1B8RA

Parvalbumin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
108
structure length
108
Chain Sequence
AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDEWTALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
total genus 41
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b8rA00
2QPTA 3EKHA 1F70A 1FW4A 4PALA 1BODA 2CXJA 1V1FA 1ALVA 1IGVA 2OPOA 3EKJA 1S6JA 1UHHA 4USLA 1B9AA 1NX1A 3EVRA 1QATA 2LANA 4XJKA 1KK8B 3TS5B 1DMOA 1PVAA 1NCZA 1JUOA 1WY9A 1KK7Z 2JQ6A 4HSZA 1CDMA 4YI9A 4MLWA 1CLBA 2BCBA 2F3ZA 3I5FB 1NUBA 1TCOB 3LK1A 4ICBA 1K9KA 1BU3A 2KFHA 3QRXA 1KFUS 2LP3A 2M3WA 3IF7A 1BOCA 1WLZA 2OTGC 1KQMC 2MHHA 4CLNA 1IJ6A 1CDNA 5DKRA 1GQMA 3EVUA 1LA3A 2LUCA 1MHOA 5HLVA 4I5LB 2LVIA 1CFFA 2ZRTA 1FI6A 2LMTA 2AMIA 2LMVA 1SL9A 3FS7A 1QX7A 5AANA 2PASA 1DGUA 1XO5A 1YX8A 2CT9A 1NSHA 2H61C 2JRFA 2RGIA 1K93D 1UUSA 3GK2A 1F71A 2JOJA 3RM1A 1XFWO 1QS7A 1PRWA 3MSEB 4MZKA 1TTXA 2ISDA 2E30A 2MLEC 3OHMB 3CZTX 3DD4A 1KQVA 1J7RA 2SCPA 1CMGA 5KSZA 4DIRA 1KK8C 3PSRA 1YUUA 4MZJA 2FJUB 4R1EA 1JC2A 1MXLC 2KAYA 1LVCD 2LLUA 3VRNA 1KWOB 1Y1UA 1OOJA 1YRUB 1K90D 4HRHA 4GGFC 1OE9B 1QX2A 2LNKA 4M2PA 1CDPA 1M63B 1Y1AA 1SL7A 2NXQA 2LVVA 3GK4X 1TIZA 2F3YA 4HREE 3ICBA 1LA0A 2Q91A 4A4BA 4MRYA 3E3RA 1L7ZA 5CSNA 1J7OA 1EH2A 1J1DA 1TNPA 3RLZA 1OZOA 2KFGA 3NSLA 1L2OB 2BBNA 4GBAA 3CGAA 1BJFA 2WCFA 3PM8A 4CFRA 1A75B 1CFPA 1EJ3A 2M7LA 1QVIZ 1KFXL 1U5IA 2KI4B 4AOMA 1QLKA 4PHNA 2WORA 3BUWB 4I5JA 1OMDA 2H2KA 1IQ3A 1SCMB 1ZOTB 5JJGA 4FTGA 2MRDA 4PHKA 1YX7A 2A4JA 1F4QA 1YUTA 1DF0A 3A4UB 1YUSA 3SG2A 1C7WA 3SG7A 1YTZC 1J55A 1CKKA 4OR9B 1DJYA 2MBXA 1AK8A 5HKYA 4DS7A 2ZNDA 3TZ1A 3OB1B 1N65A 2LVJA 1QXPA 1PALA 2FOTA 5CSFA 5DKNA 5JOLA 4F0ZB 1SNLA 3KHEA 1CM4A 1DGVA 1B7TY 2LCPA 1SPYA 3CWGA 1M46A 3VRRA 4YI8A 1Y1XA 4ETOA 3I5HC 1BLQA 1IH0A 1JSAA 1JBAA 1KSOA 3BOWA 3D0YB 1EXRA 2WC8A 1S3PA 2CCMA 2G2BA 2NLNA 3KEVA 2OTGB 1KQMB 1UHKA 2MAZA 4M2QA 3SJSA 3O78A 3FWBA 5TNCA 2JTTA 1ZUZA 2KQYA 2KI6D 1J1EA 5KU1A 1B8RA 3VRQA 2OS8C 2JWWA 1CB1A 2LMUA 3DF0B 2JNXA 2KDHA 3H4SE 1PSBA 1WLMA 2BE6A 3TUYC 2KAXA 4L9MA 2KAVA 1Q80A 4YGAA 3I5IC 4MEWA 5IBWA 2ZNEA 1AP4A 1K94A 2R2IA 1SL8A 2LP2A 3GK1A 2GV5A 3BUNB 5AEQA 2KGBC 1IWQA 2BCXA 1S5GY 3CS1A 1DJZA 1G8IA 4MN0A 1TRFA 3CR2A 1VRKA 2Y5IA 1PK0D 2BBMA 3CLNA 2JNFA 2L51A 4I5KA 3WXAA 2F33A 2HQWA 3SG5A 3OB2B 2Y4QA 1X02A 4JPZB 1CNPA 1D1OA 3VRPA 2BCAA 2TN4A 2I18A 2WCEA 2D8NA 2LAPA 2K2FA 3PFVA 5HYDA 4C0JA 5FYXA 4OKHA 1WDCC 1GGWA 1TNWA 2GGMA 3BXKA 3NSIA 4UPGA 1EL4A 2NZ0A 1AHRA 4OVNF 3OX5A 3TDUA 4PHJA 1RFJA 2KBIA 5HLOA 1BG1A 2QACA 2Y1MA 3JTDB 2LHLA 3EK7A 1K96A 4AQJA 4NDCA 5I2QA 1BF5A 2KOTA 1NPQA 4YGDB 1FF1A 5K89A 1B8CA 1CM1A 1C07A 1AUIB 4XJKB 1BMOA 3AAKA 1F54A 2DOQA 1ZFSA 5GQQC 1QIVA 1YVHA 3TDIA 1A03A 1C7VA 2JU0A 1F4OA 2CTNA 2KNEA 1RTP1 2PALA 1S36A 1B8LA 5AFPA 1B1GA 2LVKA 1SYMA 3VGOA 3BYAA 1CFCA 1EG3A 1OSAA 2M97A 2PRUA 1XFZO 2SASA 1DJIA 3EVVA 4PDZA 3ZWHA 3I5HB 1UP5A 1XFUO 2B1UA 4FQOA 1IQ5A 2K0JA 3DVKA 3PN7C 4MSPA 2JT3A 1UWOA 4PE4A 5AXIA 3JTDC 4HRGA 1XA5A 4NQGA 1JFJA 3EK8A 1GJYA 1BR1B 2KBMA 1KSMA 1R2UA 2AAOA 1KFUL 5D69A 4BY4A 4CIDA 1QJTA 1UHJA 2OS8B 1W7JB 3KPXA 1FPWA 4C0KA 3HCMA 4E68A 2V53A 4N5XA 4PE7A 3TUYB 2CBLA 2F8PA 2O60A 2L4HA 4CFQA 3D0YA 3I5GC 1TNQA 1R6PA 1SK6D 3ZNIA 4MVFA 2AUCA 3I5IB 1PSRA 4GAOA 1KK7Y 2LM5A 1NP8A 2EGDA 1RROA 2PSRA 3AKBA 2NCOA 2M1KB 3SIAA 4ORAB 1G4YR 1JF2A 2LHIA 5HKWA 2ZN8A 3NSKA 2JTZA 5ER4X 2E6WA 2HETA 4WRIA 1QTXA 3DF0A 5BPJA 1W7IB 3TDZA 2JXCA 2H61A 4QJ3B 4TNCA 2ZFDA 3PATA 3NXAA 3K21A 3WHUB 1U5IB 5CSIA 5HKZA 1J7PA 4AQIA 2GGZA 3PALA 2L4IA 1WDCB 2I7AA 2KGRA 2FCEA 2WNDA 4JWQA 3JVTC 4ORCB 1DJGA 1CLLA 1MXEA 1DT7B 1QIWA 1DF0B 2KSPA 1DTLA 4YBHB 1XVJA 1CDLA 2L2EA 2ZN9A 1XFXO 1AJ4A 1DJXA 4GUKA 1SR6C 1CTRA 3SG6A 2JULA 1B4CA 5I8NA 1GGZA 2BL0C 2EC6C 1M31A 1XFVO 1WRZA 1QV1A 1DVIA 1RJVA 2Q4UA 2K7DA 4GNKB 4Q04A 3BQ3A 5B8IB 3AAJA 1FBVA 5CPVA 3LCPC 1UHNA 3OX6A 2I94A 1JWDA 2LC5A 3FIAA 5AERA 2MJWB 2K7CA 3BOWB 3KO0A 4YRUA 1S6IA 3F45A 2PMYA 5D7FA 1V1GA 2LV7A 1YR5A 4C0LA 1F55A 1OMRA 1S6CA 2VRGA 3WNXB 1NCYA 1S1EA 2L50A 1M45A 2JT8A 2NCPA 1QVIY 3DVJA 4DRWA 1CFDA 1LXFC 2O5GA 1SRAA 3KF9A 1BT6A 1BR4B 1NCXA 3EK4A 2WCBA 3SG3A 1CMFA 2F2OA 3PN7B 1WRLA 4GFTA 5CSJA 1CLMA 4WQ3A 1PULA 1KFXS 1SKTA 1B7TZ 3LL8B 1Y6WA 4N1FA 2IS9A 2MA2A 1JF0A 1IKUA 3AKAA 3BUXB 4JQ0D 2KQ6A 1IJ5A 3CTNA 1QX5B 1MF8B 1UHIA 1MQ1A 2KYFA 5J3XA 3WHTB 1KCYA 4M2OA 1EG4A 2P6BB 2FCDA 2G9BA 5I2OA 1AJ5A 3GOFA 2JC2A 3SIBA 1FI5A 1QASA 1DJHA 4N1GA 5G08A 1XK4A 3I5GB 4ORBB 4DUQA 2LLSA 1A75A 2M0RA 4DCKA 2KFFA 2JZIA 1QV0A 3NSOA 2HQ8A 4YGBB 2JPTA 2L5XB 2CNPA 4XYNA 1MWNA 5ER5A 4YGEB 2M49B 1K9UA 1IG5A 3FWCA 4BY5A 2K8MB 4WQ2A 3TS5C 2L0PA 2LUXA 4OV2A 4MRXA 5KTYA 1ALWA 1LINA 2F2PA 3DVMA 1A4PA 1B47A 1N2DA 3A8RA 1M39A 1OZSA 3I5FC 1S5GZ 1AVSA 2M29A 2BKHB 2LE9B 2JXLA 1SY9A 3CR5X 1NWDA 1OMVA 1MUXA 3LLEA 2K2AA 3JVTB 1A29A 3SG4A 2EHBA 1A2XA 3D10A 4GPLB 3O6BA 1K2HA 1MR8A 2HF5A 4U8DA 1E8AA 2KI6C 4P2YB 3HX4A 1NYAA 1K95A 4NDDA 3CR4X 4OCIA 5PALA 1SR6B 1NX2A 2LLTA 1S26D 3O4YA 2KHNA 2BL0B 1NX3A 1ZACA 4P5OE 1ZMZA 2EC6B 4PHMA 1K9PA 1YRTB 4CPVA 1F8HA 1ODBA 1SW8A 2BE4A 1SMGA 4ZCVA 1LKJA 1XYDA 1SCVA 1XFYO 1KWOC 5I2LA 1NIWA 3PLFB 1J7QA 2HPSA 3VROA 1TOPA 2PVBA 3BUMB 4QJ5B 3O2PA 1TCFA 1TN4A 4IL1A 2BKIB 1QLSA 3C1VA 2JT0A 2K7OA 1YURA 2M9GA 1HT9A 4YGCB 1IRJA 2WOSA 2ZKMX 1SBJA 2MLFC 2ZRSA 1RWYA 2M8UA 4NDBA 1OQPA 1H4BA 1RECA 2COLB 4GGFA 1Y0VH 2K61A 3BUOB 1L2OC 1NX0A 4QJ4B 1G33A 3LK0A 1XK4C 3OP0A 5F6TA 2I2RE 4PCWA 4A4CA 3DVEA 2KI4C 5DKQA 1DJWA 4I5NB 1YVLA 2KYCA 2M1UA 1N0YA 3IQQA 3IQOA 4PE1A 2BECA 4GGNA 1JFKA 1K8UA 4MZLA 1SCMC 1TNXA 2L98A 4PE0A 1UURA 4ZCUA 2Y1NA 2K7BA 1HQVA 2M7NA 3M0WA 4D1EA 1H8BA 1WRKA 1PVBA 4MBEA 1RK9A
