2Y5IA

S100z from zebrafish in complex with calcium
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
97
structure length
97
Chain Sequence
SKLEGAMDALITVFHNYSGSEGDKYKLSKGELKELLNAELTDFLMSQKDPMLVEKIMNDLDSNKDNEVDFNEFVVLVAALTVACNDFFQEQQKKRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 CALCIUM BINDING PROTEIN Z
publication title The Crystal Structure of Zebrafish S100Z: Implications for Calcium-Promoted S100 Protein Oligomerisation.
pubmed doi rcsb
source organism Danio rerio
molecule tags Metal binding protein
total genus 39
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2y5iA00
2IS9A 1CMFA 3SG7A 5AXIA 2HF5A 5FYXA 1B1GA 1F55A 4MRYA 5JJGA 4M2QA 2KAYA 1XFYO 2LNKA 1B8RA 3GK4X 4I5KA 1JF0A 4YI9A 2SASA 2LHIA 2OPOA 1DF0B 3KF9A 4PHKA 1YUTA 1K95A 1W7IB 2KGRA 2ZNDA 2JOJA 1PSBA 3K21A 1WRLA 3LCPC 3TDUA 3ZWHA 1AJ4A 1YUUA 1QLKA 1B8LA 4PE0A 5I2QA 2NZ0A 2KAXA 1IWQA 1YVHA 1C07A 1YUSA 2K61A 3PFVA 3KO0A 4ZCUA 1RFJA 3NSKA 4AOMA 1L7ZA 3DVKA 2LVIA 4TNCA 1DJYA 2QPTA 2M3WA 1EL4A 1MWNA 1PK0D 3EKJA 2LAPA 2ZN9A 4WRIA 1XYDA 1DTLA 4GGNA 1LKJA 2GV5A 3CR2A 4OR9B 1KK8B 2M0RA 3PN7C 1WY9A 1KFXS 1UUSA 3I5IB 4NQGA 1NUBA 1S3PA 3EK7A 2JRFA 1XFUO 1C7VA 1K8UA 1BODA 2JNFA 1TNPA 1KK7Z 2Y4QA 4PE7A 3AKBA 4C0JA 3SG5A 1CM4A 2NCOA 2WCBA 1AK8A 3LL8B 4N1GA 2FOTA 1J1EA 2WOSA 1S5GZ 2L51A 1BT6A 1RROA 4U8DA 3JTDC 1S6CA 4YGDB 2Y1MA 3TS5C 2KYFA 4AQJA 1S1EA 5K89A 4PDZA 5AERA 1QVIZ 4GAOA 2F2OA 4YGEB 1MUXA 3NSIA 1SY9A 2LHLA 4WQ2A 1F71A 2K7DA 2JXLA 4HRGA 3BUMB 1BG1A 2LVVA 3CTNA 1DJIA 4OVNF 4YGAA 1GGZA 4CFRA 4ICBA 4GBAA 1NP8A 2TN4A 1V1GA 1QATA 3LK1A 1PALA 4AQIA 5BPJA 1IRJA 2K7CA 4PHNA 1BU3A 1F4OA 1V1FA 3CR5X 5CSNA 1K94A 2PRUA 3MSEB 3NXAA 3CS1A 3VGOA 1XFXO 4P5OE 2BE6A 2PALA 3OHMB 1M31A 2JTTA 1K9PA 4DUQA 4A4CA 1K90D 4PHJA 3BXKA 5I2OA 2I2RE 3OB1B 2CNPA 1PULA 1HT9A 3DF0B 2WCFA 3EVVA 5J3XA 2BCBA 1KWOB 1QJTA 1G4YR 2ISDA 4UPGA 1RWYA 2SCPA 3KEVA 1EJ3A 4MZJA 2FCDA 2KI4C 2KSPA 1K2HA 2L4IA 5HLOA 4FQOA 4E68A 1SMGA 3BUNB 3LLEA 4ETOA 3D0YB 1SPYA 4OKHA 3SJSA 1UWOA 5HYDA 4JPZB 4MVFA 5HKZA 1H8BA 1OOJA 1B7TZ 2OS8C 1GQMA 1QX5B 1UHHA 3FWCA 3A8RA 2KFHA 1WLMA 3AKAA 3I5HC 1FI6A 1SW8A 2LLUA 3GK1A 1KQMB 2M49B 3QRXA 2BBMA 1Y6WA 2LC5A 2LLTA 4MN0A 2O60A 2K7BA 2WCEA 1MQ1A 2AMIA 1TNQA 2BCXA 1SYMA 2FJUB 2BL0C 4GGFC 2JT8A 2EC6B 2O5GA 4PE1A 5DKNA 1OZOA 3SG6A 2BECA 1DJWA 4CFQA 2M7LA 5KTYA 1KSOA 1AJ5A 1L2OB 1YRUB 2HQ8A 2LVJA 2H2KA 2M29A 3SIAA 2GGMA 1NPQA 3OB2B 4YBHB 2NCPA 2ZNEA 4PALA 1YVLA 2Y5IA 1DGUA 1UHIA 2F33A 2I18A 2JPTA 3EKHA 1CDPA 2Q91A 3DD4A 3IQQA 1OMRA 2KI6D 1KFUS 1F4QA 1CKKA 2CTNA 3TUYB 1BOCA 5HKWA 1TNXA 1XO5A 3VRRA 1J7QA 1NCYA 2F8PA 2LANA 1G33A 1ALWA 2LLSA 3LK0A 4QJ3B 2KDHA 4MBEA 2VRGA 1ZUZA 2JWWA 1B8CA 3CR4X 2L2EA 1FPWA 5AFPA 1PVBA 2COLB 1YRTB 1SCMB 1N2DA 1JUOA 3BOWA 3VROA 1OSAA 1FBVA 2M1UA 2EGDA 2I94A 1YX7A 2V53A 4CIDA 4I5NB 1NWDA 1S6JA 5KSZA 2MLEC 1KK8C 5CSJA 2KFFA 1E8AA 3DVMA 4XJKA 3I5IC 1CLMA 2D8NA 2KAVA 1MXLC 2Q4UA 4A4BA 1ZACA 1NCZA 1SL9A 1WRZA 1N0YA 2HPSA 1BLQA 1BR1B 2JTZA 3CLNA 1WRKA 3CGAA 2L5XB 1A75A 1QXPA 3WXAA 1K93D 3RM1A 1D1OA 1XVJA 1B9AA 3SG2A 1QIWA 1NX3A 5HLVA 2AUCA 4YGBB 3EK4A 1K96A 5JOLA 4NDCA 3PALA 2MA2A 1CFDA 3GOFA 5DKQA 1KQVA 4PCWA 3BUOB 5IBWA 2MAZA 3FS7A 4I5LB 1G8IA 4MEWA 2L50A 1WDCB 3AAJA 3PATA 3EVUA 4MLWA 1AVSA 3CZTX 4YGCB 1TCFA 2H61C 1IG5A 1BF5A 1OZSA 1QV1A 1UHJA 3IQOA 3WNXB 3VRPA 1QX7A 2NXQA 3OX5A 5CSIA 3ZNIA 2MLFC 1NIWA 1AUIB 3H4SE 2F3YA 