1B8RA

Parvalbumin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
b'AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDEWTALVKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
molecule tags Calcium binding protein
total genus 41
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b8rA00
5F6TA 3DVJA 2K7OA 4XJKB 2G9BA 5AFPA 2JWWA 4MSPA 1NYAA 3DVEA 1WRLA 1K8UA 2I18A 3FWBA 4AOMA 5G08A 4UPGA 2K0JA 1AUIB 4A4BA 2V53A 2JXCA 1UUSA 1TCOB 1YRUB 1CLLA 1WRKA 1XFUO 1DTLA 1YUUA 5JOLA 1SK6D 1MF8B 2H61A 1Q80A 1NX0A 3JVTB 2K2AA 2K8MB 3CTNA 1M63B 1MUXA 1QXPA 1VRKA 1Y1XA 1NWDA 5PALA 2WNDA 2M0RA 1N65A 3KF9A 3O2PA 2MJWB 1CMFA 1QV0A 1CDLA 2K7BA 5GQQC 4YI8A 4CLNA 1RJVA 2P6BB 2M7LA 1EJ3A 1QIWA 2GGMA 2LCPA 1KK8C 3CS1A 1XK4C 1J1EA 1YUTA 2ZNDA 5HKWA 3I5GB 5I2OA 5KU1A 2Y1MA 2BL0C 4MLWA 1S5GY 1YVLA 2HQWA 1LA3A 4MEWA 1J7OA 4ZCUA 3AKAA 2M7NA 3KHEA 1KK7Y 1NP8A 4ORAB 3FS7A 1F54A 3SIBA 2PASA 2MLEC 4A4CA 3EVRA 1CNPA 4I5LB 3SG2A 4JPZB 4FTGA 3DVKA 2JT3A 2MLFC 3LL8B 3PATA 3PFVA 5TNCA 1DJIA 4YGBB 3BUXB 1L2OC 1NPQA 2PSRA 1JC2A 2KFFA 4YBHB 2MHHA 2FJUB 2BECA 2ZN8A 1OSAA 1JUOA 4IL1A 1V1GA 2OTGC 1FI6A 1CLMA 3BOWA 1KSMA 1FW4A 1NX3A 1LXFC 1ZFSA 2KBMA 3M0WA 3LLEA 5KTYA 1WY9A 1ZUZA 5DKQA 1Y6WA 2M1UA 1AK8A 3E3RA 1QX7A 5KSZA 1TNWA 2KHNA 1FPWA 1IH0A 5CSNA 4U8DA 1BLQA 2MRDA 2E30A 3TZ1A 5AERA 2JT8A 3BUNB 4ORCB 1B8RA 2BCBA 1SBJA 1WLZA 4GBAA 1YVHA 1B7TY 1MWNA 2KI4B 3CZTX 1QLSA 2JU0A 3PSRA 2AAOA 3BUMB 1CMGA 4GGFA 1NCYA 3A8RA 4YGDB 5CSJA 3K21A 3CR4X 3IF7A 2JNFA 4NQGA 4GPLB 4AQIA 1B47A 4HSZA 1F55A 3SG6A 2PRUA 1N2DA 2JT0A 2O5GA 2BL0B 3TS5B 1IRJA 1G4YR 1DJZA 1SR6C 3GOFA 1TN4A 2CBLA 2BKHB 3OX5A 3OX6A 2M97A 3EKJA 4N1GA 4QJ4B 3O6BA 3BUWB 2LLSA 4MRXA 2L50A 1KCYA 2NCOA 2LHIA 2PVBA 1DJYA 3SG3A 2KFGA 1B1GA 5CSIA 3A4UB 3CGAA 1H8BA 1L2OB 1XFYO 2HQ8A 3NXAA 1NUBA 2L4HA 2I2RE 2KYCA 4E68A 3TUYC 2KQYA 2JTTA 1SL9A 4NDDA 1F8HA 3EK4A 4CFQA 4WQ2A 1KFUS 2QACA 3AAKA 1CDPA 1PRWA 4PE7A 3D0YA 1G8IA 3CLNA 2LAPA 1JF2A 1KFUL 4QJ3B 4PHMA 4XJKA 2HF5A 3BUOB 1K95A 4OV2A 1J7PA 2K7CA 1QASA 2BKIB 5AXIA 2JPTA 3OB1B 1S1EA 1DJHA 1RECA 2WOSA 4N5XA 1ALWA 5DKNA 1WDCC 4YRUA 1BG1A 1QVIZ 3IQQA 1MHOA 1J7QA 5CPVA 2LP3A 5K89A 1IKUA 1AHRA 4JQ0D 1K93D 1KQMC 1S6JA 2L5XB 1FI5A 1CM4A 1MR8A 4YGEB 2LHLA 2K2FA 2K7DA 3BYAA 1IG5A 1TIZA 2BE4A 1OE9B 1JBAA 1WLMA 1UHNA 2KGBC 3O4YA 4TNCA 5HKYA 1DMOA 1MXEA 2SCPA 1S3PA 1SMGA 2A4JA 2LE9B 2M1KB 2CCMA 4M2QA 4PHKA 3I5FB 1ALVA 1M39A 1QX2A 1YURA 2M49B 4GGNA 2MBXA 1BR1B 1EH2A 1YUSA 4N1FA 1DJWA 3CWGA 2LNKA 4I5NB 1SL8A 2RGIA 3LK1A 1CFCA 4USLA 2KDHA 1M45A 1RTP1 2KAXA 1CM1A 1OOJA 2HETA 2CTNA 1QJTA 2JULA 1B8CA 1NSHA 2KQ6A 1RROA 2KNEA 1SL7A 1JWDA 1TCFA 3TUYB 2WCEA 1K9KA 1K90D 1QTXA 1XFZO 4QJ5B 5AEQA 3VGOA 1Y1AA 3AAJA 1S5GZ 3FWCA 1IWQA 1KK7Z 1J55A 1UHHA 4PALA 1XFWO 2CT9A 3I5IC 2L51A 4L9MA 4DRWA 1YX8A 2DOQA 2ZFDA 4PHNA 4MRYA 2AUCA 1XO5A 2LLUA 3I5HC 1NCXA 2JTZA 1TNXA 1SYMA 2LANA 1AP4A 4OCIA 3RM1A 1XFXO 1PK0D 3KPXA 2KOTA 5D69A 2B1UA 1KQMB 2F2PA 3PN7C 4JWQA 4PCWA 2BE6A 1SW8A 4NDCA 1XVJA 2PMYA 3FIAA 1CB1A 1BF5A 4GFTA 1H4BA 2KAYA 2BBMA 2LVIA 2ISDA 3JTDC 3BXKA 2LUCA 1LVCD 3KO0A 4M2OA 2OS8C 4WRIA 1R2UA 3WHTB 2R2IA 1KK8B 3PM8A 1EG4A 2M9GA 1LA0A 3PALA 3CR5X 1XK4A 1B4CA 2MAZA 3SJSA 1HQVA 3OB2B 1XFVO 1QX5B 2K61A 1S36A 1YR5A 1OMDA 2L0PA 2LVVA 4YGAA 4DCKA 4CIDA 1S6IA 2JOJA 1UP5A 2QPTA 1OMVA 2VRGA 1J7RA 1B7TZ 1OZSA 1Y0VH 2H61C 3HCMA 2H2KA 4C0LA 3VRNA 2GV5A 2LMUA 1BMOA 1UHJA 2FOTA 3JVTC 3TDUA 1ZACA 2KI6C 2KSPA 3ICBA 1K9UA 1W7IB 4BY5A 4OVNF 2F3ZA 1AJ4A 1EXRA 3O78A 1NX1A 1BU3A 1OQPA 1CTRA 1SRAA 1TNQA 1N0YA 1R6PA 4Q04A 2WORA 4M2PA 1QV1A 2FCEA 1KWOC 1F4OA 4OKHA 5D7FA 4ETOA 2I7AA 1BT6A 2OTGB 1SY9A 2BBNA 2F8PA 2F3YA 1J1DA 3WHUB 3I5GC 1F70A 2L98A 3EK7A 4MN0A 3VROA 2LVJA 1YX7A 3I5HB 1C07A 2NZ0A 5DKRA 4XYNA 4MBEA 1IJ6A 2LM5A 1OZOA 4GAOA 4PHJA 1WRZA 2EC6C 2LP2A 4PE4A 3PN7B 1DJXA 4F0ZB 2CNPA 2O60A 4MZKA 2M3WA 1JFJA 3TDIA 5B8IB 1BR4B 3MSEB 2LMVA 2ZRTA 3AKBA 3EK8A 1KFXS 1SCMC 3SG5A 2JXLA 2Q4UA 1ZMZA 2OS8B 1A29A 1DVIA 1NIWA 1KFXL 4I5JA 4C0KA 4MZJA 2KAVA 1LINA 1SR6B 2CXJA 3GK2A 1DJGA 3LCPC 3EKHA 4NDBA 4CFRA 3NSOA 3IQOA 5AANA 3PLFB 1NX2A 1EG3A 4WQ3A 2NCPA 4AQJA 3SIAA 1K96A 1X02A 2AMIA 1A75B 1PULA 2LVKA 4CPVA 1GGWA 1IJ5A 1A75A 4HRGA 1LKJA 2JZIA 1QLKA 1SKTA 2KI4C 2ZRSA 2WC8A 1DGUA 1PVBA 1ZOTB 1PVAA 1KSOA 2ZKMX 4GGFC 5I2QA 1XA5A 4YGCB 3OP0A 1Y1UA 1FF1A 2M8UA 1KWOB 3VRPA 2F33A 1RK9A 1MXLC 1IQ3A 4PDZA 3RLZA 3NSIA 1AJ5A 2TN4A 5HYDA 1GGZA 2LV7A 4GNKB 1C7VA 2Y5IA 3QRXA 2BCXA 3TDZA 1YRTB 2FCDA 4C0JA 1A4PA 1FBVA 1HT9A 1TOPA 2KYFA 1QATA 3TS5C 1QS7A 3NSLA 1KQVA 2G2BA 1TNPA 1F4QA 2OPOA 2ZNEA 2KGRA 5CSFA 5HKZA 2EC6B 2SASA 1TTXA 4ZCVA 4DIRA 4R1EA 2I94A 2MA2A 2NXQA 4BY4A 1M46A 4DUQA 4YI9A 5JJGA 1GJYA 1WDCB 3HX4A 3LK0A 4MVFA 4D1EA 5J3XA 3WXAA 3VRRA 4ORBB 3C1VA 1SCMB 3H4SE 1K94A 1ODBA 2IS9A 1W7JB 1RWYA 2ZN9A 5I8NA 1PSRA 2EGDA 5ER5A 2Q91A 2JRFA 2M29A 1B8LA 2JQ6A 3EVUA 4P2YB 5IBWA 2COLB 1D1OA 3WNXB 3D10A 2LC5A 1MQ1A 1SCVA 3BOWB 2PALA 1JF0A 1GQMA 1IGVA 1B9AA 1UURA 3GK4X 3SG7A 2NLNA 1UHIA 1PSBA 1UHKA 4GUKA 3SG4A 3CR2A 1C7WA 4DS7A 2LLTA 1JFKA 1SNLA 1UWOA 2D8NA 2Y1NA 3DVMA 1DT7B 1SPYA 2EHBA 1CDMA 1BODA 1F71A 4I5KA 4PE1A 1A2XA 1QIVA 1NCZA 1K9PA 2HPSA 1YTZC 1CDNA 1CKKA 4FQOA 1K2HA 3KEVA 2GGZA 2KBIA 4PE0A 1RFJA 3GK1A 5FYXA 3ZNIA 4OR9B 2LMTA 3DD4A 1BJFA 2JC2A 3DF0B 2KFHA 3DF0A 3I5FC 3OHMB 1BOCA 3I5IB 2F2OA 4HREE 5HLOA 1G33A 1TRFA 1CFPA 2WCBA 1L7ZA 2KI6D 4MZLA 1XYDA 2E6WA 1EL4A 1CLBA 4ICBA 1CFFA 1DGVA 2L4IA 2LUXA 3F45A 1CFDA 1U5IB 2JNXA 1DF0B 3BQ3A 1U5IA 3VRQA 5BPJA 4HRHA 2WCFA 1DF0A 1S6CA 1IQ5A 4P5OE 2BCAA 1S26D 1AVSA 1E8AA 1PALA 1V1FA 5HLVA 1JSAA 3EVVA 1QVIY 3NSKA 5I2LA 2L2EA 3JTDB 1M31A 5ER4X 3ZWHA 3D0YB 1A03A 1OMRA 2Y4QA
