1B8RA

Parvalbumin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDEWTALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
molecule tags Calcium binding protein
total genus 41
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b8rA00
1XFYO 3BUOB 3ICBA 2KI4C 3BQ3A 4XJKB 3O6BA 2BBNA 3JTDC 2K2AA 1YRTB 2L98A 4MZLA 1BU3A 3NSLA 4AQIA 1CFFA 1PVAA 4CIDA 4L9MA 3CR2A 2LMUA 1RJVA 3A8RA 1AVSA 2Y1MA 1K9PA 2K7OA 3SIBA 2LP2A 1F70A 1L7ZA 1NYAA 3A4UB 1YUUA 1JUOA 2LE9B 2MLEC 2WORA 3EKHA 1TRFA 2K2FA 1S6CA 3FS7A 2TN4A 3VRNA 1IRJA 3SG6A 1OSAA 1NWDA 3ZWHA 2SCPA 1XFWO 1R2UA 2G9BA 2KOTA 3PN7B 3F45A 3EKJA 1FBVA 1Q80A 1EH2A 2KBMA 2K8MB 1UHNA 2ZN9A 5TNCA 5HKWA 1OMDA 1F71A 2H2KA 1NP8A 2JT0A 4PHKA 5KU1A 1ALWA 1NUBA 2JXLA 1CFCA 2LUXA 1LA0A 1OMRA 1SY9A 4R1EA 1G33A 4JQ0D 4BY4A 1NSHA 2H61C 3H4SE 3PATA 3I5FB 1J7QA 2WCEA 1SCMB 4N5XA 3I5IB 1DGUA 1TCFA 1IQ5A 5HKZA 5I2LA 1SNLA 1PK0D 1UUSA 2MAZA 1S1EA 4HREE 2LCPA 3RLZA 4E68A 2KBIA 1IGVA 3I5GC 1Y1UA 1QS7A 2BE6A 3BYAA 1TNQA 5I2OA 1DGVA 1AP4A 1KFUL 4MLWA 3DF0A 5ER5A 3TDZA 4GNKB 3TDUA 1K2HA 1LXFC 3BOWA 2Q4UA 2I7AA 2M49B 2SASA 2KDHA 2BL0C 3OB1B 2I18A 1A4PA 2KFHA 1NX1A 1A29A 2KAYA 2KI6C 1BJFA 1KCYA 1ALVA 1HT9A 2L2EA 1ZMZA 1LA3A 2LP3A 1DJZA 4GGFC 1WDCB 1YVHA 2JTTA 3VRRA 1KSOA 4I5NB 1QLKA 4OR9B 2OTGB 3WXAA 4A4CA 4ORBB 3AAKA 3OX6A 2F2PA 1SMGA 3O78A 5KSZA 1EJ3A 2B1UA 3CTNA 5HYDA 4MBEA 3O4YA 1CM1A 4GGNA 3OP0A 1QTXA 2F3ZA 1KSMA 2K7BA 5AEQA 3RM1A 2JOJA 2KFFA 2MA2A 2PSRA 5AERA 2M0RA 1MHOA 2CNPA 2L50A 2JULA 1CFDA 2VRGA 1A75B 4PHMA 4PHNA 2KNEA 4OVNF 2LLTA 2EC6C 1IG5A 2KAVA 1TNXA 1BOCA 1TNWA 1OMVA 2MRDA 1UHJA 5D7FA 4TNCA 3SG4A 1KFXS 1NX3A 3BUNB 2JNFA 2GV5A 1W7JB 1YVLA 2H61A 3TDIA 2DOQA 4MEWA 4USLA 4HRHA 4I5JA 1XFZO 3SJSA 1AUIB 3VRPA 1MQ1A 2BKHB 2WOSA 4MVFA 1EL4A 4M2PA 4GAOA 1PVBA 1YX7A 4GPLB 4I5KA 4JWQA 5F6TA 4CLNA 2JC2A 1MUXA 2ZNEA 1NX2A 3GK2A 1SK6D 2F8PA 1UHIA 5HLVA 2LM5A 2ZN8A 2MLFC 3AKAA 2ZRTA 1U5IA 2BE4A 4UPGA 4PALA 1WRZA 1KK8B 1KQMB 1DTLA 5D69A 2KQYA 3CZTX 5I2QA 1CMFA 1M46A 1NCXA 3KEVA 1L2OC 3SG5A 4P5OE 2K61A 1JF2A 1W7IB 2MBXA 3K21A 1ZUZA 3QRXA 1CKKA 1S26D 1OOJA 2M7LA 5KTYA 4Q04A 2HETA 1Y6WA 5J3XA 2L4HA 2KAXA 3WNXB 5HKYA 1SW8A 4PCWA 3NSIA 1SR6B 4C0JA 2V53A 4ZCUA 1B9AA 1BF5A 4NQGA 2BCBA 1BT6A 3KO0A 3BXKA 4ICBA 2L0PA 1TTXA 1G4YR 4PHJA 1GJYA 5DKRA 4CPVA 1DJXA 1OZOA 4N1FA 1JFJA 1FW4A 2M9GA 3LCPC 1CFPA 1K95A 1BR1B 2CBLA 2Y1NA 3FWBA 1SRAA 1S36A 4YBHB 1JFKA 1F55A 2CCMA 3I5FC 4OCIA 3I5IC 4YGEB 3EVVA 3DD4A 2PASA 1CDNA 1C7VA 2CXJA 4YGDB 4PDZA 1N2DA 3PM8A 4WRIA 1G8IA 2LVVA 3DF0B 2NCOA 3IQQA 1KFXL 1UP5A 3KHEA 2KYCA 3BOWB 1IQ3A 3D10A 2LANA 1B8CA 1J55A 5ER4X 1SPYA 1S6JA 2ZKMX 2LHIA 3CGAA 3LK1A 5IBWA 3CWGA 5CPVA 2P6BB 3PALA 2LC5A 2KI4B 2JTZA 4ZCVA 1GGZA 1FI6A 1TN4A 4PE0A 3JTDB 2NZ0A 2KGBC 2PMYA 1Y1AA 2BBMA 3C1VA 2BCAA 2R2IA 2NCPA 1DT7B 2HQWA 1AHRA 4ORCB 1J7RA 3WHUB 2HF5A 1FF1A 2EHBA 1K9UA 4NDCA 1RWYA 2JWWA 1WLZA 2BKIB 3M0WA 2M8UA 1RROA 2LLSA 5CSNA 1SL9A 5DKNA 1CLLA 2ZNDA 1S3PA 4MZJA 1CLBA 2Y5IA 1K93D 2QPTA 1XVJA 1EG4A 1J7OA 1YX8A 5K89A 3EVRA 2LMTA 2MHHA 2O60A 3CR5X 1E8AA 3SIAA 1F8HA 4ORAB 1TNPA 2LV7A 1SYMA 2JNXA 3ZNIA 1BLQA 1GGWA 3HX4A 1YUSA 4CFRA 3CLNA 3GK4X 2WC8A 1LKJA 1ZFSA 2AAOA 5JOLA 1A03A 2LAPA 1MWNA 4N1GA 3CR4X 1CLMA 1CB1A 1VRKA 1M31A 5CSJA 1PSBA 3OX5A 4P2YB 1KWOC 1J7PA 2KHNA 3JVTC 1BG1A 1MF8B 3TUYC 3I5GB 2I94A 1IWQA 2OS8B 1U5IB 1KQVA 3LLEA 3DVKA 1WLMA 1RK9A 2LHLA 1PSRA 1MXEA 4GBAA 1LVCD 1QIVA 1UWOA 2HPSA 2M1KB 2E6WA 3EK7A 2LLUA 3IQOA 2WCBA 4YGBB 1B7TZ 3HCMA 2LVJA 2BL0B 3EVUA 1KK8C 2E30A 2OPOA 1JWDA 1KQMC 2JZIA 4YI9A 1OZSA 3SG7A 1M45A 1B7TY 1PALA 1R6PA 2JRFA 2K7DA 1X02A 3BUXB 3KF9A 3PLFB 1BR4B 4MRYA 5B8IB 1C7WA 1BODA 1QASA 1PRWA 4GUKA 1IKUA 1CDMA 1TOPA 1NX0A 1MXLC 2JT3A 1B4CA 2L51A 3IF7A 1K90D 4U8DA 1Y1XA 2HQ8A 3DVJA 2NLNA 1V1GA 3E3RA 1DJGA 4QJ5B 3VRQA 4WQ2A 1M39A 1DJHA 2F3YA 4MSPA 1GQMA 3NXAA 2LUCA 3D0YA 4WQ3A 5AANA 3SG2A 1KK7Z 4MRXA 1UURA 5CSFA 1WRLA 1TCOB 1S5GZ 2KYFA 4C0KA 2GGZA 4GGFA 4MZKA 1B47A 3I5HB 3TS5B 3PSRA 3PN7C 1QVIZ 1S5GY 4AOMA 2LVIA 3FWCA 2KFGA 4MN0A 4A4BA 1F54A 2ISDA 1WY9A 1DF0A 3WHTB 2MJWB 1XK4C 1M63B 1AK8A 2M7NA 4D1EA 1K94A 1IJ6A 2M3WA 1QIWA 1IJ5A 1IH0A 1SCMC 5AFPA 1UHKA 2FCEA 2WNDA 1QJTA 2FCDA 3PFVA 3CS1A 1YURA 3TZ1A 1A2XA 4CFQA 2ZFDA 1L2OB 1NIWA 1BMOA 5BPJA 2BCXA 3GOFA 3VROA 4OV2A 4DIRA 4QJ3B 5HLOA 2CT9A 1NCYA 2PRUA 2QACA 2EGDA 4NDBA 1JF0A 3OB2B 1RTP1 3AKBA 2M29A 1NPQA 4YRUA 3DVEA 1MR8A 5PALA 2GGMA 4XJKA 2LMVA 2O5GA 4BY5A 4DUQA 3EK8A 2G2BA 2NXQA 2BECA 1SCVA 3BUMB 3GK1A 1WDCC 2PALA 1YR5A 4IL1A 2M97A 4AQJA 2FOTA 2OTGC 4JPZB 3LK0A 1D1OA 1FPWA 1YTZC 4HSZA 1C07A 2CTNA 2L4IA 2KSPA 2L5XB 1SKTA 1JSAA 2JT8A 4HRGA 3NSKA 1OQPA 2JXCA 1J1EA 1H8BA 2A4JA 4C0LA 1JC2A 2OS8C 1DJYA 1JBAA 1ODBA 5I8NA 1RFJA 2ZRSA 1QXPA 1TIZA 1XFVO 2AMIA 1QX2A 1XK4A 1S6IA 1K96A 1UHHA 2D8NA 1WRKA 1F4QA 2KI6D 4F0ZB 4YI8A 5G08A 2LNKA 1DJWA 2RGIA 2JQ6A 4FQOA 1RECA 1NCZA 1XYDA 2K0JA 4I5LB 1K9KA 1AJ4A 1QX5B 1K8UA 5GQQC 5JJGA 2JPTA 1QV1A 1QLSA 3D0YB 2M1UA 2FJUB 2Y4QA 1CM4A 4GFTA 4XYNA 1F4OA 4DS7A 1CNPA 2COLB 1LINA 4PE1A 1DJIA 3OHMB 3O2PA 1EG3A 1FI5A 1QX7A 2AUCA 2Q91A 4FTGA 1DMOA 1YRUB 1B8RA 1ZACA 3LL8B 1HQVA 3AAJA 4M2OA 1XFXO 2JU0A 3FIAA 1ZOTB 1N65A 1CMGA 1PULA 1DF0B 3I5HC 4M2QA 4DRWA 1CDPA 4DCKA 1SBJA 3TS5C 3EK4A 1XA5A 1KWOB 1SR6C 1YUTA 1XO5A 5AXIA 1QV0A 3JVTB 4ETOA 2F33A 3TUYB 1DVIA 3SG3A 1CDLA 5DKQA 3KPXA 1Y0VH 1AJ5A 1QATA 3MSEB 4PE4A 2EC6B 2I2RE 1SL7A 1CTRA 1EXRA 4NDDA 2WCFA 1B8LA 1KK7Y 4YGAA 2K7CA 2KQ6A 5CSIA 1A75A 2LVKA 3VGOA 3DVMA 4OKHA 1V1FA 2IS9A 4PE7A 3BUWB 5FYXA 1H4BA 1KFUS 3NSOA 4YGCB 2F2OA 1B1GA 4QJ4B 1SL8A 1J1DA 1QVIY 1XFUO 2PVBA 1N0YA 2KGRA 1OE9B