2CT9A 5CPVA 4P2YB 1FI5A 2KGBC 4PHMA 2PMYA 1C7WA 3I5GB 1UP5A 4USLA 3I5FB 2K7OA 1KK7Y 2B1UA 1ALVA 2L0PA 3JVTB 1VRKA 1TTXA 2MHHA 1KWOC 2KBMA 1NX1A 3KPXA 1Y1AA 3E3RA 2PSRA 1BJFA 1U5IA 2K0JA 2LMVA 4DRWA 1WLZA 2JT0A 2OTGB 1SR6B 1SRAA 3TZ1A 1CFFA 2KI6C 1S5GY 2LCPA 4HRHA 4YI8A 3C1VA 2QACA 2LVKA 4R1EA 2LP2A 1K9UA 4NDDA 2E6WA 4OV2A 2A4JA 1JWDA 2K8MB 1FW4A 4JQ0D 4F0ZB 3O4YA 2KFGA 1QVIY 4M2OA 2MJWB 1JC2A 3BUXB 2M8UA 4GGFA 4L9MA 1BR4B 1SCVA 1ODBA 1XK4C 1H4BA 1KQMC 2M9GA 1QS7A 2JC2A 1SBJA 1JFKA 2WNDA 4M2PA 1MXEA 3VRNA 1CFPA 3SG3A 1TNWA 2L4HA 5GQQC 4GUKA 4IL1A 1F70A 1NCXA 2LUXA 2ZFDA 4MSPA 1XFWO 1SNLA 1LA0A 1CTRA 1LINA 3M0WA 2EC6C 1S6IA 3GK2A 2CCMA 2KHNA 2KQYA 1DF0A 1RJVA 3TDZA 1TRFA 1L2OC 2LUCA 2HETA 3PLFB 4XYNA 4BY5A 1AHRA 3IF7A 5B8IB 3DVJA 2BKIB 1GJYA 2NLNA 4ORCB 1NSHA 1A2XA 2WORA 2JU0A 2LMTA 1RECA 4ORBB 1OQPA 1Y0VH 1A4PA 1CMGA 2JZIA 2CBLA 2PASA 2DOQA 1R6PA 3VRQA 3AAKA 1DJGA 1JF2A 2RGIA 3TUYC 2ZRTA 3DVEA 4N5XA 1M45A 1SL8A 1J7PA 1PSRA 1PVAA 1A03A 4WQ3A 4BY4A 3O6BA 1QX2A 2KOTA 1B7TY 1Y1XA 5G08A 1DGVA 2E30A 1M46A 5CSFA 1KFXL 2ZRSA 2ZKMX 3PSRA 1RK9A 3NSOA 4GFTA 3OP0A 3WHUB 1CDMA 1QLSA 2BCAA 5AANA 4DIRA 2BBNA 1BMOA 1QASA 2LP3A 1SCMC 1NX2A 2PVBA 2JXCA 1MR8A 1IJ6A 1MHOA 2EHBA 4FTGA 1S26D 4Q04A 2JQ6A 1CNPA 1RTP1 1YX8A 3PN7B 1N65A 2P6BB 3F45A 5TNCA 1OE9B 1PRWA 4PE4A 1YURA 3BOWB 3SG4A 1JBAA 2GGZA 2WC8A 3HX4A 5I8NA 3BUWB 1UURA 1XFZO 2K2FA 1SL7A 2KYCA 1SKTA 3EVRA 4DCKA 1R2UA 4OCIA 1TOPA 4GNKB 1IH0A 5PALA 2Y1NA 3SIBA 4XJKB 1W7JB 3JTDB 1QTXA 2ZN8A 4HREE 1DMOA 1JFJA 2BKHB 3ICBA 3TS5B 2M7NA 1EG4A 1F54A 1LA3A 2LMUA 2HQWA 2H61A 1A75B 1CDLA 1M63B 1K9KA 1S36A 1F8HA 2M97A 1Y1UA 2MRDA 5F6TA 1GGWA 2MBXA 1EH2A 2JULA 1IQ5A 1EG3A 1ZOTB 1WDCC 5ER4X 1SK6D 2LE9B 1DT7B 1YTZC 2L98A 1OMVA 2LV7A 3OX6A 1KSMA 4JWQA 1YR5A 2R2IA 1B4CA 4C0LA 1TCOB 1AP4A 3DF0A 2JT3A 2F3ZA 3KHEA 4MZKA 1UHNA 5DKRA 3BYAA 4I5JA 3WHTB 2LM5A 3CWGA 1IQ3A 1FF1A 1CDNA 1LXFC 1MF8B 1HQVA 3O78A 4D1EA 4ORAB 3D0YA 4YRUA 1OMDA 3I5GC 1IGVA 2M1KB 3I5FC 3EK8A 5KU1A 2FCEA 3PM8A 3FIAA 4MRXA 5D7FA 5I2LA 3JVTC 1J7RA 2K2AA 2KI4B 2CXJA 4C0KA 3A4UB 3BQ3A 1CLLA 5HKYA 1XK4A 2OTGC 1NYAA 1SR6C 5AEQA 1IKUA 1EXRA 1DJXA 1QV0A 2OS8B 3HCMA 2KNEA 3TDIA 2KBIA 4ZCVA 1Q80A 2G2BA 4N1FA 1DVIA 4GPLB 1U5IB 3I5HB 1DJHA 4HSZA 4QJ4B 1B47A 3D10A 2JNXA 1JSAA 2BE4A 1CM1A 4DS7A 1J1DA 1ZMZA 4QJ5B 1CB1A 1TIZA 5ER5A 1ZFSA 5D69A 1J7OA 1DJZA 1NX0A 1M39A 1X02A 4CPVA 4NDBA 1TN4A 2KQ6A 3NSLA 3RLZA 1KCYA 2BL0B 1XFVO 2G9BA 1A29A 2I7AA 1XA5A 1CFCA 4CLNA 1UHKA 2F2PA 2AAOA 1J55A 4MZLA 1QIVA 3FWBA 1IJ5A 1KFUL 1CLBA 3O2PA 1LVCD
chains in the Genus database with same CATH superfamily
2IS9A 1CMFA 3SG7A 5AXIA 2HF5A 5FYXA 3IVTA 1B1GA 1F55A 4MRYA 2PQLA 3B88A 2H8VA 4M2QA 5JJGA 2KAYA 1XFYO 2LNKA 1B8RA 3D77A 3GK4X 4I5KA 1JF0A 4YI9A 2SASA 2LHIA 2OPOA 1DF0B 3KF9A 4PHKA 1YUTA 1K95A 1W7IB 2KGRA 2ZNDA 2JOJA 3V2LA 1PSBA 3K21A 1WRLA 1W9ZA 3LCPC 3TDUA 3ZWHA 1AJ4A 1YUUA 1QLKA 1B8LA 4PE0A 5I2QA 2NZ0A 2P71A 2KAXA 5HL1A 3O4XA 1IWQA 1YVHA 1C07A 1YUSA 2K61A 3PFVA 3KO0A 4ZCUA 1RFJA 3NSKA 4AOMA 1L7ZA 4OZDA 3DVKA 4INWA 2KPHA 2LVIA 4TNCA 1DJYA 3L4LA 2QPTA 2M3WA 1EL4A 1MWNA 1PK0D 3EKJA 2LAPA 2ZN9A 4WRIA 1XYDA 1DTLA 2PYQA 4GGNA 1LKJA 4KYNA 2GV5A 3CR2A 4OR9B 1KK8B 2M0RA 3PN7C 3NHIA 1WY9A 1KFXS 1UUSA 3I5IB 4NQGA 1NUBA 1S3PA 3EK7A 2JRFA 1XFUO 1C7VA 1K8UA 1BODA 2JNFA 1TNPA 1KK7Z 2Y4QA 4PE7A 3AKBA 4C0JA 3S0BA 3SG5A 1CM4A 2NCOA 2WCBA 1AK8A 3LL8B 4N1GA 2FOTA 