chains in the Genus database with same CATH superfamily
5F6TA 3DVJA 2K7OA 4XJKB 1TWOA 2G9BA 5AFPA 2JWWA 4MSPA 1NYAA 3DVEA 1WRLA 1K8UA 2I18A 2FJYA 3BFHA 3FWBA 5G08A 4AOMA 4UPGA 2K0JA 1AUIB 4A4BA 1TUZA 2V53A 2JXCA 1GM0A 1UUSA 1TCOB 1YRUB 1CLLA 1WRKA 1XFUO 1DTLA 1YUUA 5FI2A 1SK6D 1MF8B 5JOLA 2H61A 2WCMA 1Q80A 4DCKA 1NX0A 3JVTB 2K2AA 3FE8A 2K8MB 3CTNA 1M63B 1MUXA 1QXPA 1VRKA 1Y1XA 1NWDA 1T14A 5PALA 3L47A 2WNDA 2M0RA 1N65A 1P28A 3KF9A 3L4AA 3O2PA 2MJWB 3D76A 1CMFA 1QV0A 1CDLA 2K7BA 5GQQC 4YI8A 4CLNA 1RJVA 2P6BB 2M7LA 1Z4HA 1EJ3A 1QIWA 2GGMA 2LCPA 3OGNA 1KK8C 3CS1A 1XK4C 1J1EA 1YUTA 2ZNDA 5HKWA 3CZ2A 3I5GB 5I2OA 5KU1A 2Y1MA 2BL0C 4MLWA 1S5GY 1YVLA 2HQWA 1LA3A 4MEWA 1J7OA 4ZCUA 1TUJA 3AKAA 2M7NA 3KHEA 1KK7Y 1NP8A 4ORAB 3FS7A 3DZTA 1F54A 5D3OA 3SIBA 2PASA 2MLEC 4A4CA 3EVRA 1CNPA 4I5LB 3SG2A 4JPZB 4FTGA 3DVKA 2JT3A 2MLFC 3LL8B 3PATA 3PFVA 5TNCA 1DJIA 4YGBB 3BUXB 1L2OC 1NPQA 2PSRA 3CZ1A 1JC2A 2KFFA 4YBHB 2MHHA 2FJUB 2BECA 2ZN8A 1OSAA 5DICA 1JUOA 4IL1A 1V1GA 2OTGC 1FI6A 1CLMA 3BOWA 1C3YA 1KSMA 2GTEA 1FW4A 1NX3A 1LXFC 1ZFSA 2KBMA 3M0WA 3LLEA 5KTYA 1WY9A 1LS8A 1ZUZA 3FE6A 5DKQA 1Y6WA 2M1UA 1AK8A 3E3RA 1QX7A 5KSZA 1TNWA 2KHNA 1FPWA 1IH0A 5CSNA 4U8DA 1BLQA 2MRDA 2E30A 3TZ1A 5AERA 3PJIA 2JT8A 3BUNB 4ORCB 1B8RA 2BCBA 1SBJA 3BFBA 1WLZA 4GBAA 1YVHA 1B7TY 1MWNA 2KI4B 3CZTX 1QLSA 2JU0A 3PSRA 2AAOA 3BUMB 1CMGA 4GGFA 1NCYA 3A8RA 4YGDB 5CSJA 3K21A 3CR4X 3D73A 3IF7A 2JNFA 3K1EA 4NQGA 4GPLB 4AQIA 1B47A 4HSZA 1F55A 3SG6A 2PRUA 3SS4A 1N2DA 2JT0A 2O5GA 2BL0B 3TS5B 1IRJA 1G4YR 1DJZA 1SR6C 3GOFA 1TN4A 2CBLA 2BKHB 3OX5A 3OX6A 2M97A 3EKJA 3B86A 1QWVA 4N1GA 3O6BA 3BUWB 2LLSA 4MRXA 1DEKA 1OOFA 2L50A 1KCYA 2NCOA 4F7FA 1W9ZA 2LHIA 2PVBA 1DJYA 5FI7A 3SG3A 2KFGA 3DY9A 1B1GA 5CSIA 3A4UB 3CGAA 3EG5B 1H8BA 1L2OB 1XFYO 2HQ8A 3NXAA 1NUBA 2L4HA 2I2RE 2KYCA 4E68A 3TUYC 4QJ4B 5I94A 2KQYA 2JTTA 1SL9A 4NDDA 1F8HA 3EK4A 4CFQA 1Z2CB 4WQ2A 1KFUS 2QACA 3AAKA 1CDPA 1PRWA 4PE7A 3D0YA 1G8IA 3CLNA 2LAPA 1JF2A 1KFUL 4OZDA 4QJ3B 4PHMA 4XJKA 2HF5A 3BUOB 1K95A 4OV2A 1J7PA 2K7CA 1QASA 2BKIB 5AXIA 2JPTA 3OB1B 1S1EA 1DJHA 1RECA 2WOSA 3Q8IA 1ALWA 4N5XA 5DKNA 5ER5A 1WDCC 4YRUA 1BG1A 1QVIZ 3IQQA 1MHOA 1OOIX 3L4LA 3D77A 1J7QA 5CPVA 2LP3A 5K89A 1IKUA 1AHRA 4JQ0D 1K93D 1KQMC 1S6JA 2L5XB 4KYNA 1CM4A 1FI5A 1MR8A 4YGEB 2LHLA 1ORGA 2K2FA 2K7DA 3BYAA 4INXA 1IG5A 1TIZA 2BE4A 1OE9B 3R1VA 1JBAA 2L5YA 1WLMA 1UHNA 2KGBC 3O4YA 4TNCA 2KLDA 3S0EA 5HKYA 1MXEA 2QEVA 1S3PA 1SMGA 2A4JA 2LE9B 1OW4A 2M1KB 2SCPA 2WCJA 2CCMA 4M2QA 4PHKA 3I5FB 1DQEA 1ALVA 1M39A 1QX2A 1YURA 2M49B 4GGNA 2MBXA 1BR1B 1EH2A 1YUSA 4N1FA 1DJWA 3CWGA 2LNKA 4I5NB 1SL8A 2RGIA 3LK1A 1CFCA 4USLA 2KDHA 1M45A 1RTP1 2KAXA 1CM1A 1OOJA 2HETA 2CTNA 3PM2A 1QJTA 2JULA 1B8CA 2P71A 1NSHA 2KQ6A 1RROA 2KNEA 1SL7A 1JWDA 1TCFA 3TUYB 3UNWA 2WCEA 1K9KA 1K90D 1QTXA 1XFZO 1DMOA 4QJ5B 5AEQA 3VGOA 2ERBA 1Y1AA 2QEBA 3AAJA 1S5GZ 3FWCA 1IWQA 2QEOA 1KK7Z 1J55A 1UHHA 4PALA 1OOGA 1XFWO 2CT9A 2JPOA 2L51A 3I5IC 4L9MA 1YX8A 4DRWA 2DOQA 2ZFDA 4JKTA 4PHNA 4MRYA 2AUCA 1IIOA 1XO5A 2LLUA 3I5HC 1NCXA 2JTZA 1TNXA 1SYMA 2LANA 1AP4A 4OCIA 3RM1A 1XFXO 1PK0D 3KPXA 2KOTA 5D69A 2B1UA 1KQMB 2F2PA 3PN7C 3O4XA 4JWQA 4PCWA 2BE6A 1SW8A 4NDCA 1XVJA 2PMYA 3FIAA 1CB1A 1BF5A 3BJHA 4GFTA 1H4BA 2KAYA 2BBMA 5HL1A 2LVIA 2ISDA 3JTDC 3BXKA 2QEHA 5EL2A 2LUCA 1LVCD 3KO0A 4M2OA 3VB1A 2OS8C 4WRIA 1R2UA 3WHTB 4PT1A 2R2IA 1KK8B 3PM8A 1EG4A 2M9GA 1LA0A 3PALA 3CR5X 1XK4A 1B4CA 2MAZA 3SJSA 1HQVA 3OB2B 1XFVO 1QX5B 2K61A 1S36A 1YR5A 1OMDA 2L0PA 2LVVA 3N7HA 3OBVA 4YGAA 4CIDA 1S6IA 2JOJA 1UP5A 2QPTA 1OMVA 2VRGA 1J7RA 1B7TZ 1OZSA 1Y0VH 2H61C 3HCMA 2H2KA 4C0LA 4JD9A 3VRNA 2GV5A 2LMUA 2PQLA 1BMOA 1UHJA 2FOTA 2L2CA 2BNXA 3JVTC 3TDUA 1ZACA 2KI6C 2KSPA 3ICBA 1K9UA 1W7IB 4BY5A 4OVNF 2F3ZA 1AJ4A 1EXRA 3O78A 1NX1A 1BU3A 1OQPA 1CTRA 1SRAA 1TNQA 2BAPA 1N0YA 1OOHA 1R6PA 4Q04A 2WORA 4M2PA 3CABA 1QV1A 2FCEA 1KWOC 1F4OA 4OKHA 5D7FA 4ETOA 2I7AA 3S0GA 1BT6A 2OTGB 1SY9A 2BBNA 2F8PA 3R72A 4INWA 2F3YA 1J1DA 3WHUB 3I5GC 1F70A 2L98A 3EK7A 4MN0A 3VROA 2LVJA 1YX7A 2P70A 3I5HB 2NZ0A 5DKRA 1C07A 4XYNA 4MBEA 1IJ6A 2WCLA 2WC6A 2LM5A 1OZOA 4GAOA 4PHJA 1WRZA 2EC6C 2LP2A 4PE4A 3PN7B 2QDIA 1DJXA 4F0ZB 2CNPA 2O60A 4MZKA 2M3WA 1JFJA 3TDIA 2WCHA 3IVTA 3FE9A 2K60A 1BR4B 3R1PA 5B8IB 3MSEB 2LMVA 2ZRTA 3AKBA 3EK8A 1KFXS 1SCMC 3SG5A 2JXLA 2Q4UA 1ZMZA 2OS8B 1A29A 3B7AA 1DVIA 1NIWA 1KFXL 4I5JA 4C0KA 3DXLA 3NHTA 4IJ7A 3QMEA 4MZJA 2KAVA 5FI6A 1LINA 1SR6B 2CXJA 3GK2A 1DJGA 3LCPC 3EKHA 4NDBA 4CFRA 3S0FA 3NSOA 3IQOA 5AANA 3PLFB 1NX2A 1EG3A 1SSEB 2NCPA 4WQ3A 4AQJA 3SIAA 1K96A 1X02A 2AMIA 2WCKA 1A75B 1PULA 2LVKA 1C3ZA 3SS5A 4CPVA 3B6XA 1IJ5A 1A75A 4HRGA 1GGWA 1LKJA 2JZIA 1QLKA 1SKTA 2KI4C 2ZRSA 2WC8A 1DGUA 1PVBA 1ZOTB 1PVAA 1KSOA 2ZKMX 4GGFC 5I2QA 1XA5A 4YGCB 3OP0A 1Y1UA 3CDNA 1FF1A 2M8UA 1KWOB 3D74A 3VRPA 2F33A 1RK9A 1MXLC 1IQ3A 4PDZA 3RLZA 2YGUA 3NSIA 1AJ5A 2TN4A 3NGVA 5HYDA 1GGZA 2LV7A 4GNKB 1C7VA 2Y5IA 3QRXA 2BCXA 3TDZA 1YRTB 2FCDA 2KPHA 3D78A 4C0JA 1A4PA 1FBVA 1HT9A 1TOPA 1XFRA 1QATA 2KYFA 1QS7A 3NSLA 3TS5C 3SS3A 2G2BA 1KQVA 1TNPA 1F4QA 2OPOA 2ZNEA 2KGRA 5CSFA 