chains in the Genus database with same CATH superfamily
2QPTA 1XFRA 3EKHA 2ERBA 5FI2A 3OBVA 1F70A 1FW4A 4PALA 1BODA 2CXJA 1V1FA 1ALVA 1IGVA 3CZ0A 3BFAA 2OPOA 3UO9A 3EKJA 1S6JA 1UHHA 4USLA 5FI7A 1B9AA 1NX1A 3EVRA 1QATA 2LANA 4XJKA 1KK8B 3TS5B 1DMOA 1PVAA 1NCZA 1JUOA 1WY9A 1KK7Z 2JQ6A 4HSZA 1CDMA 4YI9A 4MLWA 1CLBA 2BCBA 2F3ZA 3B6XA 3I5FB 1NUBA 1TCOB 1ORGA 3LK1A 4ICBA 1K9KA 1BU3A 2KFHA 3CABA 3QRXA 1KFUS 2LP3A 2M3WA 3IF7A 3L47A 1WLZA 2OTGC 1BOCA 1KQMC 2MHHA 4KYNA 4CLNA 1IJ6A 1CDNA 5DKRA 1GQMA 2L5YA 3EVUA 1LA3A 2LUCA 1MHOA 5HLVA 4I5LB 2LVIA 1CFFA 2ZRTA 1FI6A 2PYQA 2LMTA 2AMIA 2LMVA 1SL9A 3FS7A 1QX7A 5AANA 2PASA 1DGUA 1XO5A 1YX8A 2CT9A 1NSHA 2H61C 2JRFA 2RGIA 1K93D 2WCJA 1UUSA 3GK2A 1F71A 2JOJA 3RM1A 1XFWO 1QS7A 1PRWA 3MSEB 4MZKA 1TTXA 2ISDA 2E30A 2MLEC 3OHMB 3CZTX 1Z2CB 3DD4A 1KQVA 1J7RA 2SCPA 1CMGA 3NHTA 2QEBA 3S0BA 5KSZA 4DIRA 1KK8C 3PSRA 1YUUA 4MZJA 2FJUB 4R1EA 1JC2A 1MXLC 3R1VA 2KAYA 1LVCD 2LLUA 3VRNA 1KWOB 1Y1UA 3CZ1A 1OOJA 3PM2A 1YRUB 1K90D 4HRHA 4GGFC 5DICA 3S0GA 1OE9B 1QX2A 2LNKA 4M2PA 1CDPA 1M63B 1Y1AA 1SL7A 2NXQA 2LVVA 3GK4X 1TIZA 2F3YA 4HREE 3ICBA 1LA0A 2Q91A 4A4BA 4MRYA 3E3RA 2K60A 1L7ZA 3CDNA 5CSNA 1J7OA 1EH2A 1J1DA 1TNPA 3RLZA 1OZOA 3NGVA 2KFGA 3NSLA 2WC5A 3S0AA 3V2LA 1OOHA 1L2OB 2BBNA 4GBAA 3CGAA 1BJFA 2WCFA 3PM8A 4CFRA 1A75B 1CFPA 1EJ3A 2M7LA 1QVIZ 1KFXL 1U5IA 2KI4B 3D76A 1QLKA 4PHNA 4AOMA 3SS5A 2WORA 1TWOA 3BUWB 2QEVA 4I5JA 1OMDA 2H2KA 3RZSA 1IQ3A 1SCMB 1ZOTB 5JJGA 4FTGA 1T14A 2KLDA 2MRDA 3D74A 4PHKA 1YX7A 2A4JA 1F4QA 1YUTA 1DF0A 3A4UB 1YUSA 3SG2A 1C7WA 2P71A 1YTZC 1J55A 3SG7A 4OR9B 1DJYA 1CKKA 2MBXA 1AK8A 5HKYA 4PT1A 4DS7A 2ZNDA 3TZ1A 1QWVA 3OB1B 1N65A 2LVJA 1QXPA 1OOFA 1PALA 2FOTA 5CSFA 5DKNA 5JOLA 4F0ZB 1SNLA 3KHEA 1CM4A 1DGVA 1B7TY 2LCPA 1SPYA 3CWGA 1M46A 3VRRA 4YI8A 3S0DA 1Y1XA 4ETOA 3I5HC 1BLQA 1IH0A 1JSAA 1JBAA 1KSOA 3B88A 3BOWA 3D0YB 1EXRA 2WC8A 1S3PA 2CCMA 1P28A 2WCHA 2G2BA 2NLNA 3KEVA 4INWA 2OTGB 1KQMB 1UHKA 2MAZA 4M2QA 3SJSA 3O78A 2L2CA 3FWBA 5TNCA 2JTTA 1ZUZA 2KQYA 2KI6D 1J1EA 5KU1A 1B8RA 4JD9A 3VRQA 4IJ7A 2OS8C 2JWWA 1CB1A 2LMUA 3DF0B 2JNXA 2KDHA 3H4SE 1PSBA 1WLMA 2BE6A 3TUYC 2KAXA 4L9MA 2KAVA 1Q80A 2YGUA 4YGAA 3I5IC 1TUZA 4MEWA 5IBWA 2ZNEA 1AP4A 1K94A 2R2IA 1SL8A 2LP2A 3GK1A 3UNWA 2GV5A 3BUNB 3CYZA 5AEQA 2KGBC 1IWQA 2BCXA 1S5GY 3CS1A 1OOIX 3B86A 1DJZA 1G8IA 4MN0A 1TRFA 3CR2A 1VRKA 2Y5IA 1PK0D 2BBMA 3CLNA 2JNFA 3DY9A 2L51A 4I5KA 3WXAA 2F33A 2HQWA 3SG5A 5I94A 3OB2B 2Y4QA 1X02A 4JPZB 1CNPA 1D1OA 3VRPA 2BCAA 2TN4A 2I18A 2KPHA 2D8NA 2LAPA 2WCEA 2K2FA 5FI6A 3PFVA 5HYDA 4C0JA 5FYXA 4OKHA 1WDCC 1GGWA 1TNWA 2GGMA 3BXKA 3NSIA 4UPGA 1EL4A 1SSEB 2NZ0A 3D73A 1AHRA 4OVNF 3OX5A 3TDUA 4PHJA 1RFJA 2KBIA 5HLOA 1BG1A 2QACA 2Y1MA 3JTDB 2LHLA 3EK7A 1K96A 4AQJA 4NDCA 5I2QA 1BF5A 2KOTA 1NPQA 4YGDB 2WCLA 5HL1A 1FF1A 5K89A 1B8CA 1CM1A 1C07A 1AUIB 4XJKB 1BMOA 3AAKA 1F54A 2DOQA 1ZFSA 5GQQC 1QIVA 3R1PA 1YVHA 3TDIA 1A03A 1C7VA 3B87A 1DC1A 2JU0A 1F4OA 2CTNA 3BJHA 2KNEA 1RTP1 2BAPA 2KLEA 2PALA 1S36A 1B8LA 5AFPA 1B1GA 2LVKA 1SYMA 3VGOA 3BYAA 1CFCA 1EG3A 1OSAA 2M97A 2P70A 2PRUA 4INXA 1XFZO 2SASA 1LS8A 1DJIA 3EVVA 4PDZA 3ZWHA 3I5HB 1UP5A 1XFUO 2B1UA 4FQOA 1IQ5A 2K0JA 3DVKA 3PN7C 4MSPA 2JT3A 1UWOA 3L4AA 4PE4A 3JTDC 4HRGA 5AXIA 1XA5A 4NQGA 4JKTA 1JFJA 3EK8A 1GJYA 1BR1B 2KBMA 1KSMA 2QEOA 1R2UA 2AAOA 1KFUL 5D69A 1Z4HA 4BY4A 4CIDA 2QEHA 1QJTA 1UHJA 2OS8B 1W7JB 3KPXA 1FPWA 3QMEA 4C0KA 3HCMA 4E68A 2V53A 4N5XA 4PE7A 3TUYB 2CBLA 2F8PA 2O60A 2L4HA 4CFQA 3D0YA 3I5GC 1TNQA 1R6PA 1SK6D 3ZNIA 3SS4A 4MVFA 2AUCA 3I5IB 1PSRA 4GAOA 1KK7Y 2LM5A 1NP8A 2EGDA 1RROA 2PSRA 4FQTA 3AKBA 2NCOA 2M1KB 3SIAA 4ORAB 1G4YR 1JF2A 2LHIA 5HKWA 2ZN8A 3NSKA 2JTZA 5ER4X 2E6WA 2HETA 4WRIA 1QTXA 3DF0A 5BPJA 1W7IB 3TDZA 2JXCA 2H61A 3NHIA 4QJ3B 4TNCA 2ZFDA 3PATA 3NXAA 3K21A 3WHUB 1U5IB 5CSIA 5HKZA 1J7PA 2H8VA 4AQIA 2GGZA 3PALA 2L4IA 1WDCB 3EG5B 2I7AA 2KGRA 2FCEA 2WNDA 4JWQA 3SS3A 3JVTC 4ORCB 1DJGA 1CLLA 1MXEA 1DT7B 1QIWA 1DF0B 2KSPA 1DTLA 4YBHB 1XVJA 1CDLA 2L2EA 2ZN9A 1XFXO 3L4LA 1AJ4A 1DJXA 4GUKA 1DQEA 1DEKA 3D77A 1SR6C 1CTRA 3R1OA 3SG6A 2JULA 1OOGA 1B4CA 3B7AA 5I8NA 1GGZA 2BL0C 3D78A 2EC6C 1M31A 1XFVO 1WRZA 1QV1A 1DVIA 1RJVA 2Q4UA 3CZ2A 3FE8A 5EL2A 2K7DA 4F7FA 4GNKB 4Q04A 3BQ3A 4OZDA 5B8IB 3AAJA 1FBVA 5CPVA 3LCPC 2WC6A 1UHNA 3OX6A 2I94A 1JWDA 2LC5A 3FIAA 5AERA 2MJWB 2K7CA 3BOWB 3KO0A 4YRUA 1S6IA 3F45A 2PMYA 5D7FA 1V1GA 2LV7A 1YR5A 4C0LA 1C3ZA 1F55A 1OMRA 1S6CA 2VRGA 3WNXB 1NCYA 1S1EA 2L50A 1M45A 2JT8A 2NCPA 1QVIY 3DVJA 4DRWA 1CFDA 1LXFC 2O5GA 1SRAA 3KF9A 1BT6A 1BR4B 1NCXA 3EK4A 2WCBA 3SG3A 1CMFA 2F2OA 3PN7B 1WRLA 4GFTA 5CSJA 1CLMA 4WQ3A 1PULA 3D75A 1KFXS 1SKTA 1GM0A 1B7TZ 3LL8B 1Y6WA 4N1FA 2IS9A 2MA2A 1JF0A 1IKUA 3AKAA 3BUXB 4JQ0D 2KQ6A 1IJ5A 3CTNA 3DZTA 1QX5B 1MF8B 1UHIA 1MQ1A 2KYFA 5J3XA 3WHTB 1KCYA 4M2OA 1EG4A 2P6BB 2FCDA 2G9BA 5I2OA 1AJ5A 3GOFA 2JC2A 3SIBA 1FI5A 1QASA 1DJHA 4N1GA 5G08A 1XK4A 3I5GB 4ORBB 4DUQA 3BFBA 2LLSA 1A75A 2M0RA 2WCKA 4DCKA 2KFFA 2JZIA 1QV0A 3NSOA 3O4XA 3PJIA 2HQ8A 4YGBB 2JPTA 2L5XB 2CNPA 4XYNA 1MWNA 5ER5A 4YGEB 2M49B 1K9UA 1IG5A 3FWCA 4BY5A 2K8MB 4WQ2A 3TS5C 