1J1EA 2WOSA 1S5GZ 2L51A 1BT6A 3S0FA 1RROA 4U8DA 3JTDC 1S6CA 2WCLA 4YGDB 2Y1MA 3TS5C 2KYFA 5FI2A 4AQJA 1S1EA 5K89A 4PDZA 5AERA 1QVIZ 4GAOA 2F2OA 4YGEB 1MUXA 3NSIA 2L5YA 1SY9A 2LHLA 4WQ2A 1F71A 2K7DA 2JXLA 4HRGA 3BUMB 1BG1A 2LVVA 3CTNA 2BNXA 1DJIA 2K60A 4OVNF 4YGAA 1GGZA 3S0GA 4CFRA 4ICBA 4GBAA 1NP8A 2TN4A 1V1GA 1QATA 3LK1A 1PALA 4AQIA 5BPJA 1IRJA 2K7CA 4PHNA 1BU3A 1DEKA 1OW4A 1F4OA 1V1FA 3CR5X 3DY9A 5CSNA 1K94A 2PRUA 5D3OA 3MSEB 3NXAA 3CS1A 3VGOA 1XFXO 4P5OE 2BE6A 2PALA 3OHMB 1M31A 2JTTA 1K9PA 4DUQA 3CZ2A 4A4CA 1K90D 4PHJA 3BXKA 5I2OA 2I2RE 3OB1B 2CNPA 1DC1A 1PULA 1HT9A 3DF0B 2WCFA 3EVVA 3BFHA 5J3XA 2BCBA 1KWOB 1QJTA 1XFRA 1G4YR 2WC5A 2ISDA 4UPGA 1RWYA 2SCPA 3KEVA 1EJ3A 4MZJA 2FCDA 2KI4C 2KSPA 1K2HA 2L4IA 4PT1A 5HLOA 4FQOA 4E68A 1SMGA 3BUNB 3LLEA 4ETOA 3D0YB 1SPYA 4OKHA 3SJSA 1UWOA 5HYDA 4JPZB 2JPOA 4MVFA 5HKZA 1OOJA 1B7TZ 1OOIX 2OS8C 1H8BA 1GQMA 1QX5B 1UHHA 1GM0A 3FWCA 3A8RA 2KFHA 1WLMA 3AKAA 3I5HC 3K1EA 1FI6A 1SW8A 2LLUA 3GK1A 1KQMB 2M49B 5I94A 3BFBA 3QRXA 2BBMA 1Y6WA 2LC5A 2LLTA 4MN0A 3UO9A 3FE8A 2O60A 2K7BA 2QDIA 2WCEA 2ERBA 1MQ1A 2AMIA 3NGVA 1TNQA 2BCXA 1SYMA 2FJUB 2BL0C 4GGFC 2JT8A 2EC6B 2O5GA 4PE1A 5DKNA 1OZOA 3B7AA 3SG6A 1DJWA 2BECA 2YGUA 2M7LA 4CFQA 5KTYA 1KSOA 1AJ5A 1L2OB 1YRUB 2HQ8A 2LVJA 2H2KA 2M29A 3SIAA 2GGMA 1NPQA 3OB2B 4YBHB 2NCPA 3OBVA 2ZNEA 3NHTA 4PALA 1YVLA 2Y5IA 1DGUA 1LS8A 1UHIA 2F33A 2I18A 2JPTA 3EKHA 3DXLA 1CDPA 2Q91A 3DD4A 4F7FA 3CDNA 3IQQA 1OMRA 2KI6D 1KFUS 1F4QA 1CKKA 2CTNA 3TUYB 1BOCA 5HKWA 1TNXA 1XO5A 3VRRA 1J7QA 3S0EA 1NCYA 2F8PA 2LANA 1G33A 1ALWA 2LLSA 3LK0A 4QJ3B 2KDHA 4MBEA 2VRGA 1ZUZA 2JWWA 1B8CA 3CR4X 2L2EA 1FPWA 5AFPA 1PVBA 2COLB 3N7HA 1YRTB 1SCMB 1N2DA 1JUOA 1P28A 3BOWA 3VROA 1OSAA 1FBVA 2M1UA 1TUZA 2EGDA 2I94A 2QEHA 1YX7A 2V53A 4CIDA 4I5NB 3DYEA 1NWDA 1S6JA 5KSZA 2MLEC 3D78A 1KK8C 3CYZA 2KFFA 1E8AA 5CSJA 3DVMA 4XJKA 3I5IC 1CLMA 2D8NA 2KAVA 1MXLC 2Q4UA 4A4BA 1ZACA 1NCZA 1T14A 1SL9A 1WRZA 1N0YA 2HPSA 1BLQA 1BR1B 2JTZA 3CLNA 1WRKA 3CGAA 2L5XB 1A75A 1QXPA 3WXAA 1K93D 3RM1A 1D1OA 3D74A 1XVJA 1B9AA 3SG2A 1QIWA 1NX3A 5HLVA 2AUCA 4YGBB 3EK4A 4INXA 1K96A 1TUJA 5JOLA 4NDCA 3PALA 2MA2A 1CFDA 3GOFA 5EL2A 5DKQA 1KQVA 4PCWA 3BUOB 3EG5B 5IBWA 2MAZA 3OGNA 2QEOA 3FS7A 4I5LB 1G8IA 4MEWA 2L50A 1WDCB 3AAJA 3PATA 3EVUA 4MLWA 1AVSA 3CZTX 4YGCB 1TCFA 2H61C 1IG5A 2QEBA 3PJIA 1OZSA 1BF5A 1QV1A 1UHJA 3IQOA 3WNXB 3VRPA 1QX7A 2NXQA 3OX5A 3D73A 5CSIA 3ZNIA 2MLFC 1NIWA 3BFAA 1AUIB 3H4SE 2F3YA 2CT9A 3R1PA 5CPVA 4P2YB 1FI5A 2KGBC 4PHMA 2PMYA 1C7WA 2KLEA 3I5GB 1UP5A 4USLA 3I5FB 2K7OA 1KK7Y 2B1UA 1ALVA 2L0PA 3JVTB 1VRKA 1TTXA 2MHHA 1KWOC 2KBMA 1NX1A 2WCKA 1Y1AA 3CABA 3KPXA 3E3RA 2PSRA 1BJFA 1U5IA 2K0JA 2LMVA 3SS3A 4DRWA 1WLZA 2JT0A 2OTGB 1SR6B 1SRAA 5DICA 3TZ1A 2KI6C 1CFFA 1S5GY 2LCPA 4HRHA 4YI8A 3C1VA 2QACA 2LVKA 3SS5A 4R1EA 2LP2A 1K9UA 4NDDA 2E6WA 1DQEA 2A4JA 4OV2A 1JWDA 2K8MB 1FW4A 3Q8IA 4JQ0D 1C3ZA 4F0ZB 3O4YA 2KFGA 1QVIY 4M2OA 2MJWB 1JC2A 3BUXB 2M8UA 4GGFA 1TWOA 4L9MA 1BR4B 1SCVA 1ODBA 1XK4C 1H4BA 1KQMC 2M9GA 1QS7A 2JC2A 1SBJA 1JFKA 2WCHA 2WNDA 1MXEA 4M2PA 3VRNA 3SG3A 3UNWA 1TNWA 1CFPA 2KLDA 2L4HA 1ORGA 5GQQC 4GUKA 4IL1A 1F70A 1NCXA 2LUXA 2ZFDA 4MSPA 1XFWO 1SNLA 1LA0A 1SSEB 1CTRA 3R1VA 1LINA 3M0WA 2EC6C 1S6IA 3GK2A 2CCMA 2KHNA 2KQYA 1DF0A 1RJVA 3TDZA 1TRFA 1L2OC 2LUCA 2HETA 3PLFB 4XYNA 4BY5A 1AHRA 3IF7A 5B8IB 3DVJA 2BKIB 3R1OA 1GJYA 2NLNA 4ORCB 1NSHA 2BAPA 1A2XA 2WORA 2JU0A 2LMTA 1RECA 