chains in the Genus database with same CATH superfamily
1XFYO 3BUOB 3ICBA 2KI4C 3BQ3A 4XJKB 3O6BA 2BBNA 3CYZA 3JTDC 3PM2A 2K2AA 1YRTB 2L98A 4MZLA 1BU3A 3NSLA 4AQIA 1CFFA 1PVAA 2PQLA 2QEHA 4L9MA 3CR2A 4CIDA 2LMUA 1RJVA 3A8RA 1AVSA 2Y1MA 1K9PA 2K7OA 3SIBA 2LP2A 1F70A 1L7ZA 1NYAA 2P71A 3A4UB 1YUUA 1JUOA 2LE9B 2MLEC 2WORA 3EKHA 3S0BA 1TRFA 2K2FA 1S6CA 3FS7A 2TN4A 3VRNA 1IRJA 3SG6A 1OSAA 1NWDA 3B7AA 2QEOA 3BFAA 2SCPA 3ZWHA 1XFWO 1R2UA 2G9BA 2KOTA 3PN7B 3F45A 3EKJA 1FBVA 1Q80A 1EH2A 2KBMA 2K8MB 1UHNA 3QMEA 3SS3A 2ZN9A 5TNCA 5HKWA 1OMDA 3DZTA 1F71A 2H2KA 1NP8A 2JT0A 4INWA 4PHKA 5KU1A 1DELA 1ALWA 1NUBA 2JXLA 4JKTA 1CFCA 2LUXA 1LA0A 1OMRA 1SY9A 4R1EA 1G33A 4JQ0D 5D3OA 1NSHA 2H61C 3H4SE 3PATA 3I5FB 1J7QA 2WCEA 1SCMB 4N5XA 3I5IB 1DGUA 3PJIA 1TCFA 3D74A 1IQ5A 5HKZA 5I2LA 2WCMA 1SNLA 1PK0D 1UUSA 2MAZA 1S1EA 4HREE 3B87A 4F7FA 2LCPA 3RLZA 2QEVA 4E68A 2KBIA 1IGVA 3SS5A 3I5GC 1Y1UA 1QS7A 2BE6A 3BYAA 1TNQA 5I2OA 1DGVA 1AP4A 1KFUL 4MLWA 3DF0A 5ER5A 3TDZA 1T14A 4GNKB 3TDUA 1K2HA 1LXFC 3BOWA 2Q4UA 2H8VA 2I7AA 2M49B 3D77A 2SASA 2KDHA 2BL0C 3OB1B 1GM0A 2I18A 1A4PA 2KFHA 1NX1A 1A29A 2KAYA 2KI6C 1BJFA 1KCYA 1ALVA 1HT9A 1P28A 2L2EA 1ZMZA 1LA3A 2LP3A 1DJZA 4GGFC 1WDCB 1YVHA 2JTTA 3VRRA 1KSOA 4I5NB 1QLKA 5FI6A 4OR9B 1DQEA 2OTGB 3WXAA 3CZ2A 2WCLA 3AAKA 3OX6A 4ORBB 4A4CA 2F2PA 1SMGA 3O78A 1TWOA 5KSZA 1EJ3A 2B1UA 3CTNA 4JD9A 5HYDA 4MBEA 3O4YA 1CM1A 4GGNA 3OP0A 1QTXA 3K1EA 2F3ZA 1KSMA 2K7BA 5AEQA 3RM1A 2JOJA 2KFFA 3S0GA 3Q8IA 2MA2A 2PSRA 5AERA 2M0RA 1MHOA 2CNPA 2L50A 4KYNA 1TUJA 2JULA 1CFDA 2VRGA 1A75B 4PHMA 4PHNA 2KNEA 4OVNF 2LLTA 2EC6C 1IG5A 2KAVA 1TNXA 3CZ1A 1TNWA 1OMVA 1BOCA 2MRDA 1UHJA 5D7FA 2WC5A 4TNCA 3SG4A 2WCJA 1KFXS 3IVTA 1NX3A 3BUNB 2JNFA 2GV5A 1W7JB 1YVLA 2H61A 3TDIA 2DOQA 4MEWA 4USLA 4HRHA 4I5JA 1XFZO 3SJSA 1AUIB 3VRPA 1MQ1A 2BKHB 2WOSA 4MVFA 1EL4A 4M2PA 4GAOA 1PVBA 1YX7A 4GPLB 4I5KA 4JWQA 5F6TA 4CLNA 2JC2A 1MUXA 2ZNEA 1NX2A 3GK2A 1SK6D 2F8PA 1UHIA 5HLVA 2LM5A 2ZN8A 2MLFC 3AKAA 2ZRTA 1U5IA 2BE4A 4UPGA 3S0FA 4PALA 1WRZA 1KK8B 1KQMB 1DTLA 5D69A 2KQYA 3CZTX 5I2QA 1CMFA 1M46A 1NCXA 3B86A 3KEVA 1L2OC 2L2CA 3SG5A 4P5OE 2K61A 1JF2A 1W7IB 2MBXA 3CDNA 3K21A 1ZUZA 3QRXA 1CKKA 1S26D 1OOJA 2M7LA 5KTYA 4Q04A 2HETA 4INXA 1Y6WA 5J3XA 2YGUA 2L4HA 2KAXA 3WNXB 5HKYA 1SW8A 4PCWA 2ERBA 3NSIA 1SR6B 2KPHA 2V53A 4C0JA 4ZCUA 1B9AA 1BF5A 4NQGA 2BCBA 1BT6A 3KO0A 3BXKA 4ICBA 2L0PA 1TTXA 1G4YR 4PHJA 1GJYA 5DKRA 4CPVA 1DJXA 1OZOA 4N1FA 1JFJA 1FW4A 2M9GA 3LCPC 1CFPA 1K95A 1BR1B 2CBLA 2Y1NA 3FWBA 1SRAA 1S36A 4YBHB 1JFKA 1F55A 2CCMA 3I5FC 4OCIA 3I5IC 4YGEB 3EVVA 3DD4A 2PASA 1CDNA 1C7VA 3RZSA 2CXJA 4YGDB 4PDZA 1N2DA 3PM8A 4WRIA 1G8IA 2LVVA 3DF0B 2NCOA 3IQQA 1KFXL 1UP5A 3KHEA 2KYCA 3BOWB 4FQTA 1IQ3A 3D10A 2LANA 1B8CA 1J55A 5ER4X 1SPYA 1S6JA 2ZKMX 2LHIA 3CGAA 3LK1A 5HL1A 3CWGA 5CPVA 2P6BB 3S0DA 3PALA 2LC5A 2KI4B 2JTZA 4ZCVA 1GGZA 1FI6A 1TN4A 4PE0A 3JTDB 2NZ0A 2KGBC 2PMYA 1Y1AA 2BBMA 3C1VA 2BCAA 2R2IA 2NCPA 1DT7B 3VB1A 2HQWA 1AHRA 3S0AA 5EL2A 1OOGA 4ORCB 1J7RA 3WHUB 1LS8A 2HF5A 1FF1A 2EHBA 1K9UA 4NDCA 1RWYA 2JWWA 2KLDA 1WLZA 3OGNA 2BKIB 1OOIX 3M0WA 2M8UA 1RROA 2LLSA 5CSNA 1SL9A 3R72A 5DKNA 1CLLA 2ZNDA 1S3PA 4MZJA 1CLBA 2Y5IA 1K93D 2QPTA 1XVJA 1EG4A 1J7OA 1YX8A 5K89A 3EVRA 2LMTA 2MHHA 2O60A 1OOHA 1E8AA 3CR5X 3SIAA 4ORAB 1TNPA 2LV7A 1F8HA 1SYMA 2JNXA 3ZNIA 1BLQA 1GGWA 3HX4A 1YUSA 4CFRA 3CLNA 3GK4X 2WC8A 3B88A 1LKJA 1OW4A 1ZFSA 2AAOA 3FE8A 5JOLA 2LAPA 1A03A 1DEKA 1MWNA 3R1PA 4N1GA 3CR4X 1CLMA 2L5YA 1VRKA 1CB1A 1M31A 5CSJA 1PSBA 3OX5A 4P2YB 1KWOC 1J7PA 3NGVA 2KHNA 3JVTC 1ORGA 1MF8B 3TUYC 1BG1A 3I5GB 2I94A 1IWQA 2OS8B 1TUZA 1U5IB 1KQVA 3LLEA 3DVKA 1WLMA 1RK9A 2LHLA 2BNXA 1PSRA 1MXEA 4GBAA 1LVCD 1QIVA 1UWOA 2HPSA 2M1KB 2E6WA 3EK7A 2LLUA 3IQOA 2WCBA 3R1OA 4YGBB 1B7TZ 3HCMA 2LVJA 2BL0B 3EVUA 3L47A 3CZ0A 1KK8C 2E30A 2OPOA 1JWDA 1KQMC 2WC6A 2JZIA 4YI9A 1OZSA 3SG7A 1M45A 2BAPA 1B7TY 1PALA 5I94A 1R6PA 2JRFA 2JPOA 1X02A 2K7DA 3BUXB 3KF9A 1BR4B 3PLFB 4MRYA 1C7WA 5B8IB 1BODA 1QASA 1PRWA 4GUKA 1IKUA 1CDMA 1TOPA 1NX0A 1MXLC 2JT3A 1B4CA 2L51A 3IF7A 1K90D 4U8DA 1Y1XA 2HQ8A 3DVJA 2NLNA 1V1GA 3E3RA 1DJGA 4QJ5B 3VRQA 4WQ2A 3NHTA 1M39A 1DJHA 2F3YA 4MSPA 1GQMA 3NXAA 2LUCA 3D0YA 4WQ3A 5AANA 4IJ7A 3SG2A 1KK7Z 4MRXA 1UURA 3O4XA 1WRLA 5CSFA 1TCOB 1S5GZ 2KYFA 4C0KA 2GGZA 4GGFA 4MZKA 1B47A 3I5HB 3TS5B 3B6XA 3DY9A 3PSRA 3DXLA 3PN7C 1QVIZ 1S5GY 4AOMA 2LVIA 3FWCA 2KFGA 3OBVA 4MN0A 4A4BA 2ISDA 1F54A 1WY9A 1DF0A 3WHTB 2MJWB 1XK4C 1M63B 1AK8A 2M7NA 4D1EA 1K94A 1IJ6A 3CABA 2M3WA 1QIWA 1IJ5A 3D73A 1SCMC 1IH0A 5AFPA 1UHKA 2FCEA 2WNDA 1QJTA 2FCDA 3PFVA 3CS1A 1YURA 3FE6A 3S0EA 1A2XA 3TZ1A 4CFQA 2ZFDA 1L2OB 1NIWA 3UNWA 1BMOA 5BPJA 3UO9A 1C3YA 2BCXA 3GOFA 3VROA 4OV2A 1OOFA 4DIRA 3N7HA 4QJ3B 2CT9A 5HLOA 1NCYA 1XFRA 2PRUA 2QACA 2EGDA 4NDBA 1JF0A 3OB2B 1RTP1 3AKBA 2M29A 1NPQA 3FE9A 4YRUA 1Z2CB 3DVEA 1MR8A 2PYQA 5PALA 2GGMA 4XJKA 2LMVA 2O5GA 4BY5A 4DUQA 3EK8A 2G2BA 2NXQA 2BECA 1SCVA 3BUMB 3GK1A 1WDCC 2PALA 3NHIA 1YR5A 4IL1A 2M97A 5DICA 2K60A 4AQJA 2WCKA 2FOTA 2OTGC 4JPZB 3LK0A 1D1OA 1FPWA 1Z4HA 1YTZC 1C3ZA 4HSZA 1C07A 4BY4A 2CTNA 2L4IA 2KSPA 2L5XB 1SKTA 1JSAA 2JT8A 4HRGA 1W9ZA 