2L0PA 2LUXA 4OV2A 4MRXA 5KTYA 1ALWA 1LINA 2F2PA 3DVMA 1A4PA 1B47A 1N2DA 3S0EA 3A8RA 3BFHA 1M39A 1OZSA 3I5FC 1S5GZ 1AVSA 2M29A 2BKHB 2LE9B 2JXLA 1SY9A 3CR5X 1NWDA 1OMVA 1MUXA 3LLEA 2K2AA 3JVTB 1A29A 3SG4A 2EHBA 1A2XA 3D10A 3K1EA 4GPLB 3O6BA 1K2HA 3VB1A 1MR8A 2HF5A 4U8DA 1E8AA 2KI6C 4P2YB 3HX4A 1NYAA 1K95A 4NDDA 3CR4X 4OCIA 5PALA 1SR6B 1NX2A 2JPOA 2BNXA 2LLTA 1S26D 1OW4A 3O4YA 3S0FA 2KHNA 2BL0B 1NX3A 1ZACA 2WCMA 4P5OE 1ZMZA 2EC6B 4PHMA 1K9PA 1YRTB 4CPVA 1F8HA 1TUJA 1ODBA 1SW8A 2BE4A 1SMGA 4ZCVA 1LKJA 1XYDA 1SCVA 1XFYO 1KWOC 5I2LA 3IVTA 1NIWA 3PLFB 1J7QA 2HPSA 3R72A 3VROA 1TOPA 2PVBA 3BUMB 4QJ5B 3O2PA 1IIOA 1TCFA 1TN4A 4IL1A 2BKIB 1QLSA 3C1VA 2JT0A 2K7OA 1YURA 2M9GA 1HT9A 4YGCB 1IRJA 2WOSA 2ZKMX 1SBJA 2MLFC 2ZRSA 1RWYA 1DELA 2M8UA 3Q8IA 4NDBA 1OQPA 1C3YA 1H4BA 1RECA 2COLB 2PQLA 4GGFA 1Y0VH 2K61A 3BUOB 1L2OC 1NX0A 4QJ4B 1G33A 3FE9A 1XK4C 3LK0A 3OP0A 5D3OA 5F6TA 2I2RE 4PCWA 4A4CA 1W9ZA 3OGNA 3DVEA 3FE6A 2KI4C 5DKQA 1DJWA 4I5NB 1YVLA 2KYCA 2M1UA 1N0YA 3IQQA 3IQOA 3N7HA 4PE1A 2BECA 4GGNA 2GTEA 1JFKA 1K8UA 4MZLA 1SCMC 1TNXA 2L98A 3DXLA 4PE0A 2QDIA 3DYEA 1UURA 4ZCUA 2Y1NA 2K7BA 1HQVA 2M7NA 3M0WA 4D1EA 1H8BA 1WRKA 2FJYA 1PVBA 4MBEA 1RK9A
chains in the Genus database with same CATH topology
2QPTA 3EKHA 1F70A 1FW4A 4PALA 1BODA 2CXJA 1V1FA 1ALVA 1IGVA 2OPOA 3EKJA 1S6JA 1UHHA 4USLA 1B9AA 1NX1A 3EVRA 1QATA 2LANA 4XJKA 1KK8B 3TS5B 1DMOA 1PVAA 1NCZA 1JUOA 1WY9A 1KK7Z 2JQ6A 4HSZA 1CDMA 4YI9A 4MLWA 1CLBA 2BCBA 2F3ZA 3I5FB 1NUBA 1TCOB 3LK1A 4ICBA 1K9KA 1BU3A 2KFHA 3QRXA 1KFUS 2LP3A 2M3WA 3IF7A 1BOCA 1WLZA 2OTGC 1KQMC 2MHHA 4CLNA 1IJ6A 1CDNA 5DKRA 1GQMA 3EVUA 1LA3A 2LUCA 1MHOA 5HLVA 4I5LB 2LVIA 1CFFA 2ZRTA 1FI6A 2LMTA 2AMIA 2LMVA 1SL9A 3FS7A 1QX7A 5AANA 2PASA 1DGUA 1XO5A 1YX8A 2CT9A 1NSHA 2H61C 2JRFA 2RGIA 1K93D 1UUSA 3GK2A 1F71A 2JOJA 3RM1A 1XFWO 1QS7A 1PRWA 3MSEB 4MZKA 1TTXA 2ISDA 2E30A 2MLEC 3OHMB 3CZTX 3DD4A 1KQVA 1J7RA 2SCPA 1CMGA 5KSZA 4DIRA 1KK8C 3PSRA 1YUUA 4MZJA 2FJUB 4R1EA 1JC2A 1MXLC 2KAYA 1LVCD 2LLUA 3VRNA 1KWOB 1Y1UA 1OOJA 1YRUB 1K90D 4HRHA 4GGFC 1OE9B 1QX2A 2LNKA 4M2PA 1CDPA 1M63B 1Y1AA 1SL7A 2NXQA 2LVVA 3GK4X 1TIZA 2F3YA 4HREE 3ICBA 1LA0A 2Q91A 4A4BA 4MRYA 3E3RA 1L7ZA 5CSNA 1J7OA 1EH2A 1J1DA 1TNPA 3RLZA 1OZOA 2KFGA 3NSLA 1L2OB 2BBNA 4GBAA 3CGAA 1BJFA 2WCFA 3PM8A 4CFRA 1A75B 1CFPA 1EJ3A 2M7LA 1QVIZ 1KFXL 1U5IA 2KI4B 4AOMA 1QLKA 4PHNA 2WORA 3BUWB 4I5JA 1OMDA 2H2KA 1IQ3A 1SCMB 1ZOTB 5JJGA 4FTGA 2MRDA 4PHKA 1YX7A 2A4JA 1F4QA 1YUTA 1DF0A 3A4UB 1YUSA 3SG2A 1C7WA 3SG7A 1YTZC 1J55A 1CKKA 4OR9B 1DJYA 2MBXA 1AK8A 5HKYA 4DS7A 2ZNDA 3TZ1A 3OB1B 1N65A 2LVJA 1QXPA 1PALA 2FOTA 5CSFA 5DKNA 5JOLA 4F0ZB 1SNLA 3KHEA 1CM4A 1DGVA 1B7TY 2LCPA 1SPYA 3CWGA 1M46A 3VRRA 4YI8A 1Y1XA 4ETOA 3I5HC 1BLQA 1IH0A 1JSAA 1JBAA 1KSOA 3BOWA 3D0YB 1EXRA 2WC8A 1S3PA 2CCMA 2G2BA 2NLNA 3KEVA 2OTGB 1KQMB 1UHKA 2MAZA 4M2QA 3SJSA 3O78A 3FWBA 5TNCA 2JTTA 1ZUZA 2KQYA 2KI6D 1J1EA 5KU1A 1B8RA 3VRQA 2OS8C 2JWWA 1CB1A 2LMUA 3DF0B 2JNXA 2KDHA 3H4SE 1PSBA 1WLMA 2BE6A 3TUYC 2KAXA 4L9MA 2KAVA 1Q80A 4YGAA 3I5IC 4MEWA 5IBWA 2ZNEA 1AP4A 1K94A 2R2IA 1SL8A 2LP2A 3GK1A 2GV5A 3BUNB 5AEQA 2KGBC 1IWQA 2BCXA 1S5GY 3CS1A 1DJZA 1G8IA 4MN0A 1TRFA 3CR2A 1VRKA 2Y5IA 1PK0D 2BBMA 3CLNA 2JNFA 2L51A 4I5KA 3WXAA 2F33A 2HQWA 3SG5A 3OB2B 2Y4QA 1X02A 4JPZB 1CNPA 1D1OA 3VRPA 2BCAA 2TN4A 2I18A 2WCEA 2D8NA 2LAPA 2K2FA 3PFVA 5HYDA 4C0JA 5FYXA 4OKHA 1WDCC 1GGWA 1TNWA 2GGMA 3BXKA 3NSIA 4UPGA 1EL4A 2NZ0A 1AHRA 4OVNF 3OX5A 3TDUA 4PHJA 1RFJA 2KBIA 5HLOA 1BG1A 2QACA 2Y1MA 3JTDB 2LHLA 3EK7A 1K96A 4AQJA 4NDCA 5I2QA 1BF5A 2KOTA 1NPQA 4YGDB 1FF1A 5K89A 1B8CA 1CM1A 1C07A 1AUIB 4XJKB 1BMOA 3AAKA 1F54A 2DOQA 1ZFSA 5GQQC 1QIVA 1YVHA 3TDIA 1A03A 1C7VA 2JU0A 1F4OA 2CTNA 2KNEA 1RTP1 2PALA 1S36A 1B8LA 5AFPA 1B1GA 2LVKA 1SYMA 3VGOA 3BYAA 1CFCA 1EG3A 1OSAA 2M97A 2PRUA 1XFZO 2SASA 1DJIA 3EVVA 4PDZA 3ZWHA 3I5HB 1UP5A 1XFUO 2B1UA 4FQOA 1IQ5A 2K0JA 3DVKA 3PN7C 4MSPA 2JT3A 1UWOA 4PE4A 5AXIA 3JTDC 4HRGA 1XA5A 4NQGA 1JFJA 3EK8A 1GJYA 1BR1B 2KBMA 1KSMA 1R2UA 2AAOA 1KFUL 5D69A 4BY4A 4CIDA 1QJTA 1UHJA 2OS8B 1W7JB 3KPXA 1FPWA 4C0KA 3HCMA 4E68A 2V53A 4N5XA 4PE7A 3TUYB 2CBLA 2F8PA 2O60A 2L4HA 4CFQA 3D0YA 3I5GC 1TNQA 1R6PA 1SK6D 3ZNIA 4MVFA 2AUCA 3I5IB 1PSRA 4GAOA 1KK7Y 2LM5A 1NP8A 2EGDA 1RROA 2PSRA 3AKBA 2NCOA 2M1KB 3SIAA 4ORAB 1G4YR 1JF2A 2LHIA 5HKWA 2ZN8A 3NSKA 2JTZA 5ER4X 2E6WA 2HETA 4WRIA 1QTXA 3DF0A 5BPJA 1W7IB 3TDZA 2JXCA 2H61A 4QJ3B 4TNCA 2ZFDA 3PATA 3NXAA 3K21A 3WHUB 1U5IB 5CSIA 5HKZA 1J7PA 4AQIA 2GGZA 3PALA 2L4IA 1WDCB 2I7AA 2KGRA 2FCEA 2WNDA 4JWQA 3JVTC 4ORCB 1DJGA 1CLLA 1MXEA 1DT7B 1QIWA 1DF0B 2KSPA 1DTLA 4YBHB 1XVJA 1CDLA 2L2EA 2ZN9A 1XFXO 1AJ4A 1DJXA 4GUKA 1SR6C 1CTRA 3SG6A 2JULA 1B4CA 5I8NA 1GGZA 2BL0C 2EC6C 1M31A 1XFVO 1WRZA 1QV1A 1DVIA 1RJVA 2Q4UA 2K7DA 4GNKB 4Q04A 3BQ3A 5B8IB 3AAJA 1FBVA 5CPVA 3LCPC 1UHNA 3OX6A 2I94A 1JWDA 2LC5A 3FIAA 5AERA 2MJWB 2K7CA 3BOWB 3KO0A 4YRUA 1S6IA 3F45A 2PMYA 5D7FA 1V1GA 2LV7A 1YR5A 4C0LA 1F55A 1OMRA 1S6CA 2VRGA 3WNXB 1NCYA 1S1EA 2L50A 1M45A 2JT8A 2NCPA 1QVIY 3DVJA 4DRWA 1CFDA 1LXFC 2O5GA 1SRAA 3KF9A 1BT6A 1BR4B 1NCXA 3EK4A 2WCBA 3SG3A 1CMFA 2F2OA 3PN7B 1WRLA 4GFTA 5CSJA 1CLMA 4WQ3A 1PULA 1KFXS 1SKTA 1B7TZ 3LL8B 1Y6WA 4N1FA 2IS9A 2MA2A 1JF0A 1IKUA 3AKAA 3BUXB 4JQ0D 2KQ6A 1IJ5A 3CTNA 1QX5B 1MF8B 1UHIA 1MQ1A 2KYFA 5J3XA 3WHTB 1KCYA 4M2OA 1EG4A 2P6BB 2FCDA 2G9BA 5I2OA 1AJ5A 3GOFA 2JC2A 3SIBA 