4ORBB 1OQPA 1Y0VH 1C3YA 1A4PA 1CMGA 2JZIA 2CBLA 2PASA 2DOQA 1OOGA 1R6PA 3VRQA 3AAKA 1DJGA 1JF2A 2RGIA 4FQTA 3TUYC 2ZRTA 3DVEA 4N5XA 1M45A 1SL8A 1J7PA 1PSRA 1PVAA 3B87A 1A03A 4WQ3A 4BY4A 3O6BA 1QX2A 2KOTA 1B7TY 1Y1XA 5G08A 1DGVA 1IIOA 2E30A 1M46A 3B86A 1KFXL 2ZRSA 2ZKMX 3PSRA 1RK9A 3NSOA 4GFTA 3OP0A 5CSFA 1CDMA 3WHUB 1QLSA 2BCAA 5AANA 4DIRA 4JD9A 2BBNA 1BMOA 1QASA 2LP3A 1SCMC 1NX2A 2PVBA 3L47A 2JXCA 1MR8A 1IJ6A 1MHOA 2EHBA 4FTGA 1S26D 4Q04A 2JQ6A 1CNPA 1RTP1 1YX8A 2WCJA 1N65A 2P6BB 3F45A 3PN7B 1OE9B 5FI7A 1PRWA 5TNCA 4PE4A 1YURA 3BOWB 3SG4A 1JBAA 3B6XA 3S0AA 4JKTA 2GGZA 2WC8A 1OOHA 3FE6A 1QWVA 3HX4A 5I8NA 3BUWB 3CZ0A 1UURA 1XFZO 2K2FA 1SL7A 2KYCA 1SKTA 1Z2CB 3EVRA 3L4AA 1R2UA 4OCIA 4DCKA 1TOPA 4GNKB 1IH0A 5PALA 2Y1NA 1Z4HA 3SIBA 4XJKB 1W7JB 3JTDB 1QTXA 2ZN8A 4HREE 1DMOA 3FE9A 1JFJA 2BKHB 3ICBA 3TS5B 3R72A 2M7NA 1EG4A 1F54A 1LA3A 2LMUA 2HQWA 2WC6A 2H61A 1A75B 1CDLA 1M63B 1K9KA 1S36A 1F8HA 2M97A 1Y1UA 2MRDA 5F6TA 3VB1A 4IJ7A 1GGWA 1DELA 2QEVA 2MBXA 1EH2A 2JULA 1IQ5A 1EG3A 1ZOTB 3PM2A 2L2CA 1WDCC 5ER4X 1SK6D 2LE9B 1DT7B 1YTZC 2L98A 1OMVA 2LV7A 3OX6A 2GTEA 3SS4A 1KSMA 4JWQA 1YR5A 2R2IA 3S0DA 1B4CA 4C0LA 1TCOB 1AP4A 3DF0A 2JT3A 2F3ZA 3KHEA 4MZKA 1UHNA 5DKRA 3BYAA 4I5JA 3WHTB 2LM5A 3CWGA 3QMEA 1IQ3A 1FF1A 1CDNA 1LXFC 1MF8B 1HQVA 3O78A 4D1EA 4ORAB 3D0YA 4YRUA 1OMDA 3I5GC 1IGVA 2M1KB 3I5FC 3EK8A 5KU1A 2FCEA 3PM8A 3FIAA 4MRXA 5D7FA 5I2LA 3RZSA 3JVTC 1J7RA 2FJYA 2K2AA 2KI4B 2CXJA 4C0KA 3A4UB 3BQ3A 1CLLA 5HKYA 1XK4A 2OTGC 1NYAA 1SR6C 5AEQA 2P70A 1IKUA 1EXRA 1DJXA 1QV0A 2OS8B 3BJHA 3DZTA 2KNEA 3HCMA 3TDIA 1OOFA 2KBIA 4ZCVA 2WCMA 1Q80A 2G2BA 4N1FA 1DVIA 3D76A 4GPLB 1U5IB 3I5HB 1DJHA 4HSZA 4QJ4B 1B47A 3D10A 2JNXA 1JSAA 2BE4A 1CM1A 4DS7A 5FI6A 1J1DA 1ZMZA 4QJ5B 3CZ1A 1CB1A 1TIZA 5ER5A 1ZFSA 5D69A 1J7OA 1DJZA 1NX0A 1M39A 1X02A 4CPVA 4NDBA 1TN4A 2KQ6A 3NSLA 3RLZA 1KCYA 2BL0B 1XFVO 2G9BA 1A29A 2I7AA 1XA5A 1CFCA 4CLNA 1UHKA 2F2PA 3D75A 2AAOA 1J55A 4MZLA 1QIVA 3FWBA 1IJ5A 1KFUL 1CLBA 3O2PA 1LVCD
chains in the Genus database with same CATH topology
2IS9A 1CMFA 3SG7A 5AXIA 2HF5A 5FYXA 1B1GA 1F55A 4MRYA 5JJGA 4M2QA 2KAYA 1XFYO 2LNKA 1B8RA 3GK4X 4I5KA 1JF0A 4YI9A 2SASA 2LHIA 2OPOA 1DF0B 3KF9A 4PHKA 1YUTA 1K95A 1W7IB 2KGRA 2ZNDA 2JOJA 1PSBA 3K21A 1WRLA 3LCPC 3TDUA 3ZWHA 1AJ4A 1YUUA 1QLKA 1B8LA 4PE0A 5I2QA 2NZ0A 2KAXA 1IWQA 1YVHA 1C07A 1YUSA 2K61A 3PFVA 3KO0A 4ZCUA 1RFJA 3NSKA 4AOMA 1L7ZA 3DVKA 2LVIA 4TNCA 1DJYA 2QPTA 2M3WA 1EL4A 1MWNA 1PK0D 3EKJA 2LAPA 2ZN9A 4WRIA 1XYDA 1DTLA 4GGNA 1LKJA 2GV5A 3CR2A 4OR9B 1KK8B 2M0RA 3PN7C 1WY9A 1KFXS 1UUSA 3I5IB 4NQGA 1NUBA 1S3PA 3EK7A 2JRFA 1XFUO 1C7VA 1K8UA 1BODA 2JNFA 1TNPA 1KK7Z 2Y4QA 4PE7A 3AKBA 4C0JA 3SG5A 1CM4A 2NCOA 2WCBA 1AK8A 3LL8B 4N1GA 2FOTA 1J1EA 2WOSA 1S5GZ 2L51A 1BT6A 1RROA 4U8DA 3JTDC 1S6CA 4YGDB 2Y1MA 3TS5C 2KYFA 4AQJA 1S1EA 5K89A 4PDZA 5AERA 1QVIZ 4GAOA 2F2OA 4YGEB 1MUXA 3NSIA 1SY9A 2LHLA 4WQ2A 1F71A 2K7DA 2JXLA 4HRGA 3BUMB 1BG1A 2LVVA 3CTNA 1DJIA 4OVNF 4YGAA 1GGZA 4CFRA 4ICBA 4GBAA 1NP8A 2TN4A 1V1GA 1QATA 3LK1A 1PALA 4AQIA 5BPJA 1IRJA 2K7CA 4PHNA 1BU3A 1F4OA 1V1FA 3CR5X 5CSNA 1K94A 2PRUA 3MSEB 3NXAA 3CS1A 3VGOA 1XFXO 4P5OE 2BE6A 2PALA 3OHMB 1M31A 2JTTA 1K9PA 4DUQA 4A4CA 1K90D 4PHJA 3BXKA 5I2OA 2I2RE 3OB1B 2CNPA 1PULA 1HT9A 3DF0B 2WCFA 3EVVA 5J3XA 2BCBA 1KWOB 1QJTA 1G4YR 2ISDA 4UPGA 1RWYA 2SCPA 3KEVA 1EJ3A 4MZJA 2FCDA 2KI4C 2KSPA 1K2HA 2L4IA 5HLOA 4FQOA 4E68A 1SMGA 3BUNB 