5HKZA 2EC6B 2SASA 1TTXA 4ZCVA 4DIRA 4R1EA 2I94A 2MA2A 2NXQA 4BY4A 1M46A 4DUQA 4YI9A 5JJGA 1GJYA 1WDCB 3HX4A 3LK0A 4MVFA 4D1EA 5J3XA 3WXAA 3VRRA 4ORBB 3S0BA 3C1VA 1SCMB 3H4SE 1K94A 1ODBA 2IS9A 1W7JB 1RWYA 2ZN9A 5I8NA 2H8VA 1PSRA 2EGDA 3D75A 3DYEA 2Q91A 2JRFA 2M29A 1B8LA 2JQ6A 3CZ0A 3EVUA 4P2YB 2COLB 5IBWA 1D1OA 3WNXB 3D10A 2LC5A 3B88A 1MQ1A 1SCVA 3BOWB 2PALA 1JF0A 1GQMA 1IGVA 1B9AA 2KLEA 1UURA 3GK4X 3SG7A 2NLNA 1UHIA 4FQTA 3S0AA 1PSBA 1UHKA 4GUKA 3SG4A 3CR2A 1C7WA 4DS7A 2LLTA 1JFKA 1SNLA 1UWOA 2D8NA 2Y1NA 3DVMA 1DT7B 1SPYA 2EHBA 1CDMA 1BODA 1F71A 4I5KA 4PE1A 1A2XA 1QIVA 1NCZA 1K9PA 2HPSA 1YTZC 3B87A 1CDNA 3NHIA 4FQOA 1CKKA 1K2HA 3KEVA 2GGZA 2KBIA 4PE0A 1RFJA 3GK1A 1DELA 5FYXA 3ZNIA 4OR9B 2LMTA 3DD4A 1BJFA 2JC2A 3DF0B 2KFHA 3DF0A 3I5FC 3OHMB 1BOCA 3I5IB 2F2OA 4HREE 5HLOA 1G33A 1TRFA 1CFPA 2WCBA 2WC5A 1L7ZA 2KI6D 4MZLA 1XYDA 2E6WA 1EL4A 1CLBA 4ICBA 1CFFA 1DGVA 2PYQA 2L4IA 2LUXA 3F45A 1CFDA 1U5IB 2JNXA 1DF0B 3BQ3A 1U5IA 3S0DA 3VRQA 5BPJA 4HRHA 2WCFA 1DF0A 3CYZA 1S6CA 1IQ5A 4P5OE 2BCAA 1S26D 1AVSA 1E8AA 1PALA 3BFAA 3RZSA 1V1FA 5HLVA 1JSAA 3EVVA 1QVIY 3NSKA 5I2LA 3UO9A 1DC1A 2L2EA 3JTDB 1M31A 5ER4X 3V2LA 3ZWHA 3D0YB 1A03A 1OMRA 2Y4QA 3R1OA
chains in the Genus database with same CATH topology
5F6TA 3DVJA 2K7OA 4XJKB 2G9BA 5AFPA 2JWWA 4MSPA 1NYAA 3DVEA 1WRLA 1K8UA 2I18A 3FWBA 4AOMA 5G08A 4UPGA 2K0JA 1AUIB 4A4BA 2V53A 2JXCA 1UUSA 1TCOB 1YRUB 1CLLA 1WRKA 1XFUO 1DTLA 1YUUA 5JOLA 1SK6D 1MF8B 2H61A 1Q80A 1NX0A 3JVTB 2K2AA 2K8MB 3CTNA 1M63B 1MUXA 1QXPA 1VRKA 1Y1XA 1NWDA 5PALA 2WNDA 2M0RA 1N65A 3KF9A 3O2PA 2MJWB 1CMFA 1QV0A 1CDLA 2K7BA 5GQQC 4YI8A 4CLNA 1RJVA 2P6BB 2M7LA 1EJ3A 1QIWA 2GGMA 2LCPA 1KK8C 3CS1A 1XK4C 1J1EA 1YUTA 2ZNDA 5HKWA 3I5GB 5I2OA 5KU1A 2Y1MA 2BL0C 4MLWA 1S5GY 1YVLA 2HQWA 1LA3A 4MEWA 1J7OA 4ZCUA 3AKAA 2M7NA 3KHEA 1KK7Y 1NP8A 4ORAB 3FS7A 1F54A 3SIBA 2PASA 2MLEC 4A4CA 3EVRA 1CNPA 4I5LB 3SG2A 4JPZB 4FTGA 3DVKA 2JT3A 2MLFC 3LL8B 3PATA 3PFVA 5TNCA 1DJIA 4YGBB 3BUXB 1L2OC 1NPQA 2PSRA 1JC2A 2KFFA 4YBHB 2MHHA 2FJUB 2BECA 2ZN8A 1OSAA 1JUOA 4IL1A 1V1GA 2OTGC 1FI6A 1CLMA 3BOWA 1KSMA 1FW4A 1NX3A 1LXFC 1ZFSA 2KBMA 3M0WA 3LLEA 5KTYA 1WY9A 1ZUZA 5DKQA 1Y6WA 2M1UA 1AK8A 3E3RA 1QX7A 5KSZA 1TNWA 2KHNA 1FPWA 1IH0A 5CSNA 4U8DA 1BLQA 2MRDA 2E30A 3TZ1A 5AERA 2JT8A 3BUNB 4ORCB 1B8RA 2BCBA 1SBJA 1WLZA 4GBAA 1YVHA 1B7TY 1MWNA 2KI4B 3CZTX 1QLSA 2JU0A 3PSRA 2AAOA 3BUMB 1CMGA 4GGFA 1NCYA 3A8RA 4YGDB 5CSJA 3K21A 3CR4X 3IF7A 2JNFA 4NQGA 4GPLB 4AQIA 1B47A 4HSZA 1F55A 3SG6A 2PRUA 1N2DA 2JT0A 2O5GA 2BL0B 3TS5B 1IRJA 1G4YR 1DJZA 1SR6C 3GOFA 1TN4A 2CBLA 2BKHB 3OX5A 3OX6A 2M97A 3EKJA 4N1GA 4QJ4B 3O6BA 3BUWB 2LLSA 4MRXA 2L50A 1KCYA 2NCOA 2LHIA 2PVBA 1DJYA 3SG3A 2KFGA 1B1GA 5CSIA 3A4UB 3CGAA 1H8BA 1L2OB 1XFYO 2HQ8A 3NXAA 1NUBA 2L4HA 2I2RE 2KYCA 4E68A 3TUYC 2KQYA 2JTTA 1SL9A 4NDDA 1F8HA 3EK4A 4CFQA 4WQ2A 1KFUS 2QACA 3AAKA 1CDPA 1PRWA 4PE7A 3D0YA 1G8IA 3CLNA 2LAPA 1JF2A 1KFUL 4QJ3B 4PHMA 4XJKA 2HF5A 3BUOB 1K95A 4OV2A 1J7PA 2K7CA 1QASA 2BKIB 5AXIA 2JPTA 3OB1B 1S1EA 1DJHA 1RECA 2WOSA 4N5XA 1ALWA 5DKNA 1WDCC 4YRUA 1BG1A 1QVIZ 3IQQA 1MHOA 1J7QA 5CPVA 2LP3A 5K89A 1IKUA 1AHRA 4JQ0D 1K93D 1KQMC 1S6JA 2L5XB 1FI5A 1CM4A 1MR8A 4YGEB 2LHLA 2K2FA 2K7DA 3BYAA 1IG5A 1TIZA 2BE4A 1OE9B 1JBAA 1WLMA 1UHNA 2KGBC 3O4YA 4TNCA 5HKYA 1DMOA 1MXEA 2SCPA 1S3PA 1SMGA 2A4JA 2LE9B 2M1KB 2CCMA 4M2QA 4PHKA 3I5FB 1ALVA 1M39A 1QX2A 1YURA 2M49B 4GGNA 2MBXA 1BR1B 1EH2A 1YUSA 4N1FA 1DJWA 3CWGA 2LNKA 4I5NB 1SL8A 2RGIA 3LK1A 1CFCA 4USLA 2KDHA 1M45A 1RTP1 2KAXA 1CM1A 1OOJA 2HETA 2CTNA 1QJTA 2JULA 1B8CA 1NSHA 2KQ6A 1RROA 2KNEA 1SL7A 1JWDA 1TCFA 3TUYB 2WCEA 1K9KA 1K90D 1QTXA 1XFZO 4QJ5B 5AEQA 3VGOA 1Y1AA 3AAJA 1S5GZ 3FWCA 1IWQA 1KK7Z 1J55A 1UHHA 4PALA 1XFWO 2CT9A 3I5IC 2L51A 4L9MA 4DRWA 1YX8A 2DOQA 2ZFDA 4PHNA 4MRYA 2AUCA 1XO5A 2LLUA 3I5HC 1NCXA 2JTZA 1TNXA 1SYMA 2LANA 1AP4A 4OCIA 3RM1A 1XFXO 1PK0D 3KPXA 2KOTA 5D69A 2B1UA 1KQMB 2F2PA 3PN7C 4JWQA 4PCWA 2BE6A 1SW8A 4NDCA 1XVJA 2PMYA 3FIAA 1CB1A 1BF5A 4GFTA 1H4BA 2KAYA 2BBMA 2LVIA 2ISDA 3JTDC 3BXKA 2LUCA 1LVCD 3KO0A 4M2OA 2OS8C 4WRIA 1R2UA 3WHTB 2R2IA 1KK8B 3PM8A 1EG4A 2M9GA 1LA0A 3PALA 3CR5X 1XK4A 1B4CA 2MAZA 3SJSA 1HQVA 3OB2B 1XFVO 1QX5B 2K61A 1S36A 1YR5A 1OMDA 2L0PA 2LVVA 4YGAA 4DCKA 4CIDA 1S6IA 2JOJA 1UP5A 2QPTA 1OMVA 2VRGA 1J7RA 1B7TZ 1OZSA 1Y0VH 2H61C 3HCMA 2H2KA 4C0LA 3VRNA 2GV5A 2LMUA 1BMOA 1UHJA 2FOTA 3JVTC 3TDUA 1ZACA 2KI6C 2KSPA 3ICBA 1K9UA 1W7IB 4BY5A 4OVNF 2F3ZA 1AJ4A 1EXRA 3O78A 1NX1A 1BU3A 1OQPA 1CTRA 1SRAA 1TNQA 1N0YA 1R6PA 4Q04A 2WORA 4M2PA 1QV1A 2FCEA 1KWOC 1F4OA 4OKHA 5D7FA 4ETOA 2I7AA 1BT6A 2OTGB 1SY9A 2BBNA 2F8PA 2F3YA 1J1DA 3WHUB 3I5GC 1F70A 2L98A 3EK7A 4MN0A 3VROA 2LVJA 1YX7A 3I5HB 1C07A 2NZ0A 5DKRA 4XYNA 4MBEA 1IJ6A 2LM5A 1OZOA 4GAOA 4PHJA 1WRZA 2EC6C 2LP2A 4PE4A 3PN7B 1DJXA 4F0ZB 2CNPA 2O60A 4MZKA 2M3WA 1JFJA 3TDIA 5B8IB 1BR4B 3MSEB 2LMVA 2ZRTA 3AKBA 3EK8A 1KFXS 1SCMC 3SG5A 2JXLA 2Q4UA 1ZMZA 2OS8B 1A29A 1DVIA 1NIWA 1KFXL 4I5JA 4C0KA 4MZJA 2KAVA 1LINA 1SR6B 2CXJA 3GK2A 1DJGA 3LCPC 3EKHA 4NDBA 4CFRA 3NSOA 3IQOA 5AANA 3PLFB 1NX2A 1EG3A 4WQ3A 2NCPA 4AQJA 3SIAA 1K96A 1X02A 2AMIA 1A75B 1PULA 2LVKA 4CPVA 1GGWA 1IJ5A 1A75A 4HRGA 1LKJA 2JZIA 1QLKA 1SKTA 2KI4C 2ZRSA 2WC8A 1DGUA 1PVBA 1ZOTB 1PVAA 1KSOA 2ZKMX 4GGFC 5I2QA 1XA5A 4YGCB 3OP0A 1Y1UA 1FF1A 2M8UA 1KWOB 3VRPA 2F33A 1RK9A 1MXLC 1IQ3A 4PDZA 3RLZA 3NSIA 1AJ5A 2TN4A 5HYDA 1GGZA 