1FI5A 1QASA 1DJHA 4N1GA 5G08A 1XK4A 3I5GB 4ORBB 4DUQA 2LLSA 1A75A 2M0RA 4DCKA 2KFFA 2JZIA 1QV0A 3NSOA 2HQ8A 4YGBB 2JPTA 2L5XB 2CNPA 4XYNA 1MWNA 5ER5A 4YGEB 2M49B 1K9UA 1IG5A 3FWCA 4BY5A 2K8MB 4WQ2A 3TS5C 2L0PA 2LUXA 4OV2A 4MRXA 5KTYA 1ALWA 1LINA 2F2PA 3DVMA 1A4PA 1B47A 1N2DA 3A8RA 1M39A 1OZSA 3I5FC 1S5GZ 1AVSA 2M29A 2BKHB 2LE9B 2JXLA 1SY9A 3CR5X 1NWDA 1OMVA 1MUXA 3LLEA 2K2AA 3JVTB 1A29A 3SG4A 2EHBA 1A2XA 3D10A 4GPLB 3O6BA 1K2HA 1MR8A 2HF5A 4U8DA 1E8AA 2KI6C 4P2YB 3HX4A 1NYAA 1K95A 4NDDA 3CR4X 4OCIA 5PALA 1SR6B 1NX2A 2LLTA 1S26D 3O4YA 2KHNA 2BL0B 1NX3A 1ZACA 4P5OE 1ZMZA 2EC6B 4PHMA 1K9PA 1YRTB 4CPVA 1F8HA 1ODBA 1SW8A 2BE4A 1SMGA 4ZCVA 1LKJA 1XYDA 1SCVA 1XFYO 1KWOC 5I2LA 1NIWA 3PLFB 1J7QA 2HPSA 3VROA 1TOPA 2PVBA 3BUMB 4QJ5B 3O2PA 1TCFA 1TN4A 4IL1A 2BKIB 1QLSA 3C1VA 2JT0A 2K7OA 1YURA 2M9GA 1HT9A 4YGCB 1IRJA 2WOSA 2ZKMX 1SBJA 2MLFC 2ZRSA 1RWYA 2M8UA 4NDBA 1OQPA 1H4BA 1RECA 2COLB 4GGFA 1Y0VH 2K61A 3BUOB 1L2OC 1NX0A 4QJ4B 1G33A 3LK0A 1XK4C 3OP0A 5F6TA 2I2RE 4PCWA 4A4CA 3DVEA 2KI4C 5DKQA 1DJWA 4I5NB 1YVLA 2KYCA 2M1UA 1N0YA 3IQQA 3IQOA 4PE1A 2BECA 4GGNA 1JFKA 1K8UA 4MZLA 1SCMC 1TNXA 2L98A 4PE0A 1UURA 4ZCUA 2Y1NA 2K7BA 1HQVA 2M7NA 3M0WA 4D1EA 1H8BA 1WRKA 1PVBA 4MBEA 1RK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPT A;  3EKH A;  1F70 A;  1FW4 A;  4PAL A;  1BOD A;  2CXJ A;  1V1F A;  1ALV A;  1IGV A;  2OPO A;  3EKJ A;  1S6J A;  1UHH A;  4USL A;  1B9A A;  1NX1 A;  3EVR A;  1QAT A;  2LAN A;  4XJK A;  1KK8 B;  3TS5 B;  1DMO A;  1PVA A;  1NCZ A;  1JUO A;  1WY9 A;  1KK7 Z;  2JQ6 A;  4HSZ A;  1CDM A;  4YI9 A;  4MLW A;  1CLB A;  2BCB A;  2F3Z A;  3I5F B;  1NUB A;  1TCO B;  3LK1 A;  4ICB A;  1K9K A;  1BU3 A;  2KFH A;  3QRX A;  1KFU S;  2LP3 A;  2M3W A;  3IF7 A;  1BOC A;  1WLZ A;  2OTG C;  1KQM C;  2MHH A;  4CLN A;  1IJ6 A;  1CDN A;  5DKR A;  1GQM A;  3EVU A;  1LA3 A;  2LUC A;  1MHO A;  5HLV A;  4I5L B;  2LVI A;  1CFF A;  2ZRT A;  1FI6 A;  2LMT A;  2AMI A;  2LMV A;  1SL9 A;  3FS7 A;  1QX7 A;  5AAN A;  2PAS A;  1DGU A;  1XO5 A;  1YX8 A;  2CT9 A;  1NSH A;  2H61 C;  2JRF A;  2RGI A;  1K93 D;  1UUS A;  3GK2 A;  1F71 A;  2JOJ A;  3RM1 A;  1XFW O;  1QS7 A;  1PRW A;  3MSE B;  4MZK A;  1TTX A;  2ISD A;  2E30 A;  2MLE C;  3OHM B;  3CZT X;  3DD4 A;  1KQV A;  1J7R A;  2SCP A;  1CMG A;  5KSZ A;  4DIR A;  1KK8 C;  3PSR A;  1YUU A;  4MZJ A;  2FJU B;  4R1E A;  1JC2 A;  1MXL C;  2KAY A;  1LVC D;  2LLU A;  3VRN A;  1KWO B;  1Y1U A;  1OOJ A;  1YRU B;  1K90 D;  4HRH A;  4GGF C;  1OE9 B;  1QX2 A;  2LNK A;  4M2P A;  1CDP A;  1M63 B;  1Y1A A;  1SL7 A;  2NXQ A;  2LVV A;  3GK4 X;  1TIZ A;  2F3Y A;  4HRE E;  3ICB A;  1LA0 A;  2Q91 A;  4A4B A;  4MRY A;  3E3R A;  1L7Z A;  5CSN A;  1J7O A;  1EH2 A;  1J1D A;  1TNP A;  3RLZ A;  1OZO A;  2KFG A;  3NSL A;  1L2O B;  2BBN A;  4GBA A;  3CGA A;  1BJF A;  2WCF A;  3PM8 A;  4CFR A;  1A75 B;  1CFP A;  1EJ3 A;  2M7L A;  1QVI Z;  1KFX L;  1U5I A;  2KI4 B;  4AOM A;  1QLK A;  4PHN A;  2WOR A;  3BUW B;  4I5J A;  1OMD A;  2H2K A;  1IQ3 A;  1SCM B;  1ZOT B;  5JJG A;  4FTG A;  2MRD A;  4PHK A;  1YX7 A;  2A4J A;  1F4Q A;  1YUT A;  1DF0 A;  3A4U B;  1YUS A;  3SG2 A;  1C7W A;  3SG7 A;  1YTZ C;  1J55 A;  1CKK A;  4OR9 B;  1DJY A;  2MBX A;  1AK8 A;  5HKY A;  4DS7 A;  2ZND A;  3TZ1 A;  3OB1 B;  1N65 A;  2LVJ A;  1QXP A;  1PAL A;  2FOT A;  5CSF A;  5DKN A;  5JOL A;  4F0Z B;  1SNL A;  3KHE A;  1CM4 A;  1DGV A;  1B7T Y;  2LCP A;  1SPY A;  3CWG A;  1M46 A;  3VRR A;  4YI8 A;  1Y1X A;  4ETO A;  3I5H C;  1BLQ A;  1IH0 A;  1JSA A;  1JBA A;  1KSO A;  3BOW A;  3D0Y B;  1EXR A;  2WC8 A;  1S3P A;  2CCM A;  2G2B A;  2NLN A;  3KEV A;  2OTG B;  1KQM B;  1UHK A;  2MAZ A;  4M2Q A;  3SJS A;  3O78 A;  3FWB A;  5TNC A;  2JTT A;  1ZUZ A;  2KQY A;  2KI6 D;  1J1E A;  5KU1 A;  1B8R A;  3VRQ A;  2OS8 C;  2JWW A;  1CB1 A;  2LMU A;  3DF0 B;  2JNX A;  2KDH A;  3H4S E;  1PSB A;  1WLM A;  2BE6 A;  3TUY C;  2KAX A;  4L9M A;  2KAV A;  1Q80 A;  4YGA A;  3I5I C;  4MEW A;  5IBW A;  2ZNE A;  1AP4 A;  1K94 A;  2R2I A;  1SL8 A;  2LP2 A;  3GK1 A;  2GV5 A;  3BUN B;  5AEQ A;  2KGB C;  1IWQ A;  2BCX A;  1S5G Y;  3CS1 A;  1DJZ A;  1G8I A;  4MN0 A;  1TRF A;  3CR2 A;  1VRK A;  2Y5I A;  1PK0 D;  2BBM A;  3CLN A;  2JNF A;  2L51 A;  4I5K A;  3WXA A;  2F33 A;  2HQW A;  3SG5 A;  3OB2 B;  2Y4Q A;  1X02 A;  4JPZ B;  1CNP A;  1D1O A;  3VRP A;  2BCA A;  2TN4 A;  2I18 A;  2WCE A;  2D8N A;  2LAP A;  2K2F A;  3PFV A;  5HYD A;  4C0J A;  5FYX A;  4OKH A;  1WDC C;  1GGW A;  1TNW A;  2GGM A;  3BXK A;  3NSI A;  4UPG A;  1EL4 A;  2NZ0 A;  1AHR A;  4OVN F;  3OX5 A;  3TDU A;  4PHJ A;  1RFJ A;  2KBI A;  5HLO A;  1BG1 A;  2QAC A;  2Y1M A;  3JTD B;  2LHL A;  3EK7 A;  1K96 A;  4AQJ A;  4NDC A;  5I2Q A;  1BF5 A;  2KOT A;  1NPQ A;  4YGD B;  1FF1 A;  5K89 A;  1B8C A;  1CM1 A;  1C07 A;  1AUI B;  4XJK B;  1BMO A;  3AAK A;  1F54 A;  2DOQ A;  1ZFS A;  5GQQ C;  1QIV A;  1YVH A;  3TDI A;  1A03 A;  1C7V A;  2JU0 A;  1F4O A;  2CTN A;  2KNE A;  1RTP 1;  2PAL A;  1S36 A;  1B8L A;  5AFP A;  1B1G A;  2LVK A;  1SYM A;  3VGO A;  3BYA A;  1CFC A;  1EG3 A;  1OSA A;  2M97 A;  2PRU A;  1XFZ O;  2SAS A;  1DJI A;  3EVV A;  4PDZ A;  3ZWH A;  3I5H B;  1UP5 A;  1XFU O;  2B1U A;  4FQO A;  1IQ5 A;  2K0J A;  3DVK A;  3PN7 C;  4MSP A;  2JT3 A;  1UWO A;  4PE4 A;  5AXI A;  3JTD C;  4HRG A;  1XA5 A;  4NQG A;  1JFJ A;  3EK8 