3NSKA 1OQPA 2JXCA 1J1EA 3BFBA 1H8BA 2A4JA 4C0LA 1JC2A 2OS8C 1SSEB 1DJYA 1JBAA 1ODBA 5I8NA 1RFJA 2ZRSA 1QXPA 1TIZA 1XFVO 2AMIA 1QX2A 1XK4A 1S6IA 1K96A 1UHHA 2GTEA 2D8NA 1WRKA 2P70A 1F4QA 2KI6D 4F0ZB 4YI8A 5G08A 3V2LA 2LNKA 1DJWA 3R1VA 2RGIA 3BFHA 2JQ6A 4FQOA 1RECA 3SS4A 1NCZA 1XYDA 2K0JA 4I5LB 3L4LA 1K9KA 1DC1A 1AJ4A 1QX5B 1K8UA 5GQQC 2FJYA 2QDIA 3EG5B 5JJGA 2JPTA 1QV1A 1QLSA 3D0YB 2M1UA 2WCHA 2FJUB 2Y4QA 1CM4A 4GFTA 3D76A 4XYNA 1F4OA 4DS7A 1CNPA 2COLB 1LINA 1IIOA 4PE1A 1DJIA 3BJHA 3OHMB 3L4AA 3O2PA 1EG3A 1FI5A 1QX7A 2AUCA 2Q91A 4FTGA 1DMOA 1YRUB 1B8RA 1ZACA 3LL8B 1HQVA 1QWVA 3AAJA 4M2OA 1XFXO 5IBWA 2JU0A 3FIAA 3D75A 1ZOTB 1N65A 1CMGA 1PULA 1DF0B 3I5HC 4M2QA 4DRWA 1CDPA 4DCKA 1SBJA 3TS5C 3EK4A 1XA5A 1KWOB 1SR6C 1YUTA 1XO5A 5AXIA 1QV0A 3JVTB 4ETOA 2F33A 3TUYB 1DVIA 3SG3A 1CDLA 5DKQA 3KPXA 1Y0VH 1AJ5A 1QATA 3MSEB 4PE4A 2EC6B 2I2RE 1SL7A 1CTRA 1EXRA 4NDDA 2WCFA 3DYEA 1B8LA 1KK7Y 4YGAA 2K7CA 2KQ6A 5CSIA 1A75A 2LVKA 2QEBA 3DVMA 3VGOA 4OKHA 1V1FA 5FI2A 4OZDA 2IS9A 4PE7A 4PT1A 3BUWB 5FYXA 1H4BA 1KFUS 3NSOA 4YGCB 2F2OA 1B1GA 4QJ4B 1SL8A 1J1DA 1QVIY 1XFUO 2PVBA 3D78A 5FI7A 2KLEA 1N0YA 2KGRA 1OE9B
chains in the Genus database with same CATH topology
1XFYO 3BUOB 3ICBA 2KI4C 3BQ3A 4XJKB 3O6BA 2BBNA 3JTDC 2K2AA 1YRTB 2L98A 4MZLA 1BU3A 3NSLA 4AQIA 1CFFA 1PVAA 4CIDA 4L9MA 3CR2A 2LMUA 1RJVA 3A8RA 1AVSA 2Y1MA 1K9PA 2K7OA 3SIBA 2LP2A 1F70A 1L7ZA 1NYAA 3A4UB 1YUUA 1JUOA 2LE9B 2MLEC 2WORA 3EKHA 1TRFA 2K2FA 1S6CA 3FS7A 2TN4A 3VRNA 1IRJA 3SG6A 1OSAA 1NWDA 3ZWHA 2SCPA 1XFWO 1R2UA 2G9BA 2KOTA 3PN7B 3F45A 3EKJA 1FBVA 1Q80A 1EH2A 2KBMA 2K8MB 1UHNA 2ZN9A 5TNCA 5HKWA 1OMDA 1F71A 2H2KA 1NP8A 2JT0A 4PHKA 5KU1A 1ALWA 1NUBA 2JXLA 1CFCA 2LUXA 1LA0A 1OMRA 1SY9A 4R1EA 1G33A 4JQ0D 4BY4A 1NSHA 2H61C 3H4SE 3PATA 3I5FB 1J7QA 2WCEA 1SCMB 4N5XA 3I5IB 1DGUA 1TCFA 1IQ5A 5HKZA 5I2LA 1SNLA 1PK0D 1UUSA 2MAZA 1S1EA 4HREE 2LCPA 3RLZA 4E68A 2KBIA 1IGVA 3I5GC 1Y1UA 1QS7A 2BE6A 3BYAA 1TNQA 5I2OA 1DGVA 1AP4A 1KFUL 4MLWA 3DF0A 5ER5A 3TDZA 4GNKB 3TDUA 1K2HA 1LXFC 3BOWA 2Q4UA 2I7AA 2M49B 2SASA 2KDHA 2BL0C 3OB1B 2I18A 1A4PA 2KFHA 1NX1A 1A29A 2KAYA 2KI6C 1BJFA 1KCYA 1ALVA 1HT9A 2L2EA 1ZMZA 1LA3A 2LP3A 1DJZA 4GGFC 1WDCB 1YVHA 2JTTA 3VRRA 1KSOA 4I5NB 1QLKA 4OR9B 2OTGB 3WXAA 4A4CA 4ORBB 3AAKA 3OX6A 2F2PA 1SMGA 3O78A 5KSZA 1EJ3A 2B1UA 3CTNA 5HYDA 4MBEA 3O4YA 1CM1A 4GGNA 3OP0A 1QTXA 2F3ZA 1KSMA 2K7BA 5AEQA 3RM1A 2JOJA 2KFFA 2MA2A 2PSRA 5AERA 2M0RA 1MHOA 2CNPA 2L50A 2JULA 1CFDA 2VRGA 1A75B 4PHMA 4PHNA 2KNEA 4OVNF 2LLTA 2EC6C 1IG5A 2KAVA 1TNXA 1BOCA 1TNWA 1OMVA 2MRDA 1UHJA 5D7FA 4TNCA 3SG4A 1KFXS 1NX3A 3BUNB 2JNFA 2GV5A 1W7JB 1YVLA 2H61A 3TDIA 2DOQA 4MEWA 4USLA 4HRHA 4I5JA 1XFZO 3SJSA 1AUIB 3VRPA 1MQ1A 2BKHB 2WOSA 4MVFA 1EL4A 4M2PA 4GAOA 1PVBA 1YX7A 4GPLB 4I5KA 4JWQA 5F6TA 4CLNA 2JC2A 1MUXA 2ZNEA 1NX2A 3GK2A 1SK6D 2F8PA 1UHIA 5HLVA 2LM5A 2ZN8A 2MLFC 3AKAA 2ZRTA 1U5IA 2BE4A 4UPGA 4PALA 1WRZA 1KK8B 1KQMB 1DTLA 5D69A 2KQYA 3CZTX 5I2QA 1CMFA 1M46A 1NCXA 3KEVA 1L2OC 3SG5A 4P5OE 2K61A 1JF2A 1W7IB 2MBXA 3K21A 1ZUZA 3QRXA 1CKKA 1S26D 1OOJA 2M7LA 5KTYA 4Q04A 2HETA 1Y6WA 5J3XA 2L4HA 2KAXA 3WNXB 5HKYA 1SW8A 4PCWA 3NSIA 1SR6B 4C0JA 2V53A 4ZCUA 1B9AA 1BF5A 4NQGA 2BCBA 1BT6A 3KO0A 3BXKA 4ICBA 2L0PA 1TTXA 1G4YR 4PHJA 1GJYA 5DKRA 4CPVA 1DJXA 1OZOA 4N1FA 1JFJA 1FW4A 2M9GA 3LCPC 1CFPA 1K95A 1BR1B 2CBLA 2Y1NA 3FWBA 1SRAA 1S36A 4YBHB 1JFKA 1F55A 2CCMA 3I5FC 4OCIA 3I5IC 4YGEB 3EVVA 3DD4A 2PASA 1CDNA 1C7VA 2CXJA 4YGDB 4PDZA 1N2DA 3PM8A 4WRIA 1G8IA 2LVVA 3DF0B 2NCOA 3IQQA 1KFXL 1UP5A 3KHEA 2KYCA 3BOWB 1IQ3A 3D10A 2LANA 1B8CA 1J55A 5ER4X 1SPYA 1S6JA 2ZKMX 2LHIA 3CGAA 3LK1A 5IBWA 3CWGA 5CPVA 2P6BB 3PALA 2LC5A 2KI4B 2JTZA 4ZCVA 1GGZA 1FI6A 1TN4A 4PE0A 3JTDB 2NZ0A 2KGBC 2PMYA 1Y1AA 2BBMA 3C1VA 2BCAA 2R2IA 2NCPA 1DT7B 2HQWA 1AHRA 4ORCB 1J7RA 3WHUB 2HF5A 1FF1A 2EHBA 1K9UA 4NDCA 1RWYA 2JWWA 1WLZA 2BKIB 3M0WA 2M8UA 1RROA 2LLSA 5CSNA 1SL9A 5DKNA 1CLLA 2ZNDA 1S3PA 4MZJA 1CLBA 2Y5IA 1K93D 2QPTA 1XVJA 1EG4A 1J7OA 1YX8A 5K89A 3EVRA 2LMTA 2MHHA 2O60A 3CR5X 1E8AA 3SIAA 1F8HA 4ORAB 1TNPA 2LV7A 1SYMA 2JNXA 3ZNIA 1BLQA 1GGWA 3HX4A 1YUSA 4CFRA 3CLNA 3GK4X 2WC8A 1LKJA 1ZFSA 2AAOA 5JOLA 1A03A 2LAPA 1MWNA 4N1GA 3CR4X 1CLMA 1CB1A 1VRKA 1M31A 5CSJA 1PSBA 3OX5A 4P2YB 1KWOC 1J7PA 2KHNA 3JVTC 1BG1A 1MF8B 3TUYC 3I5GB 2I94A 1IWQA 2OS8B 1U5IB 1KQVA 3LLEA 3DVKA 1WLMA 1RK9A 2LHLA 1PSRA 1MXEA 4GBAA 1LVCD 1QIVA 1UWOA 2HPSA 2M1KB 2E6WA 3EK7A 2LLUA 3IQOA 2WCBA 4YGBB 1B7TZ 3HCMA 2LVJA 2BL0B 3EVUA 1KK8C 2E30A 2OPOA 1JWDA 1KQMC 2JZIA 4YI9A 1OZSA 3SG7A 1M45A 1B7TY 1PALA 1R6PA 2JRFA 2K7DA 1X02A 3BUXB 3KF9A 3PLFB 1BR4B 4MRYA 5B8IB 1C7WA 1BODA 1QASA 1PRWA 4GUKA 1IKUA 1CDMA 1TOPA 1NX0A 1MXLC 2JT3A 1B4CA 2L51A 3IF7A 1K90D 4U8DA 1Y1XA 2HQ8A 3DVJA 2NLNA 1V1GA 3E3RA 1DJGA 4QJ5B 3VRQA 4WQ2A 1M39A 1DJHA 2F3YA 4MSPA 1GQMA 3NXAA 2LUCA 3D0YA 4WQ3A 5AANA 3SG2A 1KK7Z 4MRXA 1UURA 5CSFA 1WRLA 1TCOB 1S5GZ 2KYFA 4C0KA 2GGZA 4GGFA 4MZKA 1B47A 3I5HB 3TS5B 3PSRA 3PN7C 1QVIZ 1S5GY 4AOMA 2LVIA 3FWCA 2KFGA 4MN0A 4A4BA 1F54A 2ISDA 1WY9A 1DF0A 3WHTB 2MJWB 1XK4C 1M63B 1AK8A 2M7NA 4D1EA 1K94A 1IJ6A 2M3WA 1QIWA 1IJ5A 1IH0A 1SCMC 5AFPA 1UHKA 2FCEA 2WNDA 1QJTA 2FCDA 3PFVA 3CS1A 1YURA 3TZ1A 1A2XA 4CFQA 2ZFDA 1L2OB 1NIWA 1BMOA 5BPJA 2BCXA 3GOFA 3VROA 4OV2A 4DIRA 4QJ3B 5HLOA 2CT9A 1NCYA 2PRUA 2QACA 2EGDA 4NDBA 1JF0A 3OB2B 1RTP1 3AKBA 2M29A 1NPQA 4YRUA 3DVEA 1MR8A 