2LV7A 4GNKB 1C7VA 2Y5IA 3QRXA 2BCXA 3TDZA 1YRTB 2FCDA 4C0JA 1A4PA 1FBVA 1HT9A 1TOPA 2KYFA 1QATA 3TS5C 1QS7A 3NSLA 1KQVA 2G2BA 1TNPA 1F4QA 2OPOA 2ZNEA 2KGRA 5CSFA 5HKZA 2EC6B 2SASA 1TTXA 4ZCVA 4DIRA 4R1EA 2I94A 2MA2A 2NXQA 4BY4A 1M46A 4DUQA 4YI9A 5JJGA 1GJYA 1WDCB 3HX4A 3LK0A 4MVFA 4D1EA 5J3XA 3WXAA 3VRRA 4ORBB 3C1VA 1SCMB 3H4SE 1K94A 1ODBA 2IS9A 1W7JB 1RWYA 2ZN9A 5I8NA 1PSRA 2EGDA 5ER5A 2Q91A 2JRFA 2M29A 1B8LA 2JQ6A 3EVUA 4P2YB 5IBWA 2COLB 1D1OA 3WNXB 3D10A 2LC5A 1MQ1A 1SCVA 3BOWB 2PALA 1JF0A 1GQMA 1IGVA 1B9AA 1UURA 3GK4X 3SG7A 2NLNA 1UHIA 1PSBA 1UHKA 4GUKA 3SG4A 3CR2A 1C7WA 4DS7A 2LLTA 1JFKA 1SNLA 1UWOA 2D8NA 2Y1NA 3DVMA 1DT7B 1SPYA 2EHBA 1CDMA 1BODA 1F71A 4I5KA 4PE1A 1A2XA 1QIVA 1NCZA 1K9PA 2HPSA 1YTZC 1CDNA 1CKKA 4FQOA 1K2HA 3KEVA 2GGZA 2KBIA 4PE0A 1RFJA 3GK1A 5FYXA 3ZNIA 4OR9B 2LMTA 3DD4A 1BJFA 2JC2A 3DF0B 2KFHA 3DF0A 3I5FC 3OHMB 1BOCA 3I5IB 2F2OA 4HREE 5HLOA 1G33A 1TRFA 1CFPA 2WCBA 1L7ZA 2KI6D 4MZLA 1XYDA 2E6WA 1EL4A 1CLBA 4ICBA 1CFFA 1DGVA 2L4IA 2LUXA 3F45A 1CFDA 1U5IB 2JNXA 1DF0B 3BQ3A 1U5IA 3VRQA 5BPJA 4HRHA 2WCFA 1DF0A 1S6CA 1IQ5A 4P5OE 2BCAA 1S26D 1AVSA 1E8AA 1PALA 1V1FA 5HLVA 1JSAA 3EVVA 1QVIY 3NSKA 5I2LA 2L2EA 3JTDB 1M31A 5ER4X 3ZWHA 3D0YB 1A03A 1OMRA 2Y4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6T A;  3DVJ A;  2K7O A;  4XJK B;  2G9B A;  5AFP A;  2JWW A;  4MSP A;  1NYA A;  3DVE A;  1WRL A;  1K8U A;  2I18 A;  3FWB A;  4AOM A;  5G08 A;  4UPG A;  2K0J A;  1AUI B;  4A4B A;  2V53 A;  2JXC A;  1UUS A;  1TCO B;  1YRU B;  1CLL A;  1WRK A;  1XFU O;  1DTL A;  1YUU A;  5JOL A;  1SK6 D;  1MF8 B;  2H61 A;  1Q80 A;  1NX0 A;  3JVT B;  2K2A A;  2K8M B;  3CTN A;  1M63 B;  1MUX A;  1QXP A;  1VRK A;  1Y1X A;  1NWD A;  5PAL A;  2WND A;  2M0R A;  1N65 A;  3KF9 A;  3O2P A;  2MJW B;  1CMF A;  1QV0 A;  1CDL A;  2K7B A;  5GQQ C;  4YI8 A;  4CLN A;  1RJV A;  2P6B B;  2M7L A;  1EJ3 A;  1QIW A;  2GGM A;  2LCP A;  1KK8 C;  3CS1 A;  1XK4 C;  1J1E A;  1YUT A;  2ZND A;  5HKW A;  3I5G B;  5I2O A;  5KU1 A;  2Y1M A;  2BL0 C;  4MLW A;  1S5G Y;  1YVL A;  2HQW A;  1LA3 A;  4MEW A;  1J7O A;  4ZCU A;  3AKA A;  2M7N A;  3KHE A;  1KK7 Y;  1NP8 A;  4ORA B;  3FS7 A;  1F54 A;  3SIB A;  2PAS A;  2MLE C;  4A4C A;  3EVR A;  1CNP A;  4I5L B;  3SG2 A;  4JPZ B;  4FTG A;  3DVK A;  2JT3 A;  2MLF C;  3LL8 B;  3PAT A;  3PFV A;  5TNC A;  1DJI A;  4YGB B;  3BUX B;  1L2O C;  1NPQ A;  2PSR A;  1JC2 A;  2KFF A;  4YBH B;  2MHH A;  2FJU B;  2BEC A;  2ZN8 A;  1OSA A;  1JUO A;  4IL1 A;  1V1G A;  2OTG C;  1FI6 A;  1CLM A;  3BOW A;  1KSM A;  1FW4 A;  1NX3 A;  1LXF C;  1ZFS A;  2KBM A;  3M0W A;  3LLE A;  5KTY A;  1WY9 A;  1ZUZ A;  5DKQ A;  1Y6W A;  2M1U A;  1AK8 A;  3E3R A;  1QX7 A;  5KSZ A;  1TNW A;  2KHN A;  1FPW A;  1IH0 A;  5CSN A;  4U8D A;  1BLQ A;  2MRD A;  2E30 A;  3TZ1 A;  5AER A;  2JT8 A;  3BUN B;  4ORC B;  1B8R A;  2BCB A;  1SBJ A;  1WLZ A;  4GBA A;  1YVH A;  1B7T Y;  1MWN A;  2KI4 B;  3CZT X;  1QLS A;  2JU0 A;  3PSR A;  2AAO A;  3BUM B;  1CMG A;  4GGF A;  1NCY A;  3A8R A;  4YGD B;  5CSJ A;  3K21 A;  3CR4 X;  3IF7 A;  2JNF A;  4NQG A;  4GPL B;  4AQI A;  1B47 A;  4HSZ A;  1F55 A;  3SG6 A;  2PRU A;  1N2D A;  2JT0 A;  2O5G A;  2BL0 B;  3TS5 B;  1IRJ A;  1G4Y R;  1DJZ A;  1SR6 C;  3GOF A;  1TN4 A;  2CBL A;  2BKH B;  3OX5 A;  3OX6 A;  2M97 A;  3EKJ A;  4N1G A;  4QJ4 B;  3O6B A;  3BUW B;  2LLS A;  4MRX A;  2L50 A;  1KCY A;  2NCO A;  2LHI A;  2PVB A;  1DJY A;  3SG3 A;  2KFG A;  1B1G A;  5CSI A;  3A4U B;  3CGA A;  1H8B A;  1L2O B;  1XFY O;  2HQ8 A;  3NXA A;  1NUB A;  2L4H A;  2I2R E;  2KYC A;  4E68 A;  3TUY C;  2KQY A;  2JTT A;  1SL9 A;  4NDD A;  1F8H A;  3EK4 A;  4CFQ A;  4WQ2 A;  1KFU S;  2QAC A;  3AAK A;  1CDP A;  1PRW A;  4PE7 A;  3D0Y A;  1G8I A;  3CLN A;  2LAP A;  1JF2 A;  1KFU L;  4QJ3 B;  4PHM A;  4XJK A;  2HF5 A;  3BUO B;  1K95 A;  4OV2 A;  1J7P A;  2K7C A;  1QAS A;  2BKI B;  5AXI A;  2JPT A;  3OB1 B;  1S1E A;  1DJH A;  1REC A;  2WOS A;  4N5X A;  1ALW A;  5DKN A;  1WDC C;  4YRU A;  1BG1 A;  1QVI Z;  3IQQ A;  1MHO A;  1J7Q A;  5CPV A;  2LP3 A;  5K89 A;  1IKU A;  1AHR A;  4JQ0 D;  1K93 D;  1KQM C;  1S6J A;  2L5X B;  1FI5 A;  1CM4 A;  1MR8 A;  4YGE B;  2LHL A;  2K2F A;  2K7D A;  3BYA A;  1IG5 A;  1TIZ A;  2BE4 A;  1OE9 B;  1JBA A;  1WLM A;  1UHN A;  2KGB C;  3O4Y A;  4TNC A;  5HKY A;  1DMO A;  1MXE A;  2SCP A;  1S3P A;  1SMG A;  2A4J A;  2LE9 B;  2M1K B;  2CCM A;  4M2Q A;  4PHK A;  3I5F B;  1ALV A;  1M39 A;  1QX2 A;  1YUR A;  2M49 B;  4GGN A;  2MBX A;  1BR1 B;  1EH2 A;  1YUS A;  4N1F A;  1DJW A;  3CWG A;  2LNK A;  4I5N B;  1SL8 A;  2RGI A;  3LK1 A;  1CFC A;  4USL A;  2KDH A;  1M45 A;  1RTP 1;  2KAX A;  1CM1 A;  1OOJ A;  2HET A;  2CTN A;  1QJT A;  2JUL A;  1B8C A;  1NSH A;  2KQ6 A;  1RRO A;  2KNE A;  1SL7 A;  1JWD A;  1TCF A;  3TUY B;  2WCE A;  1K9K A;  1K90 D;  1QTX A;  1XFZ O;  4QJ5 B;  5AEQ A;  3VGO A;  1Y1A A;  3AAJ A;  1S5G Z;  3FWC A;  1IWQ A;  1KK7 Z;  1J55 A;  1UHH A;  4PAL A;  1XFW O;  2CT9 A;  3I5I C;  2L51 A;  4L9M A;  4DRW A;  1YX8 A;  2DOQ A;  2ZFD A;  4PHN A;  4MRY A;  2AUC A;  1XO5 A;  2LLU A;  3I5H C;  1NCX A;  2JTZ A;  1TNX A;  1SYM A;  2LAN A;  1AP4 A;  4OCI A;  3RM1 A;  1XFX O;  1PK0 D;  3KPX A;  2KOT A;  5D69 A;  2B1U A;  1KQM B;  2F2P A;  3PN7 C;  4JWQ A;  4PCW A;  2BE6 A;  1SW8 A;  4NDC A;  1XVJ A;  2PMY A;  3FIA A;  1CB1 A;  1BF5 