2Y5IA

S100z from zebrafish in complex with calcium
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
97
structure length
97
Chain Sequence
SKLEGAMDALITVFHNYSGSEGDKYKLSKGELKELLNAELTDFLMSQKDPMLVEKIMNDLDSNKDNEVDFNEFVVLVAALTVACNDFFQEQQKKRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Zebrafish S100Z: Implications for Calcium-Promoted S100 Protein Oligomerisation.
pubmed doi rcsb
source organism Danio rerio
molecule tags Metal binding protein
molecule keywords S100 CALCIUM BINDING PROTEIN Z
total genus 39
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2y5iA00
3TZ1A 2Y1MA 3EKJA 2FJUB 5IBWA 1DTLA 1SRAA 1K9PA 3FWCA 1QX7A 2LMUA 4MLWA 2ZRSA 1EXRA 2KI6D 1LA0A 3OP0A 3EVUA 3OB2B 3SG2A 1IQ5A 5AFPA 1SR6B 1H8BA 1ZUZA 2KGRA 1M63B 1R6PA 1DF0A 3AKAA 1QV1A 1F70A 5AERA 2JZIA 1KQMB 1YRUB 2KBIA 1DT7B 1SCVA 2EGDA 3ZNIA 1CM4A 5D7FA 2OS8B 2R2IA 1FI6A 2JQ6A 5TNCA 3RM1A 1IJ6A 1K2HA 1ALWA 3D0YB 2LLUA 1GGZA 4AQJA 1UHKA 1Y1UA 1KFXL 3CTNA 1KWOC 1CFFA 2L4IA 2KFFA 1B7TY 1ZFSA 3DF0B 2LHIA 2P6BB 1PSRA 1HQVA 5CSFA 1MUXA 2K7CA 1A29A 1SNLA 1QTXA 1Y1XA 4MN0A 2Y5IA 2MHHA 3BUWB 2KYFA 4D1EA 1NSHA 4FQOA 5J3XA 1D1OA 2LHLA 4MRYA 1LINA 4MZJA 5HKWA 1XFWO 1YVLA 1SCMC 3JTDB 2KDHA 1KQVA 2WCFA 4QJ4B 3JVTC 1RK9A 4P2YB 4ORAB 4I5JA 2K8MB 4OV2A 4NDDA 2BE6A 1RTP1 1YUSA 2BBMA 2L0PA 5G08A 1QV0A 2LUCA 1BT6A 2JC2A 4Q04A 4U8DA 2MRDA 1JF0A 1QATA 1SPYA 3EVRA 5CSIA 1EL4A 1OQPA 3PLFB 2K2FA 3AAKA 2CTNA 1AVSA 2E6WA 2MA2A 1W7IB 3SIAA 3ZWHA 1BU3A 3IF7A 2M7LA 1PRWA 2Q4UA 1GGWA 2JOJA 3I5HB 2M1UA 2LCPA 4F0ZB 2KGBC 3EVVA 3IQQA 2BCAA 3D10A 2LMTA 1DJYA 4N5XA 1KSMA 2LV7A 4CPVA 1OZOA 2KHNA 2LP2A 3BUOB 4OVNF 1L7ZA 3EK7A 1PK0D 4A4CA 3SIBA 4DS7A 1PVAA 4YGBB 2AAOA 1AJ5A 4MBEA 4I5LB 3DVJA 1NIWA 3GK4X 4MVFA 1BJFA 5AANA 1CMGA 2K0JA 4MZLA 5I2OA 4ZCUA 1A4PA 2MLFC 3PN7C 1UHJA 5AEQA 4YI9A 1BF5A 3E3RA 3LLEA 3DF0A 3LL8B 1K9UA 1IG5A 1UURA 2JXLA 1NX0A 2ZKMX 2LP3A 1NPQA 1DJIA 1NYAA 2PASA 2RGIA 1B1GA 2EHBA 1EH2A 2PRUA 1KQMC 2JPTA 1YR5A 4JQ0D 3GK2A 4JWQA 2FOTA 1IWQA 1KK7Y 2V53A 2AMIA 1CLBA 1B8CA 1NWDA 1S6JA 1WRLA 2KFGA 1J55A 2NCOA 3DVEA 4DCKA 1MQ1A 3JTDC 1K8UA 1QIVA 2BECA 2PMYA 4PALA 4PHMA 1SL9A 1TNXA 1KFUS 1V1FA 3TS5C 1XA5A 1DVIA 1WDCC 5PALA 4ICBA 1G8IA 1TOPA 2QACA 1Y6WA 1S26D 4N1GA 1RJVA 3CGAA 3O2PA 1N65A 1B9AA 1CKKA 2KYCA 2LNKA 2JULA 3O78A 1FBVA 3OX5A 2Y1NA 1NCYA 2H2KA 4BY4A 1JFJA 4M2OA 3PALA 3VRPA 1S6CA 2Q91A 3VROA 4CFRA 1NUBA 3I5IB 1MR8A 3H4SE 1QS7A 2ZFDA 5DKQA 2M8UA 4NDBA 1TCOB 2F2OA 2LM5A 4XJKA 3CLNA 4AOMA 4DRWA 1M46A 1AJ4A 1F54A 2CCMA 3NSOA 3PM8A 2NXQA 4YGDB 1WDCB 3I5HC 4XJKB 1OZSA 1SR6C 2MAZA 5KTYA 1RROA 1TNQA 2L50A 4OKHA 2WOSA 3AAJA 1RWYA 1M39A 3NXAA 2OTGB 1PVBA 3RLZA 4QJ5B 1NX1A 3BYAA 1NCZA 1B4CA 1YX7A 2G2BA 2BL0C 2OS8C 4PHNA 2MJWB 4WQ2A 2LUXA 2WCEA 2M29A 2PSRA 4NDCA 2KAVA 1DJXA 2LLSA 4I5KA 4YRUA 1B8RA 3FWBA 4OR9B 2GV5A 3BXKA 3KHEA 1Y0VH 1C7WA 1Y1AA 1NCXA 4PHKA 5AXIA 3VRNA 1WLZA 3F45A 3M0WA 2BKIB 1U5IB 3CZTX 2K61A 1DJHA 1S5GZ 1AP4A 2GGMA 2BL0B 3DVMA 2M49B 1ZMZA 4CIDA 3EKHA 4UPGA 1PALA 3VRRA 3GK1A 1GQMA 1QLKA 2L51A 2O5GA 1SW8A 2KI4B 1S36A 4DUQA 1J7PA 2O60A 1XYDA 3TS5B 1XVJA 4C0KA 3BUMB 1BR1B 2GGZA 3SG7A 1LVCD 1LXFC 2HQWA 1NX2A 3LCPC 5I8NA 1XK4A 1YTZC 3TUYC 2BCXA 1F71A 1KFUL 1QIWA 2K7OA 2JNFA 1SBJA 1KFXS 4HSZA 1OOJA 1TTXA 2LMVA 3EK8A 1XFUO 2NZ0A 1K96A 1TNPA 2M9GA 1FW4A 3ICBA 1EG4A 1FF1A 1UP5A 3PN7B 2AUCA 1CDMA 2LVJA 2IS9A 1PSBA 1UHNA 2VRGA 3A8RA 4ORCB 1JBAA 1QJTA 4GFTA 1UHHA 4C0JA 1WY9A 1AHRA 5CSNA 1U5IA 2WC8A 1BOCA 3KF9A 1S5GY 1CB1A 4E68A 1BG1A 1IRJA 5HLVA 2BCBA 1FPWA 3MSEB 2JU0A 1DJWA 1CLMA 1JSAA 1LA3A 1L2OC 2WNDA 4P5OE 1TIZA 1TRFA 1LKJA 3O4YA 1K95A 2LVIA 4PDZA 1OE9B 1RECA 5DKNA 1JWDA 4OCIA 1AUIB 1YUTA 3OB1B 5HYDA 3KPXA 2NLNA 3K21A 1R2UA 1KK8C 2KSPA 1OSAA 4GAOA 2CXJA 4PE4A 2E30A 1IGVA 1QVIY 3GOFA 3I5GC 3TDIA 3DD4A 1SKTA 1K94A 3WHTB 3NSLA 1J7RA 5I2LA 1QASA 1CFDA 1K90D 2BE4A 1ZACA 2JNXA 2K2AA 2F33A 3FIAA 5HKZA 1JFKA 2MLEC 4HREE 2PALA 4IL1A 4YGCB 1EJ3A 4M2PA 2PVBA 1JF2A 2Y4QA 1BMOA 2ZRTA 2JTTA 2ZNDA 2ZNEA 1K93D 1N0YA 5HLOA 2QPTA 2HPSA 2F2PA 2LAPA 4HRGA 3I5FC 4GNKB 4M2QA 3A4UB 2MBXA 2EC6C 2M97A 1C7VA 4USLA 1YVHA 1EG3A 3TDZA 2A4JA 1XFZO 2H61A 1QX5B 2SCPA 4TNCA 3SG4A 1WLMA 2JXCA 1KSOA 1CDLA 4GPLB 4JPZB 4DIRA 3AKBA 3DVKA 1IH0A 1SYMA 4NQGA 1A75A 2LVVA 1H4BA 3OX6A 3OHMB 1QX2A 1DMOA 2JTZA 4XYNA 1MWNA 2BKHB 1BR4B 1QLSA 2F3YA 1DJGA 1SL8A 1A03A 3C1VA 4WQ3A 4YGAA 4ETOA 2KAXA 3CWGA 3I5GB 4MSPA 1WRKA 2WORA 1OMDA 1B7TZ 2I2RE 2TN4A 2KNEA 2H61C 3SJSA 1FI5A 4PE1A 1CDNA 4MEWA 2DOQA 2FCDA 1G4YR 2KQ6A 1RFJA 1W7JB 2CNPA 1CDPA 2SASA 1NX3A 1L2OB 3CR4X 5ER4X 3SG6A 1C07A 1M45A 4GGFA 1BODA 1CLLA 1TNWA 1DGUA 1CM1A 3LK0A 5BPJA 1S6IA 2KOTA 2KFHA 2OTGC 1YRTB 3NSIA 1ALVA 5JOLA 2JT3A 2I94A 3EK4A 1XFXO 4ORBB 1AK8A 3LK1A 2KAYA 4YI8A 1CFPA 3FS7A 1CNPA 1KWOB 3HX4A 2OPOA 1XFVO 2M0RA 1S1EA 5JJGA 4FTGA 1MXLC 5CPVA 4I5NB 2BBNA 2M1KB 3NSKA 3JVTB 1VRKA 4R1EA 4CFQA 1J7QA 2LC5A 1QXPA 2FCEA 2I7AA 1GJYA 3PSRA 3IQOA 1TN4A 1UWOA 1ZOTB 4PE7A 1SMGA 3CS1A 5GQQC 3VGOA 1J7OA 4A4BA 3I5FB 3KO0A 1PULA 1YX8A 1SCMB 3BOWA 2WCBA 1DJZA 1X02A 1XO5A 2L2EA 3QRXA 2KQYA 4GGNA 2ISDA 3BUNB 1N2DA 5FYXA 5HKYA 3WXAA 2M7NA 4QJ3B 2COLB 1J1EA 1A2XA 2K7DA 1K9KA 3CR5X 1SL7A 3HCMA 2B1UA 2CT9A 1YUUA 4BY5A 2HF5A 2K7BA 5I2QA 4ZCVA 5K89A 4GUKA 1ODBA 4N1FA 1DF0B 2NCPA 4L9MA 1IQ3A 1G33A 1CFCA 1JUOA 4CLNA 1IKUA 2LLTA 2HETA 1CMFA 4GGFC 3I5IC 2L98A 4MZKA 3VRQA 4MRXA 5F6TA 3TUYB 5KSZA 1Q80A 2JRFA 5ER5A 2LANA 1KCYA 1CTRA 1UUSA 1V1GA 3D0YA 1XK4C 3BUXB 4YBHB 1B47A 1MF8B 2KI6C 1E8AA 2L5XB 2ZN8A 1NP8A 2CBLA 2G9BA 4YGEB 4WRIA 2L4HA 2I18A 4AQIA 4PCWA 1TCFA 2KI4C 3O6BA 4GBAA 1KK7Z 1BLQA 1J1DA 3KEVA 1SK6D 5B8IB 2KBMA 3WNXB 3SG3A 1F8HA 1JC2A 4HRHA 2JWWA 5D69A 1IJ5A 2JT0A 1F4OA 4PE0A 2ZN9A 1A75B 3PFVA 5DKRA 1HT9A 3PATA 3SG5A 1QVIZ 3CR2A 3TDUA 4C0LA 1XFYO 1KK8B 1MHOA 1S3PA 1F4QA 1UHIA 2M3WA 1F55A 4PHJA 1DGVA 1WRZA 2F3ZA 2JT8A 2EC6B 2LE9B 5CSJA 1YURA 2LVKA 1OMRA 2D8NA 5KU1A 1SY9A 1MXEA 2F8PA 3BOWB 3BQ3A 3WHUB 1OMVA 2HQ8A 1B8LA 1M31A