5PALA 2GGMA 4XJKA 2LMVA 2O5GA 4BY5A 4DUQA 3EK8A 2G2BA 2NXQA 2BECA 1SCVA 3BUMB 3GK1A 1WDCC 2PALA 1YR5A 4IL1A 2M97A 4AQJA 2FOTA 2OTGC 4JPZB 3LK0A 1D1OA 1FPWA 1YTZC 4HSZA 1C07A 2CTNA 2L4IA 2KSPA 2L5XB 1SKTA 1JSAA 2JT8A 4HRGA 3NSKA 1OQPA 2JXCA 1J1EA 1H8BA 2A4JA 4C0LA 1JC2A 2OS8C 1DJYA 1JBAA 1ODBA 5I8NA 1RFJA 2ZRSA 1QXPA 1TIZA 1XFVO 2AMIA 1QX2A 1XK4A 1S6IA 1K96A 1UHHA 2D8NA 1WRKA 1F4QA 2KI6D 4F0ZB 4YI8A 5G08A 2LNKA 1DJWA 2RGIA 2JQ6A 4FQOA 1RECA 1NCZA 1XYDA 2K0JA 4I5LB 1K9KA 1AJ4A 1QX5B 1K8UA 5GQQC 5JJGA 2JPTA 1QV1A 1QLSA 3D0YB 2M1UA 2FJUB 2Y4QA 1CM4A 4GFTA 4XYNA 1F4OA 4DS7A 1CNPA 2COLB 1LINA 4PE1A 1DJIA 3OHMB 3O2PA 1EG3A 1FI5A 1QX7A 2AUCA 2Q91A 4FTGA 1DMOA 1YRUB 1B8RA 1ZACA 3LL8B 1HQVA 3AAJA 4M2OA 1XFXO 2JU0A 3FIAA 1ZOTB 1N65A 1CMGA 1PULA 1DF0B 3I5HC 4M2QA 4DRWA 1CDPA 4DCKA 1SBJA 3TS5C 3EK4A 1XA5A 1KWOB 1SR6C 1YUTA 1XO5A 5AXIA 1QV0A 3JVTB 4ETOA 2F33A 3TUYB 1DVIA 3SG3A 1CDLA 5DKQA 3KPXA 1Y0VH 1AJ5A 1QATA 3MSEB 4PE4A 2EC6B 2I2RE 1SL7A 1CTRA 1EXRA 4NDDA 2WCFA 1B8LA 1KK7Y 4YGAA 2K7CA 2KQ6A 5CSIA 1A75A 2LVKA 3VGOA 3DVMA 4OKHA 1V1FA 2IS9A 4PE7A 3BUWB 5FYXA 1H4BA 1KFUS 3NSOA 4YGCB 2F2OA 1B1GA 4QJ4B 1SL8A 1J1DA 1QVIY 1XFUO 2PVBA 1N0YA 2KGRA 1OE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFY O;  3BUO B;  3ICB A;  2KI4 C;  3BQ3 A;  4XJK B;  3O6B A;  2BBN A;  3JTD C;  2K2A A;  1YRT B;  2L98 A;  4MZL A;  1BU3 A;  3NSL A;  4AQI A;  1CFF A;  1PVA A;  4CID A;  4L9M A;  3CR2 A;  2LMU A;  1RJV A;  3A8R A;  1AVS A;  2Y1M A;  1K9P A;  2K7O A;  3SIB A;  2LP2 A;  1F70 A;  1L7Z A;  1NYA A;  3A4U B;  1YUU A;  1JUO A;  2LE9 B;  2MLE C;  2WOR A;  3EKH A;  1TRF A;  2K2F A;  1S6C A;  3FS7 A;  2TN4 A;  3VRN A;  1IRJ A;  3SG6 A;  1OSA A;  1NWD A;  3ZWH A;  2SCP A;  1XFW O;  1R2U A;  2G9B A;  2KOT A;  3PN7 B;  3F45 A;  3EKJ A;  1FBV A;  1Q80 A;  1EH2 A;  2KBM A;  2K8M B;  1UHN A;  2ZN9 A;  5TNC A;  5HKW A;  1OMD A;  1F71 A;  2H2K A;  1NP8 A;  2JT0 A;  4PHK A;  5KU1 A;  1ALW A;  1NUB A;  2JXL A;  1CFC A;  2LUX A;  1LA0 A;  1OMR A;  1SY9 A;  4R1E A;  1G33 A;  4JQ0 D;  4BY4 A;  1NSH A;  2H61 C;  3H4S E;  3PAT A;  3I5F B;  1J7Q A;  2WCE A;  1SCM B;  4N5X A;  3I5I B;  1DGU A;  1TCF A;  1IQ5 A;  5HKZ A;  5I2L A;  1SNL A;  1PK0 D;  1UUS A;  2MAZ A;  1S1E A;  4HRE E;  2LCP A;  3RLZ A;  4E68 A;  2KBI A;  1IGV A;  3I5G C;  1Y1U A;  1QS7 A;  2BE6 A;  3BYA A;  1TNQ A;  5I2O A;  1DGV A;  1AP4 A;  1KFU L;  4MLW A;  3DF0 A;  5ER5 A;  3TDZ A;  4GNK B;  3TDU A;  1K2H A;  1LXF C;  3BOW A;  2Q4U A;  2I7A A;  2M49 B;  2SAS A;  2KDH A;  2BL0 C;  3OB1 B;  2I18 A;  1A4P A;  2KFH A;  1NX1 A;  1A29 A;  2KAY A;  2KI6 C;  1BJF A;  1KCY A;  1ALV A;  1HT9 A;  2L2E A;  1ZMZ A;  1LA3 A;  2LP3 A;  1DJZ A;  4GGF C;  1WDC B;  1YVH A;  2JTT A;  3VRR A;  1KSO A;  4I5N B;  1QLK A;  4OR9 B;  2OTG B;  3WXA A;  4A4C A;  4ORB B;  3AAK A;  3OX6 A;  2F2P A;  1SMG A;  3O78 A;  5KSZ A;  1EJ3 A;  2B1U A;  3CTN A;  5HYD A;  4MBE A;  3O4Y A;  1CM1 A;  4GGN A;  3OP0 A;  1QTX A;  2F3Z A;  1KSM A;  2K7B A;  5AEQ A;  3RM1 A;  2JOJ A;  2KFF A;  2MA2 A;  2PSR A;  5AER A;  2M0R A;  1MHO A;  2CNP A;  2L50 A;  2JUL A;  1CFD A;  2VRG A;  1A75 B;  4PHM A;  4PHN A;  2KNE A;  4OVN F;  2LLT A;  2EC6 C;  1IG5 A;  2KAV A;  1TNX A;  1BOC A;  1TNW A;  1OMV A;  2MRD A;  1UHJ A;  5D7F A;  4TNC A;  3SG4 A;  1KFX S;  1NX3 A;  3BUN B;  2JNF A;  2GV5 A;  1W7J B;  1YVL A;  2H61 A;  3TDI A;  2DOQ A;  4MEW A;  4USL A;  4HRH A;  4I5J A;  1XFZ O;  3SJS A;  1AUI B;  3VRP A;  1MQ1 A;  2BKH B;  2WOS A;  4MVF A;  1EL4 A;  4M2P A;  4GAO A;  1PVB A;  1YX7 A;  4GPL B;  4I5K A;  4JWQ A;  5F6T A;  4CLN A;  2JC2 A;  1MUX A;  2ZNE A;  1NX2 A;  3GK2 A;  1SK6 D;  2F8P A;  1UHI A;  5HLV A;  2LM5 A;  2ZN8 A;  2MLF C;  3AKA A;  2ZRT A;  1U5I A;  2BE4 A;  4UPG A;  4PAL A;  1WRZ A;  1KK8 B;  1KQM B;  1DTL A;  5D69 A;  2KQY A;  3CZT X;  5I2Q A;  1CMF A;  1M46 A;  1NCX A;  3KEV A;  1L2O C;  3SG5 A;  4P5O E;  2K61 A;  1JF2 A;  1W7I B;  2MBX A;  3K21 A;  1ZUZ A;  3QRX A;  1CKK A;  1S26 D;  1OOJ A;  2M7L A;  5KTY A;  4Q04 A;  2HET A;  1Y6W A;  5J3X A;  2L4H A;  2KAX A;  3WNX B;  5HKY A;  1SW8 A;  4PCW A;  3NSI A;  1SR6 B;  4C0J A;  2V53 A;  4ZCU A;  1B9A A;  1BF5 A;  4NQG A;  2BCB A;  1BT6 A;  3KO0 A;  3BXK A;  4ICB A;  2L0P A;  1TTX A;  1G4Y R;  4PHJ A;  1GJY A;  5DKR A;  4CPV A;  1DJX A;  1OZO A;  4N1F A;  1JFJ A;  1FW4 A;  2M9G A;  3LCP C;  1CFP A;  1K95 A;  1BR1 B;  2CBL A;  2Y1N A;  3FWB A;  1SRA A;  1S36 A;  4YBH B;  1JFK A;  1F55 A;  2CCM A;  3I5F C;  4OCI A;  3I5I C;  4YGE B;  3EVV A;  3DD4 A;  2PAS A;  1CDN A;  1C7V A;  2CXJ A;  4YGD B;  4PDZ A;  1N2D A;  3PM8 A;  4WRI A;  1G8I A;  2LVV A;  3DF0 B;  2NCO A;  3IQQ A;  1KFX L;  1UP5 A;  3KHE A;  2KYC A;  3BOW B;  1IQ3 A;  3D10 A;  2LAN A;  1B8C A;  1J55 A;  5ER4 X;  1SPY A;  1S6J A;  2ZKM X;  2LHI A;  3CGA A;  3LK1 A;  5IBW A;  3CWG A;  5CPV A;  2P6B B;  3PAL A;  2LC5 A;  2KI4 B;  2JTZ A;  4ZCV A;  1GGZ A;  1FI6 A;  1TN4 A;  4PE0 A;  3JTD B;  2NZ0 A;  2KGB C;  2PMY A;  1Y1A A;  2BBM A;  3C1V A;  2BCA A;  2R2I A;  2NCP A;  1DT7 B;  2HQW A;  1AHR A;  4ORC B;  1J7R A;  3WHU B;  2HF5 A;  1FF1 A;  2EHB A;  1K9U A;  4NDC A;  1RWY A;  2JWW A;  1WLZ A;  2BKI B;  3M0W A;  2M8U A;  1RRO A;  2LLS A;  5CSN A;  1SL9 A;  5DKN A;  1CLL A;  2ZND A;  1S3P A;  4MZJ A;  1CLB A;  2Y5I A;  1K93 D;  