A;  1GJY A;  1BR1 B;  2KBM A;  1KSM A;  1R2U A;  2AAO A;  1KFU L;  5D69 A;  4BY4 A;  4CID A;  1QJT A;  1UHJ A;  2OS8 B;  1W7J B;  3KPX A;  1FPW A;  4C0K A;  3HCM A;  4E68 A;  2V53 A;  4N5X A;  4PE7 A;  3TUY B;  2CBL A;  2F8P A;  2O60 A;  2L4H A;  4CFQ A;  3D0Y A;  3I5G C;  1TNQ A;  1R6P A;  1SK6 D;  3ZNI A;  4MVF A;  2AUC A;  3I5I B;  1PSR A;  4GAO A;  1KK7 Y;  2LM5 A;  1NP8 A;  2EGD A;  1RRO A;  2PSR A;  3AKB A;  2NCO A;  2M1K B;  3SIA A;  4ORA B;  1G4Y R;  1JF2 A;  2LHI A;  5HKW A;  2ZN8 A;  3NSK A;  2JTZ A;  5ER4 X;  2E6W A;  2HET A;  4WRI A;  1QTX A;  3DF0 A;  5BPJ A;  1W7I B;  3TDZ A;  2JXC A;  2H61 A;  4QJ3 B;  4TNC A;  2ZFD A;  3PAT A;  3NXA A;  3K21 A;  3WHU B;  1U5I B;  5CSI A;  5HKZ A;  1J7P A;  4AQI A;  2GGZ A;  3PAL A;  2L4I A;  1WDC B;  2I7A A;  2KGR A;  2FCE A;  2WND A;  4JWQ A;  3JVT C;  4ORC B;  1DJG A;  1CLL A;  1MXE A;  1DT7 B;  1QIW A;  1DF0 B;  2KSP A;  1DTL A;  4YBH B;  1XVJ A;  1CDL A;  2L2E A;  2ZN9 A;  1XFX O;  1AJ4 A;  1DJX A;  4GUK A;  1SR6 C;  1CTR A;  3SG6 A;  2JUL A;  1B4C A;  5I8N A;  1GGZ A;  2BL0 C;  2EC6 C;  1M31 A;  1XFV O;  1WRZ A;  1QV1 A;  1DVI A;  1RJV A;  2Q4U A;  2K7D A;  4GNK B;  4Q04 A;  3BQ3 A;  5B8I B;  3AAJ A;  1FBV A;  5CPV A;  3LCP C;  1UHN A;  3OX6 A;  2I94 A;  1JWD A;  2LC5 A;  3FIA A;  5AER A;  2MJW B;  2K7C A;  3BOW B;  3KO0 A;  4YRU A;  1S6I A;  3F45 A;  2PMY A;  5D7F A;  1V1G A;  2LV7 A;  1YR5 A;  4C0L A;  1F55 A;  1OMR A;  1S6C A;  2VRG A;  3WNX B;  1NCY A;  1S1E A;  2L50 A;  1M45 A;  2JT8 A;  2NCP A;  1QVI Y;  3DVJ A;  4DRW A;  1CFD A;  1LXF C;  2O5G A;  1SRA A;  3KF9 A;  1BT6 A;  1BR4 B;  1NCX A;  3EK4 A;  2WCB A;  3SG3 A;  1CMF A;  2F2O A;  3PN7 B;  1WRL A;  4GFT A;  5CSJ A;  1CLM A;  4WQ3 A;  1PUL A;  1KFX S;  1SKT A;  1B7T Z;  3LL8 B;  1Y6W A;  4N1F A;  2IS9 A;  2MA2 A;  1JF0 A;  1IKU A;  3AKA A;  3BUX B;  4JQ0 D;  2KQ6 A;  1IJ5 A;  3CTN A;  1QX5 B;  1MF8 B;  1UHI A;  1MQ1 A;  2KYF A;  5J3X A;  3WHT B;  1KCY A;  4M2O A;  1EG4 A;  2P6B B;  2FCD A;  2G9B A;  5I2O A;  1AJ5 A;  3GOF A;  2JC2 A;  3SIB A;  1FI5 A;  1QAS A;  1DJH A;  4N1G A;  5G08 A;  1XK4 A;  3I5G B;  4ORB B;  4DUQ A;  2LLS A;  1A75 A;  2M0R A;  4DCK A;  2KFF A;  2JZI A;  1QV0 A;  3NSO A;  2HQ8 A;  4YGB B;  2JPT A;  2L5X B;  2CNP A;  4XYN A;  1MWN A;  5ER5 A;  4YGE B;  2M49 B;  1K9U A;  1IG5 A;  3FWC A;  4BY5 A;  2K8M B;  4WQ2 A;  3TS5 C;  2L0P A;  2LUX A;  4OV2 A;  4MRX A;  5KTY A;  1ALW A;  1LIN A;  2F2P A;  3DVM A;  1A4P A;  1B47 A;  1N2D A;  3A8R A;  1M39 A;  1OZS A;  3I5F C;  1S5G Z;  1AVS A;  2M29 A;  2BKH B;  2LE9 B;  2JXL A;  1SY9 A;  3CR5 X;  1NWD A;  1OMV A;  1MUX A;  3LLE A;  2K2A A;  3JVT B;  1A29 A;  3SG4 A;  2EHB A;  1A2X A;  3D10 A;  4GPL B;  3O6B A;  1K2H A;  1MR8 A;  2HF5 A;  4U8D A;  1E8A A;  2KI6 C;  4P2Y B;  3HX4 A;  1NYA A;  1K95 A;  4NDD A;  3CR4 X;  4OCI A;  5PAL A;  1SR6 B;  1NX2 A;  2LLT A;  1S26 D;  3O4Y A;  2KHN A;  2BL0 B;  1NX3 A;  1ZAC A;  4P5O E;  1ZMZ A;  2EC6 B;  4PHM A;  1K9P A;  1YRT B;  4CPV A;  1F8H A;  1ODB A;  1SW8 A;  2BE4 A;  1SMG A;  4ZCV A;  1LKJ A;  1XYD A;  1SCV A;  1XFY O;  1KWO C;  5I2L A;  1NIW A;  3PLF B;  1J7Q A;  2HPS A;  3VRO A;  1TOP A;  2PVB A;  3BUM B;  4QJ5 B;  3O2P A;  1TCF A;  1TN4 A;  4IL1 A;  2BKI B;  1QLS A;  3C1V A;  2JT0 A;  2K7O A;  1YUR A;  2M9G A;  1HT9 A;  4YGC B;  1IRJ A;  2WOS A;  2ZKM X;  1SBJ A;  2MLF C;  2ZRS A;  1RWY A;  2M8U A;  4NDB A;  1OQP A;  1H4B A;  1REC A;  2COL B;  4GGF A;  1Y0V H;  2K61 A;  3BUO B;  1L2O C;  1NX0 A;  4QJ4 B;  1G33 A;  3LK0 A;  1XK4 C;  3OP0 A;  5F6T A;  2I2R E;  4PCW A;  4A4C A;  3DVE A;  2KI4 C;  5DKQ A;  1DJW A;  4I5N B;  1YVL A;  2KYC A;  2M1U A;  1N0Y A;  3IQQ A;  3IQO A;  4PE1 A;  2BEC A;  4GGN A;  1JFK A;  1K8U A;  4MZL A;  1SCM C;  1TNX A;  2L98 A;  4PE0 A;  1UUR A;  4ZCU A;  2Y1N A;  2K7B A;  1HQV A;  2M7N A;  3M0W A;  4D1E A;  1H8B A;  1WRK A;  1PVB A;  4MBE A;  1RK9 A; 
#chains in the Genus database with same CATH topology
 2QPT A;  1XFR A;  3EKH A;  2ERB A;  5FI2 A;  3OBV A;  1F70 A;  1FW4 A;  4PAL A;  1BOD A;  2CXJ A;  1V1F A;  1ALV A;  1IGV A;  3CZ0 A;  3BFA A;  2OPO A;  3UO9 A;  3EKJ A;  1S6J A;  1UHH A;  4USL A;  5FI7 A;  1B9A A;  1NX1 A;  3EVR A;  1QAT A;  2LAN A;  4XJK A;  1KK8 B;  3TS5 B;  1DMO A;  1PVA A;  1NCZ A;  1JUO A;  1WY9 A;  1KK7 Z;  2JQ6 A;  4HSZ A;  1CDM A;  4YI9 A;  4MLW A;  1CLB A;  2BCB A;  2F3Z A;  3B6X A;  3I5F B;  1NUB A;  1TCO B;  1ORG A;  3LK1 A;  4ICB A;  1K9K A;  1BU3 A;  2KFH A;  3CAB A;  3QRX A;  1KFU S;  2LP3 A;  2M3W A;  3IF7 A;  3L47 A;  1WLZ A;  2OTG C;  1BOC A;  1KQM C;  2MHH A;  4KYN A;  4CLN A;  1IJ6 A;  1CDN A;  5DKR A;  1GQM A;  2L5Y A;  3EVU A;  1LA3 A;  2LUC A;  1MHO A;  5HLV A;  4I5L B;  2LVI A;  1CFF A;  2ZRT A;  1FI6 A;  2PYQ A;  2LMT A;  2AMI A;  2LMV A;  1SL9 A;  3FS7 A;  1QX7 A;  5AAN A;  2PAS A;  1DGU A;  1XO5 A;  1YX8 A;  2CT9 A;  1NSH A;  2H61 C;  2JRF A;  2RGI A;  1K93 D;  2WCJ A;  1UUS A;  3GK2 A;  1F71 A;  2JOJ A;  3RM1 A;  1XFW O;  1QS7 A;  1PRW A;  3MSE B;  4MZK A;  1TTX A;  2ISD A;  2E30 A;  2MLE C;  3OHM B;  3CZT X;  1Z2C B;  3DD4 A;  1KQV A;  1J7R A;  2SCP A;  1CMG A;  3NHT A;  2QEB A;  3S0B A;  5KSZ A;  4DIR A;  1KK8 C;  3PSR A;  1YUU A;  4MZJ A;  2FJU B;  4R1E A;  1JC2 A;  1MXL C;  3R1V A;  2KAY A;  1LVC D;  2LLU A;  3VRN A;  1KWO