chains in the Genus database with same CATH superfamily
3TZ1A 4JD9A 2Y1MA 3EKJA 2FJUB 5IBWA 5FI6A 1DTLA 1SRAA 1K9PA 3FWCA 1QX7A 2LMUA 4MLWA 2ZRSA 1EXRA 2KI6D 1LA0A 3OP0A 3EVUA 3OB2B 4INXA 2PQLA 3SG2A 1IQ5A 5AFPA 1SR6B 1H8BA 1ZUZA 2KGRA 4FQTA 1M63B 1ORGA 1R6PA 1DF0A 3AKAA 1QV1A 1GM0A 1F70A 5AERA 2JZIA 1KQMB 1YRUB 2KBIA 1DT7B 1SCVA 2EGDA 3ZNIA 1CM4A 5D7FA 2OS8B 2R2IA 1DC1A 1FI6A 2GTEA 2JQ6A 3IVTA 3OGNA 5TNCA 3RM1A 1IJ6A 1K2HA 1ALWA 3D0YB 2LLUA 5EL2A 1GGZA 3S0EA 1TUZA 4AQJA 1UHKA 1Y1UA 1KFXL 3CTNA 1KWOC 1CFFA 2L4IA 2K60A 3DZTA 1OOFA 1B7TY 1ZFSA 2KFFA 3DF0B 2LHIA 2P6BB 1PSRA 1HQVA 5CSFA 1MUXA 2K7CA 1A29A 1SNLA 1QTXA 1Y1XA 4MN0A 2Y5IA 2MHHA 2P71A 3PJIA 3BUWB 2KYFA 4D1EA 1NSHA 1OW4A 4FQOA 5J3XA 2LHLA 1D1OA 4MRYA 1LINA 3NGVA 4MZJA 5HKWA 1XFWO 1YVLA 1SCMC 3JTDB 4JKTA 2KDHA 1KQVA 2WCFA 4QJ4B 3JVTC 1RK9A 4P2YB 4ORAB 4I5JA 2K8MB 4OV2A 3PM2A 4NDDA 2BE6A 1RTP1 1YUSA 2BBMA 2L0PA 5G08A 1QV0A 2LUCA 1BT6A 1DEKA 2JC2A 4Q04A 4U8DA 2MRDA 1JF0A 1QATA 1SPYA 3EVRA 5CSIA 1EL4A 1OQPA 3PLFB 2K2FA 3AAKA 2L2CA 2CTNA 1AVSA 2E6WA 2MA2A 1W7IB 3SIAA 3ZWHA 1BU3A 3IF7A 2M7LA 1PRWA 2Q4UA 1GGWA 2JOJA 3I5HB 2M1UA 2LCPA 2QEOA 4F0ZB 2KGBC 3S0AA 3EVVA 3IQQA 2BCAA 3UNWA 3D10A 2LMTA 1DJYA 4N5XA 1KSMA 2LV7A 4CPVA 1OZOA 2KHNA 2LP2A 3BUOB 4OVNF 1L7ZA 3EK7A 1PK0D 4A4CA 3SIBA 4DS7A 1PVAA 4YGBB 2AAOA 2KLEA 2ERBA 3FE6A 1AJ5A 4MBEA 4I5LB 3DVJA 1NIWA 3GK4X 4MVFA 1BJFA 3D73A 5AANA 3D74A 1CMGA 2K0JA 1OOIX 4MZLA 4ZCUA 5I2OA 1A4PA 2MLFC 3PN7C 1UHJA 5AEQA 4YI9A 1BF5A 3E3RA 3LLEA 3DF0A 3LL8B 1K9UA 1IG5A 1UURA 2JXLA 1NX0A 1P28A 2ZKMX 3DY9A 2LP3A 1NPQA 1DJIA 1NYAA 2PASA 2RGIA 1B1GA 2EHBA 2WCHA 3V2LA 3B7AA 1EH2A 2PRUA 1KQMC 2JPTA 1YR5A 4JQ0D 3GK2A 4JWQA 2FOTA 1IWQA 1KK7Y 2V53A 2AMIA 3B6XA 1CLBA 3CYZA 3B88A 1B8CA 1NWDA 1S6JA 1WRLA 2KFGA 1J55A 2NCOA 3DVEA 4DCKA 1MQ1A 3JTDC 1K8UA 1QIVA 2BECA 2PMYA 4PALA 4PHMA 1SL9A 1TNXA 1KFUS 1V1FA 3TS5C 1TWOA 3R1PA 3R1OA 1XA5A 1DVIA 1WDCC 3DXLA 3SS5A 5PALA 4ICBA 1G8IA 1DELA 1TOPA 2QACA 1Y6WA 1S26D 4N1GA 1RJVA 3CGAA 3O2PA 1N65A 1B9AA 1QWVA 1CKKA 2KYCA 2LNKA 2JULA 3O78A 1FBVA 3OX5A 2Y1NA 1NCYA 2H2KA 4BY4A 1JFJA 4M2OA 3PALA 3K1EA 3VRPA 1S6CA 2Q91A 3VROA 4CFRA 3DYEA 1NUBA 3I5IB 1MR8A 3H4SE 1QS7A 2ZFDA 5DKQA 2M8UA 4NDBA 1TCOB 2BAPA 2F2OA 2LM5A 4XJKA 3CLNA 4AOMA 4DRWA 1M46A 1AJ4A 1F54A 2CCMA 3NSOA 3PM8A 2NXQA 3FE8A 4YGDB 1WDCB 3I5HC 4XJKB 1OZSA 1SR6C 2MAZA 5KTYA 1RROA 1TNQA 2L50A 4OKHA 2WOSA 3S0GA 3AAJA 1RWYA 1M39A 3NXAA 2OTGB 1C3ZA 1PVBA 4OZDA 3RLZA 4QJ5B 1NX1A 3BYAA 1NCZA 1B4CA 1YX7A 2G2BA 2BL0C 2OS8C 4IJ7A 2MJWB 4PHNA 4PT1A 2LUXA 4WQ2A 2WCEA 1Z2CB 2M29A 2PSRA 4NDCA 2KAVA 3FE9A 1DJXA 2LLSA 4I5KA 3SS3A 4YRUA 1B8RA 3FWBA 4OR9B 2GV5A 3BXKA 3CDNA 3KHEA 1Y0VH 1C7WA 1Y1AA 1NCXA 3OBVA 4PHKA 5AXIA 1OOGA 3VRNA 1WLZA 3F45A 3M0WA 1W9ZA 2BKIB 1U5IB 3CZTX 2K61A 3SS4A 1DJHA 1S5GZ 1AP4A 2GGMA 2BL0B 3DVMA 3NHIA 5FI7A 2M49B 1ZMZA 4CIDA 3D75A 3EKHA 4UPGA 1PALA 3VRRA 3GK1A 1T14A 1GQMA 1QLKA 2L51A 2O5GA 1SW8A 2KI4B 1S36A 4DUQA 3R1VA 1J7PA 2O60A 3D76A 2JPOA 1XYDA 3TS5B 1XVJA 4C0KA 3BUMB 1BR1B 2GGZA 3SG7A 1LVCD 1LXFC 2HQWA 1NX2A 3LCPC 5I8NA 1XK4A 1YTZC 3TUYC 2BCXA 1F71A 1KFUL 1QIWA 2K7OA 2JNFA 1SBJA 1KFXS 4HSZA 1OOJA 1TTXA 2LMVA 1Z4HA 3EK8A 1XFUO 2NZ0A 1K96A 1TNPA 2L5YA 2M9GA 1FW4A 3BJHA 3ICBA 1EG4A 1FF1A 1UP5A 3PN7B 3S0DA 2AUCA 1CDMA 2LVJA 2IS9A 1PSBA 1UHNA 2VRGA 3A8RA 4ORCB 1JBAA 1QJTA 4GFTA 1UHHA 4C0JA 1WY9A 1AHRA 5CSNA 1U5IA 2WC8A 1BOCA 3KF9A 1S5GY 1CB1A 2QEHA 4E68A 1IRJA 5HLVA 2BCBA 1BG1A 1FPWA 3MSEB 1DQEA 2JU0A 1DJWA 1CLMA 1JSAA 1LA3A 1L2OC 2WNDA 4P5OE 1TIZA 1TRFA 1LKJA 3O4YA 1K95A 2LVIA 4PDZA 1OE9B 4KYNA 1RECA 3UO9A 5DKNA 1JWDA 4OCIA 1AUIB 1YUTA 3OB1B 2KLDA 4INWA 5FI2A 3KPXA 5HYDA 2NLNA 3K21A 1R2UA 1KK8C 2KSPA 1OSAA 4GAOA 2CXJA 4PE4A 3CZ0A 2E30A 1IGVA 1QVIY 3GOFA 2H8VA 3I5GC 3TDIA 3DD4A 1SKTA 1K94A 3WHTB 1OOHA 1J7RA 3NSLA 1QASA 5I2LA 1CFDA 3CABA 5I94A 1K90D 2BE4A 1ZACA 2JNXA 2K2AA 2F33A 3FIAA 3BFAA 5HKZA 1JFKA 2MLEC 4HREE 2PALA 2BNXA 4IL1A 1EJ3A 4YGCB 4M2PA 2PVBA 1JF2A 2Y4QA 1BMOA 2ZRTA 2JTTA 2ZNDA 2P70A 1K93D 1N0YA 2ZNEA 2KPHA 5HLOA 2QPTA 2HPSA 2F2PA 2LAPA 4HRGA 3I5FC 4GNKB 4M2QA 3A4UB 2MBXA 2EC6C 3D78A 2M97A 1C7VA 4USLA 1YVHA 1EG3A 3TDZA 2A4JA 1C3YA 1XFRA 1XFZO 2H61A 2QEVA 3N7HA 1QX5B 2SCPA 3EG5B 4TNCA 3SG4A 1WLMA 3Q8IA 2JXCA 1KSOA 1CDLA 4GPLB 4JPZB 4DIRA 3AKBA 3DVKA 1IH0A 1SYMA 4NQGA 1A75A 2LVVA 2WCKA 1H4BA 3S0BA 3OX6A 3OHMB 1QX2A 1DMOA 2JTZA 4XYNA 1MWNA 2BKHB 1BR4B 1QLSA 2F3YA 1DJGA 1SL8A 1TUJA 1A03A 3C1VA 4WQ3A 1LS8A 4YGAA 4ETOA 2KAXA 3CWGA 3I5GB 4MSPA 1WRKA 2WORA 1OMDA 1B7TZ 2I2RE 2TN4A 2KNEA 2H61C 3SJSA 1FI5A 4PE1A 1CDNA 4MEWA 2DOQA 2FCDA 2WC5A 1G4YR 2KQ6A 1RFJA 1W7JB 2CNPA 1CDPA 3CZ2A 2SASA 1NX3A 1L2OB 3O4XA 1IIOA 3B86A 3BFHA 3CR4X 5ER4X 3SG6A 1M45A 4GGFA 1BODA 1C07A 1CLLA 1TNWA 1DGUA 1CM1A 3D77A 3LK0A 5BPJA 1S6IA 2KOTA 2KFHA 2OTGC 1YRTB 3NSIA 1ALVA 2YGUA 5JOLA 2JT3A 