2QPT A;  1XVJ A;  1EG4 A;  1J7O A;  1YX8 A;  5K89 A;  3EVR A;  2LMT A;  2MHH A;  2O60 A;  3CR5 X;  1E8A A;  3SIA A;  1F8H A;  4ORA B;  1TNP A;  2LV7 A;  1SYM A;  2JNX A;  3ZNI A;  1BLQ A;  1GGW A;  3HX4 A;  1YUS A;  4CFR A;  3CLN A;  3GK4 X;  2WC8 A;  1LKJ A;  1ZFS A;  2AAO A;  5JOL A;  1A03 A;  2LAP A;  1MWN A;  4N1G A;  3CR4 X;  1CLM A;  1CB1 A;  1VRK A;  1M31 A;  5CSJ A;  1PSB A;  3OX5 A;  4P2Y B;  1KWO C;  1J7P A;  2KHN A;  3JVT C;  1BG1 A;  1MF8 B;  3TUY C;  3I5G B;  2I94 A;  1IWQ A;  2OS8 B;  1U5I B;  1KQV A;  3LLE A;  3DVK A;  1WLM A;  1RK9 A;  2LHL A;  1PSR A;  1MXE A;  4GBA A;  1LVC D;  1QIV A;  1UWO A;  2HPS A;  2M1K B;  2E6W A;  3EK7 A;  2LLU A;  3IQO A;  2WCB A;  4YGB B;  1B7T Z;  3HCM A;  2LVJ A;  2BL0 B;  3EVU A;  1KK8 C;  2E30 A;  2OPO A;  1JWD A;  1KQM C;  2JZI A;  4YI9 A;  1OZS A;  3SG7 A;  1M45 A;  1B7T Y;  1PAL A;  1R6P A;  2JRF A;  2K7D A;  1X02 A;  3BUX B;  3KF9 A;  3PLF B;  1BR4 B;  4MRY A;  5B8I B;  1C7W A;  1BOD A;  1QAS A;  1PRW A;  4GUK A;  1IKU A;  1CDM A;  1TOP A;  1NX0 A;  1MXL C;  2JT3 A;  1B4C A;  2L51 A;  3IF7 A;  1K90 D;  4U8D A;  1Y1X A;  2HQ8 A;  3DVJ A;  2NLN A;  1V1G A;  3E3R A;  1DJG A;  4QJ5 B;  3VRQ A;  4WQ2 A;  1M39 A;  1DJH A;  2F3Y A;  4MSP A;  1GQM A;  3NXA A;  2LUC A;  3D0Y A;  4WQ3 A;  5AAN A;  3SG2 A;  1KK7 Z;  4MRX A;  1UUR A;  5CSF A;  1WRL A;  1TCO B;  1S5G Z;  2KYF A;  4C0K A;  2GGZ A;  4GGF A;  4MZK A;  1B47 A;  3I5H B;  3TS5 B;  3PSR A;  3PN7 C;  1QVI Z;  1S5G Y;  4AOM A;  2LVI A;  3FWC A;  2KFG A;  4MN0 A;  4A4B A;  1F54 A;  2ISD A;  1WY9 A;  1DF0 A;  3WHT B;  2MJW B;  1XK4 C;  1M63 B;  1AK8 A;  2M7N A;  4D1E A;  1K94 A;  1IJ6 A;  2M3W A;  1QIW A;  1IJ5 A;  1IH0 A;  1SCM C;  5AFP A;  1UHK A;  2FCE A;  2WND A;  1QJT A;  2FCD A;  3PFV A;  3CS1 A;  1YUR A;  3TZ1 A;  1A2X A;  4CFQ A;  2ZFD A;  1L2O B;  1NIW A;  1BMO A;  5BPJ A;  2BCX A;  3GOF A;  3VRO A;  4OV2 A;  4DIR A;  4QJ3 B;  5HLO A;  2CT9 A;  1NCY A;  2PRU A;  2QAC A;  2EGD A;  4NDB A;  1JF0 A;  3OB2 B;  1RTP 1;  3AKB A;  2M29 A;  1NPQ A;  4YRU A;  3DVE A;  1MR8 A;  5PAL A;  2GGM A;  4XJK A;  2LMV A;  2O5G A;  4BY5 A;  4DUQ A;  3EK8 A;  2G2B A;  2NXQ A;  2BEC A;  1SCV A;  3BUM B;  3GK1 A;  1WDC C;  2PAL A;  1YR5 A;  4IL1 A;  2M97 A;  4AQJ A;  2FOT A;  2OTG C;  4JPZ B;  3LK0 A;  1D1O A;  1FPW A;  1YTZ C;  4HSZ A;  1C07 A;  2CTN A;  2L4I A;  2KSP A;  2L5X B;  1SKT A;  1JSA A;  2JT8 A;  4HRG A;  3NSK A;  1OQP A;  2JXC A;  1J1E A;  1H8B A;  2A4J A;  4C0L A;  1JC2 A;  2OS8 C;  1DJY A;  1JBA A;  1ODB A;  5I8N A;  1RFJ A;  2ZRS A;  1QXP A;  1TIZ A;  1XFV O;  2AMI A;  1QX2 A;  1XK4 A;  1S6I A;  1K96 A;  1UHH A;  2D8N A;  1WRK A;  1F4Q A;  2KI6 D;  4F0Z B;  4YI8 A;  5G08 A;  2LNK A;  1DJW A;  2RGI A;  2JQ6 A;  4FQO A;  1REC A;  1NCZ A;  1XYD A;  2K0J A;  4I5L B;  1K9K A;  1AJ4 A;  1QX5 B;  1K8U A;  5GQQ C;  5JJG A;  2JPT A;  1QV1 A;  1QLS A;  3D0Y B;  2M1U A;  2FJU B;  2Y4Q A;  1CM4 A;  4GFT A;  4XYN A;  1F4O A;  4DS7 A;  1CNP A;  2COL B;  1LIN A;  4PE1 A;  1DJI A;  3OHM B;  3O2P A;  1EG3 A;  1FI5 A;  1QX7 A;  2AUC A;  2Q91 A;  4FTG A;  1DMO A;  1YRU B;  1B8R A;  1ZAC A;  3LL8 B;  1HQV A;  3AAJ A;  4M2O A;  1XFX O;  2JU0 A;  3FIA A;  1ZOT B;  1N65 A;  1CMG A;  1PUL A;  1DF0 B;  3I5H C;  4M2Q A;  4DRW A;  1CDP A;  4DCK A;  1SBJ A;  3TS5 C;  3EK4 A;  1XA5 A;  1KWO B;  1SR6 C;  1YUT A;  1XO5 A;  5AXI A;  1QV0 A;  3JVT B;  4ETO A;  2F33 A;  3TUY B;  1DVI A;  3SG3 A;  1CDL A;  5DKQ A;  3KPX A;  1Y0V H;  1AJ5 A;  1QAT A;  3MSE B;  4PE4 A;  2EC6 B;  2I2R E;  1SL7 A;  1CTR A;  1EXR A;  4NDD A;  2WCF A;  1B8L A;  1KK7 Y;  4YGA A;  2K7C A;  2KQ6 A;  5CSI A;  1A75 A;  2LVK A;  3VGO A;  3DVM A;  4OKH A;  1V1F A;  2IS9 A;  4PE7 A;  3BUW B;  5FYX A;  1H4B A;  1KFU S;  3NSO A;  4YGC B;  2F2O A;  1B1G A;  4QJ4 B;  1SL8 A;  1J1D A;  1QVI Y;  1XFU O;  2PVB A;  1N0Y A;  2KGR A;  1OE9 B; 
#chains in the Genus database with same CATH topology
 1XFY O;  3BUO B;  3ICB A;  2KI4 C;  3BQ3 A;  4XJK B;  3O6B A;  2BBN A;  3CYZ A;  3JTD C;  3PM2 A;  2K2A A;  1YRT B;  2L98 A;  4MZL A;  1BU3 A;  3NSL A;  4AQI A;  1CFF A;  1PVA A;  2PQL A;  2QEH A;  4L9M A;  3CR2 A;  4CID A;  2LMU A;  1RJV A;  3A8R A;  1AVS A;  2Y1M A;  1K9P A;  2K7O A;  3SIB A;  2LP2 A;  1F70 A;  1L7Z A;  1NYA A;  2P71 A;  3A4U B;  1YUU A;  1JUO A;  2LE9 B;  2MLE C;  2WOR A;  3EKH A;  3S0B A;  1TRF A;  2K2F A;  1S6C A;  3FS7 A;  2TN4 A;  3VRN A;  1IRJ A;  3SG6 A;  1OSA A;  1NWD A;  3B7A A;  2QEO A;  3BFA A;  2SCP A;  3ZWH A;  1XFW O;  1R2U A;  2G9B A;  2KOT A;  3PN7 B;  3F45 A;  3EKJ A;  1FBV A;  1Q80 A;  1EH2 A;  2KBM A;  2K8M B;  1UHN A;  3QME A;  3SS3 A;  2ZN9 A;  5TNC A;  5HKW A;  1OMD A;  3DZT A;  1F71 A;  2H2K A;  1NP8 A;  2JT0 A;  4INW A;  4PHK A;  5KU1 A;  1DEL A;  1ALW A;  1NUB A;  2JXL A;  4JKT A;  1CFC A;  2LUX A;  1LA0 A;  1OMR A;  1SY9 A;  4R1E A;  1G33 A;  4JQ0 D;  5D3O A;  1NSH A;  2H61 C;  3H4S E;  3PAT A;  3I5F B;  1J7Q A;  2WCE A;  1SCM B;  4N5X A;  3I5I B;  1DGU A;  3PJI A;  1TCF A;  3D74 A;  1IQ5 A;  5HKZ A;  5I2L A;  2WCM A;  1SNL A;  1PK0 D;  1UUS A;  2MAZ A;  1S1E A;  4HRE E;  3B87 A;  4F7F A;  2LCP A;  3RLZ A;  2QEV A;  4E68 A;  2KBI A;  1IGV A;  3SS5 A;  3I5G C;  1Y1U A;  1QS7 A;  2BE6 A;  3BYA A;  1TNQ A;  5I2O A;  1DGV A;  1AP4 A;  1KFU L;  4MLW A;  