A;  4GFT A;  1H4B A;  2KAY A;  2BBM A;  2LVI A;  2ISD A;  3JTD C;  3BXK A;  2LUC A;  1LVC D;  3KO0 A;  4M2O A;  2OS8 C;  4WRI A;  1R2U A;  3WHT B;  2R2I A;  1KK8 B;  3PM8 A;  1EG4 A;  2M9G A;  1LA0 A;  3PAL A;  3CR5 X;  1XK4 A;  1B4C A;  2MAZ A;  3SJS A;  1HQV A;  3OB2 B;  1XFV O;  1QX5 B;  2K61 A;  1S36 A;  1YR5 A;  1OMD A;  2L0P A;  2LVV A;  4YGA A;  4DCK A;  4CID A;  1S6I A;  2JOJ A;  1UP5 A;  2QPT A;  1OMV A;  2VRG A;  1J7R A;  1B7T Z;  1OZS A;  1Y0V H;  2H61 C;  3HCM A;  2H2K A;  4C0L A;  3VRN A;  2GV5 A;  2LMU A;  1BMO A;  1UHJ A;  2FOT A;  3JVT C;  3TDU A;  1ZAC A;  2KI6 C;  2KSP A;  3ICB A;  1K9U A;  1W7I B;  4BY5 A;  4OVN F;  2F3Z A;  1AJ4 A;  1EXR A;  3O78 A;  1NX1 A;  1BU3 A;  1OQP A;  1CTR A;  1SRA A;  1TNQ A;  1N0Y A;  1R6P A;  4Q04 A;  2WOR A;  4M2P A;  1QV1 A;  2FCE A;  1KWO C;  1F4O A;  4OKH A;  5D7F A;  4ETO A;  2I7A A;  1BT6 A;  2OTG B;  1SY9 A;  2BBN A;  2F8P A;  2F3Y A;  1J1D A;  3WHU B;  3I5G C;  1F70 A;  2L98 A;  3EK7 A;  4MN0 A;  3VRO A;  2LVJ A;  1YX7 A;  3I5H B;  1C07 A;  2NZ0 A;  5DKR A;  4XYN A;  4MBE A;  1IJ6 A;  2LM5 A;  1OZO A;  4GAO A;  4PHJ A;  1WRZ A;  2EC6 C;  2LP2 A;  4PE4 A;  3PN7 B;  1DJX A;  4F0Z B;  2CNP A;  2O60 A;  4MZK A;  2M3W A;  1JFJ A;  3TDI A;  5B8I B;  1BR4 B;  3MSE B;  2LMV A;  2ZRT A;  3AKB A;  3EK8 A;  1KFX S;  1SCM C;  3SG5 A;  2JXL A;  2Q4U A;  1ZMZ A;  2OS8 B;  1A29 A;  1DVI A;  1NIW A;  1KFX L;  4I5J A;  4C0K A;  4MZJ A;  2KAV A;  1LIN A;  1SR6 B;  2CXJ A;  3GK2 A;  1DJG A;  3LCP C;  3EKH A;  4NDB A;  4CFR A;  3NSO A;  3IQO A;  5AAN A;  3PLF B;  1NX2 A;  1EG3 A;  4WQ3 A;  2NCP A;  4AQJ A;  3SIA A;  1K96 A;  1X02 A;  2AMI A;  1A75 B;  1PUL A;  2LVK A;  4CPV A;  1GGW A;  1IJ5 A;  1A75 A;  4HRG A;  1LKJ A;  2JZI A;  1QLK A;  1SKT A;  2KI4 C;  2ZRS A;  2WC8 A;  1DGU A;  1PVB A;  1ZOT B;  1PVA A;  1KSO A;  2ZKM X;  4GGF C;  5I2Q A;  1XA5 A;  4YGC B;  3OP0 A;  1Y1U A;  1FF1 A;  2M8U A;  1KWO B;  3VRP A;  2F33 A;  1RK9 A;  1MXL C;  1IQ3 A;  4PDZ A;  3RLZ A;  3NSI A;  1AJ5 A;  2TN4 A;  5HYD A;  1GGZ A;  2LV7 A;  4GNK B;  1C7V A;  2Y5I A;  3QRX A;  2BCX A;  3TDZ A;  1YRT B;  2FCD A;  4C0J A;  1A4P A;  1FBV A;  1HT9 A;  1TOP A;  2KYF A;  1QAT A;  3TS5 C;  1QS7 A;  3NSL A;  1KQV A;  2G2B A;  1TNP A;  1F4Q A;  2OPO A;  2ZNE A;  2KGR A;  5CSF A;  5HKZ A;  2EC6 B;  2SAS A;  1TTX A;  4ZCV A;  4DIR A;  4R1E A;  2I94 A;  2MA2 A;  2NXQ A;  4BY4 A;  1M46 A;  4DUQ A;  4YI9 A;  5JJG A;  1GJY A;  1WDC B;  3HX4 A;  3LK0 A;  4MVF A;  4D1E A;  5J3X A;  3WXA A;  3VRR A;  4ORB B;  3C1V A;  1SCM B;  3H4S E;  1K94 A;  1ODB A;  2IS9 A;  1W7J B;  1RWY A;  2ZN9 A;  5I8N A;  1PSR A;  2EGD A;  5ER5 A;  2Q91 A;  2JRF A;  2M29 A;  1B8L A;  2JQ6 A;  3EVU A;  4P2Y B;  5IBW A;  2COL B;  1D1O A;  3WNX B;  3D10 A;  2LC5 A;  1MQ1 A;  1SCV A;  3BOW B;  2PAL A;  1JF0 A;  1GQM A;  1IGV A;  1B9A A;  1UUR A;  3GK4 X;  3SG7 A;  2NLN A;  1UHI A;  1PSB A;  1UHK A;  4GUK A;  3SG4 A;  3CR2 A;  1C7W A;  4DS7 A;  2LLT A;  1JFK A;  1SNL A;  1UWO A;  2D8N A;  2Y1N A;  3DVM A;  1DT7 B;  1SPY A;  2EHB A;  1CDM A;  1BOD A;  1F71 A;  4I5K A;  4PE1 A;  1A2X A;  1QIV A;  1NCZ A;  1K9P A;  2HPS A;  1YTZ C;  1CDN A;  1CKK A;  4FQO A;  1K2H A;  3KEV A;  2GGZ A;  2KBI A;  4PE0 A;  1RFJ A;  3GK1 A;  5FYX A;  3ZNI A;  4OR9 B;  2LMT A;  3DD4 A;  1BJF A;  2JC2 A;  3DF0 B;  2KFH A;  3DF0 A;  3I5F C;  3OHM B;  1BOC A;  3I5I B;  2F2O A;  4HRE E;  5HLO A;  1G33 A;  1TRF A;  1CFP A;  2WCB A;  1L7Z A;  2KI6 D;  4MZL A;  1XYD A;  2E6W A;  1EL4 A;  1CLB A;  4ICB A;  1CFF A;  1DGV A;  2L4I A;  2LUX A;  3F45 A;  1CFD A;  1U5I B;  2JNX A;  1DF0 B;  3BQ3 A;  1U5I A;  3VRQ A;  5BPJ A;  4HRH A;  2WCF A;  1DF0 A;  1S6C A;  1IQ5 A;  4P5O E;  2BCA A;  1S26 D;  1AVS A;  1E8A A;  1PAL A;  1V1F A;  5HLV A;  1JSA A;  3EVV A;  1QVI Y;  3NSK A;  5I2L A;  2L2E A;  3JTD B;  1M31 A;  5ER4 X;  3ZWH A;  3D0Y B;  1A03 A;  1OMR A;  2Y4Q A; 
#chains in the Genus database with same CATH topology
 5F6T A;  3DVJ A;  2K7O A;  4XJK B;  1TWO A;  2G9B A;  5AFP A;  2JWW A;  4MSP A;  1NYA A;  3DVE A;  1WRL A;  1K8U A;  2I18 A;  2FJY A;  3BFH A;  3FWB A;  5G08 A;  4AOM A;  4UPG A;  2K0J A;  1AUI B;  4A4B A;  1TUZ A;  2V53 A;  2JXC A;  1GM0 A;  1UUS A;  1TCO B;  1YRU B;  1CLL A;  1WRK A;  1XFU O;  1DTL A;  1YUU A;  5FI2 A;  1SK6 D;  1MF8 B;  5JOL A;  2H61 A;  2WCM A;  1Q80 A;  4DCK A;  1NX0 A;  3JVT B;  2K2A A;  3FE8 A;  2K8M B;  3CTN A;  1M63 B;  1MUX A;  1QXP A;  1VRK A;  1Y1X A;  1NWD A;  1T14 A;  5PAL A;  3L47 A;  2WND A;  2M0R A;  1N65 A;  1P28 A;  3KF9 A;  3L4A A;  3O2P A;  2MJW B;  3D76 A;  1CMF A;  1QV0 A;  1CDL A;  2K7B A;  5GQQ C;  4YI8 A;  4CLN A;  1RJV A;  2P6B B;  2M7L A;  1Z4H A;  1EJ3 A;  1QIW A;  2GGM A;  2LCP A;  3OGN A;  1KK8 C;  3CS1 A;  1XK4 C;  1J1E A;  1YUT A;  2ZND A;  5HKW A;  3CZ2 A;  3I5G B;  5I2O A;  5KU1 A;  2Y1M A;  2BL0 C;  4MLW A;  1S5G Y;  1YVL A;  2HQW A;  1LA3 A;  4MEW A;  1J7O A;  4ZCU A;  1TUJ A;  3AKA A;  2M7N A;  3KHE A;  1KK7 Y;  1NP8 A;  4ORA B;  3FS7 A;  3DZT A;  1F54 A;  5D3O A;  3SIB A;  2PAS A;  2MLE C;  4A4C A;  3EVR A;  1CNP A;  4I5L B;  3SG2 A;  4JPZ B;  4FTG A;  3DVK A;  2JT3 A;  2MLF C;  3LL8 B;  3PAT A;  3PFV A;  5TNC A;  1DJI A;  4YGB B;  3BUX B;  1L2O C;  1NPQ A;  2PSR A;  3CZ1 A;  1JC2 A;  2KFF A;  4YBH B;  2MHH A;  2FJU