2I94A 3EK4A 1XFXO 2QEBA 4ORBB 2WCJA 1AK8A 3LK1A 2KAYA 4YI8A 1CFPA 3FS7A 1CNPA 1KWOB 3HX4A 2OPOA 1XFVO 2M0RA 3L4LA 1S1EA 5JJGA 4FTGA 1MXLC 5CPVA 4I5NB 2BBNA 2M1KB 3NSKA 3R72A 2FJYA 3JVTB 1VRKA 4R1EA 4CFQA 1J7QA 2LC5A 1QXPA 2FCEA 2I7AA 1GJYA 3PSRA 3IQOA 1TN4A 1UWOA 1ZOTB 3QMEA 4PE7A 1SMGA 3CS1A 5GQQC 3VGOA 1J7OA 4A4BA 3I5FB 3KO0A 1PULA 1YX8A 1SCMB 3BOWA 2WCBA 1DJZA 1X02A 1XO5A 2L2EA 4F7FA 3QRXA 2KQYA 1SSEB 4GGNA 2ISDA 3BUNB 1N2DA 5FYXA 5HKYA 3WXAA 2M7NA 4QJ3B 2COLB 1J1EA 1A2XA 2K7DA 1K9KA 3CR5X 1SL7A 3CZ1A 3HCMA 3VB1A 2B1UA 2CT9A 1YUUA 2WCMA 2HF5A 2K7BA 4BY5A 5I2QA 4ZCVA 5K89A 4GUKA 1ODBA 4N1FA 1DF0B 2NCPA 2QDIA 4L9MA 3B87A 1IQ3A 1G33A 1CFCA 1JUOA 4CLNA 1IKUA 3BFBA 2LLTA 2HETA 1CMFA 4GGFC 3I5IC 2L98A 4MZKA 3VRQA 4MRXA 5F6TA 3TUYB 2WC6A 5KSZA 1Q80A 2JRFA 5ER5A 2LANA 1KCYA 1CTRA 1UUSA 1V1GA 2WCLA 3D0YA 1XK4C 3BUXB 4YBHB 1B47A 1MF8B 2KI6C 2PYQA 1E8AA 2L5XB 2ZN8A 1NP8A 2CBLA 2G9BA 4YGEB 4WRIA 2L4HA 2I18A 4AQIA 3L47A 4PCWA 3S0FA 1TCFA 2KI4C 3NHTA 3O6BA 4GBAA 1KK7Z 5HL1A 1J1DA 1BLQA 3KEVA 1SK6D 5B8IB 2KBMA 3WNXB 3SG3A 1F8HA 1JC2A 4HRHA 2JWWA 5D69A 1IJ5A 2JT0A 1F4OA 4PE0A 2ZN9A 1A75B 3PFVA 5DKRA 1HT9A 3PATA 3SG5A 1QVIZ 3CR2A 3TDUA 4C0LA 3RZSA 1XFYO 1KK8B 1MHOA 1S3PA 1F4QA 1UHIA 2M3WA 1F55A 4PHJA 5DICA 1DGVA 1WRZA 2F3ZA 2JT8A 2EC6B 2LE9B 3L4AA 5CSJA 1YURA 2LVKA 1OMRA 2D8NA 5KU1A 1SY9A 1MXEA 2F8PA 3BOWB 5D3OA 3BQ3A 3WHUB 1OMVA 2HQ8A 1B8LA 1M31A
chains in the Genus database with same CATH topology
3TZ1A 2Y1MA 3EKJA 2FJUB 5IBWA 1DTLA 1SRAA 1K9PA 3FWCA 1QX7A 2LMUA 4MLWA 2ZRSA 1EXRA 2KI6D 1LA0A 3OP0A 3EVUA 3OB2B 3SG2A 1IQ5A 5AFPA 1SR6B 1H8BA 1ZUZA 2KGRA 1M63B 1R6PA 1DF0A 3AKAA 1QV1A 1F70A 5AERA 2JZIA 1KQMB 1YRUB 2KBIA 1DT7B 1SCVA 2EGDA 3ZNIA 1CM4A 5D7FA 2OS8B 2R2IA 1FI6A 2JQ6A 5TNCA 3RM1A 1IJ6A 1K2HA 1ALWA 3D0YB 2LLUA 1GGZA 4AQJA 1UHKA 1Y1UA 1KFXL 3CTNA 1KWOC 1CFFA 2L4IA 2KFFA 1B7TY 1ZFSA 3DF0B 2LHIA 2P6BB 1PSRA 1HQVA 5CSFA 1MUXA 2K7CA 1A29A 1SNLA 1QTXA 1Y1XA 4MN0A 2Y5IA 2MHHA 3BUWB 2KYFA 4D1EA 1NSHA 4FQOA 5J3XA 1D1OA 2LHLA 4MRYA 1LINA 4MZJA 5HKWA 1XFWO 1YVLA 1SCMC 3JTDB 2KDHA 1KQVA 2WCFA 4QJ4B 3JVTC 1RK9A 4P2YB 4ORAB 4I5JA 2K8MB 4OV2A 4NDDA 2BE6A 1RTP1 1YUSA 2BBMA 2L0PA 5G08A 1QV0A 2LUCA 1BT6A 2JC2A 4Q04A 4U8DA 2MRDA 1JF0A 1QATA 1SPYA 3EVRA 5CSIA 1EL4A 1OQPA 3PLFB 2K2FA 3AAKA 2CTNA 1AVSA 2E6WA 2MA2A 1W7IB 3SIAA 3ZWHA 1BU3A 3IF7A 2M7LA 1PRWA 2Q4UA 1GGWA 2JOJA 3I5HB 2M1UA 2LCPA 4F0ZB 2KGBC 3EVVA 3IQQA 2BCAA 3D10A 2LMTA 1DJYA 4N5XA 1KSMA 2LV7A 4CPVA 1OZOA 2KHNA 2LP2A 3BUOB 4OVNF 1L7ZA 3EK7A 1PK0D 4A4CA 3SIBA 4DS7A 1PVAA 4YGBB 2AAOA 1AJ5A 4MBEA 4I5LB 3DVJA 1NIWA 3GK4X 4MVFA 1BJFA 5AANA 1CMGA 2K0JA 4MZLA 5I2OA 4ZCUA 1A4PA 2MLFC 3PN7C 1UHJA 5AEQA 4YI9A 1BF5A 3E3RA 3LLEA 3DF0A 3LL8B 1K9UA 1IG5A 1UURA 2JXLA 1NX0A 2ZKMX 2LP3A 1NPQA 1DJIA 1NYAA 2PASA 2RGIA 1B1GA 2EHBA 1EH2A 2PRUA 1KQMC 2JPTA 1YR5A 4JQ0D 3GK2A 4JWQA 2FOTA 1IWQA 1KK7Y 2V53A 2AMIA 1CLBA 1B8CA 1NWDA 1S6JA 1WRLA 2KFGA 1J55A 2NCOA 3DVEA 4DCKA 1MQ1A 3JTDC 1K8UA 1QIVA 2BECA 2PMYA 4PALA 4PHMA 1SL9A 1TNXA 1KFUS 1V1FA 3TS5C 1XA5A 1DVIA 1WDCC 5PALA 4ICBA 1G8IA 1TOPA 2QACA 1Y6WA 1S26D 4N1GA 1RJVA 3CGAA 3O2PA 1N65A 1B9AA 1CKKA 2KYCA 2LNKA 2JULA 3O78A 1FBVA 3OX5A 2Y1NA 1NCYA 2H2KA 4BY4A 1JFJA 4M2OA 3PALA 3VRPA 1S6CA 2Q91A 3VROA 4CFRA 1NUBA 3I5IB 1MR8A 3H4SE 1QS7A 2ZFDA 5DKQA 2M8UA 4NDBA 1TCOB 2F2OA 2LM5A 4XJKA 3CLNA 4AOMA 4DRWA 1M46A 1AJ4A 1F54A 2CCMA 3NSOA 3PM8A 2NXQA 4YGDB 1WDCB 3I5HC 4XJKB 1OZSA 1SR6C 2MAZA 5KTYA 1RROA 1TNQA 2L50A 4OKHA 2WOSA 3AAJA 1RWYA 1M39A 3NXAA 2OTGB 1PVBA 3RLZA 4QJ5B 1NX1A 3BYAA 1NCZA 1B4CA 1YX7A 2G2BA 2BL0C 2OS8C 4PHNA 2MJWB 4WQ2A 2LUXA 2WCEA 2M29A 2PSRA 4NDCA 2KAVA 1DJXA 2LLSA 4I5KA 4YRUA 1B8RA 3FWBA 4OR9B 2GV5A 3BXKA 3KHEA 1Y0VH 1C7WA 1Y1AA 1NCXA 4PHKA 5AXIA 3VRNA 1WLZA 3F45A 3M0WA 2BKIB 1U5IB 3CZTX 2K61A 1DJHA 1S5GZ 1AP4A 2GGMA 2BL0B 3DVMA 2M49B 1ZMZA 4CIDA 3EKHA 4UPGA 1PALA 3VRRA 3GK1A 1GQMA 1QLKA 2L51A 2O5GA 1SW8A 2KI4B 1S36A 4DUQA 1J7PA 2O60A 1XYDA 3TS5B 1XVJA 4C0KA 3BUMB 1BR1B 2GGZA 3SG7A 1LVCD 1LXFC 2HQWA 1NX2A 3LCPC 5I8NA 1XK4A 1YTZC 3TUYC 2BCXA 1F71A 1KFUL 1QIWA 2K7OA 2JNFA 1SBJA 1KFXS 4HSZA 1OOJA 1TTXA 2LMVA 3EK8A 1XFUO 2NZ0A 1K96A 1TNPA 2M9GA 1FW4A 3ICBA 1EG4A 1FF1A 1UP5A 3PN7B 2AUCA 1CDMA 2LVJA 2IS9A 1PSBA 1UHNA 2VRGA 3A8RA 4ORCB 1JBAA 1QJTA 4GFTA 1UHHA 4C0JA 1WY9A 1AHRA 5CSNA 1U5IA 2WC8A 1BOCA 3KF9A 1S5GY 1CB1A 4E68A 1BG1A 1IRJA 5HLVA 2BCBA 1FPWA 3MSEB 2JU0A 1DJWA 1CLMA 1JSAA 1LA3A 1L2OC 2WNDA 4P5OE 1TIZA 1TRFA 1LKJA 3O4YA 1K95A 2LVIA 4PDZA 1OE9B 1RECA 5DKNA 1JWDA 4OCIA 1AUIB 1YUTA 3OB1B 5HYDA 3KPXA 2NLNA 3K21A 1R2UA 1KK8C 2KSPA 1OSAA 4GAOA 2CXJA 4PE4A 2E30A 1IGVA 1QVIY 3GOFA 3I5GC 3TDIA 3DD4A 1SKTA 1K94A 3WHTB 3NSLA 1J7RA 5I2LA 1QASA 1CFDA 1K90D 2BE4A 1ZACA 2JNXA 2K2AA 2F33A 3FIAA 5HKZA 1JFKA 2MLEC 4HREE 2PALA 4IL1A 4YGCB 1EJ3A 4M2PA 2PVBA 1JF2A 2Y4QA 1BMOA 2ZRTA 2JTTA 2ZNDA 2ZNEA 1K93D 1N0YA 5HLOA 2QPTA 2HPSA 2F2PA 2LAPA 4HRGA 3I5FC 4GNKB 4M2QA 3A4UB 2MBXA 2EC6C 2M97A 1C7VA 4USLA 1YVHA 1EG3A 3TDZA 2A4JA 1XFZO 2H61A 1QX5B 2SCPA 4TNCA 3SG4A 1WLMA 2JXCA 1KSOA 1CDLA 4GPLB 4JPZB 4DIRA 3AKBA 3DVKA 1IH0A 1SYMA 4NQGA 1A75A 2LVVA 1H4BA 3OX6A 3OHMB 1QX2A 1DMOA 2JTZA 4XYNA 1MWNA 2BKHB 1BR4B 1QLSA 2F3YA 1DJGA 1SL8A 1A03A 3C1VA 4WQ3A 4YGAA 4ETOA 2KAXA 3CWGA 3I5GB 4MSPA 1WRKA 2WORA 1OMDA 1B7TZ 2I2RE 2TN4A 2KNEA 2H61C 3SJSA 1FI5A 4PE1A 1CDNA 4MEWA 2DOQA 2FCDA 1G4YR 2KQ6A 1RFJA 1W7JB 2CNPA 1CDPA 