3LLEA 4ETOA 3D0YB 1SPYA 4OKHA 3SJSA 1UWOA 5HYDA 4JPZB 4MVFA 5HKZA 1H8BA 1OOJA 1B7TZ 2OS8C 1GQMA 1QX5B 1UHHA 3FWCA 3A8RA 2KFHA 1WLMA 3AKAA 3I5HC 1FI6A 1SW8A 2LLUA 3GK1A 1KQMB 2M49B 3QRXA 2BBMA 1Y6WA 2LC5A 2LLTA 4MN0A 2O60A 2K7BA 2WCEA 1MQ1A 2AMIA 1TNQA 2BCXA 1SYMA 2FJUB 2BL0C 4GGFC 2JT8A 2EC6B 2O5GA 4PE1A 5DKNA 1OZOA 3SG6A 2BECA 1DJWA 4CFQA 2M7LA 5KTYA 1KSOA 1AJ5A 1L2OB 1YRUB 2HQ8A 2LVJA 2H2KA 2M29A 3SIAA 2GGMA 1NPQA 3OB2B 4YBHB 2NCPA 2ZNEA 4PALA 1YVLA 2Y5IA 1DGUA 1UHIA 2F33A 2I18A 2JPTA 3EKHA 1CDPA 2Q91A 3DD4A 3IQQA 1OMRA 2KI6D 1KFUS 1F4QA 1CKKA 2CTNA 3TUYB 1BOCA 5HKWA 1TNXA 1XO5A 3VRRA 1J7QA 1NCYA 2F8PA 2LANA 1G33A 1ALWA 2LLSA 3LK0A 4QJ3B 2KDHA 4MBEA 2VRGA 1ZUZA 2JWWA 1B8CA 3CR4X 2L2EA 1FPWA 5AFPA 1PVBA 2COLB 1YRTB 1SCMB 1N2DA 1JUOA 3BOWA 3VROA 1OSAA 1FBVA 2M1UA 2EGDA 2I94A 1YX7A 2V53A 4CIDA 4I5NB 1NWDA 1S6JA 5KSZA 2MLEC 1KK8C 5CSJA 2KFFA 1E8AA 3DVMA 4XJKA 3I5IC 1CLMA 2D8NA 2KAVA 1MXLC 2Q4UA 4A4BA 1ZACA 1NCZA 1SL9A 1WRZA 1N0YA 2HPSA 1BLQA 1BR1B 2JTZA 3CLNA 1WRKA 3CGAA 2L5XB 1A75A 1QXPA 3WXAA 1K93D 3RM1A 1D1OA 1XVJA 1B9AA 3SG2A 1QIWA 1NX3A 5HLVA 2AUCA 4YGBB 3EK4A 1K96A 5JOLA 4NDCA 3PALA 2MA2A 1CFDA 3GOFA 5DKQA 1KQVA 4PCWA 3BUOB 5IBWA 2MAZA 3FS7A 4I5LB 1G8IA 4MEWA 2L50A 1WDCB 3AAJA 3PATA 3EVUA 4MLWA 1AVSA 3CZTX 4YGCB 1TCFA 2H61C 1IG5A 1BF5A 1OZSA 1QV1A 1UHJA 3IQOA 3WNXB 3VRPA 1QX7A 2NXQA 3OX5A 5CSIA 3ZNIA 2MLFC 1NIWA 1AUIB 3H4SE 2F3YA 2CT9A 5CPVA 4P2YB 1FI5A 2KGBC 4PHMA 2PMYA 1C7WA 3I5GB 1UP5A 4USLA 3I5FB 2K7OA 1KK7Y 2B1UA 1ALVA 2L0PA 3JVTB 1VRKA 1TTXA 2MHHA 1KWOC 2KBMA 1NX1A 3KPXA 1Y1AA 3E3RA 2PSRA 1BJFA 1U5IA 2K0JA 2LMVA 4DRWA 1WLZA 2JT0A 2OTGB 1SR6B 1SRAA 3TZ1A 1CFFA 2KI6C 1S5GY 2LCPA 4HRHA 4YI8A 3C1VA 2QACA 2LVKA 4R1EA 2LP2A 1K9UA 4NDDA 2E6WA 4OV2A 2A4JA 1JWDA 2K8MB 1FW4A 4JQ0D 4F0ZB 3O4YA 2KFGA 1QVIY 4M2OA 2MJWB 1JC2A 3BUXB 2M8UA 4GGFA 4L9MA 1BR4B 1SCVA 1ODBA 1XK4C 1H4BA 1KQMC 2M9GA 1QS7A 2JC2A 1SBJA 1JFKA 2WNDA 4M2PA 1MXEA 3VRNA 1CFPA 3SG3A 1TNWA 2L4HA 5GQQC 4GUKA 4IL1A 1F70A 1NCXA 2LUXA 2ZFDA 4MSPA 1XFWO 1SNLA 1LA0A 1CTRA 1LINA 3M0WA 2EC6C 1S6IA 3GK2A 2CCMA 2KHNA 2KQYA 1DF0A 1RJVA 3TDZA 1TRFA 1L2OC 2LUCA 2HETA 3PLFB 4XYNA 4BY5A 1AHRA 3IF7A 5B8IB 3DVJA 2BKIB 1GJYA 2NLNA 4ORCB 1NSHA 1A2XA 2WORA 2JU0A 2LMTA 1RECA 4ORBB 1OQPA 1Y0VH 1A4PA 1CMGA 2JZIA 2CBLA 2PASA 2DOQA 1R6PA 3VRQA 3AAKA 1DJGA 1JF2A 2RGIA 3TUYC 2ZRTA 3DVEA 4N5XA 1M45A 1SL8A 1J7PA 1PSRA 1PVAA 1A03A 4WQ3A 4BY4A 3O6BA 1QX2A 2KOTA 1B7TY 1Y1XA 5G08A 1DGVA 2E30A 1M46A 5CSFA 1KFXL 2ZRSA 2ZKMX 3PSRA 1RK9A 3NSOA 4GFTA 3OP0A 3WHUB 1CDMA 1QLSA 2BCAA 5AANA 4DIRA 2BBNA 1BMOA 1QASA 2LP3A 1SCMC 1NX2A 2PVBA 2JXCA 1MR8A 1IJ6A 1MHOA 2EHBA 4FTGA 1S26D 4Q04A 2JQ6A 1CNPA 1RTP1 1YX8A 3PN7B 1N65A 2P6BB 3F45A 5TNCA 1OE9B 1PRWA 4PE4A 1YURA 3BOWB 3SG4A 1JBAA 2GGZA 2WC8A 3HX4A 5I8NA 3BUWB 1UURA 1XFZO 2K2FA 1SL7A 2KYCA 1SKTA 3EVRA 4DCKA 1R2UA 4OCIA 1TOPA 4GNKB 1IH0A 5PALA 2Y1NA 3SIBA 4XJKB 1W7JB 3JTDB 1QTXA 2ZN8A 4HREE 1DMOA 1JFJA 2BKHB 3ICBA 3TS5B 2M7NA 1EG4A 1F54A 1LA3A 2LMUA 2HQWA 2H61A 1A75B 1CDLA 1M63B 1K9KA 1S36A 1F8HA 2M97A 1Y1UA 2MRDA 5F6TA 1GGWA 2MBXA 1EH2A 2JULA 1IQ5A 1EG3A 1ZOTB 1WDCC 5ER4X 1SK6D 2LE9B 1DT7B 1YTZC 2L98A 1OMVA 2LV7A 3OX6A 1KSMA 4JWQA 1YR5A 2R2IA 1B4CA 4C0LA 1TCOB 1AP4A 3DF0A 2JT3A 2F3ZA 3KHEA 4MZKA 1UHNA 5DKRA 3BYAA 4I5JA 3WHTB 2LM5A 3CWGA 1IQ3A 1FF1A 1CDNA 1LXFC 1MF8B 1HQVA 3O78A 4D1EA 4ORAB 3D0YA 4YRUA 1OMDA 3I5GC 1IGVA 2M1KB 