3DF0 A;  5ER5 A;  3TDZ A;  1T14 A;  4GNK B;  3TDU A;  1K2H A;  1LXF C;  3BOW A;  2Q4U A;  2H8V A;  2I7A A;  2M49 B;  3D77 A;  2SAS A;  2KDH A;  2BL0 C;  3OB1 B;  1GM0 A;  2I18 A;  1A4P A;  2KFH A;  1NX1 A;  1A29 A;  2KAY A;  2KI6 C;  1BJF A;  1KCY A;  1ALV A;  1HT9 A;  1P28 A;  2L2E A;  1ZMZ A;  1LA3 A;  2LP3 A;  1DJZ A;  4GGF C;  1WDC B;  1YVH A;  2JTT A;  3VRR A;  1KSO A;  4I5N B;  1QLK A;  5FI6 A;  4OR9 B;  1DQE A;  2OTG B;  3WXA A;  3CZ2 A;  2WCL A;  3AAK A;  3OX6 A;  4ORB B;  4A4C A;  2F2P A;  1SMG A;  3O78 A;  1TWO A;  5KSZ A;  1EJ3 A;  2B1U A;  3CTN A;  4JD9 A;  5HYD A;  4MBE A;  3O4Y A;  1CM1 A;  4GGN A;  3OP0 A;  1QTX A;  3K1E A;  2F3Z A;  1KSM A;  2K7B A;  5AEQ A;  3RM1 A;  2JOJ A;  2KFF A;  3S0G A;  3Q8I A;  2MA2 A;  2PSR A;  5AER A;  2M0R A;  1MHO A;  2CNP A;  2L50 A;  4KYN A;  1TUJ A;  2JUL A;  1CFD A;  2VRG A;  1A75 B;  4PHM A;  4PHN A;  2KNE A;  4OVN F;  2LLT A;  2EC6 C;  1IG5 A;  2KAV A;  1TNX A;  3CZ1 A;  1TNW A;  1OMV A;  1BOC A;  2MRD A;  1UHJ A;  5D7F A;  2WC5 A;  4TNC A;  3SG4 A;  2WCJ A;  1KFX S;  3IVT A;  1NX3 A;  3BUN B;  2JNF A;  2GV5 A;  1W7J B;  1YVL A;  2H61 A;  3TDI A;  2DOQ A;  4MEW A;  4USL A;  4HRH A;  4I5J A;  1XFZ O;  3SJS A;  1AUI B;  3VRP A;  1MQ1 A;  2BKH B;  2WOS A;  4MVF A;  1EL4 A;  4M2P A;  4GAO A;  1PVB A;  1YX7 A;  4GPL B;  4I5K A;  4JWQ A;  5F6T A;  4CLN A;  2JC2 A;  1MUX A;  2ZNE A;  1NX2 A;  3GK2 A;  1SK6 D;  2F8P A;  1UHI A;  5HLV A;  2LM5 A;  2ZN8 A;  2MLF C;  3AKA A;  2ZRT A;  1U5I A;  2BE4 A;  4UPG A;  3S0F A;  4PAL A;  1WRZ A;  1KK8 B;  1KQM B;  1DTL A;  5D69 A;  2KQY A;  3CZT X;  5I2Q A;  1CMF A;  1M46 A;  1NCX A;  3B86 A;  3KEV A;  1L2O C;  2L2C A;  3SG5 A;  4P5O E;  2K61 A;  1JF2 A;  1W7I B;  2MBX A;  3CDN A;  3K21 A;  1ZUZ A;  3QRX A;  1CKK A;  1S26 D;  1OOJ A;  2M7L A;  5KTY A;  4Q04 A;  2HET A;  4INX A;  1Y6W A;  5J3X A;  2YGU A;  2L4H A;  2KAX A;  3WNX B;  5HKY A;  1SW8 A;  4PCW A;  2ERB A;  3NSI A;  1SR6 B;  2KPH A;  2V53 A;  4C0J A;  4ZCU A;  1B9A A;  1BF5 A;  4NQG A;  2BCB A;  1BT6 A;  3KO0 A;  3BXK A;  4ICB A;  2L0P A;  1TTX A;  1G4Y R;  4PHJ A;  1GJY A;  5DKR A;  4CPV A;  1DJX A;  1OZO A;  4N1F A;  1JFJ A;  1FW4 A;  2M9G A;  3LCP C;  1CFP A;  1K95 A;  1BR1 B;  2CBL A;  2Y1N A;  3FWB A;  1SRA A;  1S36 A;  4YBH B;  1JFK A;  1F55 A;  2CCM A;  3I5F C;  4OCI A;  3I5I C;  4YGE B;  3EVV A;  3DD4 A;  2PAS A;  1CDN A;  1C7V A;  3RZS A;  2CXJ A;  4YGD B;  4PDZ A;  1N2D A;  3PM8 A;  4WRI A;  1G8I A;  2LVV A;  3DF0 B;  2NCO A;  3IQQ A;  1KFX L;  1UP5 A;  3KHE A;  2KYC A;  3BOW B;  4FQT A;  1IQ3 A;  3D10 A;  2LAN A;  1B8C A;  1J55 A;  5ER4 X;  1SPY A;  1S6J A;  2ZKM X;  2LHI A;  3CGA A;  3LK1 A;  5HL1 A;  3CWG A;  5CPV A;  2P6B B;  3S0D A;  3PAL A;  2LC5 A;  2KI4 B;  2JTZ A;  4ZCV A;  1GGZ A;  1FI6 A;  1TN4 A;  4PE0 A;  3JTD B;  2NZ0 A;  2KGB C;  2PMY A;  1Y1A A;  2BBM A;  3C1V A;  2BCA A;  2R2I A;  2NCP A;  1DT7 B;  3VB1 A;  2HQW A;  1AHR A;  3S0A A;  5EL2 A;  1OOG A;  4ORC B;  1J7R A;  3WHU B;  1LS8 A;  2HF5 A;  1FF1 A;  2EHB A;  1K9U A;  4NDC A;  1RWY A;  2JWW A;  2KLD A;  1WLZ A;  3OGN A;  2BKI B;  1OOI X;  3M0W A;  2M8U A;  1RRO A;  2LLS A;  5CSN A;  1SL9 A;  3R72 A;  5DKN A;  1CLL A;  2ZND A;  1S3P A;  4MZJ A;  1CLB A;  2Y5I A;  1K93 D;  2QPT A;  1XVJ A;  1EG4 A;  1J7O A;  1YX8 A;  5K89 A;  3EVR A;  2LMT A;  2MHH A;  2O60 A;  1OOH A;  1E8A A;  3CR5 X;  3SIA A;  4ORA B;  1TNP A;  2LV7 A;  1F8H A;  1SYM A;  2JNX A;  3ZNI A;  1BLQ A;  1GGW A;  3HX4 A;  1YUS A;  4CFR A;  3CLN A;  3GK4 X;  2WC8 A;  3B88 A;  1LKJ A;  1OW4 A;  1ZFS A;  2AAO A;  3FE8 A;  5JOL A;  2LAP A;  1A03 A;  1DEK A;  1MWN A;  3R1P A;  4N1G A;  3CR4 X;  1CLM A;  2L5Y A;  1VRK A;  1CB1 A;  1M31 A;  5CSJ A;  1PSB A;  3OX5 A;  4P2Y B;  1KWO C;  1J7P A;  3NGV A;  2KHN A;  3JVT C;  1ORG A;  1MF8 B;  3TUY C;  1BG1 A;  3I5G B;  2I94 A;  1IWQ A;  2OS8 B;  1TUZ A;  1U5I B;  1KQV A;  3LLE A;  3DVK A;  1WLM A;  1RK9 A;  2LHL A;  2BNX A;  1PSR A;  1MXE A;  4GBA A;  1LVC D;  1QIV A;  1UWO A;  2HPS A;  2M1K B;  2E6W A;  3EK7 A;  2LLU A;  3IQO A;  2WCB A;  3R1O A;  4YGB B;  1B7T Z;  3HCM A;  2LVJ A;  2BL0 B;  3EVU A;  3L47 A;  3CZ0 A;  1KK8 C;  2E30 A;  2OPO A;  1JWD A;  1KQM C;  2WC6 A;  2JZI A;  4YI9 A;  1OZS A;  3SG7 A;  1M45 A;  2BAP A;  1B7T Y;  1PAL A;  5I94 A;  1R6P A;  2JRF A;  2JPO A;  1X02 A;  2K7D A;  3BUX B;  3KF9 A;  1BR4 B;  3PLF B;  4MRY A;  1C7W A;  5B8I B;  1BOD A;  1QAS A;  1PRW A;  4GUK A;  1IKU A;  1CDM A;  1TOP A;  1NX0 A;  1MXL C;  2JT3 A;  1B4C A;  2L51 A;  3IF7 A;  1K90 D;  4U8D A;  1Y1X A;  2HQ8 A;  3DVJ A;  2NLN A;  1V1G A;  3E3R A;  1DJG A;  4QJ5 B;  3VRQ A;  4WQ2 A;  3NHT A;  1M39 A;  1DJH A;  2F3Y A;  4MSP A;  1GQM A;  3NXA A;  2LUC A;  3D0Y A;  4WQ3 A;  5AAN A;  4IJ7 A;  3SG2 A;  1KK7 Z;  4MRX A;  1UUR A;  3O4X A;  1WRL A;  5CSF A;  1TCO B;  1S5G Z;  2KYF A;  4C0K A;  2GGZ A;  4GGF A;  4MZK A;  1B47 A;  3I5H B;  3TS5 B;  3B6X A;  3DY9 A;  3PSR A;  3DXL A;  3PN7 C;  1QVI Z;  1S5G Y;  4AOM A;  2LVI A;  3FWC A;  2KFG A;  3OBV A;  4MN0 A;  4A4B A;  2ISD A;  1F54 A;  1WY9 A;  1DF0 A;  3WHT B;  2MJW B;  1XK4 C;  1M63 B;  1AK8 A;  2M7N A;  4D1E A;  1K94 A;  1IJ6 A;  3CAB A;  2M3W A;  1QIW A;  1IJ5 A;  3D73 A;  1SCM C;  1IH0 A;  5AFP A;  1UHK A;  2FCE A;  2WND A;  1QJT A;  2FCD