B;  2BEC A;  2ZN8 A;  1OSA A;  5DIC A;  1JUO A;  4IL1 A;  1V1G A;  2OTG C;  1FI6 A;  1CLM A;  3BOW A;  1C3Y A;  1KSM A;  2GTE A;  1FW4 A;  1NX3 A;  1LXF C;  1ZFS A;  2KBM A;  3M0W A;  3LLE A;  5KTY A;  1WY9 A;  1LS8 A;  1ZUZ A;  3FE6 A;  5DKQ A;  1Y6W A;  2M1U A;  1AK8 A;  3E3R A;  1QX7 A;  5KSZ A;  1TNW A;  2KHN A;  1FPW A;  1IH0 A;  5CSN A;  4U8D A;  1BLQ A;  2MRD A;  2E30 A;  3TZ1 A;  5AER A;  3PJI A;  2JT8 A;  3BUN B;  4ORC B;  1B8R A;  2BCB A;  1SBJ A;  3BFB A;  1WLZ A;  4GBA A;  1YVH A;  1B7T Y;  1MWN A;  2KI4 B;  3CZT X;  1QLS A;  2JU0 A;  3PSR A;  2AAO A;  3BUM B;  1CMG A;  4GGF A;  1NCY A;  3A8R A;  4YGD B;  5CSJ A;  3K21 A;  3CR4 X;  3D73 A;  3IF7 A;  2JNF A;  3K1E A;  4NQG A;  4GPL B;  4AQI A;  1B47 A;  4HSZ A;  1F55 A;  3SG6 A;  2PRU A;  3SS4 A;  1N2D A;  2JT0 A;  2O5G A;  2BL0 B;  3TS5 B;  1IRJ A;  1G4Y R;  1DJZ A;  1SR6 C;  3GOF A;  1TN4 A;  2CBL A;  2BKH B;  3OX5 A;  3OX6 A;  2M97 A;  3EKJ A;  3B86 A;  1QWV A;  4N1G A;  3O6B A;  3BUW B;  2LLS A;  4MRX A;  1DEK A;  1OOF A;  2L50 A;  1KCY A;  2NCO A;  4F7F A;  1W9Z A;  2LHI A;  2PVB A;  1DJY A;  5FI7 A;  3SG3 A;  2KFG A;  3DY9 A;  1B1G A;  5CSI A;  3A4U B;  3CGA A;  3EG5 B;  1H8B A;  1L2O B;  1XFY O;  2HQ8 A;  3NXA A;  1NUB A;  2L4H A;  2I2R E;  2KYC A;  4E68 A;  3TUY C;  4QJ4 B;  5I94 A;  2KQY A;  2JTT A;  1SL9 A;  4NDD A;  1F8H A;  3EK4 A;  4CFQ A;  1Z2C B;  4WQ2 A;  1KFU S;  2QAC A;  3AAK A;  1CDP A;  1PRW A;  4PE7 A;  3D0Y A;  1G8I A;  3CLN A;  2LAP A;  1JF2 A;  1KFU L;  4OZD A;  4QJ3 B;  4PHM A;  4XJK A;  2HF5 A;  3BUO B;  1K95 A;  4OV2 A;  1J7P A;  2K7C A;  1QAS A;  2BKI B;  5AXI A;  2JPT A;  3OB1 B;  1S1E A;  1DJH A;  1REC A;  2WOS A;  3Q8I A;  1ALW A;  4N5X A;  5DKN A;  5ER5 A;  1WDC C;  4YRU A;  1BG1 A;  1QVI Z;  3IQQ A;  1MHO A;  1OOI X;  3L4L A;  3D77 A;  1J7Q A;  5CPV A;  2LP3 A;  5K89 A;  1IKU A;  1AHR A;  4JQ0 D;  1K93 D;  1KQM C;  1S6J A;  2L5X B;  4KYN A;  1CM4 A;  1FI5 A;  1MR8 A;  4YGE B;  2LHL A;  1ORG A;  2K2F A;  2K7D A;  3BYA A;  4INX A;  1IG5 A;  1TIZ A;  2BE4 A;  1OE9 B;  3R1V A;  1JBA A;  2L5Y A;  1WLM A;  1UHN A;  2KGB C;  3O4Y A;  4TNC A;  2KLD A;  3S0E A;  5HKY A;  1MXE A;  2QEV A;  1S3P A;  1SMG A;  2A4J A;  2LE9 B;  1OW4 A;  2M1K B;  2SCP A;  2WCJ A;  2CCM A;  4M2Q A;  4PHK A;  3I5F B;  1DQE A;  1ALV A;  1M39 A;  1QX2 A;  1YUR A;  2M49 B;  4GGN A;  2MBX A;  1BR1 B;  1EH2 A;  1YUS A;  4N1F A;  1DJW A;  3CWG A;  2LNK A;  4I5N B;  1SL8 A;  2RGI A;  3LK1 A;  1CFC A;  4USL A;  2KDH A;  1M45 A;  1RTP 1;  2KAX A;  1CM1 A;  1OOJ A;  2HET A;  2CTN A;  3PM2 A;  1QJT A;  2JUL A;  1B8C A;  2P71 A;  1NSH A;  2KQ6 A;  1RRO A;  2KNE A;  1SL7 A;  1JWD A;  1TCF A;  3TUY B;  3UNW A;  2WCE A;  1K9K A;  1K90 D;  1QTX A;  1XFZ O;  1DMO A;  4QJ5 B;  5AEQ A;  3VGO A;  2ERB A;  1Y1A A;  2QEB A;  3AAJ A;  1S5G Z;  3FWC A;  1IWQ A;  2QEO A;  1KK7 Z;  1J55 A;  1UHH A;  4PAL A;  1OOG A;  1XFW O;  2CT9 A;  2JPO A;  2L51 A;  3I5I C;  4L9M A;  1YX8 A;  4DRW A;  2DOQ A;  2ZFD A;  4JKT A;  4PHN A;  4MRY A;  2AUC A;  1IIO A;  1XO5 A;  2LLU A;  3I5H C;  1NCX A;  2JTZ A;  1TNX A;  1SYM A;  2LAN A;  1AP4 A;  4OCI A;  3RM1 A;  1XFX O;  1PK0 D;  3KPX A;  2KOT A;  5D69 A;  2B1U A;  1KQM B;  2F2P A;  3PN7 C;  3O4X A;  4JWQ A;  4PCW A;  2BE6 A;  1SW8 A;  4NDC A;  1XVJ A;  2PMY A;  3FIA A;  1CB1 A;  1BF5 A;  3BJH A;  4GFT A;  1H4B A;  2KAY A;  2BBM A;  5HL1 A;  2LVI A;  2ISD A;  3JTD C;  3BXK A;  2QEH A;  5EL2 A;  2LUC A;  1LVC D;  3KO0 A;  4M2O A;  3VB1 A;  2OS8 C;  4WRI A;  1R2U A;  3WHT B;  4PT1 A;  2R2I A;  1KK8 B;  3PM8 A;  1EG4 A;  2M9G A;  1LA0 A;  3PAL A;  3CR5 X;  1XK4 A;  1B4C A;  2MAZ A;  3SJS A;  1HQV A;  3OB2 B;  1XFV O;  1QX5 B;  2K61 A;  1S36 A;  1YR5 A;  1OMD A;  2L0P A;  2LVV A;  3N7H A;  3OBV A;  4YGA A;  4CID A;  1S6I A;  2JOJ A;  1UP5 A;  2QPT A;  1OMV A;  2VRG A;  1J7R A;  1B7T Z;  1OZS A;  1Y0V H;  2H61 C;  3HCM A;  2H2K A;  4C0L A;  4JD9 A;  3VRN A;  2GV5 A;  2LMU A;  2PQL A;  1BMO A;  1UHJ A;  2FOT A;  2L2C A;  2BNX A;  3JVT C;  3TDU A;  1ZAC A;  2KI6 C;  2KSP A;  3ICB A;  1K9U A;  1W7I B;  4BY5 A;  4OVN F;  2F3Z A;  1AJ4 A;  1EXR A;  3O78 A;  1NX1 A;  1BU3 A;  1OQP A;  1CTR A;  1SRA A;  1TNQ A;  2BAP A;  1N0Y A;  1OOH A;  1R6P A;  4Q04 A;  2WOR A;  4M2P A;  3CAB A;  1QV1 A;  2FCE A;  1KWO C;  1F4O A;  4OKH A;  5D7F A;  4ETO A;  2I7A A;  3S0G A;  1BT6 A;  2OTG B;  1SY9 A;  2BBN A;  2F8P A;  3R72 A;  4INW A;  2F3Y A;  1J1D A;  3WHU B;  3I5G C;  1F70 A;  2L98 A;  3EK7 A;  4MN0 A;  3VRO A;  2LVJ A;  1YX7 A;  2P70 A;  3I5H B;  2NZ0 A;  5DKR A;  1C07 A;  4XYN A;  4MBE A;  1IJ6 A;  2WCL A;  2WC6 A;  2LM5 A;  1OZO A;  4GAO A;  4PHJ A;  1WRZ A;  2EC6 C;  2LP2 A;  4PE4 A;  3PN7 B;  2QDI A;  1DJX A;  4F0Z B;  2CNP A;  2O60 A;  4MZK A;  2M3W A;  1JFJ A;  3TDI A;  2WCH A;  3IVT A;  3FE9 A;  2K60 A;  1BR4 B;  3R1P A;  5B8I B;  3MSE B;  2LMV A;  2ZRT A;  3AKB A;  3EK8 A;  1KFX S;  1SCM C;  3SG5 A;  2JXL A;  2Q4U A;  1ZMZ A;  2OS8 B;  1A29 A;  3B7A A;  1DVI A;  1NIW A;  1KFX L;  4I5J A;  4C0K A;  3DXL A;  3NHT A;  4IJ7 A;  3QME A;  4MZJ A;  2KAV A;  5FI6 A;  1LIN A;  1SR6 B;  2CXJ A;  3GK2 A;  1DJG A;  3LCP C;  3EKH A;  4NDB A;  4CFR A;  3S0F A;  3NSO A;  3IQO A;  5AAN A;  3PLF B;  1NX2 A;  1EG3 A;  1SSE B;  2NCP A;  4WQ3 A;  4AQJ A;  3SIA A;  1K96 A;  