2SASA 1NX3A 1L2OB 3CR4X 5ER4X 3SG6A 1C07A 1M45A 4GGFA 1BODA 1CLLA 1TNWA 1DGUA 1CM1A 3LK0A 5BPJA 1S6IA 2KOTA 2KFHA 2OTGC 1YRTB 3NSIA 1ALVA 5JOLA 2JT3A 2I94A 3EK4A 1XFXO 4ORBB 1AK8A 3LK1A 2KAYA 4YI8A 1CFPA 3FS7A 1CNPA 1KWOB 3HX4A 2OPOA 1XFVO 2M0RA 1S1EA 5JJGA 4FTGA 1MXLC 5CPVA 4I5NB 2BBNA 2M1KB 3NSKA 3JVTB 1VRKA 4R1EA 4CFQA 1J7QA 2LC5A 1QXPA 2FCEA 2I7AA 1GJYA 3PSRA 3IQOA 1TN4A 1UWOA 1ZOTB 4PE7A 1SMGA 3CS1A 5GQQC 3VGOA 1J7OA 4A4BA 3I5FB 3KO0A 1PULA 1YX8A 1SCMB 3BOWA 2WCBA 1DJZA 1X02A 1XO5A 2L2EA 3QRXA 2KQYA 4GGNA 2ISDA 3BUNB 1N2DA 5FYXA 5HKYA 3WXAA 2M7NA 4QJ3B 2COLB 1J1EA 1A2XA 2K7DA 1K9KA 3CR5X 1SL7A 3HCMA 2B1UA 2CT9A 1YUUA 4BY5A 2HF5A 2K7BA 5I2QA 4ZCVA 5K89A 4GUKA 1ODBA 4N1FA 1DF0B 2NCPA 4L9MA 1IQ3A 1G33A 1CFCA 1JUOA 4CLNA 1IKUA 2LLTA 2HETA 1CMFA 4GGFC 3I5IC 2L98A 4MZKA 3VRQA 4MRXA 5F6TA 3TUYB 5KSZA 1Q80A 2JRFA 5ER5A 2LANA 1KCYA 1CTRA 1UUSA 1V1GA 3D0YA 1XK4C 3BUXB 4YBHB 1B47A 1MF8B 2KI6C 1E8AA 2L5XB 2ZN8A 1NP8A 2CBLA 2G9BA 4YGEB 4WRIA 2L4HA 2I18A 4AQIA 4PCWA 1TCFA 2KI4C 3O6BA 4GBAA 1KK7Z 1BLQA 1J1DA 3KEVA 1SK6D 5B8IB 2KBMA 3WNXB 3SG3A 1F8HA 1JC2A 4HRHA 2JWWA 5D69A 1IJ5A 2JT0A 1F4OA 4PE0A 2ZN9A 1A75B 3PFVA 5DKRA 1HT9A 3PATA 3SG5A 1QVIZ 3CR2A 3TDUA 4C0LA 1XFYO 1KK8B 1MHOA 1S3PA 1F4QA 1UHIA 2M3WA 1F55A 4PHJA 1DGVA 1WRZA 2F3ZA 2JT8A 2EC6B 2LE9B 5CSJA 1YURA 2LVKA 1OMRA 2D8NA 5KU1A 1SY9A 1MXEA 2F8PA 3BOWB 3BQ3A 3WHUB 1OMVA 2HQ8A 1B8LA 1M31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZ1 A;  2Y1M A;  3EKJ A;  2FJU B;  5IBW A;  1DTL A;  1SRA A;  1K9P A;  3FWC A;  1QX7 A;  2LMU A;  4MLW A;  2ZRS A;  1EXR A;  2KI6 D;  1LA0 A;  3OP0 A;  3EVU A;  3OB2 B;  3SG2 A;  1IQ5 A;  5AFP A;  1SR6 B;  1H8B A;  1ZUZ A;  2KGR A;  1M63 B;  1R6P A;  1DF0 A;  3AKA A;  1QV1 A;  1F70 A;  5AER A;  2JZI A;  1KQM B;  1YRU B;  2KBI A;  1DT7 B;  1SCV A;  2EGD A;  3ZNI A;  1CM4 A;  5D7F A;  2OS8 B;  2R2I A;  1FI6 A;  2JQ6 A;  5TNC A;  3RM1 A;  1IJ6 A;  1K2H A;  1ALW A;  3D0Y B;  2LLU A;  1GGZ A;  4AQJ A;  1UHK A;  1Y1U A;  1KFX L;  3CTN A;  1KWO C;  1CFF A;  2L4I A;  2KFF A;  1B7T Y;  1ZFS A;  3DF0 B;  2LHI A;  2P6B B;  1PSR A;  1HQV A;  5CSF A;  1MUX A;  2K7C A;  1A29 A;  1SNL A;  1QTX A;  1Y1X A;  4MN0 A;  2Y5I A;  2MHH A;  3BUW B;  2KYF A;  4D1E A;  1NSH A;  4FQO A;  5J3X A;  1D1O A;  2LHL A;  4MRY A;  1LIN A;  4MZJ A;  5HKW A;  1XFW O;  1YVL A;  1SCM C;  3JTD B;  2KDH A;  1KQV A;  2WCF A;  4QJ4 B;  3JVT C;  1RK9 A;  4P2Y B;  4ORA B;  4I5J A;  2K8M B;  4OV2 A;  4NDD A;  2BE6 A;  1RTP 1;  1YUS A;  2BBM A;  2L0P A;  5G08 A;  1QV0 A;  2LUC A;  1BT6 A;  2JC2 A;  4Q04 A;  4U8D A;  2MRD A;  1JF0 A;  1QAT A;  1SPY A;  3EVR A;  5CSI A;  1EL4 A;  1OQP A;  3PLF B;  2K2F A;  3AAK A;  2CTN A;  1AVS A;  2E6W A;  2MA2 A;  1W7I B;  3SIA A;  3ZWH A;  1BU3 A;  3IF7 A;  2M7L A;  1PRW A;  2Q4U A;  1GGW A;  2JOJ A;  3I5H B;  2M1U A;  2LCP A;  4F0Z B;  2KGB C;  3EVV A;  3IQQ A;  2BCA A;  3D10 A;  2LMT A;  1DJY A;  4N5X A;  1KSM A;  2LV7 A;  4CPV A;  1OZO A;  2KHN A;  2LP2 A;  3BUO B;  4OVN F;  1L7Z A;  3EK7 A;  1PK0 D;  4A4C A;  3SIB A;  4DS7 A;  1PVA A;  4YGB B;  2AAO A;  1AJ5 A;  4MBE A;  4I5L B;  3DVJ A;  1NIW A;  3GK4 X;  4MVF A;  1BJF A;  5AAN A;  1CMG A;  2K0J A;  4MZL A;  5I2O A;  4ZCU A;  1A4P A;  2MLF C;  3PN7 C;  1UHJ A;  5AEQ A;  4YI9 A;  1BF5 A;  3E3R A;  3LLE A;  3DF0 A;  3LL8 B;  1K9U A;  1IG5 A;  1UUR A;  2JXL A;  1NX0 A;  2ZKM X;  2LP3 A;  1NPQ A;  1DJI A;  1NYA A;  2PAS A;  2RGI A;  1B1G A;  2EHB A;  1EH2 A;  2PRU A;  1KQM C;  2JPT A;  1YR5 A;  4JQ0 D;  3GK2 A;  4JWQ A;  2FOT A;  1IWQ A;  1KK7 Y;  2V53 A;  2AMI A;  1CLB A;  1B8C A;  1NWD A;  1S6J A;  1WRL A;  2KFG A;  1J55 A;  2NCO A;  3DVE A;  4DCK A;  1MQ1 A;  3JTD C;  1K8U A;  1QIV A;  2BEC A;  2PMY A;  4PAL A;  4PHM A;  1SL9 A;  1TNX A;  1KFU S;  1V1F A;  3TS5 C;  1XA5 A;  1DVI A;  1WDC C;  5PAL A;  4ICB A;  1G8I A;  1TOP A;  2QAC A;  1Y6W A;  1S26 D;  4N1G A;  1RJV A;  3CGA A;  3O2P A;  1N65 A;  1B9A A;  1CKK A;  2KYC A;  2LNK A;  2JUL A;  3O78 A;  1FBV A;  3OX5 A;  2Y1N A;  1NCY A;  2H2K A;  4BY4 A;  1JFJ A;  4M2O A;  3PAL A;  3VRP A;  1S6C A;  2Q91 A;  3VRO A;  4CFR A;  1NUB A;  3I5I B;  1MR8 A;  3H4S E;  1QS7 A;  2ZFD A;  5DKQ A;  2M8U A;  4NDB A;  1TCO B;  2F2O A;  2LM5 A;  4XJK A;  3CLN A;  4AOM A;  4DRW A;  1M46 A;  1AJ4 A;  1F54 A;  2CCM A;  3NSO A;  3PM8 A;  2NXQ A;  4YGD B;  1WDC B;  3I5H C;  4XJK B;  1OZS A;  1SR6 C;  2MAZ A;  5KTY A;  1RRO A;  1TNQ A;  2L50 A;  4OKH A;  2WOS A;  3AAJ A;  1RWY A;  1M39 A;  3NXA A;  2OTG B;  1PVB A;  3RLZ A;  4QJ5 B;  1NX1 A;  3BYA A;  1NCZ A;  1B4C A;  1YX7 A;  2G2B A;  2BL0 C;  2OS8 C;  4PHN A;  2MJW B;  4WQ2 A;  2LUX A;  2WCE A;  2M29 A;  2PSR A;  4NDC A;  2KAV A;  1DJX A;  2LLS A;  4I5K A;  4YRU A;  1B8R A;  3FWB A;  4OR9 B;  2GV5 A;  3BXK A;  3KHE A;  1Y0V H;  1C7W A;  1Y1A A;  1NCX A;  4PHK A;  5AXI A;  3VRN A;  1WLZ A;  3F45 A;  3M0W A;  2BKI B;  1U5I B;  3CZT X;  2K61 A;  1DJH A;  1S5G Z;  1AP4 A;  2GGM A;  2BL0 B;  3DVM A;  2M49 B;  1ZMZ A;  4CID A;  3EKH A;  4UPG A;  1PAL A;  3VRR A;  3GK1 A;  1GQM A;  1QLK A;  2L51 A;  2O5G A;  1SW8 A;  2KI4 B;  1S36 A;  4DUQ A;  1J7P A;  2O60 A;  1XYD A;  3TS5 B;  1XVJ A;  4C0K A;  3BUM B;  1BR1 B;  2GGZ A;  3SG7 A;  1LVC D;  1LXF C;  2HQW A;  1NX2 A;  3LCP C;  5I8N A;  1XK4 A;  1YTZ C;  3TUY C;  2BCX A;  1F71 A;  1KFU L;  1QIW A;  2K7O