3I5FC 3EK8A 5KU1A 2FCEA 3PM8A 3FIAA 4MRXA 5D7FA 5I2LA 3JVTC 1J7RA 2K2AA 2KI4B 2CXJA 4C0KA 3A4UB 3BQ3A 1CLLA 5HKYA 1XK4A 2OTGC 1NYAA 1SR6C 5AEQA 1IKUA 1EXRA 1DJXA 1QV0A 2OS8B 3HCMA 2KNEA 3TDIA 2KBIA 4ZCVA 1Q80A 2G2BA 4N1FA 1DVIA 4GPLB 1U5IB 3I5HB 1DJHA 4HSZA 4QJ4B 1B47A 3D10A 2JNXA 1JSAA 2BE4A 1CM1A 4DS7A 1J1DA 1ZMZA 4QJ5B 1CB1A 1TIZA 5ER5A 1ZFSA 5D69A 1J7OA 1DJZA 1NX0A 1M39A 1X02A 4CPVA 4NDBA 1TN4A 2KQ6A 3NSLA 3RLZA 1KCYA 2BL0B 1XFVO 2G9BA 1A29A 2I7AA 1XA5A 1CFCA 4CLNA 1UHKA 2F2PA 2AAOA 1J55A 4MZLA 1QIVA 3FWBA 1IJ5A 1KFUL 1CLBA 3O2PA 1LVCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IS9 A;  1CMF A;  3SG7 A;  5AXI A;  2HF5 A;  5FYX A;  1B1G A;  1F55 A;  4MRY A;  5JJG A;  4M2Q A;  2KAY A;  1XFY O;  2LNK A;  1B8R A;  3GK4 X;  4I5K A;  1JF0 A;  4YI9 A;  2SAS A;  2LHI A;  2OPO A;  1DF0 B;  3KF9 A;  4PHK A;  1YUT A;  1K95 A;  1W7I B;  2KGR A;  2ZND A;  2JOJ A;  1PSB A;  3K21 A;  1WRL A;  3LCP C;  3TDU A;  3ZWH A;  1AJ4 A;  1YUU A;  1QLK A;  1B8L A;  4PE0 A;  5I2Q A;  2NZ0 A;  2KAX A;  1IWQ A;  1YVH A;  1C07 A;  1YUS A;  2K61 A;  3PFV A;  3KO0 A;  4ZCU A;  1RFJ A;  3NSK A;  4AOM A;  1L7Z A;  3DVK A;  2LVI A;  4TNC A;  1DJY A;  2QPT A;  2M3W A;  1EL4 A;  1MWN A;  1PK0 D;  3EKJ A;  2LAP A;  2ZN9 A;  4WRI A;  1XYD A;  1DTL A;  4GGN A;  1LKJ A;  2GV5 A;  3CR2 A;  4OR9 B;  1KK8 B;  2M0R A;  3PN7 C;  1WY9 A;  1KFX S;  1UUS A;  3I5I B;  4NQG A;  1NUB A;  1S3P A;  3EK7 A;  2JRF A;  1XFU O;  1C7V A;  1K8U A;  1BOD A;  2JNF A;  1TNP A;  1KK7 Z;  2Y4Q A;  4PE7 A;  3AKB A;  4C0J A;  3SG5 A;  1CM4 A;  2NCO A;  2WCB A;  1AK8 A;  3LL8 B;  4N1G A;  2FOT A;  1J1E A;  2WOS A;  1S5G Z;  2L51 A;  1BT6 A;  1RRO A;  4U8D A;  3JTD C;  1S6C A;  4YGD B;  2Y1M A;  3TS5 C;  2KYF A;  4AQJ A;  1S1E A;  5K89 A;  4PDZ A;  5AER A;  1QVI Z;  4GAO A;  2F2O A;  4YGE B;  1MUX A;  3NSI A;  1SY9 A;  2LHL A;  4WQ2 A;  1F71 A;  2K7D A;  2JXL A;  4HRG A;  3BUM B;  1BG1 A;  2LVV A;  3CTN A;  1DJI A;  4OVN F;  4YGA A;  1GGZ A;  4CFR A;  4ICB A;  4GBA A;  1NP8 A;  2TN4 A;  1V1G A;  1QAT A;  3LK1 A;  1PAL A;  4AQI A;  5BPJ A;  1IRJ A;  2K7C A;  4PHN A;  1BU3 A;  1F4O A;  1V1F A;  3CR5 X;  5CSN A;  1K94 A;  2PRU A;  3MSE B;  3NXA A;  3CS1 A;  3VGO A;  1XFX O;  4P5O E;  2BE6 A;  2PAL A;  3OHM B;  1M31 A;  2JTT A;  1K9P A;  4DUQ A;  4A4C A;  1K90 D;  4PHJ A;  3BXK A;  5I2O A;  2I2R E;  3OB1 B;  2CNP A;  1PUL A;  1HT9 A;  3DF0 B;  2WCF A;  3EVV A;  5J3X A;  2BCB A;  1KWO B;  1QJT A;  1G4Y R;  2ISD A;  4UPG A;  1RWY A;  2SCP A;  3KEV A;  1EJ3 A;  4MZJ A;  2FCD A;  2KI4 C;  2KSP A;  1K2H A;  2L4I A;  5HLO A;  4FQO A;  4E68 A;  1SMG A;  3BUN B;  3LLE A;  4ETO A;  3D0Y B;  1SPY A;  4OKH A;  3SJS A;  1UWO A;  5HYD A;  4JPZ B;  4MVF A;  5HKZ A;  1H8B A;  1OOJ A;  1B7T Z;  2OS8 C;  1GQM A;  1QX5 B;  1UHH A;  3FWC A;  3A8R A;  2KFH A;  1WLM A;  3AKA A;  3I5H C;  1FI6 A;  1SW8 A;  2LLU A;  3GK1 A;  1KQM B;  2M49 B;  3QRX A;  2BBM A;  1Y6W A;  2LC5 A;  2LLT A;  4MN0 A;  2O60 A;  2K7B A;  2WCE A;  1MQ1 A;  2AMI A;  1TNQ A;  2BCX A;  1SYM A;  2FJU B;  2BL0 C;  4GGF C;  2JT8 A;  2EC6 B;  2O5G A;  4PE1 A;  5DKN A;  1OZO A;  3SG6 A;  2BEC A;  1DJW A;  4CFQ A;  2M7L A;  5KTY A;  1KSO A;  1AJ5 A;  1L2O B;  1YRU B;  2HQ8 A;  2LVJ A;  2H2K A;  2M29 A;  3SIA A;  2GGM A;  1NPQ A;  3OB2 B;  4YBH B;  2NCP A;  2ZNE A;  4PAL A;  1YVL A;  2Y5I A;  1DGU A;  1UHI A;  