1X02 A;  2AMI A;  2WCK A;  1A75 B;  1PUL A;  2LVK A;  1C3Z A;  3SS5 A;  4CPV A;  3B6X A;  1IJ5 A;  1A75 A;  4HRG A;  1GGW A;  1LKJ A;  2JZI A;  1QLK A;  1SKT A;  2KI4 C;  2ZRS A;  2WC8 A;  1DGU A;  1PVB A;  1ZOT B;  1PVA A;  1KSO A;  2ZKM X;  4GGF C;  5I2Q A;  1XA5 A;  4YGC B;  3OP0 A;  1Y1U A;  3CDN A;  1FF1 A;  2M8U A;  1KWO B;  3D74 A;  3VRP A;  2F33 A;  1RK9 A;  1MXL C;  1IQ3 A;  4PDZ A;  3RLZ A;  2YGU A;  3NSI A;  1AJ5 A;  2TN4 A;  3NGV A;  5HYD A;  1GGZ A;  2LV7 A;  4GNK B;  1C7V A;  2Y5I A;  3QRX A;  2BCX A;  3TDZ A;  1YRT B;  2FCD A;  2KPH A;  3D78 A;  4C0J A;  1A4P A;  1FBV A;  1HT9 A;  1TOP A;  1XFR A;  1QAT A;  2KYF A;  1QS7 A;  3NSL A;  3TS5 C;  3SS3 A;  2G2B A;  1KQV A;  1TNP A;  1F4Q A;  2OPO A;  2ZNE A;  2KGR A;  5CSF A;  5HKZ A;  2EC6 B;  2SAS A;  1TTX A;  4ZCV A;  4DIR A;  4R1E A;  2I94 A;  2MA2 A;  2NXQ A;  4BY4 A;  1M46 A;  4DUQ A;  4YI9 A;  5JJG A;  1GJY A;  1WDC B;  3HX4 A;  3LK0 A;  4MVF A;  4D1E A;  5J3X A;  3WXA A;  3VRR A;  4ORB B;  3S0B A;  3C1V A;  1SCM B;  3H4S E;  1K94 A;  1ODB A;  2IS9 A;  1W7J B;  1RWY A;  2ZN9 A;  5I8N A;  2H8V A;  1PSR A;  2EGD A;  3D75 A;  3DYE A;  2Q91 A;  2JRF A;  2M29 A;  1B8L A;  2JQ6 A;  3CZ0 A;  3EVU A;  4P2Y B;  2COL B;  5IBW A;  1D1O A;  3WNX B;  3D10 A;  2LC5 A;  3B88 A;  1MQ1 A;  1SCV A;  3BOW B;  2PAL A;  1JF0 A;  1GQM A;  1IGV A;  1B9A A;  2KLE A;  1UUR A;  3GK4 X;  3SG7 A;  2NLN A;  1UHI A;  4FQT A;  3S0A A;  1PSB A;  1UHK A;  4GUK A;  3SG4 A;  3CR2 A;  1C7W A;  4DS7 A;  2LLT A;  1JFK A;  1SNL A;  1UWO A;  2D8N A;  2Y1N A;  3DVM A;  1DT7 B;  1SPY A;  2EHB A;  1CDM A;  1BOD A;  1F71 A;  4I5K A;  4PE1 A;  1A2X A;  1QIV A;  1NCZ A;  1K9P A;  2HPS A;  1YTZ C;  3B87 A;  1CDN A;  3NHI A;  4FQO A;  1CKK A;  1K2H A;  3KEV A;  2GGZ A;  2KBI A;  4PE0 A;  1RFJ A;  3GK1 A;  1DEL A;  5FYX A;  3ZNI A;  4OR9 B;  2LMT A;  3DD4 A;  1BJF A;  2JC2 A;  3DF0 B;  2KFH A;  3DF0 A;  3I5F C;  3OHM B;  1BOC A;  3I5I B;  2F2O A;  4HRE E;  5HLO A;  1G33 A;  1TRF A;  1CFP A;  2WCB A;  2WC5 A;  1L7Z A;  2KI6 D;  4MZL A;  1XYD A;  2E6W A;  1EL4 A;  1CLB A;  4ICB A;  1CFF A;  1DGV A;  2PYQ A;  2L4I A;  2LUX A;  3F45 A;  1CFD A;  1U5I B;  2JNX A;  1DF0 B;  3BQ3 A;  1U5I A;  3S0D A;  3VRQ A;  5BPJ A;  4HRH A;  2WCF A;  1DF0 A;  3CYZ A;  1S6C A;  1IQ5 A;  4P5O E;  2BCA A;  1S26 D;  1AVS A;  1E8A A;  1PAL A;  3BFA A;  3RZS A;  1V1F A;  5HLV A;  1JSA A;  3EVV A;  1QVI Y;  3NSK A;  5I2L A;  3UO9 A;  1DC1 A;  2L2E A;  3JTD B;  1M31 A;  5ER4 X;  3V2L A;  3ZWH A;  3D0Y B;  1A03 A;  1OMR A;  2Y4Q A;  3R1O A; 
#chains in the Genus database with same CATH homology
 5F6T A;  3DVJ A;  2K7O A;  4XJK B;  2G9B A;  5AFP A;  2JWW A;  4MSP A;  1NYA A;  3DVE A;  1WRL A;  1K8U A;  2I18 A;  3FWB A;  4AOM A;  5G08 A;  4UPG A;  2K0J A;  1AUI B;  4A4B A;  2V53 A;  2JXC A;  1UUS A;  1TCO B;  1YRU B;  1CLL A;  1WRK A;  1XFU O;  1DTL A;  1YUU A;  5JOL A;  1SK6 D;  1MF8 B;  2H61 A;  1Q80 A;  1NX0 A;  3JVT B;  2K2A A;  2K8M B;  3CTN A;  1M63 B;  1MUX A;  1QXP A;  1VRK A;  1Y1X A;  1NWD A;  5PAL A;  2WND A;  2M0R A;  1N65 A;  3KF9 A;  3O2P A;  2MJW B;  1CMF A;  1QV0 A;  1CDL A;  2K7B A;  5GQQ C;  4YI8 A;  4CLN A;  1RJV A;  2P6B B;  2M7L A;  1EJ3 A;  1QIW A;  2GGM A;  2LCP A;  1KK8 C;  3CS1 A;  1XK4 C;  1J1E A;  1YUT A;  2ZND A;  5HKW A;  3I5G B;  5I2O A;  5KU1 A;  2Y1M A;  2BL0 C;  4MLW A;  1S5G Y;  1YVL A;  2HQW A;  1LA3 A;  4MEW A;  1J7O A;  4ZCU A;  3AKA A;  2M7N A;  3KHE A;  1KK7 Y;  1NP8 A;  4ORA B;  3FS7 A;  1F54 A;  3SIB A;  2PAS A;  2MLE C;  4A4C A;  3EVR A;  1CNP A;  4I5L B;  3SG2 A;  4JPZ B;  4FTG A;  3DVK A;  2JT3 A;  2MLF C;  3LL8 B;  3PAT A;  3PFV A;  5TNC A;  1DJI A;  4YGB B;  3BUX B;  1L2O C;  1NPQ A;  2PSR A;  1JC2 A;  2KFF A;  4YBH B;  2MHH A;  2FJU B;  2BEC A;  2ZN8 A;  1OSA A;  1JUO A;  4IL1 A;  1V1G A;  2OTG C;  1FI6 A;  1CLM A;  3BOW A;  1KSM A;  1FW4 A;  1NX3 A;  1LXF C;  1ZFS A;  2KBM A;  3M0W A;  3LLE A;  5KTY A;  1WY9 A;  1ZUZ A;  5DKQ A;  1Y6W A;  2M1U A;  1AK8 A;  3E3R A;  1QX7 A;  5KSZ A;  1TNW A;  2KHN A;  1FPW A;  1IH0 A;  5CSN A;  4U8D A;  1BLQ A;  2MRD A;  2E30 A;  3TZ1 A;  5AER A;  2JT8 A;  3BUN B;  4ORC B;  1B8R A;  2BCB A;  1SBJ A;  1WLZ A;  4GBA A;  1YVH A;  1B7T Y;  1MWN A;  2KI4 B;  3CZT X;  1QLS A;  2JU0 A;  3PSR A;  2AAO A;  3BUM B;  1CMG A;  4GGF A;  1NCY A;  3A8R A;  4YGD B;  5CSJ A;  3K21 A;  3CR4 X;  3IF7 A;  2JNF A;  4NQG A;  4GPL B;  4AQI A;  1B47 A;  4HSZ A;  1F55 A;  3SG6 A;  2PRU A;  1N2D A;  2JT0 A;  2O5G A;  2BL0 B;  3TS5 B;  1IRJ A;  1G4Y R;  1DJZ A;  1SR6 C;  3GOF A;  1TN4 A;  2CBL A;  2BKH B;  3OX5 A;  3OX6 A;  2M97 A;  3EKJ A;  4N1G A;  4QJ4 B;  3O6B A;  3BUW B;  2LLS A;  4MRX A;  2L50 A;  1KCY A;  2NCO A;  2LHI A;  2PVB A;  1DJY A;  3SG3 A;  2KFG A;  1B1G A;  5CSI A;  3A4U B;  3CGA A;  1H8B A;  1L2O B;  1XFY O;  2HQ8 A;  3NXA A;  1NUB A;  2L4H A;  2I2R E;  2KYC A;  4E68 A;  3TUY C;  2KQY A;  2JTT A;  1SL9 A;  4NDD A;  1F8H A;  3EK4 A;  4CFQ A;  4WQ2 A;  1KFU S;  2QAC A;  3AAK A;  1CDP A;  1PRW A;  4PE7 A;  3D0Y A;  1G8I A;  3CLN A;  2LAP A;  1JF2 A;  1KFU L;  4QJ3 B;  4PHM A;  4XJK A;  2HF5 A;  3BUO B;  1K95 A;  4OV2 A;  1J7P A;  2K7C A;  1QAS A;  2BKI B;  5AXI A;  2JPT A;  3OB1 B;  1S1E A;  1DJH A;  1REC A;  2WOS A;  4N5X A;  1ALW A;  5DKN A;  1WDC C;  4YRU