A;  2JNF A;  1SBJ A;  1KFX S;  4HSZ A;  1OOJ A;  1TTX A;  2LMV A;  3EK8 A;  1XFU O;  2NZ0 A;  1K96 A;  1TNP A;  2M9G A;  1FW4 A;  3ICB A;  1EG4 A;  1FF1 A;  1UP5 A;  3PN7 B;  2AUC A;  1CDM A;  2LVJ A;  2IS9 A;  1PSB A;  1UHN A;  2VRG A;  3A8R A;  4ORC B;  1JBA A;  1QJT A;  4GFT A;  1UHH A;  4C0J A;  1WY9 A;  1AHR A;  5CSN A;  1U5I A;  2WC8 A;  1BOC A;  3KF9 A;  1S5G Y;  1CB1 A;  4E68 A;  1BG1 A;  1IRJ A;  5HLV A;  2BCB A;  1FPW A;  3MSE B;  2JU0 A;  1DJW A;  1CLM A;  1JSA A;  1LA3 A;  1L2O C;  2WND A;  4P5O E;  1TIZ A;  1TRF A;  1LKJ A;  3O4Y A;  1K95 A;  2LVI A;  4PDZ A;  1OE9 B;  1REC A;  5DKN A;  1JWD A;  4OCI A;  1AUI B;  1YUT A;  3OB1 B;  5HYD A;  3KPX A;  2NLN A;  3K21 A;  1R2U A;  1KK8 C;  2KSP A;  1OSA A;  4GAO A;  2CXJ A;  4PE4 A;  2E30 A;  1IGV A;  1QVI Y;  3GOF A;  3I5G C;  3TDI A;  3DD4 A;  1SKT A;  1K94 A;  3WHT B;  3NSL A;  1J7R A;  5I2L A;  1QAS A;  1CFD A;  1K90 D;  2BE4 A;  1ZAC A;  2JNX A;  2K2A A;  2F33 A;  3FIA A;  5HKZ A;  1JFK A;  2MLE C;  4HRE E;  2PAL A;  4IL1 A;  4YGC B;  1EJ3 A;  4M2P A;  2PVB A;  1JF2 A;  2Y4Q A;  1BMO A;  2ZRT A;  2JTT A;  2ZND A;  2ZNE A;  1K93 D;  1N0Y A;  5HLO A;  2QPT A;  2HPS A;  2F2P A;  2LAP A;  4HRG A;  3I5F C;  4GNK B;  4M2Q A;  3A4U B;  2MBX A;  2EC6 C;  2M97 A;  1C7V A;  4USL A;  1YVH A;  1EG3 A;  3TDZ A;  2A4J A;  1XFZ O;  2H61 A;  1QX5 B;  2SCP A;  4TNC A;  3SG4 A;  1WLM A;  2JXC A;  1KSO A;  1CDL A;  4GPL B;  4JPZ B;  4DIR A;  3AKB A;  3DVK A;  1IH0 A;  1SYM A;  4NQG A;  1A75 A;  2LVV A;  1H4B A;  3OX6 A;  3OHM B;  1QX2 A;  1DMO A;  2JTZ A;  4XYN A;  1MWN A;  2BKH B;  1BR4 B;  1QLS A;  2F3Y A;  1DJG A;  1SL8 A;  1A03 A;  3C1V A;  4WQ3 A;  4YGA A;  4ETO A;  2KAX A;  3CWG A;  3I5G B;  4MSP A;  1WRK A;  2WOR A;  1OMD A;  1B7T Z;  2I2R E;  2TN4 A;  2KNE A;  2H61 C;  3SJS A;  1FI5 A;  4PE1 A;  1CDN A;  4MEW A;  2DOQ A;  2FCD A;  1G4Y R;  2KQ6 A;  1RFJ A;  1W7J B;  2CNP A;  1CDP A;  2SAS A;  1NX3 A;  1L2O B;  3CR4 X;  5ER4 X;  3SG6 A;  1C07 A;  1M45 A;  4GGF A;  1BOD A;  1CLL A;  1TNW A;  1DGU A;  1CM1 A;  3LK0 A;  5BPJ A;  1S6I A;  2KOT A;  2KFH A;  2OTG C;  1YRT B;  3NSI A;  1ALV A;  5JOL A;  2JT3 A;  2I94 A;  3EK4 A;  1XFX O;  4ORB B;  1AK8 A;  3LK1 A;  2KAY A;  4YI8 A;  1CFP A;  3FS7 A;  1CNP A;  1KWO B;  3HX4 A;  2OPO A;  1XFV O;  2M0R A;  1S1E A;  5JJG A;  4FTG A;  1MXL C;  5CPV A;  4I5N B;  2BBN A;  2M1K B;  3NSK A;  3JVT B;  1VRK A;  4R1E A;  4CFQ A;  1J7Q A;  2LC5 A;  1QXP A;  2FCE A;  2I7A A;  1GJY A;  3PSR A;  3IQO A;  1TN4 A;  1UWO A;  1ZOT B;  4PE7 A;  1SMG A;  3CS1 A;  5GQQ C;  3VGO A;  1J7O A;  4A4B A;  3I5F B;  3KO0 A;  1PUL A;  1YX8 A;  1SCM B;  3BOW A;  2WCB A;  1DJZ A;  1X02 A;  1XO5 A;  2L2E A;  3QRX A;  2KQY A;  4GGN A;  2ISD A;  3BUN B;  1N2D A;  5FYX A;  5HKY A;  3WXA A;  2M7N A;  4QJ3 B;  2COL B;  1J1E A;  1A2X A;  2K7D A;  1K9K A;  3CR5 X;  1SL7 A;  3HCM A;  2B1U A;  2CT9 A;  1YUU A;  4BY5 A;  2HF5 A;  2K7B A;  5I2Q A;  4ZCV A;  5K89 A;  4GUK A;  1ODB A;  4N1F A;  1DF0 B;  2NCP A;  4L9M A;  1IQ3 A;  1G33 A;  1CFC A;  1JUO A;  4CLN A;  1IKU A;  2LLT A;  2HET A;  1CMF A;  4GGF C;  3I5I C;  2L98 A;  4MZK A;  3VRQ A;  4MRX A;  5F6T A;  3TUY B;  5KSZ A;  1Q80 A;  2JRF A;  5ER5 A;  2LAN A;  1KCY A;  1CTR A;  1UUS A;  1V1G A;  3D0Y A;  1XK4 C;  3BUX B;  4YBH B;  1B47 A;  1MF8 B;  2KI6 C;  1E8A A;  2L5X B;  2ZN8 A;  1NP8 A;  2CBL A;  2G9B A;  4YGE B;  4WRI A;  2L4H A;  2I18 A;  4AQI A;  4PCW A;  1TCF A;  2KI4 C;  3O6B A;  4GBA A;  1KK7 Z;  1BLQ A;  1J1D A;  3KEV A;  1SK6 D;  5B8I B;  2KBM A;  3WNX B;  3SG3 A;  1F8H A;  1JC2 A;  4HRH A;  2JWW A;  5D69 A;  1IJ5 A;  2JT0 A;  1F4O A;  4PE0 A;  2ZN9 A;  1A75 B;  3PFV A;  5DKR A;  1HT9 A;  3PAT A;  3SG5 A;  1QVI Z;  3CR2 A;  3TDU A;  4C0L A;  1XFY O;  1KK8 B;  1MHO A;  1S3P A;  1F4Q A;  1UHI A;  2M3W A;  1F55 A;  4PHJ A;  1DGV A;  1WRZ A;  2F3Z A;  2JT8 A;  2EC6 B;  2LE9 B;  5CSJ A;  1YUR A;  2LVK A;  1OMR A;  2D8N A;  5KU1 A;  1SY9 A;  1MXE A;  2F8P A;  3BOW B;  3BQ3 A;  3WHU B;  1OMV A;  2HQ8 A;  1B8L A;  1M31 A; 
#chains in the Genus database with same CATH topology
 3TZ1 A;  4JD9 A;  2Y1M A;  3EKJ A;  2FJU B;  5IBW A;  5FI6 A;  1DTL A;  1SRA A;  1K9P A;  3FWC A;  1QX7 A;  2LMU A;  4MLW A;  2ZRS A;  1EXR A;  2KI6 D;  1LA0 A;  3OP0 A;  3EVU A;  3OB2 B;  4INX A;  2PQL A;  3SG2 A;  1IQ5 A;  5AFP A;  1SR6 B;  1H8B A;  1ZUZ A;  2KGR A;  4FQT A;  1M63 B;  1ORG A;  1R6P A;  1DF0 A;  3AKA A;  1QV1 A;  1GM0 A;  1F70 A;  5AER A;  2JZI A;  1KQM B;  1YRU B;  2KBI A;  1DT7 B;  1SCV A;  2EGD A;  3ZNI A;  1CM4 A;  5D7F A;  2OS8 B;  2R2I A;  1DC1 A;  1FI6 A;  2GTE A;  2JQ6 A;  3IVT A;  3OGN A;  5TNC A;  3RM1 A;  1IJ6 A;  1K2H A;  1ALW A;  3D0Y B;  2LLU A;  5EL2 A;  1GGZ A;  3S0E A;  1TUZ A;  4AQJ A;  1UHK A;  1Y1U A;  1KFX L;  3CTN A;  1KWO C;  1CFF A;  2L4I A;  2K60 A;  3DZT A;  1OOF A;  1B7T Y;  1ZFS A;  2KFF A;  3DF0 B;  2LHI A;  2P6B B;  1PSR A;  1HQV A;  5CSF A;  1MUX A;  2K7C A;  1A29 A;  1SNL A;  1QTX A;  1Y1X A;  4MN0 A;  2Y5I A;  2MHH A;  2P71 A;  3PJI A;  3BUW B;  2KYF A;  4D1E A;  1NSH A;  1OW4 A;  4FQO A;  5J3X A;  2LHL A;  1D1O A;  4MRY A;  1LIN A;  3NGV A;  4MZJ A;  5HKW A;  1XFW O;  1YVL A;  1SCM C;  3JTD B;  4JKT A;  2KDH A;  1KQV A;  2WCF A;  4QJ4 B;  3JVT C;  1RK9 A;  4P2Y B;  4ORA B;  4I5J A;  2K8M B;  4OV2 A;  3PM2 A;  4NDD A;  