B;  1Y1U A;  3CZ1 A;  1OOJ A;  3PM2 A;  1YRU B;  1K90 D;  4HRH A;  4GGF C;  5DIC A;  3S0G A;  1OE9 B;  1QX2 A;  2LNK A;  4M2P A;  1CDP A;  1M63 B;  1Y1A A;  1SL7 A;  2NXQ A;  2LVV A;  3GK4 X;  1TIZ A;  2F3Y A;  4HRE E;  3ICB A;  1LA0 A;  2Q91 A;  4A4B A;  4MRY A;  3E3R A;  2K60 A;  1L7Z A;  3CDN A;  5CSN A;  1J7O A;  1EH2 A;  1J1D A;  1TNP A;  3RLZ A;  1OZO A;  3NGV A;  2KFG A;  3NSL A;  2WC5 A;  3S0A A;  3V2L A;  1OOH A;  1L2O B;  2BBN A;  4GBA A;  3CGA A;  1BJF A;  2WCF A;  3PM8 A;  4CFR A;  1A75 B;  1CFP A;  1EJ3 A;  2M7L A;  1QVI Z;  1KFX L;  1U5I A;  2KI4 B;  3D76 A;  1QLK A;  4PHN A;  4AOM A;  3SS5 A;  2WOR A;  1TWO A;  3BUW B;  2QEV A;  4I5J A;  1OMD A;  2H2K A;  3RZS A;  1IQ3 A;  1SCM B;  1ZOT B;  5JJG A;  4FTG A;  1T14 A;  2KLD A;  2MRD A;  3D74 A;  4PHK A;  1YX7 A;  2A4J A;  1F4Q A;  1YUT A;  1DF0 A;  3A4U B;  1YUS A;  3SG2 A;  1C7W A;  2P71 A;  1YTZ C;  1J55 A;  3SG7 A;  4OR9 B;  1DJY A;  1CKK A;  2MBX A;  1AK8 A;  5HKY A;  4PT1 A;  4DS7 A;  2ZND A;  3TZ1 A;  1QWV A;  3OB1 B;  1N65 A;  2LVJ A;  1QXP A;  1OOF A;  1PAL A;  2FOT A;  5CSF A;  5DKN A;  5JOL A;  4F0Z B;  1SNL A;  3KHE A;  1CM4 A;  1DGV A;  1B7T Y;  2LCP A;  1SPY A;  3CWG A;  1M46 A;  3VRR A;  4YI8 A;  3S0D A;  1Y1X A;  4ETO A;  3I5H C;  1BLQ A;  1IH0 A;  1JSA A;  1JBA A;  1KSO A;  3B88 A;  3BOW A;  3D0Y B;  1EXR A;  2WC8 A;  1S3P A;  2CCM A;  1P28 A;  2WCH A;  2G2B A;  2NLN A;  3KEV A;  4INW A;  2OTG B;  1KQM B;  1UHK A;  2MAZ A;  4M2Q A;  3SJS A;  3O78 A;  2L2C A;  3FWB A;  5TNC A;  2JTT A;  1ZUZ A;  2KQY A;  2KI6 D;  1J1E A;  5KU1 A;  1B8R A;  4JD9 A;  3VRQ A;  4IJ7 A;  2OS8 C;  2JWW A;  1CB1 A;  2LMU A;  3DF0 B;  2JNX A;  2KDH A;  3H4S E;  1PSB A;  1WLM A;  2BE6 A;  3TUY C;  2KAX A;  4L9M A;  2KAV A;  1Q80 A;  2YGU A;  4YGA A;  3I5I C;  1TUZ A;  4MEW A;  5IBW A;  2ZNE A;  1AP4 A;  1K94 A;  2R2I A;  1SL8 A;  2LP2 A;  3GK1 A;  3UNW A;  2GV5 A;  3BUN B;  3CYZ A;  5AEQ A;  2KGB C;  1IWQ A;  2BCX A;  1S5G Y;  3CS1 A;  1OOI X;  3B86 A;  1DJZ A;  1G8I A;  4MN0 A;  1TRF A;  3CR2 A;  1VRK A;  2Y5I A;  1PK0 D;  2BBM A;  3CLN A;  2JNF A;  3DY9 A;  2L51 A;  4I5K A;  3WXA A;  2F33 A;  2HQW A;  3SG5 A;  5I94 A;  3OB2 B;  2Y4Q A;  1X02 A;  4JPZ B;  1CNP A;  1D1O A;  3VRP A;  2BCA A;  2TN4 A;  2I18 A;  2KPH A;  2D8N A;  2LAP A;  2WCE A;  2K2F A;  5FI6 A;  3PFV A;  5HYD A;  4C0J A;  5FYX A;  4OKH A;  1WDC C;  1GGW A;  1TNW A;  2GGM A;  3BXK A;  3NSI A;  4UPG A;  1EL4 A;  1SSE B;  2NZ0 A;  3D73 A;  1AHR A;  4OVN F;  3OX5 A;  3TDU A;  4PHJ A;  1RFJ A;  2KBI A;  5HLO A;  1BG1 A;  2QAC A;  2Y1M A;  3JTD B;  2LHL A;  3EK7 A;  1K96 A;  4AQJ A;  4NDC A;  5I2Q A;  1BF5 A;  2KOT A;  1NPQ A;  4YGD B;  2WCL A;  5HL1 A;  1FF1 A;  5K89 A;  1B8C A;  1CM1 A;  1C07 A;  1AUI B;  4XJK B;  1BMO A;  3AAK A;  1F54 A;  2DOQ A;  1ZFS A;  5GQQ C;  1QIV A;  3R1P A;  1YVH A;  3TDI A;  1A03 A;  1C7V A;  3B87 A;  1DC1 A;  2JU0 A;  1F4O A;  2CTN A;  3BJH A;  2KNE A;  1RTP 1;  2BAP A;  2KLE A;  2PAL A;  1S36 A;  1B8L A;  5AFP A;  1B1G A;  2LVK A;  1SYM A;  3VGO A;  3BYA A;  1CFC A;  1EG3 A;  1OSA A;  2M97 A;  2P70 A;  2PRU A;  4INX A;  1XFZ O;  2SAS A;  1LS8 A;  1DJI A;  3EVV A;  4PDZ A;  3ZWH A;  3I5H B;  1UP5 A;  1XFU O;  2B1U A;  4FQO A;  1IQ5 A;  2K0J A;  3DVK A;  3PN7 C;  4MSP A;  2JT3 A;  1UWO A;  3L4A A;  4PE4 A;  3JTD C;  4HRG A;  5AXI A;  1XA5 A;  4NQG A;  4JKT A;  1JFJ A;  3EK8 A;  1GJY A;  1BR1 B;  2KBM A;  1KSM A;  2QEO A;  1R2U A;  2AAO A;  1KFU L;  5D69 A;  1Z4H A;  4BY4 A;  4CID A;  2QEH A;  1QJT A;  1UHJ A;  2OS8 B;  1W7J B;  3KPX A;  1FPW A;  3QME A;  4C0K A;  3HCM A;  4E68 A;  2V53 A;  4N5X A;  4PE7 A;  3TUY B;  2CBL A;  2F8P A;  2O60 A;  2L4H A;  4CFQ A;  3D0Y A;  3I5G C;  1TNQ A;  1R6P A;  1SK6 D;  3ZNI A;  3SS4 A;  4MVF A;  2AUC A;  3I5I B;  1PSR A;  4GAO A;  1KK7 Y;  2LM5 A;  1NP8 A;  2EGD A;  1RRO A;  2PSR A;  4FQT A;  3AKB A;  2NCO A;  2M1K B;  3SIA A;  4ORA B;  1G4Y R;  1JF2 A;  2LHI A;  5HKW A;  2ZN8 A;  3NSK A;  2JTZ A;  5ER4 X;  2E6W A;  2HET A;  4WRI A;  1QTX A;  3DF0 A;  5BPJ A;  1W7I B;  3TDZ A;  2JXC A;  2H61 A;  3NHI A;  4QJ3 B;  4TNC A;  2ZFD A;  3PAT A;  3NXA A;  3K21 A;  3WHU B;  1U5I B;  5CSI A;  5HKZ A;  1J7P A;  2H8V A;  4AQI A;  2GGZ A;  3PAL A;  2L4I A;  1WDC B;  3EG5 B;  2I7A A;  2KGR A;  2FCE A;  2WND A;  4JWQ A;  3SS3 A;  3JVT C;  4ORC B;  1DJG A;  1CLL A;  1MXE A;  1DT7 B;  1QIW A;  1DF0 B;  2KSP A;  1DTL A;  4YBH B;  1XVJ A;  1CDL A;  2L2E A;  2ZN9 A;  1XFX O;  3L4L A;  1AJ4 A;  1DJX A;  4GUK A;  1DQE A;  1DEK A;  3D77 A;  1SR6 C;  1CTR A;  3R1O A;  3SG6 A;  2JUL A;  1OOG A;  1B4C A;  3B7A A;  5I8N A;  1GGZ A;  2BL0 C;  3D78 A;  2EC6 C;  1M31 A;  1XFV O;  1WRZ A;  1QV1 A;  1DVI A;  1RJV A;  2Q4U A;  3CZ2 A;  3FE8 A;  5EL2 A;  2K7D A;  4F7F A;  4GNK B;  4Q04 A;  3BQ3 A;  4OZD A;  5B8I B;  3AAJ A;  1FBV A;  5CPV A;  3LCP C;  2WC6 A;  1UHN A;  3OX6 A;  2I94 A;  1JWD A;  2LC5 A;  3FIA A;  5AER A;  2MJW B;  2K7C A;  3BOW B;  3KO0 A;  4YRU A;  1S6I A;  3F45 A;  2PMY A;  5D7F A;  1V1G A;  2LV7 A;  1YR5 A;  4C0L A;  1C3Z A;  1F55 A;  1OMR A;  1S6C A;  2VRG A;  3WNX B;  1NCY A;  1S1E A;  2L50 A;  1M45 A;  2JT8 A;  2NCP A;  1QVI Y;  3DVJ A;  4DRW A;  1CFD A;  1LXF C;  2O5G A;  1SRA A;  3KF9 A;  1BT6 A;  1BR4 B;  1NCX A;  3EK4 A;  2WCB A;  3SG3 A;  