A;  3PFV A;  3CS1 A;  1YUR A;  3FE6 A;  3S0E A;  1A2X A;  3TZ1 A;  4CFQ A;  2ZFD A;  1L2O B;  1NIW A;  3UNW A;  1BMO A;  5BPJ A;  3UO9 A;  1C3Y A;  2BCX A;  3GOF A;  3VRO A;  4OV2 A;  1OOF A;  4DIR A;  3N7H A;  4QJ3 B;  2CT9 A;  5HLO A;  1NCY A;  1XFR A;  2PRU A;  2QAC A;  2EGD A;  4NDB A;  1JF0 A;  3OB2 B;  1RTP 1;  3AKB A;  2M29 A;  1NPQ A;  3FE9 A;  4YRU A;  1Z2C B;  3DVE A;  1MR8 A;  2PYQ A;  5PAL A;  2GGM A;  4XJK A;  2LMV A;  2O5G A;  4BY5 A;  4DUQ A;  3EK8 A;  2G2B A;  2NXQ A;  2BEC A;  1SCV A;  3BUM B;  3GK1 A;  1WDC C;  2PAL A;  3NHI A;  1YR5 A;  4IL1 A;  2M97 A;  5DIC A;  2K60 A;  4AQJ A;  2WCK A;  2FOT A;  2OTG C;  4JPZ B;  3LK0 A;  1D1O A;  1FPW A;  1Z4H A;  1YTZ C;  1C3Z A;  4HSZ A;  1C07 A;  4BY4 A;  2CTN A;  2L4I A;  2KSP A;  2L5X B;  1SKT A;  1JSA A;  2JT8 A;  4HRG A;  1W9Z A;  3NSK A;  1OQP A;  2JXC A;  1J1E A;  3BFB A;  1H8B A;  2A4J A;  4C0L A;  1JC2 A;  2OS8 C;  1SSE B;  1DJY A;  1JBA A;  1ODB A;  5I8N A;  1RFJ A;  2ZRS A;  1QXP A;  1TIZ A;  1XFV O;  2AMI A;  1QX2 A;  1XK4 A;  1S6I A;  1K96 A;  1UHH A;  2GTE A;  2D8N A;  1WRK A;  2P70 A;  1F4Q A;  2KI6 D;  4F0Z B;  4YI8 A;  5G08 A;  3V2L A;  2LNK A;  1DJW A;  3R1V A;  2RGI A;  3BFH A;  2JQ6 A;  4FQO A;  1REC A;  3SS4 A;  1NCZ A;  1XYD A;  2K0J A;  4I5L B;  3L4L A;  1K9K A;  1DC1 A;  1AJ4 A;  1QX5 B;  1K8U A;  5GQQ C;  2FJY A;  2QDI A;  3EG5 B;  5JJG A;  2JPT A;  1QV1 A;  1QLS A;  3D0Y B;  2M1U A;  2WCH A;  2FJU B;  2Y4Q A;  1CM4 A;  4GFT A;  3D76 A;  4XYN A;  1F4O A;  4DS7 A;  1CNP A;  2COL B;  1LIN A;  1IIO A;  4PE1 A;  1DJI A;  3BJH A;  3OHM B;  3L4A A;  3O2P A;  1EG3 A;  1FI5 A;  1QX7 A;  2AUC A;  2Q91 A;  4FTG A;  1DMO A;  1YRU B;  1B8R A;  1ZAC A;  3LL8 B;  1HQV A;  1QWV A;  3AAJ A;  4M2O A;  1XFX O;  5IBW A;  2JU0 A;  3FIA A;  3D75 A;  1ZOT B;  1N65 A;  1CMG A;  1PUL A;  1DF0 B;  3I5H C;  4M2Q A;  4DRW A;  1CDP A;  4DCK A;  1SBJ A;  3TS5 C;  3EK4 A;  1XA5 A;  1KWO B;  1SR6 C;  1YUT A;  1XO5 A;  5AXI A;  1QV0 A;  3JVT B;  4ETO A;  2F33 A;  3TUY B;  1DVI A;  3SG3 A;  1CDL A;  5DKQ A;  3KPX A;  1Y0V H;  1AJ5 A;  1QAT A;  3MSE B;  4PE4 A;  2EC6 B;  2I2R E;  1SL7 A;  1CTR A;  1EXR A;  4NDD A;  2WCF A;  3DYE A;  1B8L A;  1KK7 Y;  4YGA A;  2K7C A;  2KQ6 A;  5CSI A;  1A75 A;  2LVK A;  2QEB A;  3DVM A;  3VGO A;  4OKH A;  1V1F A;  5FI2 A;  4OZD A;  2IS9 A;  4PE7 A;  4PT1 A;  3BUW B;  5FYX A;  1H4B A;  1KFU S;  3NSO A;  4YGC B;  2F2O A;  1B1G A;  4QJ4 B;  1SL8 A;  1J1D A;  1QVI Y;  1XFU O;  2PVB A;  3D78 A;  5FI7 A;  2KLE A;  1N0Y A;  2KGR A;  1OE9 B; 
#chains in the Genus database with same CATH homology
 1XFY O;  3BUO B;  3ICB A;  2KI4 C;  3BQ3 A;  4XJK B;  3O6B A;  2BBN A;  3JTD C;  2K2A A;  1YRT B;  2L98 A;  4MZL A;  1BU3 A;  3NSL A;  4AQI A;  1CFF A;  1PVA A;  4CID A;  4L9M A;  3CR2 A;  2LMU A;  1RJV A;  3A8R A;  1AVS A;  2Y1M A;  1K9P A;  2K7O A;  3SIB A;  2LP2 A;  1F70 A;  1L7Z A;  1NYA A;  3A4U B;  1YUU A;  1JUO A;  2LE9 B;  2MLE C;  2WOR A;  3EKH A;  1TRF A;  2K2F A;  1S6C A;  3FS7 A;  2TN4 A;  3VRN A;  1IRJ A;  3SG6 A;  1OSA A;  1NWD A;  3ZWH A;  2SCP A;  1XFW O;  1R2U A;  2G9B A;  2KOT A;  3PN7 B;  3F45 A;  3EKJ A;  1FBV A;  1Q80 A;  1EH2 A;  2KBM A;  2K8M B;  1UHN A;  2ZN9 A;  5TNC A;  5HKW A;  1OMD A;  1F71 A;  2H2K A;  1NP8 A;  2JT0 A;  4PHK A;  5KU1 A;  1ALW A;  1NUB A;  2JXL A;  1CFC A;  2LUX A;  1LA0 A;  1OMR A;  1SY9 A;  4R1E A;  1G33 A;  4JQ0 D;  4BY4 A;  1NSH A;  2H61 C;  3H4S E;  3PAT A;  3I5F B;  1J7Q A;  2WCE A;  1SCM B;  4N5X A;  3I5I B;  1DGU A;  1TCF A;  1IQ5 A;  5HKZ A;  5I2L A;  1SNL A;  1PK0 D;  1UUS A;  2MAZ A;  1S1E A;  4HRE E;  2LCP A;  3RLZ A;  4E68 A;  2KBI A;  1IGV A;  3I5G C;  1Y1U A;  1QS7 A;  2BE6 A;  3BYA A;  1TNQ A;  5I2O A;  1DGV A;  1AP4 A;  1KFU L;  4MLW A;  3DF0 A;  5ER5 A;  3TDZ A;  4GNK B;  3TDU A;  1K2H A;  1LXF C;  3BOW A;  2Q4U A;  2I7A A;  2M49 B;  2SAS A;  2KDH A;  2BL0 C;  3OB1 B;  2I18 A;  1A4P A;  2KFH A;  1NX1 A;  1A29 A;  2KAY A;  2KI6 C;  1BJF A;  1KCY A;  1ALV A;  1HT9 A;  2L2E A;  1ZMZ A;  1LA3 A;  2LP3 A;  1DJZ A;  4GGF C;  1WDC B;  1YVH A;  2JTT A;  3VRR A;  1KSO A;  4I5N B;  1QLK A;  4OR9 B;  2OTG B;  3WXA A;  4A4C A;  4ORB B;  3AAK A;  3OX6 A;  2F2P A;  1SMG A;  3O78 A;  5KSZ A;  1EJ3 A;  2B1U A;  3CTN A;  5HYD A;  4MBE A;  3O4Y A;  1CM1 A;  4GGN A;  3OP0 A;  1QTX A;  2F3Z A;  1KSM A;  2K7B A;  5AEQ A;  3RM1 A;  2JOJ A;  2KFF A;  2MA2 A;  2PSR A;  5AER A;  2M0R A;  1MHO A;  2CNP A;  2L50 A;  2JUL A;  1CFD A;  2VRG A;  1A75 B;  4PHM A;  4PHN A;  2KNE A;  4OVN F;  2LLT A;  2EC6 C;  1IG5 A;  2KAV A;  1TNX A;  1BOC A;  1TNW A;  1OMV A;  2MRD A;  1UHJ A;  5D7F A;  4TNC A;  3SG4 A;  1KFX S;  1NX3 A;  3BUN B;  2JNF A;  2GV5 A;  1W7J B;  1YVL A;  2H61 A;  3TDI A;  2DOQ A;  4MEW A;  4USL A;  4HRH A;  4I5J A;  1XFZ O;  3SJS A;  1AUI B;  3VRP A;  1MQ1 A;  2BKH B;  2WOS A;  4MVF A;  1EL4 A;  4M2P A;  4GAO A;  1PVB A;  1YX7 A;  4GPL B;  4I5K A;  4JWQ A;  5F6T A;  4CLN A;  2JC2 A;  1MUX A;  2ZNE A;  1NX2 A;  3GK2 A;  1SK6 D;  2F8P A;  1UHI A;  5HLV A;  2LM5 A;  2ZN8 A;  2MLF C;  3AKA A;  2ZRT A;  1U5I A;  2BE4 A;  4UPG A;  4PAL A;  1WRZ A;  1KK8 B;  1KQM B;  1DTL A;  5D69 A;  2KQY A;  3CZT X;  5I2Q A;  1CMF A;  1M46 A;  1NCX A;  3KEV A;  1L2O C;  3SG5 A;  4P5O E;  2K61 A;  1JF2 A;  1W7I B;  2MBX