A;  1BG1 A;  1QVI Z;  3IQQ A;  1MHO A;  1J7Q A;  5CPV A;  2LP3 A;  5K89 A;  1IKU A;  1AHR A;  4JQ0 D;  1K93 D;  1KQM C;  1S6J A;  2L5X B;  1FI5 A;  1CM4 A;  1MR8 A;  4YGE B;  2LHL A;  2K2F A;  2K7D A;  3BYA A;  1IG5 A;  1TIZ A;  2BE4 A;  1OE9 B;  1JBA A;  1WLM A;  1UHN A;  2KGB C;  3O4Y A;  4TNC A;  5HKY A;  1DMO A;  1MXE A;  2SCP A;  1S3P A;  1SMG A;  2A4J A;  2LE9 B;  2M1K B;  2CCM A;  4M2Q A;  4PHK A;  3I5F B;  1ALV A;  1M39 A;  1QX2 A;  1YUR A;  2M49 B;  4GGN A;  2MBX A;  1BR1 B;  1EH2 A;  1YUS A;  4N1F A;  1DJW A;  3CWG A;  2LNK A;  4I5N B;  1SL8 A;  2RGI A;  3LK1 A;  1CFC A;  4USL A;  2KDH A;  1M45 A;  1RTP 1;  2KAX A;  1CM1 A;  1OOJ A;  2HET A;  2CTN A;  1QJT A;  2JUL A;  1B8C A;  1NSH A;  2KQ6 A;  1RRO A;  2KNE A;  1SL7 A;  1JWD A;  1TCF A;  3TUY B;  2WCE A;  1K9K A;  1K90 D;  1QTX A;  1XFZ O;  4QJ5 B;  5AEQ A;  3VGO A;  1Y1A A;  3AAJ A;  1S5G Z;  3FWC A;  1IWQ A;  1KK7 Z;  1J55 A;  1UHH A;  4PAL A;  1XFW O;  2CT9 A;  3I5I C;  2L51 A;  4L9M A;  4DRW A;  1YX8 A;  2DOQ A;  2ZFD A;  4PHN A;  4MRY A;  2AUC A;  1XO5 A;  2LLU A;  3I5H C;  1NCX A;  2JTZ A;  1TNX A;  1SYM A;  2LAN A;  1AP4 A;  4OCI A;  3RM1 A;  1XFX O;  1PK0 D;  3KPX A;  2KOT A;  5D69 A;  2B1U A;  1KQM B;  2F2P A;  3PN7 C;  4JWQ A;  4PCW A;  2BE6 A;  1SW8 A;  4NDC A;  1XVJ A;  2PMY A;  3FIA A;  1CB1 A;  1BF5 A;  4GFT A;  1H4B A;  2KAY A;  2BBM A;  2LVI A;  2ISD A;  3JTD C;  3BXK A;  2LUC A;  1LVC D;  3KO0 A;  4M2O A;  2OS8 C;  4WRI A;  1R2U A;  3WHT B;  2R2I A;  1KK8 B;  3PM8 A;  1EG4 A;  2M9G A;  1LA0 A;  3PAL A;  3CR5 X;  1XK4 A;  1B4C A;  2MAZ A;  3SJS A;  1HQV A;  3OB2 B;  1XFV O;  1QX5 B;  2K61 A;  1S36 A;  1YR5 A;  1OMD A;  2L0P A;  2LVV A;  4YGA A;  4DCK A;  4CID A;  1S6I A;  2JOJ A;  1UP5 A;  2QPT A;  1OMV A;  2VRG A;  1J7R A;  1B7T Z;  1OZS A;  1Y0V H;  2H61 C;  3HCM A;  2H2K A;  4C0L A;  3VRN A;  2GV5 A;  2LMU A;  1BMO A;  1UHJ A;  2FOT A;  3JVT C;  3TDU A;  1ZAC A;  2KI6 C;  2KSP A;  3ICB A;  1K9U A;  1W7I B;  4BY5 A;  4OVN F;  2F3Z A;  1AJ4 A;  1EXR A;  3O78 A;  1NX1 A;  1BU3 A;  1OQP A;  1CTR A;  1SRA A;  1TNQ A;  1N0Y A;  1R6P A;  4Q04 A;  2WOR A;  4M2P A;  1QV1 A;  2FCE A;  1KWO C;  1F4O A;  4OKH A;  5D7F A;  4ETO A;  2I7A A;  1BT6 A;  2OTG B;  1SY9 A;  2BBN A;  2F8P A;  2F3Y A;  1J1D A;  3WHU B;  3I5G C;  1F70 A;  2L98 A;  3EK7 A;  4MN0 A;  3VRO A;  2LVJ A;  1YX7 A;  3I5H B;  1C07 A;  2NZ0 A;  5DKR A;  4XYN A;  4MBE A;  1IJ6 A;  2LM5 A;  1OZO A;  4GAO A;  4PHJ A;  1WRZ A;  2EC6 C;  2LP2 A;  4PE4 A;  3PN7 B;  1DJX A;  4F0Z B;  2CNP A;  2O60 A;  4MZK A;  2M3W A;  1JFJ A;  3TDI A;  5B8I B;  1BR4 B;  3MSE B;  2LMV A;  2ZRT A;  3AKB A;  3EK8 A;  1KFX S;  1SCM C;  3SG5 A;  2JXL A;  2Q4U A;  1ZMZ A;  2OS8 B;  1A29 A;  1DVI A;  1NIW A;  1KFX L;  4I5J A;  4C0K A;  4MZJ A;  2KAV A;  1LIN A;  1SR6 B;  2CXJ A;  3GK2 A;  1DJG A;  3LCP C;  3EKH A;  4NDB A;  4CFR A;  3NSO A;  3IQO A;  5AAN A;  3PLF B;  1NX2 A;  1EG3 A;  4WQ3 A;  2NCP A;  4AQJ A;  3SIA A;  1K96 A;  1X02 A;  2AMI A;  1A75 B;  1PUL A;  2LVK A;  4CPV A;  1GGW A;  1IJ5 A;  1A75 A;  4HRG A;  1LKJ A;  2JZI A;  1QLK A;  1SKT A;  2KI4 C;  2ZRS A;  2WC8 A;  1DGU A;  1PVB A;  1ZOT B;  1PVA A;  1KSO A;  2ZKM X;  4GGF C;  5I2Q A;  1XA5 A;  4YGC B;  3OP0 A;  1Y1U A;  1FF1 A;  2M8U A;  1KWO B;  3VRP A;  2F33 A;  1RK9 A;  1MXL C;  1IQ3 A;  4PDZ A;  3RLZ A;  3NSI A;  1AJ5 A;  2TN4 A;  5HYD A;  1GGZ A;  2LV7 A;  4GNK B;  1C7V A;  2Y5I A;  3QRX A;  2BCX A;  3TDZ A;  1YRT B;  2FCD A;  4C0J A;  1A4P A;  1FBV A;  1HT9 A;  1TOP A;  2KYF A;  1QAT A;  3TS5 C;  1QS7 A;  3NSL A;  1KQV A;  2G2B A;  1TNP A;  1F4Q A;  2OPO A;  2ZNE A;  2KGR A;  5CSF A;  5HKZ A;  2EC6 B;  2SAS A;  1TTX A;  4ZCV A;  4DIR A;  4R1E A;  2I94 A;  2MA2 A;  2NXQ A;  4BY4 A;  1M46 A;  4DUQ A;  4YI9 A;  5JJG A;  1GJY A;  1WDC B;  3HX4 A;  3LK0 A;  4MVF A;  4D1E A;  5J3X A;  3WXA A;  3VRR A;  4ORB B;  3C1V A;  1SCM B;  3H4S E;  1K94 A;  1ODB A;  2IS9 A;  1W7J B;  1RWY A;  2ZN9 A;  5I8N A;  1PSR A;  2EGD A;  5ER5 A;  2Q91 A;  2JRF A;  2M29 A;  1B8L A;  2JQ6 A;  3EVU A;  4P2Y B;  5IBW A;  2COL B;  1D1O A;  3WNX B;  3D10 A;  2LC5 A;  1MQ1 A;  1SCV A;  3BOW B;  2PAL A;  1JF0 A;  1GQM A;  1IGV A;  1B9A A;  1UUR A;  3GK4 X;  3SG7 A;  2NLN A;  1UHI A;  1PSB A;  1UHK A;  4GUK A;  3SG4 A;  3CR2 A;  1C7W A;  4DS7 A;  2LLT A;  1JFK A;  1SNL A;  1UWO A;  2D8N A;  2Y1N A;  3DVM A;  1DT7 B;  1SPY A;  2EHB A;  1CDM A;  1BOD A;  1F71 A;  4I5K A;  4PE1 A;  1A2X A;  1QIV A;  1NCZ A;  1K9P A;  2HPS A;  1YTZ C;  1CDN A;  1CKK A;  4FQO A;  1K2H A;  3KEV A;  2GGZ A;  2KBI A;  4PE0 A;  1RFJ A;  3GK1 A;  5FYX A;  3ZNI A;  4OR9 B;  2LMT A;  3DD4 A;  1BJF A;  2JC2 A;  3DF0 B;  2KFH A;  3DF0 A;  3I5F C;  3OHM B;  1BOC A;  3I5I B;  2F2O A;  4HRE E;  5HLO A;  1G33 A;  1TRF A;  1CFP A;  2WCB A;  1L7Z A;  2KI6 D;  4MZL A;  1XYD A;  2E6W A;  1EL4 A;  1CLB A;  4ICB A;  1CFF A;  1DGV A;  2L4I A;  2LUX A;  3F45 A;  1CFD A;  1U5I B;  2JNX A;  1DF0 B;  3BQ3 A;  1U5I A;  3VRQ A;  5BPJ A;  4HRH A;  2WCF A;  1DF0 A;  1S6C A;  1IQ5 A;  4P5O E;  2BCA A;  1S26 D;  1AVS A;  1E8A A;  1PAL A;  1V1F A;  5HLV A;  1JSA A;  3EVV A;  1QVI Y;  3NSK A;  5I2L A;  2L2E A;  3JTD B;  1M31 A;  5ER4 X;  3ZWH A;  3D0Y B;  1A03 A;  1OMR A;  2Y4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...