1CMF A;  2F2O A;  3PN7 B;  1WRL A;  4GFT A;  5CSJ A;  1CLM A;  4WQ3 A;  1PUL A;  3D75 A;  1KFX S;  1SKT A;  1GM0 A;  1B7T Z;  3LL8 B;  1Y6W A;  4N1F A;  2IS9 A;  2MA2 A;  1JF0 A;  1IKU A;  3AKA A;  3BUX B;  4JQ0 D;  2KQ6 A;  1IJ5 A;  3CTN A;  3DZT A;  1QX5 B;  1MF8 B;  1UHI A;  1MQ1 A;  2KYF A;  5J3X A;  3WHT B;  1KCY A;  4M2O A;  1EG4 A;  2P6B B;  2FCD A;  2G9B A;  5I2O A;  1AJ5 A;  3GOF A;  2JC2 A;  3SIB A;  1FI5 A;  1QAS A;  1DJH A;  4N1G A;  5G08 A;  1XK4 A;  3I5G B;  4ORB B;  4DUQ A;  3BFB A;  2LLS A;  1A75 A;  2M0R A;  2WCK A;  4DCK A;  2KFF A;  2JZI A;  1QV0 A;  3NSO A;  3O4X A;  3PJI A;  2HQ8 A;  4YGB B;  2JPT A;  2L5X B;  2CNP A;  4XYN A;  1MWN A;  5ER5 A;  4YGE B;  2M49 B;  1K9U A;  1IG5 A;  3FWC A;  4BY5 A;  2K8M B;  4WQ2 A;  3TS5 C;  2L0P A;  2LUX A;  4OV2 A;  4MRX A;  5KTY A;  1ALW A;  1LIN A;  2F2P A;  3DVM A;  1A4P A;  1B47 A;  1N2D A;  3S0E A;  3A8R A;  3BFH A;  1M39 A;  1OZS A;  3I5F C;  1S5G Z;  1AVS A;  2M29 A;  2BKH B;  2LE9 B;  2JXL A;  1SY9 A;  3CR5 X;  1NWD A;  1OMV A;  1MUX A;  3LLE A;  2K2A A;  3JVT B;  1A29 A;  3SG4 A;  2EHB A;  1A2X A;  3D10 A;  3K1E A;  4GPL B;  3O6B A;  1K2H A;  3VB1 A;  1MR8 A;  2HF5 A;  4U8D A;  1E8A A;  2KI6 C;  4P2Y B;  3HX4 A;  1NYA A;  1K95 A;  4NDD A;  3CR4 X;  4OCI A;  5PAL A;  1SR6 B;  1NX2 A;  2JPO A;  2BNX A;  2LLT A;  1S26 D;  1OW4 A;  3O4Y A;  3S0F A;  2KHN A;  2BL0 B;  1NX3 A;  1ZAC A;  2WCM A;  4P5O E;  1ZMZ A;  2EC6 B;  4PHM A;  1K9P A;  1YRT B;  4CPV A;  1F8H A;  1TUJ A;  1ODB A;  1SW8 A;  2BE4 A;  1SMG A;  4ZCV A;  1LKJ A;  1XYD A;  1SCV A;  1XFY O;  1KWO C;  5I2L A;  3IVT A;  1NIW A;  3PLF B;  1J7Q A;  2HPS A;  3R72 A;  3VRO A;  1TOP A;  2PVB A;  3BUM B;  4QJ5 B;  3O2P A;  1IIO A;  1TCF A;  1TN4 A;  4IL1 A;  2BKI B;  1QLS A;  3C1V A;  2JT0 A;  2K7O A;  1YUR A;  2M9G A;  1HT9 A;  4YGC B;  1IRJ A;  2WOS A;  2ZKM X;  1SBJ A;  2MLF C;  2ZRS A;  1RWY A;  1DEL A;  2M8U A;  3Q8I A;  4NDB A;  1OQP A;  1C3Y A;  1H4B A;  1REC A;  2COL B;  2PQL A;  4GGF A;  1Y0V H;  2K61 A;  3BUO B;  1L2O C;  1NX0 A;  4QJ4 B;  1G33 A;  3FE9 A;  1XK4 C;  3LK0 A;  3OP0 A;  5D3O A;  5F6T A;  2I2R E;  4PCW A;  4A4C A;  1W9Z A;  3OGN A;  3DVE A;  3FE6 A;  2KI4 C;  5DKQ A;  1DJW A;  4I5N B;  1YVL A;  2KYC A;  2M1U A;  1N0Y A;  3IQQ A;  3IQO A;  3N7H A;  4PE1 A;  2BEC A;  4GGN A;  2GTE A;  1JFK A;  1K8U A;  4MZL A;  1SCM C;  1TNX A;  2L98 A;  3DXL A;  4PE0 A;  2QDI A;  3DYE A;  1UUR A;  4ZCU A;  2Y1N A;  2K7B A;  1HQV A;  2M7N A;  3M0W A;  4D1E A;  1H8B A;  1WRK A;  2FJY A;  1PVB A;  4MBE A;  1RK9 A; 
#chains in the Genus database with same CATH homology
 2QPT A;  3EKH A;  1F70 A;  1FW4 A;  4PAL A;  1BOD A;  2CXJ A;  1V1F A;  1ALV A;  1IGV A;  2OPO A;  3EKJ A;  1S6J A;  1UHH A;  4USL A;  1B9A A;  1NX1 A;  3EVR A;  1QAT A;  2LAN A;  4XJK A;  1KK8 B;  3TS5 B;  1DMO A;  1PVA A;  1NCZ A;  1JUO A;  1WY9 A;  1KK7 Z;  2JQ6 A;  4HSZ A;  1CDM A;  4YI9 A;  4MLW A;  1CLB A;  2BCB A;  2F3Z A;  3I5F B;  1NUB A;  1TCO B;  3LK1 A;  4ICB A;  1K9K A;  1BU3 A;  2KFH A;  3QRX A;  1KFU S;  2LP3 A;  2M3W A;  3IF7 A;  1BOC A;  1WLZ A;  2OTG C;  1KQM C;  2MHH A;  4CLN A;  1IJ6 A;  1CDN A;  5DKR A;  1GQM A;  3EVU A;  1LA3 A;  2LUC A;  1MHO A;  5HLV A;  4I5L B;  2LVI A;  1CFF A;  2ZRT A;  1FI6 A;  2LMT A;  2AMI A;  2LMV A;  1SL9 A;  3FS7 A;  1QX7 A;  5AAN A;  2PAS A;  1DGU A;  1XO5 A;  1YX8 A;  2CT9 A;  1NSH A;  2H61 C;  2JRF A;  2RGI A;  1K93 D;  1UUS A;  3GK2 A;  1F71 A;  2JOJ A;  3RM1 A;  1XFW O;  1QS7 A;  1PRW A;  3MSE B;  4MZK A;  1TTX A;  2ISD A;  2E30 A;  2MLE C;  3OHM B;  3CZT X;  3DD4 A;  1KQV A;  1J7R A;  2SCP A;  1CMG A;  5KSZ A;  4DIR A;  1KK8 C;  3PSR A;  1YUU A;  4MZJ A;  2FJU B;  4R1E A;  1JC2 A;  1MXL C;  2KAY A;  1LVC D;  2LLU A;  3VRN A;  1KWO B;  1Y1U A;  1OOJ A;  1YRU B;  1K90 D;  4HRH A;  4GGF C;  1OE9 B;  1QX2 A;  2LNK A;  4M2P A;  1CDP A;  1M63 B;  1Y1A A;  1SL7 A;  2NXQ A;  2LVV A;  3GK4 X;  1TIZ A;  2F3Y A;  4HRE E;  3ICB A;  1LA0 A;  2Q91 A;  4A4B A;  4MRY A;  3E3R A;  1L7Z A;  5CSN A;  1J7O A;  1EH2 A;  1J1D A;  1TNP A;  3RLZ A;  1OZO A;  2KFG A;  3NSL A;  1L2O B;  2BBN A;  4GBA A;  3CGA A;  1BJF A;  2WCF A;  3PM8 A;  4CFR A;  1A75 B;  1CFP A;  1EJ3 A;  2M7L A;  1QVI Z;  1KFX L;  1U5I A;  2KI4 B;  4AOM A;  1QLK A;  4PHN A;  2WOR A;  3BUW B;  4I5J A;  1OMD A;  2H2K A;  1IQ3 A;  1SCM B;  1ZOT B;  5JJG A;  4FTG A;  2MRD A;  4PHK A;  1YX7 A;  2A4J A;  1F4Q A;  1YUT A;  1DF0 A;  3A4U B;  1YUS A;  3SG2 A;  1C7W A;  3SG7 A;  1YTZ C;  1J55 A;  1CKK A;  4OR9 B;  1DJY A;  2MBX A;  1AK8 A;  5HKY A;  4DS7 A;  2ZND A;  3TZ1 A;  3OB1 B;  1N65 A;  2LVJ A;  1QXP A;  1PAL A;  2FOT A;  5CSF A;  5DKN A;  5JOL A;  4F0Z B;  1SNL A;  3KHE A;  1CM4 A;  1DGV A;  1B7T Y;  2LCP A;  1SPY A;  3CWG A;  1M46 A;  3VRR A;  4YI8 A;  1Y1X A;  4ETO A;  3I5H C;  1BLQ A;  1IH0 A;  1JSA A;  1JBA A;  1KSO A;  3BOW A;  3D0Y B;  1EXR A;  2WC8 A;  1S3P A;  2CCM A;  2G2B A;  2NLN A;  3KEV A;  2OTG B;  1KQM B;  1UHK A;  2MAZ A;  4M2Q A;  3SJS A;  3O78 A;  3FWB A;  5TNC A;  2JTT A;  1ZUZ A;  2KQY A;  2KI6 D;  1J1E A;  5KU1 A;  1B8R A;  3VRQ A;  2OS8 C;  2JWW A;  1CB1 A;  2LMU A;  3DF0 B;  2JNX A;  2KDH A;  3H4S E;  1PSB A;  1WLM A;  2BE6 A;  3TUY C;  2KAX A;  4L9M A;  2KAV A;  1Q80 A;  4YGA A;  3I5I C;  4MEW A;  5IBW A;  2ZNE A;  