;  3LL8 B;  2KI4 B;  4JWQ A;  2CBL A;  2M3W A;  1UHK A;  2NLN A;  1F4Q A;  1GQM A;  1B8L A;  3DVK A;  1CLB A;  1QVI Z;  2H2K A;  3O78 A;  1J7O A;  1GGZ A;  3BUO B;  1SCM C;  4XJK B;  3VRO A;  4MLW A;  1C07 A;  2MAZ A;  2JNX A;  1AP4 A;  5CSJ A;  2TN4 A;  1S36 A;  1QX7 A;  3WNX B;  1K8U A;  1K96 A;  4I5K A;  1K95 A;  4N5X A;  1SW8 A;  1DJZ A;  1YUR A;  3EK8 A;  3LK0 A;  1Q80 A;  1X02 A;  4I5N B;  3I5I C;  3PN7 B;  1YX7 A;  1NX2 A;  5AER A;  1V1G A;  1DJY A;  1WRZ A;  3EVV A;  2L2E A;  4C0L A;  3PAL A;  4MSP A;  1K9U A;  3BQ3 A;  2ZKM X;  4CLN A;  4UPG A;  4M2Q A;  2M1U A;  1LKJ A;  2KI6 D;  2E30 A;  1JC2 A;  2OS8 C;  3MSE B;  1NX3 A;  2M0R A;  1TNQ A;  1OSA A;  1IKU A;  1BOC A;  1KCY A;  3SG6 A;  1RJV A;  1XVJ A;  1YR5 A;  5HKZ A;  4I5L B;  3H4S E;  1DMO A;  3GK1 A;  1RK9 A;  3DVJ A;  2M8U A;  1S6J A;  2KI4 C;  4PHK A;  4N1G A;  4U8D A;  4M2O A;  1BJF A;  2NXQ A;  5TNC A;  2LMT A;  1SRA A;  2PMY A;  2PVB A;  2FJU B;  2I94 A;  2JTZ A;  3NSL A;  2LUC A;  1Y1U A;  4A4B A;  2BCA A;  2L0P A;  4M2P A;  5ER4 X;  2Y4Q A;  2PSR A;  4ORC B;  2COL B;  1RRO A;  1YVL A;  3GOF A;  2WCE A;  5IBW A;  2GV5 A;  1JF2 A;  1PVB A;  1Y0V H;  2PRU A;  3M0W A;  2I7A A;  3CR4 X;  2B1U A;  1JSA A;  5DKQ A;  2JUL A;  2A4J A;  1MF8 B;  5G08 A;  3NSK A;  1QS7 A;  2FCE A;  3AAK A;  2L4I A;  3O6B A;  2CT9 A;  1S26 D;  4GAO A;  1PVA A;  1CFF A;  1TCF A;  1Y6W A;  1UP5 A;  2O5G A;  2KFG A;  4FTG A;  1JFJ A;  1UHI A;  1VRK A;  2F8P A;  1CKK A;  1U5I A;  4L9M A;  1DGU A;  4OVN F;  3LCP C;  1QX2 A;  4WQ3 A;  2SCP A;  1G33 A;  1SYM A;  4MEW A;  1SL8 A;  1LXF C;  3FWB A;  1XFU O;  4NQG A;  1K90 D;  2JT8 A;  2JU0 A;  1K2H A;  2K7B A;  1PK0 D;  1QX5 B;  5HLO A;  1KFX L;  1RFJ A;  2JTT A;  1ODB A;  3I5H B;  4MBE A;  1NSH A;  1SKT A;  4MVF A;  4OR9 B;  1QV1 A;  1WLZ A;  1WRK A;  2IS9 A;  1QLK A;  2O60 A;  4YGA A;  4AOM A;  3IQQ A;  4MZJ A;  1C7W A;  4YRU A;  4AQI A;  2LCP A;  4ZCV A;  3PAT A;  1M63 B;  1JFK A;  1DJW A;  1A2X A;  3TDI A;  4GGF C;  1CM4 A;  2V53 A;  4F0Z B;  1N0Y A;  4ORB B;  5AXI A;  1TNW A;  1IJ5 A;  2AAO A;  2PAL A;  2BKH B;  2OPO A;  1MXL C;  1YUS A;  1H8B A;  3SG2 A;  1KWO B;  3GK2 A;  2WOS A;  5HYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...