2BE6 A;  1RTP 1;  1YUS A;  2BBM A;  2L0P A;  5G08 A;  1QV0 A;  2LUC A;  1BT6 A;  1DEK A;  2JC2 A;  4Q04 A;  4U8D A;  2MRD A;  1JF0 A;  1QAT A;  1SPY A;  3EVR A;  5CSI A;  1EL4 A;  1OQP A;  3PLF B;  2K2F A;  3AAK A;  2L2C A;  2CTN A;  1AVS A;  2E6W A;  2MA2 A;  1W7I B;  3SIA A;  3ZWH A;  1BU3 A;  3IF7 A;  2M7L A;  1PRW A;  2Q4U A;  1GGW A;  2JOJ A;  3I5H B;  2M1U A;  2LCP A;  2QEO A;  4F0Z B;  2KGB C;  3S0A A;  3EVV A;  3IQQ A;  2BCA A;  3UNW A;  3D10 A;  2LMT A;  1DJY A;  4N5X A;  1KSM A;  2LV7 A;  4CPV A;  1OZO A;  2KHN A;  2LP2 A;  3BUO B;  4OVN F;  1L7Z A;  3EK7 A;  1PK0 D;  4A4C A;  3SIB A;  4DS7 A;  1PVA A;  4YGB B;  2AAO A;  2KLE A;  2ERB A;  3FE6 A;  1AJ5 A;  4MBE A;  4I5L B;  3DVJ A;  1NIW A;  3GK4 X;  4MVF A;  1BJF A;  3D73 A;  5AAN A;  3D74 A;  1CMG A;  2K0J A;  1OOI X;  4MZL A;  4ZCU A;  5I2O A;  1A4P A;  2MLF C;  3PN7 C;  1UHJ A;  5AEQ A;  4YI9 A;  1BF5 A;  3E3R A;  3LLE A;  3DF0 A;  3LL8 B;  1K9U A;  1IG5 A;  1UUR A;  2JXL A;  1NX0 A;  1P28 A;  2ZKM X;  3DY9 A;  2LP3 A;  1NPQ A;  1DJI A;  1NYA A;  2PAS A;  2RGI A;  1B1G A;  2EHB A;  2WCH A;  3V2L A;  3B7A A;  1EH2 A;  2PRU A;  1KQM C;  2JPT A;  1YR5 A;  4JQ0 D;  3GK2 A;  4JWQ A;  2FOT A;  1IWQ A;  1KK7 Y;  2V53 A;  2AMI A;  3B6X A;  1CLB A;  3CYZ A;  3B88 A;  1B8C A;  1NWD A;  1S6J A;  1WRL A;  2KFG A;  1J55 A;  2NCO A;  3DVE A;  4DCK A;  1MQ1 A;  3JTD C;  1K8U A;  1QIV A;  2BEC A;  2PMY A;  4PAL A;  4PHM A;  1SL9 A;  1TNX A;  1KFU S;  1V1F A;  3TS5 C;  1TWO A;  3R1P A;  3R1O A;  1XA5 A;  1DVI A;  1WDC C;  3DXL A;  3SS5 A;  5PAL A;  4ICB A;  1G8I A;  1DEL A;  1TOP A;  2QAC A;  1Y6W A;  1S26 D;  4N1G A;  1RJV A;  3CGA A;  3O2P A;  1N65 A;  1B9A A;  1QWV A;  1CKK A;  2KYC A;  2LNK A;  2JUL A;  3O78 A;  1FBV A;  3OX5 A;  2Y1N A;  1NCY A;  2H2K A;  4BY4 A;  1JFJ A;  4M2O A;  3PAL A;  3K1E A;  3VRP A;  1S6C A;  2Q91 A;  3VRO A;  4CFR A;  3DYE A;  1NUB A;  3I5I B;  1MR8 A;  3H4S E;  1QS7 A;  2ZFD A;  5DKQ A;  2M8U A;  4NDB A;  1TCO B;  2BAP A;  2F2O A;  2LM5 A;  4XJK A;  3CLN A;  4AOM A;  4DRW A;  1M46 A;  1AJ4 A;  1F54 A;  2CCM A;  3NSO A;  3PM8 A;  2NXQ A;  3FE8 A;  4YGD B;  1WDC B;  3I5H C;  4XJK B;  1OZS A;  1SR6 C;  2MAZ A;  5KTY A;  1RRO A;  1TNQ A;  2L50 A;  4OKH A;  2WOS A;  3S0G A;  3AAJ A;  1RWY A;  1M39 A;  3NXA A;  2OTG B;  1C3Z A;  1PVB A;  4OZD A;  3RLZ A;  4QJ5 B;  1NX1 A;  3BYA A;  1NCZ A;  1B4C A;  1YX7 A;  2G2B A;  2BL0 C;  2OS8 C;  4IJ7 A;  2MJW B;  4PHN A;  4PT1 A;  2LUX A;  4WQ2 A;  2WCE A;  1Z2C B;  2M29 A;  2PSR A;  4NDC A;  2KAV A;  3FE9 A;  1DJX A;  2LLS A;  4I5K A;  3SS3 A;  4YRU A;  1B8R A;  3FWB A;  4OR9 B;  2GV5 A;  3BXK A;  3CDN A;  3KHE A;  1Y0V H;  1C7W A;  1Y1A A;  1NCX A;  3OBV A;  4PHK A;  5AXI A;  1OOG A;  3VRN A;  1WLZ A;  3F45 A;  3M0W A;  1W9Z A;  2BKI B;  1U5I B;  3CZT X;  2K61 A;  3SS4 A;  1DJH A;  1S5G Z;  1AP4 A;  2GGM A;  2BL0 B;  3DVM A;  3NHI A;  5FI7 A;  2M49 B;  1ZMZ A;  4CID A;  3D75 A;  3EKH A;  4UPG A;  1PAL A;  3VRR A;  3GK1 A;  1T14 A;  1GQM A;  1QLK A;  2L51 A;  2O5G A;  1SW8 A;  2KI4 B;  1S36 A;  4DUQ A;  3R1V A;  1J7P A;  2O60 A;  3D76 A;  2JPO A;  1XYD A;  3TS5 B;  1XVJ A;  4C0K A;  3BUM B;  1BR1 B;  2GGZ A;  3SG7 A;  1LVC D;  1LXF C;  2HQW A;  1NX2 A;  3LCP C;  5I8N A;  1XK4 A;  1YTZ C;  3TUY C;  2BCX A;  1F71 A;  1KFU L;  1QIW A;  2K7O A;  2JNF A;  1SBJ A;  1KFX S;  4HSZ A;  1OOJ A;  1TTX A;  2LMV A;  1Z4H A;  3EK8 A;  1XFU O;  2NZ0 A;  1K96 A;  1TNP A;  2L5Y A;  2M9G A;  1FW4 A;  3BJH A;  3ICB A;  1EG4 A;  1FF1 A;  1UP5 A;  3PN7 B;  3S0D A;  2AUC A;  1CDM A;  2LVJ A;  2IS9 A;  1PSB A;  1UHN A;  2VRG A;  3A8R A;  4ORC B;  1JBA A;  1QJT A;  4GFT A;  1UHH A;  4C0J A;  1WY9 A;  1AHR A;  5CSN A;  1U5I A;  2WC8 A;  1BOC A;  3KF9 A;  1S5G Y;  1CB1 A;  2QEH A;  4E68 A;  1IRJ A;  5HLV A;  2BCB A;  1BG1 A;  1FPW A;  3MSE B;  1DQE A;  2JU0 A;  1DJW A;  1CLM A;  1JSA A;  1LA3 A;  1L2O C;  2WND A;  4P5O E;  1TIZ A;  1TRF A;  1LKJ A;  3O4Y A;  1K95 A;  2LVI A;  4PDZ A;  1OE9 B;  4KYN A;  1REC A;  3UO9 A;  5DKN A;  1JWD A;  4OCI A;  1AUI B;  1YUT A;  3OB1 B;  2KLD A;  4INW A;  5FI2 A;  3KPX A;  5HYD A;  2NLN A;  3K21 A;  1R2U A;  1KK8 C;  2KSP A;  1OSA A;  4GAO A;  2CXJ A;  4PE4 A;  3CZ0 A;  2E30 A;  1IGV A;  1QVI Y;  3GOF A;  2H8V A;  3I5G C;  3TDI A;  3DD4 A;  1SKT A;  1K94 A;  3WHT B;  1OOH A;  1J7R A;  3NSL A;  1QAS A;  5I2L A;  1CFD A;  3CAB A;  5I94 A;  1K90 D;  2BE4 A;  1ZAC A;  2JNX A;  2K2A A;  2F33 A;  3FIA A;  3BFA A;  5HKZ A;  1JFK A;  2MLE C;  4HRE E;  2PAL A;  2BNX A;  4IL1 A;  1EJ3 A;  4YGC B;  4M2P A;  2PVB A;  1JF2 A;  2Y4Q A;  1BMO A;  2ZRT A;  2JTT A;  2ZND A;  2P70 A;  1K93 D;  1N0Y A;  2ZNE A;  2KPH A;  5HLO A;  2QPT A;  2HPS A;  2F2P A;  2LAP A;  4HRG A;  3I5F C;  4GNK B;  4M2Q A;  3A4U B;  2MBX A;  2EC6 C;  3D78 A;  2M97 A;  1C7V A;  4USL A;  1YVH A;  1EG3 A;  3TDZ A;  2A4J A;  1C3Y A;  1XFR A;  1XFZ O;  2H61 A;  2QEV A;  3N7H A;  1QX5 B;  2SCP A;  3EG5 B;  4TNC A;  3SG4 A;  1WLM A;  3Q8I A;  2JXC A;  1KSO A;  1CDL A;  4GPL B;  4JPZ B;  4DIR A;  3AKB A;  3DVK A;  1IH0 A;  1SYM A;  4NQG A;  1A75 A;  2LVV A;  2WCK A;  1H4B A;  3S0B A;  3OX6 A;  3OHM B;  1QX2 A;  1DMO A;  2JTZ A;  4XYN A;  1MWN A;  2BKH B;  1BR4 B;  1QLS A;  2F3Y A;  1DJG A;  1SL8 A;  1TUJ A;  1A03 A;  3C1V A;  4WQ3 A;  1LS8 A;  4YGA A;  4ETO A;  2KAX A;  3CWG