1AP4 A;  1K94 A;  2R2I A;  1SL8 A;  2LP2 A;  3GK1 A;  2GV5 A;  3BUN B;  5AEQ A;  2KGB C;  1IWQ A;  2BCX A;  1S5G Y;  3CS1 A;  1DJZ A;  1G8I A;  4MN0 A;  1TRF A;  3CR2 A;  1VRK A;  2Y5I A;  1PK0 D;  2BBM A;  3CLN A;  2JNF A;  2L51 A;  4I5K A;  3WXA A;  2F33 A;  2HQW A;  3SG5 A;  3OB2 B;  2Y4Q A;  1X02 A;  4JPZ B;  1CNP A;  1D1O A;  3VRP A;  2BCA A;  2TN4 A;  2I18 A;  2WCE A;  2D8N A;  2LAP A;  2K2F A;  3PFV A;  5HYD A;  4C0J A;  5FYX A;  4OKH A;  1WDC C;  1GGW A;  1TNW A;  2GGM A;  3BXK A;  3NSI A;  4UPG A;  1EL4 A;  2NZ0 A;  1AHR A;  4OVN F;  3OX5 A;  3TDU A;  4PHJ A;  1RFJ A;  2KBI A;  5HLO A;  1BG1 A;  2QAC A;  2Y1M A;  3JTD B;  2LHL A;  3EK7 A;  1K96 A;  4AQJ A;  4NDC A;  5I2Q A;  1BF5 A;  2KOT A;  1NPQ A;  4YGD B;  1FF1 A;  5K89 A;  1B8C A;  1CM1 A;  1C07 A;  1AUI B;  4XJK B;  1BMO A;  3AAK A;  1F54 A;  2DOQ A;  1ZFS A;  5GQQ C;  1QIV A;  1YVH A;  3TDI A;  1A03 A;  1C7V A;  2JU0 A;  1F4O A;  2CTN A;  2KNE A;  1RTP 1;  2PAL A;  1S36 A;  1B8L A;  5AFP A;  1B1G A;  2LVK A;  1SYM A;  3VGO A;  3BYA A;  1CFC A;  1EG3 A;  1OSA A;  2M97 A;  2PRU A;  1XFZ O;  2SAS A;  1DJI A;  3EVV A;  4PDZ A;  3ZWH A;  3I5H B;  1UP5 A;  1XFU O;  2B1U A;  4FQO A;  1IQ5 A;  2K0J A;  3DVK A;  3PN7 C;  4MSP A;  2JT3 A;  1UWO A;  4PE4 A;  5AXI A;  3JTD C;  4HRG A;  1XA5 A;  4NQG A;  1JFJ A;  3EK8 A;  1GJY A;  1BR1 B;  2KBM A;  1KSM A;  1R2U A;  2AAO A;  1KFU L;  5D69 A;  4BY4 A;  4CID A;  1QJT A;  1UHJ A;  2OS8 B;  1W7J B;  3KPX A;  1FPW A;  4C0K A;  3HCM A;  4E68 A;  2V53 A;  4N5X A;  4PE7 A;  3TUY B;  2CBL A;  2F8P A;  2O60 A;  2L4H A;  4CFQ A;  3D0Y A;  3I5G C;  1TNQ A;  1R6P A;  1SK6 D;  3ZNI A;  4MVF A;  2AUC A;  3I5I B;  1PSR A;  4GAO A;  1KK7 Y;  2LM5 A;  1NP8 A;  2EGD A;  1RRO A;  2PSR A;  3AKB A;  2NCO A;  2M1K B;  3SIA A;  4ORA B;  1G4Y R;  1JF2 A;  2LHI A;  5HKW A;  2ZN8 A;  3NSK A;  2JTZ A;  5ER4 X;  2E6W A;  2HET A;  4WRI A;  1QTX A;  3DF0 A;  5BPJ A;  1W7I B;  3TDZ A;  2JXC A;  2H61 A;  4QJ3 B;  4TNC A;  2ZFD A;  3PAT A;  3NXA A;  3K21 A;  3WHU B;  1U5I B;  5CSI A;  5HKZ A;  1J7P A;  4AQI A;  2GGZ A;  3PAL A;  2L4I A;  1WDC B;  2I7A A;  2KGR A;  2FCE A;  2WND A;  4JWQ A;  3JVT C;  4ORC B;  1DJG A;  1CLL A;  1MXE A;  1DT7 B;  1QIW A;  1DF0 B;  2KSP A;  1DTL A;  4YBH B;  1XVJ A;  1CDL A;  2L2E A;  2ZN9 A;  1XFX O;  1AJ4 A;  1DJX A;  4GUK A;  1SR6 C;  1CTR A;  3SG6 A;  2JUL A;  1B4C A;  5I8N A;  1GGZ A;  2BL0 C;  2EC6 C;  1M31 A;  1XFV O;  1WRZ A;  1QV1 A;  1DVI A;  1RJV A;  2Q4U A;  2K7D A;  4GNK B;  4Q04 A;  3BQ3 A;  5B8I B;  3AAJ A;  1FBV A;  5CPV A;  3LCP C;  1UHN A;  3OX6 A;  2I94 A;  1JWD A;  2LC5 A;  3FIA A;  5AER A;  2MJW B;  2K7C A;  3BOW B;  3KO0 A;  4YRU A;  1S6I A;  3F45 A;  2PMY A;  5D7F A;  1V1G A;  2LV7 A;  1YR5 A;  4C0L A;  1F55 A;  1OMR A;  1S6C A;  2VRG A;  3WNX B;  1NCY A;  1S1E A;  2L50 A;  1M45 A;  2JT8 A;  2NCP A;  1QVI Y;  3DVJ A;  4DRW A;  1CFD A;  1LXF C;  2O5G A;  1SRA A;  3KF9 A;  1BT6 A;  1BR4 B;  1NCX A;  3EK4 A;  2WCB A;  3SG3 A;  1CMF A;  2F2O A;  3PN7 B;  1WRL A;  4GFT A;  5CSJ A;  1CLM A;  4WQ3 A;  1PUL A;  1KFX S;  1SKT A;  1B7T Z;  3LL8 B;  1Y6W A;  4N1F A;  2IS9 A;  2MA2 A;  1JF0 A;  1IKU A;  3AKA A;  3BUX B;  4JQ0 D;  2KQ6 A;  1IJ5 A;  3CTN A;  1QX5 B;  1MF8 B;  1UHI A;  1MQ1 A;  2KYF A;  5J3X A;  3WHT B;  1KCY A;  4M2O A;  1EG4 A;  2P6B B;  2FCD A;  2G9B A;  5I2O A;  1AJ5 A;  3GOF A;  2JC2 A;  3SIB A;  1FI5 A;  1QAS A;  1DJH A;  4N1G A;  5G08 A;  1XK4 A;  3I5G B;  4ORB B;  4DUQ A;  2LLS A;  1A75 A;  2M0R A;  4DCK A;  2KFF A;  2JZI A;  1QV0 A;  3NSO A;  2HQ8 A;  4YGB B;  2JPT A;  2L5X B;  2CNP A;  4XYN A;  1MWN A;  5ER5 A;  4YGE B;  2M49 B;  1K9U A;  1IG5 A;  3FWC A;  4BY5 A;  2K8M B;  4WQ2 A;  3TS5 C;  2L0P A;  2LUX A;  4OV2 A;  4MRX A;  5KTY A;  1ALW A;  1LIN A;  2F2P A;  3DVM A;  1A4P A;  1B47 A;  1N2D A;  3A8R A;  1M39 A;  1OZS A;  3I5F C;  1S5G Z;  1AVS A;  2M29 A;  2BKH B;  2LE9 B;  2JXL A;  1SY9 A;  3CR5 X;  1NWD A;  1OMV A;  1MUX A;  3LLE A;  2K2A A;  3JVT B;  1A29 A;  3SG4 A;  2EHB A;  1A2X A;  3D10 A;  4GPL B;  3O6B A;  1K2H A;  1MR8 A;  2HF5 A;  4U8D A;  1E8A A;  2KI6 C;  4P2Y B;  3HX4 A;  1NYA A;  1K95 A;  4NDD A;  3CR4 X;  4OCI A;  5PAL A;  1SR6 B;  1NX2 A;  2LLT A;  1S26 D;  3O4Y A;  2KHN A;  2BL0 B;  1NX3 A;  1ZAC A;  4P5O E;  1ZMZ A;  2EC6 B;  4PHM A;  1K9P A;  1YRT B;  4CPV A;  1F8H A;  1ODB A;  1SW8 A;  2BE4 A;  1SMG A;  4ZCV A;  1LKJ A;  1XYD A;  1SCV A;  1XFY O;  1KWO C;  5I2L A;  1NIW A;  3PLF B;  1J7Q A;  2HPS A;  3VRO A;  1TOP A;  2PVB A;  3BUM B;  4QJ5 B;  3O2P A;  1TCF A;  1TN4 A;  4IL1 A;  2BKI B;  1QLS A;  3C1V A;  2JT0 A;  2K7O A;  1YUR A;  2M9G A;  1HT9 A;  4YGC B;  1IRJ A;  2WOS A;  2ZKM X;  1SBJ A;  2MLF C;  2ZRS A;  1RWY A;  2M8U A;  4NDB A;  1OQP A;  1H4B A;  1REC A;  2COL B;  4GGF A;  1Y0V H;  2K61 A;  3BUO B;  1L2O C;  1NX0 A;  4QJ4 B;  1G33 A;  3LK0 A;  1XK4 C;  3OP0 A;  5F6T A;  2I2R E;  4PCW A;  4A4C A;  3DVE A;  2KI4 C;  5DKQ A;  1DJW A;  4I5N B;  1YVL A;  2KYC A;  2M1U A;  1N0Y A;  3IQQ A;  3IQO A;  4PE1 A;  2BEC A;  4GGN A;  1JFK A;  1K8U A;  4MZL A;  1SCM C;  1TNX A;  2L98 A;  4PE0 A;  1UUR A;  4ZCU A;  2Y1N A;  2K7B A;  1HQV A;  2M7N A;  3M0W A;  4D1E A;  1H8B A;  1WRK A;  1PVB A;  4MBE A;  1RK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...