A;  3K21 A;  1ZUZ A;  3QRX A;  1CKK A;  1S26 D;  1OOJ A;  2M7L A;  5KTY A;  4Q04 A;  2HET A;  1Y6W A;  5J3X A;  2L4H A;  2KAX A;  3WNX B;  5HKY A;  1SW8 A;  4PCW A;  3NSI A;  1SR6 B;  4C0J A;  2V53 A;  4ZCU A;  1B9A A;  1BF5 A;  4NQG A;  2BCB A;  1BT6 A;  3KO0 A;  3BXK A;  4ICB A;  2L0P A;  1TTX A;  1G4Y R;  4PHJ A;  1GJY A;  5DKR A;  4CPV A;  1DJX A;  1OZO A;  4N1F A;  1JFJ A;  1FW4 A;  2M9G A;  3LCP C;  1CFP A;  1K95 A;  1BR1 B;  2CBL A;  2Y1N A;  3FWB A;  1SRA A;  1S36 A;  4YBH B;  1JFK A;  1F55 A;  2CCM A;  3I5F C;  4OCI A;  3I5I C;  4YGE B;  3EVV A;  3DD4 A;  2PAS A;  1CDN A;  1C7V A;  2CXJ A;  4YGD B;  4PDZ A;  1N2D A;  3PM8 A;  4WRI A;  1G8I A;  2LVV A;  3DF0 B;  2NCO A;  3IQQ A;  1KFX L;  1UP5 A;  3KHE A;  2KYC A;  3BOW B;  1IQ3 A;  3D10 A;  2LAN A;  1B8C A;  1J55 A;  5ER4 X;  1SPY A;  1S6J A;  2ZKM X;  2LHI A;  3CGA A;  3LK1 A;  5IBW A;  3CWG A;  5CPV A;  2P6B B;  3PAL A;  2LC5 A;  2KI4 B;  2JTZ A;  4ZCV A;  1GGZ A;  1FI6 A;  1TN4 A;  4PE0 A;  3JTD B;  2NZ0 A;  2KGB C;  2PMY A;  1Y1A A;  2BBM A;  3C1V A;  2BCA A;  2R2I A;  2NCP A;  1DT7 B;  2HQW A;  1AHR A;  4ORC B;  1J7R A;  3WHU B;  2HF5 A;  1FF1 A;  2EHB A;  1K9U A;  4NDC A;  1RWY A;  2JWW A;  1WLZ A;  2BKI B;  3M0W A;  2M8U A;  1RRO A;  2LLS A;  5CSN A;  1SL9 A;  5DKN A;  1CLL A;  2ZND A;  1S3P A;  4MZJ A;  1CLB A;  2Y5I A;  1K93 D;  2QPT A;  1XVJ A;  1EG4 A;  1J7O A;  1YX8 A;  5K89 A;  3EVR A;  2LMT A;  2MHH A;  2O60 A;  3CR5 X;  1E8A A;  3SIA A;  1F8H A;  4ORA B;  1TNP A;  2LV7 A;  1SYM A;  2JNX A;  3ZNI A;  1BLQ A;  1GGW A;  3HX4 A;  1YUS A;  4CFR A;  3CLN A;  3GK4 X;  2WC8 A;  1LKJ A;  1ZFS A;  2AAO A;  5JOL A;  1A03 A;  2LAP A;  1MWN A;  4N1G A;  3CR4 X;  1CLM A;  1CB1 A;  1VRK A;  1M31 A;  5CSJ A;  1PSB A;  3OX5 A;  4P2Y B;  1KWO C;  1J7P A;  2KHN A;  3JVT C;  1BG1 A;  1MF8 B;  3TUY C;  3I5G B;  2I94 A;  1IWQ A;  2OS8 B;  1U5I B;  1KQV A;  3LLE A;  3DVK A;  1WLM A;  1RK9 A;  2LHL A;  1PSR A;  1MXE A;  4GBA A;  1LVC D;  1QIV A;  1UWO A;  2HPS A;  2M1K B;  2E6W A;  3EK7 A;  2LLU A;  3IQO A;  2WCB A;  4YGB B;  1B7T Z;  3HCM A;  2LVJ A;  2BL0 B;  3EVU A;  1KK8 C;  2E30 A;  2OPO A;  1JWD A;  1KQM C;  2JZI A;  4YI9 A;  1OZS A;  3SG7 A;  1M45 A;  1B7T Y;  1PAL A;  1R6P A;  2JRF A;  2K7D A;  1X02 A;  3BUX B;  3KF9 A;  3PLF B;  1BR4 B;  4MRY A;  5B8I B;  1C7W A;  1BOD A;  1QAS A;  1PRW A;  4GUK A;  1IKU A;  1CDM A;  1TOP A;  1NX0 A;  1MXL C;  2JT3 A;  1B4C A;  2L51 A;  3IF7 A;  1K90 D;  4U8D A;  1Y1X A;  2HQ8 A;  3DVJ A;  2NLN A;  1V1G A;  3E3R A;  1DJG A;  4QJ5 B;  3VRQ A;  4WQ2 A;  1M39 A;  1DJH A;  2F3Y A;  4MSP A;  1GQM A;  3NXA A;  2LUC A;  3D0Y A;  4WQ3 A;  5AAN A;  3SG2 A;  1KK7 Z;  4MRX A;  1UUR A;  5CSF A;  1WRL A;  1TCO B;  1S5G Z;  2KYF A;  4C0K A;  2GGZ A;  4GGF A;  4MZK A;  1B47 A;  3I5H B;  3TS5 B;  3PSR A;  3PN7 C;  1QVI Z;  1S5G Y;  4AOM A;  2LVI A;  3FWC A;  2KFG A;  4MN0 A;  4A4B A;  1F54 A;  2ISD A;  1WY9 A;  1DF0 A;  3WHT B;  2MJW B;  1XK4 C;  1M63 B;  1AK8 A;  2M7N A;  4D1E A;  1K94 A;  1IJ6 A;  2M3W A;  1QIW A;  1IJ5 A;  1IH0 A;  1SCM C;  5AFP A;  1UHK A;  2FCE A;  2WND A;  1QJT A;  2FCD A;  3PFV A;  3CS1 A;  1YUR A;  3TZ1 A;  1A2X A;  4CFQ A;  2ZFD A;  1L2O B;  1NIW A;  1BMO A;  5BPJ A;  2BCX A;  3GOF A;  3VRO A;  4OV2 A;  4DIR A;  4QJ3 B;  5HLO A;  2CT9 A;  1NCY A;  2PRU A;  2QAC A;  2EGD A;  4NDB A;  1JF0 A;  3OB2 B;  1RTP 1;  3AKB A;  2M29 A;  1NPQ A;  4YRU A;  3DVE A;  1MR8 A;  5PAL A;  2GGM A;  4XJK A;  2LMV A;  2O5G A;  4BY5 A;  4DUQ A;  3EK8 A;  2G2B A;  2NXQ A;  2BEC A;  1SCV A;  3BUM B;  3GK1 A;  1WDC C;  2PAL A;  1YR5 A;  4IL1 A;  2M97 A;  4AQJ A;  2FOT A;  2OTG C;  4JPZ B;  3LK0 A;  1D1O A;  1FPW A;  1YTZ C;  4HSZ A;  1C07 A;  2CTN A;  2L4I A;  2KSP A;  2L5X B;  1SKT A;  1JSA A;  2JT8 A;  4HRG A;  3NSK A;  1OQP A;  2JXC A;  1J1E A;  1H8B A;  2A4J A;  4C0L A;  1JC2 A;  2OS8 C;  1DJY A;  1JBA A;  1ODB A;  5I8N A;  1RFJ A;  2ZRS A;  1QXP A;  1TIZ A;  1XFV O;  2AMI A;  1QX2 A;  1XK4 A;  1S6I A;  1K96 A;  1UHH A;  2D8N A;  1WRK A;  1F4Q A;  2KI6 D;  4F0Z B;  4YI8 A;  5G08 A;  2LNK A;  1DJW A;  2RGI A;  2JQ6 A;  4FQO A;  1REC A;  1NCZ A;  1XYD A;  2K0J A;  4I5L B;  1K9K A;  1AJ4 A;  1QX5 B;  1K8U A;  5GQQ C;  5JJG A;  2JPT A;  1QV1 A;  1QLS A;  3D0Y B;  2M1U A;  2FJU B;  2Y4Q A;  1CM4 A;  4GFT A;  4XYN A;  1F4O A;  4DS7 A;  1CNP A;  2COL B;  1LIN A;  4PE1 A;  1DJI A;  3OHM B;  3O2P A;  1EG3 A;  1FI5 A;  1QX7 A;  2AUC A;  2Q91 A;  4FTG A;  1DMO A;  1YRU B;  1B8R A;  1ZAC A;  3LL8 B;  1HQV A;  3AAJ A;  4M2O A;  1XFX O;  2JU0 A;  3FIA A;  1ZOT B;  1N65 A;  1CMG A;  1PUL A;  1DF0 B;  3I5H C;  4M2Q A;  4DRW A;  1CDP A;  4DCK A;  1SBJ A;  3TS5 C;  3EK4 A;  1XA5 A;  1KWO B;  1SR6 C;  1YUT A;  1XO5 A;  5AXI A;  1QV0 A;  3JVT B;  4ETO A;  2F33 A;  3TUY B;  1DVI A;  3SG3 A;  1CDL A;  5DKQ A;  3KPX A;  1Y0V H;  1AJ5 A;  1QAT A;  3MSE B;  4PE4 A;  2EC6 B;  2I2R E;  1SL7 A;  1CTR A;  1EXR A;  4NDD A;  2WCF A;  1B8L A;  1KK7 Y;  4YGA A;  2K7C A;  2KQ6 A;  5CSI A;  1A75 A;  2LVK A;  3VGO A;  3DVM A;  4OKH A;  1V1F A;  2IS9 A;  4PE7 A;  3BUW B;  5FYX A;  1H4B A;  1KFU S;  3NSO A;  4YGC B;  2F2O A;  1B1G A;  4QJ4 B;  1SL8 A;  1J1D A;  1QVI Y;  1XFU O;  2PVB A;  1N0Y A;  2KGR A;  1OE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...