A;  3I5G B;  4MSP A;  1WRK A;  2WOR A;  1OMD A;  1B7T Z;  2I2R E;  2TN4 A;  2KNE A;  2H61 C;  3SJS A;  1FI5 A;  4PE1 A;  1CDN A;  4MEW A;  2DOQ A;  2FCD A;  2WC5 A;  1G4Y R;  2KQ6 A;  1RFJ A;  1W7J B;  2CNP A;  1CDP A;  3CZ2 A;  2SAS A;  1NX3 A;  1L2O B;  3O4X A;  1IIO A;  3B86 A;  3BFH A;  3CR4 X;  5ER4 X;  3SG6 A;  1M45 A;  4GGF A;  1BOD A;  1C07 A;  1CLL A;  1TNW A;  1DGU A;  1CM1 A;  3D77 A;  3LK0 A;  5BPJ A;  1S6I A;  2KOT A;  2KFH A;  2OTG C;  1YRT B;  3NSI A;  1ALV A;  2YGU A;  5JOL A;  2JT3 A;  2I94 A;  3EK4 A;  1XFX O;  2QEB A;  4ORB B;  2WCJ A;  1AK8 A;  3LK1 A;  2KAY A;  4YI8 A;  1CFP A;  3FS7 A;  1CNP A;  1KWO B;  3HX4 A;  2OPO A;  1XFV O;  2M0R A;  3L4L A;  1S1E A;  5JJG A;  4FTG A;  1MXL C;  5CPV A;  4I5N B;  2BBN A;  2M1K B;  3NSK A;  3R72 A;  2FJY A;  3JVT B;  1VRK A;  4R1E A;  4CFQ A;  1J7Q A;  2LC5 A;  1QXP A;  2FCE A;  2I7A A;  1GJY A;  3PSR A;  3IQO A;  1TN4 A;  1UWO A;  1ZOT B;  3QME A;  4PE7 A;  1SMG A;  3CS1 A;  5GQQ C;  3VGO A;  1J7O A;  4A4B A;  3I5F B;  3KO0 A;  1PUL A;  1YX8 A;  1SCM B;  3BOW A;  2WCB A;  1DJZ A;  1X02 A;  1XO5 A;  2L2E A;  4F7F A;  3QRX A;  2KQY A;  1SSE B;  4GGN A;  2ISD A;  3BUN B;  1N2D A;  5FYX A;  5HKY A;  3WXA A;  2M7N A;  4QJ3 B;  2COL B;  1J1E A;  1A2X A;  2K7D A;  1K9K A;  3CR5 X;  1SL7 A;  3CZ1 A;  3HCM A;  3VB1 A;  2B1U A;  2CT9 A;  1YUU A;  2WCM A;  2HF5 A;  2K7B A;  4BY5 A;  5I2Q A;  4ZCV A;  5K89 A;  4GUK A;  1ODB A;  4N1F A;  1DF0 B;  2NCP A;  2QDI A;  4L9M A;  3B87 A;  1IQ3 A;  1G33 A;  1CFC A;  1JUO A;  4CLN A;  1IKU A;  3BFB A;  2LLT A;  2HET A;  1CMF A;  4GGF C;  3I5I C;  2L98 A;  4MZK A;  3VRQ A;  4MRX A;  5F6T A;  3TUY B;  2WC6 A;  5KSZ A;  1Q80 A;  2JRF A;  5ER5 A;  2LAN A;  1KCY A;  1CTR A;  1UUS A;  1V1G A;  2WCL A;  3D0Y A;  1XK4 C;  3BUX B;  4YBH B;  1B47 A;  1MF8 B;  2KI6 C;  2PYQ A;  1E8A A;  2L5X B;  2ZN8 A;  1NP8 A;  2CBL A;  2G9B A;  4YGE B;  4WRI A;  2L4H A;  2I18 A;  4AQI A;  3L47 A;  4PCW A;  3S0F A;  1TCF A;  2KI4 C;  3NHT A;  3O6B A;  4GBA A;  1KK7 Z;  5HL1 A;  1J1D A;  1BLQ A;  3KEV A;  1SK6 D;  5B8I B;  2KBM A;  3WNX B;  3SG3 A;  1F8H A;  1JC2 A;  4HRH A;  2JWW A;  5D69 A;  1IJ5 A;  2JT0 A;  1F4O A;  4PE0 A;  2ZN9 A;  1A75 B;  3PFV A;  5DKR A;  1HT9 A;  3PAT A;  3SG5 A;  1QVI Z;  3CR2 A;  3TDU A;  4C0L A;  3RZS A;  1XFY O;  1KK8 B;  1MHO A;  1S3P A;  1F4Q A;  1UHI A;  2M3W A;  1F55 A;  4PHJ A;  5DIC A;  1DGV A;  1WRZ A;  2F3Z A;  2JT8 A;  2EC6 B;  2LE9 B;  3L4A A;  5CSJ A;  1YUR A;  2LVK A;  1OMR A;  2D8N A;  5KU1 A;  1SY9 A;  1MXE A;  2F8P A;  3BOW B;  5D3O A;  3BQ3 A;  3WHU B;  1OMV A;  2HQ8 A;  1B8L A;  1M31 A; 
#chains in the Genus database with same CATH homology
 3TZ1 A;  2Y1M A;  3EKJ A;  2FJU B;  5IBW A;  1DTL A;  1SRA A;  1K9P A;  3FWC A;  1QX7 A;  2LMU A;  4MLW A;  2ZRS A;  1EXR A;  2KI6 D;  1LA0 A;  3OP0 A;  3EVU A;  3OB2 B;  3SG2 A;  1IQ5 A;  5AFP A;  1SR6 B;  1H8B A;  1ZUZ A;  2KGR A;  1M63 B;  1R6P A;  1DF0 A;  3AKA A;  1QV1 A;  1F70 A;  5AER A;  2JZI A;  1KQM B;  1YRU B;  2KBI A;  1DT7 B;  1SCV A;  2EGD A;  3ZNI A;  1CM4 A;  5D7F A;  2OS8 B;  2R2I A;  1FI6 A;  2JQ6 A;  5TNC A;  3RM1 A;  1IJ6 A;  1K2H A;  1ALW A;  3D0Y B;  2LLU A;  1GGZ A;  4AQJ A;  1UHK A;  1Y1U A;  1KFX L;  3CTN A;  1KWO C;  1CFF A;  2L4I A;  2KFF A;  1B7T Y;  1ZFS A;  3DF0 B;  2LHI A;  2P6B B;  1PSR A;  1HQV A;  5CSF A;  1MUX A;  2K7C A;  1A29 A;  1SNL A;  1QTX A;  1Y1X A;  4MN0 A;  2Y5I A;  2MHH A;  3BUW B;  2KYF A;  4D1E A;  1NSH A;  4FQO A;  5J3X A;  1D1O A;  2LHL A;  4MRY A;  1LIN A;  4MZJ A;  5HKW A;  1XFW O;  1YVL A;  1SCM C;  3JTD B;  2KDH A;  1KQV A;  2WCF A;  4QJ4 B;  3JVT C;  1RK9 A;  4P2Y B;  4ORA B;  4I5J A;  2K8M B;  4OV2 A;  4NDD A;  2BE6 A;  1RTP 1;  1YUS A;  2BBM A;  2L0P A;  5G08 A;  1QV0 A;  2LUC A;  1BT6 A;  2JC2 A;  4Q04 A;  4U8D A;  2MRD A;  1JF0 A;  1QAT A;  1SPY A;  3EVR A;  5CSI A;  1EL4 A;  1OQP A;  3PLF B;  2K2F A;  3AAK A;  2CTN A;  1AVS A;  2E6W A;  2MA2 A;  1W7I B;  3SIA A;  3ZWH A;  1BU3 A;  3IF7 A;  2M7L A;  1PRW A;  2Q4U A;  1GGW A;  2JOJ A;  3I5H B;  2M1U A;  2LCP A;  4F0Z B;  2KGB C;  3EVV A;  3IQQ A;  2BCA A;  3D10 A;  2LMT A;  1DJY A;  4N5X A;  1KSM A;  2LV7 A;  4CPV A;  1OZO A;  2KHN A;  2LP2 A;  3BUO B;  4OVN F;  1L7Z A;  3EK7 A;  1PK0 D;  4A4C A;  3SIB A;  4DS7 A;  1PVA A;  4YGB B;  2AAO A;  1AJ5 A;  4MBE A;  4I5L B;  3DVJ A;  1NIW A;  3GK4 X;  4MVF A;  1BJF A;  5AAN A;  1CMG A;  2K0J A;  4MZL A;  5I2O A;  4ZCU A;  1A4P A;  2MLF C;  3PN7 C;  1UHJ A;  5AEQ A;  4YI9 A;  1BF5 A;  3E3R A;  3LLE A;  3DF0 A;  3LL8 B;  1K9U A;  1IG5 A;  1UUR A;  2JXL A;  1NX0 A;  2ZKM X;  2LP3 A;  1NPQ A;  1DJI A;  1NYA A;  2PAS A;  2RGI A;  1B1G A;  2EHB A;  1EH2 A;  2PRU A;  1KQM C;  2JPT A;  1YR5 A;  4JQ0 D;  3GK2 A;  4JWQ A;  2FOT A;  1IWQ A;  1KK7 Y;  2V53 A;  2AMI A;  1CLB A;  1B8C A;  1NWD A;  1S6J A;  1WRL A;  2KFG A;  1J55 A;  2NCO A;  3DVE A;  4DCK A;  1MQ1 A;  3JTD C;  1K8U A;  1QIV A;  2BEC A;  2PMY A;  4PAL A;  4PHM A;  1SL9 A;  1TNX A;  1KFU S;  1V1F A;  3TS5 C;  1XA5 A;  1DVI A;  1WDC C;  5PAL A;  4ICB A;  1G8I A;  1TOP A;  2QAC A;  1Y6W A;  1S26 D;  4N1G A;  1RJV A;  3CGA A;  3O2P A;  1N65 A;  1B9A A;  1CKK A;  2KYC A;  2LNK A;  2JUL A;  3O78 A;  1FBV A;  3OX5 A;  2Y1N A;  1NCY A;  2H2K A;  4BY4 A;  1JFJ A;  4M2O A;  3PAL A;  3VRP A;  1S6C A;  2Q91 A;  