2F33 A;  2I18 A;  2JPT A;  3EKH A;  1CDP A;  2Q91 A;  3DD4 A;  3IQQ A;  1OMR A;  2KI6 D;  1KFU S;  1F4Q A;  1CKK A;  2CTN A;  3TUY B;  1BOC A;  5HKW A;  1TNX A;  1XO5 A;  3VRR A;  1J7Q A;  1NCY A;  2F8P A;  2LAN A;  1G33 A;  1ALW A;  2LLS A;  3LK0 A;  4QJ3 B;  2KDH A;  4MBE A;  2VRG A;  1ZUZ A;  2JWW A;  1B8C A;  3CR4 X;  2L2E A;  1FPW A;  5AFP A;  1PVB A;  2COL B;  1YRT B;  1SCM B;  1N2D A;  1JUO A;  3BOW A;  3VRO A;  1OSA A;  1FBV A;  2M1U A;  2EGD A;  2I94 A;  1YX7 A;  2V53 A;  4CID A;  4I5N B;  1NWD A;  1S6J A;  5KSZ A;  2MLE C;  1KK8 C;  5CSJ A;  2KFF A;  1E8A A;  3DVM A;  4XJK A;  3I5I C;  1CLM A;  2D8N A;  2KAV A;  1MXL C;  2Q4U A;  4A4B A;  1ZAC A;  1NCZ A;  1SL9 A;  1WRZ A;  1N0Y A;  2HPS A;  1BLQ A;  1BR1 B;  2JTZ A;  3CLN A;  1WRK A;  3CGA A;  2L5X B;  1A75 A;  1QXP A;  3WXA A;  1K93 D;  3RM1 A;  1D1O A;  1XVJ A;  1B9A A;  3SG2 A;  1QIW A;  1NX3 A;  5HLV A;  2AUC A;  4YGB B;  3EK4 A;  1K96 A;  5JOL A;  4NDC A;  3PAL A;  2MA2 A;  1CFD A;  3GOF A;  5DKQ A;  1KQV A;  4PCW A;  3BUO B;  5IBW A;  2MAZ A;  3FS7 A;  4I5L B;  1G8I A;  4MEW A;  2L50 A;  1WDC B;  3AAJ A;  3PAT A;  3EVU A;  4MLW A;  1AVS A;  3CZT X;  4YGC B;  1TCF A;  2H61 C;  1IG5 A;  1BF5 A;  1OZS A;  1QV1 A;  1UHJ A;  3IQO A;  3WNX B;  3VRP A;  1QX7 A;  2NXQ A;  3OX5 A;  5CSI A;  3ZNI A;  2MLF C;  1NIW A;  1AUI B;  3H4S E;  2F3Y A;  2CT9 A;  5CPV A;  4P2Y B;  1FI5 A;  2KGB C;  4PHM A;  2PMY A;  1C7W A;  3I5G B;  1UP5 A;  4USL A;  3I5F B;  2K7O A;  1KK7 Y;  2B1U A;  1ALV A;  2L0P A;  3JVT B;  1VRK A;  1TTX A;  2MHH A;  1KWO C;  2KBM A;  1NX1 A;  3KPX A;  1Y1A A;  3E3R A;  2PSR A;  1BJF A;  1U5I A;  2K0J A;  2LMV A;  4DRW A;  1WLZ A;  2JT0 A;  2OTG B;  1SR6 B;  1SRA A;  3TZ1 A;  1CFF A;  2KI6 C;  1S5G Y;  2LCP A;  4HRH A;  4YI8 A;  3C1V A;  2QAC A;  2LVK A;  4R1E A;  2LP2 A;  1K9U A;  4NDD A;  2E6W A;  4OV2 A;  2A4J A;  1JWD A;  2K8M B;  1FW4 A;  4JQ0 D;  4F0Z B;  3O4Y A;  2KFG A;  1QVI Y;  4M2O A;  2MJW B;  1JC2 A;  3BUX B;  2M8U A;  4GGF A;  4L9M A;  1BR4 B;  1SCV A;  1ODB A;  1XK4 C;  1H4B A;  1KQM C;  2M9G A;  1QS7 A;  2JC2 A;  1SBJ A;  1JFK A;  2WND A;  4M2P A;  1MXE A;  3VRN A;  1CFP A;  3SG3 A;  1TNW A;  2L4H A;  5GQQ C;  4GUK A;  4IL1 A;  1F70 A;  1NCX A;  2LUX A;  2ZFD A;  4MSP A;  1XFW O;  1SNL A;  1LA0 A;  1CTR A;  1LIN A;  3M0W A;  2EC6 C;  1S6I A;  3GK2 A;  2CCM A;  2KHN A;  2KQY A;  1DF0 A;  1RJV A;  3TDZ A;  1TRF A;  1L2O C;  2LUC A;  2HET A;  3PLF B;  4XYN A;  4BY5 A;  1AHR A;  3IF7 A;  5B8I B;  3DVJ A;  2BKI B;  1GJY A;  2NLN A;  4ORC B;  1NSH A;  1A2X A;  2WOR A;  2JU0 A;  2LMT A;  1REC A;  4ORB B;  1OQP A;  1Y0V H;  1A4P A;  1CMG A;  2JZI A;  2CBL A;  2PAS A;  2DOQ A;  1R6P A;  3VRQ A;  3AAK A;  1DJG A;  1JF2 A;  2RGI A;  3TUY C;  2ZRT A;  3DVE A;  4N5X A;  1M45 A;  1SL8 A;  1J7P A;  1PSR A;  1PVA A;  1A03 A;  4WQ3 A;  4BY4 A;  3O6B A;  1QX2 A;  2KOT A;  1B7T Y;  1Y1X A;  5G08 A;  1DGV A;  2E30 A;  1M46 A;  5CSF A;  1KFX L;  2ZRS A;  2ZKM X;  3PSR A;  1RK9 A;  3NSO A;  4GFT A;  3OP0 A;  3WHU B;  1CDM A;  1QLS A;  2BCA A;  5AAN A;  4DIR A;  2BBN A;  1BMO A;  1QAS A;  2LP3 A;  1SCM C;  1NX2 A;  2PVB A;  2JXC A;  1MR8 A;  1IJ6 A;  1MHO A;  2EHB A;  4FTG A;  1S26 D;  4Q04 A;  2JQ6 A;  1CNP A;  1RTP 1;  1YX8 A;  3PN7 B;  1N65 A;  2P6B B;  3F45 A;  5TNC A;  1OE9 B;  1PRW A;  4PE4 A;  1YUR A;  3BOW B;  3SG4 A;  1JBA