3VRO A;  4CFR A;  1NUB A;  3I5I B;  1MR8 A;  3H4S E;  1QS7 A;  2ZFD A;  5DKQ A;  2M8U A;  4NDB A;  1TCO B;  2F2O A;  2LM5 A;  4XJK A;  3CLN A;  4AOM A;  4DRW A;  1M46 A;  1AJ4 A;  1F54 A;  2CCM A;  3NSO A;  3PM8 A;  2NXQ A;  4YGD B;  1WDC B;  3I5H C;  4XJK B;  1OZS A;  1SR6 C;  2MAZ A;  5KTY A;  1RRO A;  1TNQ A;  2L50 A;  4OKH A;  2WOS A;  3AAJ A;  1RWY A;  1M39 A;  3NXA A;  2OTG B;  1PVB A;  3RLZ A;  4QJ5 B;  1NX1 A;  3BYA A;  1NCZ A;  1B4C A;  1YX7 A;  2G2B A;  2BL0 C;  2OS8 C;  4PHN A;  2MJW B;  4WQ2 A;  2LUX A;  2WCE A;  2M29 A;  2PSR A;  4NDC A;  2KAV A;  1DJX A;  2LLS A;  4I5K A;  4YRU A;  1B8R A;  3FWB A;  4OR9 B;  2GV5 A;  3BXK A;  3KHE A;  1Y0V H;  1C7W A;  1Y1A A;  1NCX A;  4PHK A;  5AXI A;  3VRN A;  1WLZ A;  3F45 A;  3M0W A;  2BKI B;  1U5I B;  3CZT X;  2K61 A;  1DJH A;  1S5G Z;  1AP4 A;  2GGM A;  2BL0 B;  3DVM A;  2M49 B;  1ZMZ A;  4CID A;  3EKH A;  4UPG A;  1PAL A;  3VRR A;  3GK1 A;  1GQM A;  1QLK A;  2L51 A;  2O5G A;  1SW8 A;  2KI4 B;  1S36 A;  4DUQ A;  1J7P A;  2O60 A;  1XYD A;  3TS5 B;  1XVJ A;  4C0K A;  3BUM B;  1BR1 B;  2GGZ A;  3SG7 A;  1LVC D;  1LXF C;  2HQW A;  1NX2 A;  3LCP C;  5I8N A;  1XK4 A;  1YTZ C;  3TUY C;  2BCX A;  1F71 A;  1KFU L;  1QIW A;  2K7O A;  2JNF A;  1SBJ A;  1KFX S;  4HSZ A;  1OOJ A;  1TTX A;  2LMV A;  3EK8 A;  1XFU O;  2NZ0 A;  1K96 A;  1TNP A;  2M9G A;  1FW4 A;  3ICB A;  1EG4 A;  1FF1 A;  1UP5 A;  3PN7 B;  2AUC A;  1CDM A;  2LVJ A;  2IS9 A;  1PSB A;  1UHN A;  2VRG A;  3A8R A;  4ORC B;  1JBA A;  1QJT A;  4GFT A;  1UHH A;  4C0J A;  1WY9 A;  1AHR A;  5CSN A;  1U5I A;  2WC8 A;  1BOC A;  3KF9 A;  1S5G Y;  1CB1 A;  4E68 A;  1BG1 A;  1IRJ A;  5HLV A;  2BCB A;  1FPW A;  3MSE B;  2JU0 A;  1DJW A;  1CLM A;  1JSA A;  1LA3 A;  1L2O C;  2WND A;  4P5O E;  1TIZ A;  1TRF A;  1LKJ A;  3O4Y A;  1K95 A;  2LVI A;  4PDZ A;  1OE9 B;  1REC A;  5DKN A;  1JWD A;  4OCI A;  1AUI B;  1YUT A;  3OB1 B;  5HYD A;  3KPX A;  2NLN A;  3K21 A;  1R2U A;  1KK8 C;  2KSP A;  1OSA A;  4GAO A;  2CXJ A;  4PE4 A;  2E30 A;  1IGV A;  1QVI Y;  3GOF A;  3I5G C;  3TDI A;  3DD4 A;  1SKT A;  1K94 A;  3WHT B;  3NSL A;  1J7R A;  5I2L A;  1QAS A;  1CFD A;  1K90 D;  2BE4 A;  1ZAC A;  2JNX A;  2K2A A;  2F33 A;  3FIA A;  5HKZ A;  1JFK A;  2MLE C;  4HRE E;  2PAL A;  4IL1 A;  4YGC B;  1EJ3 A;  4M2P A;  2PVB A;  1JF2 A;  2Y4Q A;  1BMO A;  2ZRT A;  2JTT A;  2ZND A;  2ZNE A;  1K93 D;  1N0Y A;  5HLO A;  2QPT A;  2HPS A;  2F2P A;  2LAP A;  4HRG A;  3I5F C;  4GNK B;  4M2Q A;  3A4U B;  2MBX A;  2EC6 C;  2M97 A;  1C7V A;  4USL A;  1YVH A;  1EG3 A;  3TDZ A;  2A4J A;  1XFZ O;  2H61 A;  1QX5 B;  2SCP A;  4TNC A;  3SG4 A;  1WLM A;  2JXC A;  1KSO A;  1CDL A;  4GPL B;  4JPZ B;  4DIR A;  3AKB A;  3DVK A;  1IH0 A;  1SYM A;  4NQG A;  1A75 A;  2LVV A;  1H4B A;  3OX6 A;  3OHM B;  1QX2 A;  1DMO A;  2JTZ A;  4XYN A;  1MWN A;  2BKH B;  1BR4 B;  1QLS A;  2F3Y A;  1DJG A;  1SL8 A;  1A03 A;  3C1V A;  4WQ3 A;  4YGA A;  4ETO A;  2KAX A;  3CWG A;  3I5G B;  4MSP A;  1WRK A;  2WOR A;  1OMD A;  1B7T Z;  2I2R E;  2TN4 A;  2KNE A;  2H61 C;  3SJS A;  1FI5 A;  4PE1 A;  1CDN A;  4MEW A;  2DOQ A;  2FCD A;  1G4Y R;  2KQ6 A;  1RFJ A;  1W7J B;  2CNP A;  1CDP A;  2SAS A;  1NX3 A;  1L2O B;  3CR4 X;  5ER4 X;  3SG6 A;  1C07 A;  1M45 A;  4GGF A;  1BOD A;  1CLL A;  1TNW A;  1DGU A;  1CM1 A;  3LK0 A;  5BPJ A;  1S6I A;  2KOT A;  2KFH A;  2OTG C;  1YRT B;  3NSI A;  1ALV A;  5JOL A;  2JT3 A;  2I94 A;  3EK4 A;  1XFX O;  4ORB B;  1AK8 A;  3LK1 A;  2KAY A;  4YI8 A;  1CFP A;  3FS7 A;  1CNP A;  1KWO B;  3HX4 A;  2OPO A;  1XFV O;  2M0R A;  1S1E A;  5JJG A;  4FTG A;  1MXL C;  5CPV A;  4I5N B;  2BBN A;  2M1K B;  3NSK A;  3JVT B;  1VRK A;  4R1E A;  4CFQ A;  1J7Q A;  2LC5 A;  1QXP A;  2FCE A;  2I7A A;  1GJY A;  3PSR A;  3IQO A;  1TN4 A;  1UWO A;  1ZOT B;  4PE7 A;  1SMG A;  3CS1 A;  5GQQ C;  3VGO A;  1J7O A;  4A4B A;  3I5F B;  3KO0 A;  1PUL A;  1YX8 A;  1SCM B;  3BOW A;  2WCB A;  1DJZ A;  1X02 A;  1XO5 A;  2L2E A;  3QRX A;  2KQY A;  4GGN A;  2ISD A;  3BUN B;  1N2D A;  5FYX A;  5HKY A;  3WXA A;  2M7N A;  4QJ3 B;  2COL B;  1J1E A;  1A2X A;  2K7D A;  1K9K A;  3CR5 X;  1SL7 A;  3HCM A;  2B1U A;  2CT9 A;  1YUU A;  4BY5 A;  2HF5 A;  2K7B A;  5I2Q A;  4ZCV A;  5K89 A;  4GUK A;  1ODB A;  4N1F A;  1DF0 B;  2NCP A;  4L9M A;  1IQ3 A;  1G33 A;  1CFC A;  1JUO A;  4CLN A;  1IKU A;  2LLT A;  2HET A;  1CMF A;  4GGF C;  3I5I C;  2L98 A;  4MZK A;  3VRQ A;  4MRX A;  5F6T A;  3TUY B;  5KSZ A;  1Q80 A;  2JRF A;  5ER5 A;  2LAN A;  1KCY A;  1CTR A;  1UUS A;  1V1G A;  3D0Y A;  1XK4 C;  3BUX B;  4YBH B;  1B47 A;  1MF8 B;  2KI6 C;  1E8A A;  2L5X B;  2ZN8 A;  1NP8 A;  2CBL A;  2G9B A;  4YGE B;  4WRI A;  2L4H A;  2I18 A;  4AQI A;  4PCW A;  1TCF A;  2KI4 C;  3O6B A;  4GBA A;  1KK7 Z;  1BLQ A;  1J1D A;  3KEV A;  1SK6 D;  5B8I B;  2KBM A;  3WNX B;  3SG3 A;  1F8H A;  1JC2 A;  4HRH A;  2JWW A;  5D69 A;  1IJ5 A;  2JT0 A;  1F4O A;  4PE0 A;  2ZN9 A;  1A75 B;  3PFV A;  5DKR A;  1HT9 A;  3PAT A;  3SG5 A;  1QVI Z;  3CR2 A;  3TDU A;  4C0L A;  1XFY O;  1KK8 B;  1MHO A;  1S3P A;  1F4Q A;  1UHI A;  2M3W A;  1F55 A;  4PHJ A;  1DGV A;  1WRZ A;  2F3Z A;  2JT8 A;  2EC6 B;  2LE9 B;  5CSJ A;  1YUR A;  2LVK A;  1OMR A;  2D8N A;  5KU1 A;  1SY9 A;  1MXE A;  2F8P A;  3BOW B;  3BQ3 A;  3WHU B;  1OMV A;  2HQ8 A;  1B8L A;  1M31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...