A;  2GGZ A;  2WC8 A;  3HX4 A;  5I8N A;  3BUW B;  1UUR A;  1XFZ O;  2K2F A;  1SL7 A;  2KYC A;  1SKT A;  3EVR A;  4DCK A;  1R2U A;  4OCI A;  1TOP A;  4GNK B;  1IH0 A;  5PAL A;  2Y1N A;  3SIB A;  4XJK B;  1W7J B;  3JTD B;  1QTX A;  2ZN8 A;  4HRE E;  1DMO A;  1JFJ A;  2BKH B;  3ICB A;  3TS5 B;  2M7N A;  1EG4 A;  1F54 A;  1LA3 A;  2LMU A;  2HQW A;  2H61 A;  1A75 B;  1CDL A;  1M63 B;  1K9K A;  1S36 A;  1F8H A;  2M97 A;  1Y1U A;  2MRD A;  5F6T A;  1GGW A;  2MBX A;  1EH2 A;  2JUL A;  1IQ5 A;  1EG3 A;  1ZOT B;  1WDC C;  5ER4 X;  1SK6 D;  2LE9 B;  1DT7 B;  1YTZ C;  2L98 A;  1OMV A;  2LV7 A;  3OX6 A;  1KSM A;  4JWQ A;  1YR5 A;  2R2I A;  1B4C A;  4C0L A;  1TCO B;  1AP4 A;  3DF0 A;  2JT3 A;  2F3Z A;  3KHE A;  4MZK A;  1UHN A;  5DKR A;  3BYA A;  4I5J A;  3WHT B;  2LM5 A;  3CWG A;  1IQ3 A;  1FF1 A;  1CDN A;  1LXF C;  1MF8 B;  1HQV A;  3O78 A;  4D1E A;  4ORA B;  3D0Y A;  4YRU A;  1OMD A;  3I5G C;  1IGV A;  2M1K B;  3I5F C;  3EK8 A;  5KU1 A;  2FCE A;  3PM8 A;  3FIA A;  4MRX A;  5D7F A;  5I2L A;  3JVT C;  1J7R A;  2K2A A;  2KI4 B;  2CXJ A;  4C0K A;  3A4U B;  3BQ3 A;  1CLL A;  5HKY A;  1XK4 A;  2OTG C;  1NYA A;  1SR6 C;  5AEQ A;  1IKU A;  1EXR A;  1DJX A;  1QV0 A;  2OS8 B;  3HCM A;  2KNE A;  3TDI A;  2KBI A;  4ZCV A;  1Q80 A;  2G2B A;  4N1F A;  1DVI A;  4GPL B;  1U5I B;  3I5H B;  1DJH A;  4HSZ A;  4QJ4 B;  1B47 A;  3D10 A;  2JNX A;  1JSA A;  2BE4 A;  1CM1 A;  4DS7 A;  1J1D A;  1ZMZ A;  4QJ5 B;  1CB1 A;  1TIZ A;  5ER5 A;  1ZFS A;  5D69 A;  1J7O A;  1DJZ A;  1NX0 A;  1M39 A;  1X02 A;  4CPV A;  4NDB A;  1TN4 A;  2KQ6 A;  3NSL A;  3RLZ A;  1KCY A;  2BL0 B;  1XFV O;  2G9B A;  1A29 A;  2I7A A;  1XA5 A;  1CFC A;  4CLN A;  1UHK A;  2F2P A;  2AAO A;  1J55 A;  4MZL A;  1QIV A;  3FWB A;  1IJ5 A;  1KFU L;  1CLB A;  3O2P A;  1LVC D; 
#chains in the Genus database with same CATH topology
 2IS9 A;  1CMF A;  3SG7 A;  5AXI A;  2HF5 A;  5FYX A;  3IVT A;  1B1G A;  1F55 A;  4MRY A;  2PQL A;  3B88 A;  2H8V A;  4M2Q A;  5JJG A;  2KAY A;  1XFY O;  2LNK A;  1B8R A;  3D77 A;  3GK4 X;  4I5K A;  1JF0 A;  4YI9 A;  2SAS A;  2LHI A;  2OPO A;  1DF0 B;  3KF9 A;  4PHK A;  1YUT A;  1K95 A;  1W7I B;  2KGR A;  2ZND A;  2JOJ A;  3V2L A;  1PSB A;  3K21 A;  1WRL A;  1W9Z A;  3LCP C;  3TDU A;  3ZWH A;  1AJ4 A;  1YUU A;  1QLK A;  1B8L A;  4PE0 A;  5I2Q A;  2NZ0 A;  2P71 A;  2KAX A;  5HL1 A;  3O4X A;  1IWQ A;  1YVH A;  1C07 A;  1YUS A;  2K61 A;  3PFV A;  3KO0 A;  4ZCU A;  1RFJ A;  3NSK A;  4AOM A;  1L7Z A;  4OZD A;  3DVK A;  4INW A;  2KPH A;  2LVI A;  4TNC A;  1DJY A;  3L4L A;  2QPT A;  2M3W A;  1EL4 A;  1MWN A;  1PK0 D;  3EKJ A;  2LAP A;  2ZN9 A;  4WRI A;  1XYD A;  1DTL A;  2PYQ A;  4GGN A;  1LKJ A;  4KYN A;  2GV5 A;  3CR2 A;  4OR9 B;  1KK8 B;  2M0R A;  3PN7 C;  3NHI A;  1WY9 A;  1KFX S;  1UUS A;  3I5I B;  4NQG A;  1NUB A;  1S3P A;  3EK7 A;  2JRF A;  1XFU O;  1C7V A;  1K8U A;  1BOD A;  2JNF A;  1TNP A;  1KK7 Z;  2Y4Q A;  4PE7 A;  3AKB A;  4C0J A;  3S0B A;  3SG5 A;  1CM4 A;  2NCO A;  2WCB A;  1AK8 A;  3LL8 B;  4N1G A;  2FOT A;  1J1E A;  2WOS A;  1S5G Z;  2L51 A;  1BT6 A;  3S0F A;  1RRO A;  4U8D A;  3JTD C;  1S6C A;  2WCL A;  4YGD B;  2Y1M A;  3TS5 C;  2KYF A;  5FI2 A;  4AQJ A;  1S1E A;  5K89 A;  4PDZ A;  5AER A;  1QVI Z;  4GAO A;  2F2O A;  4YGE B;  1MUX A;  3NSI A;  2L5Y A;  1SY9 A;  2LHL A;  4WQ2 A;  1F71 A;  2K7D A;  2JXL A;  4HRG A;  3BUM B;  1BG1 A;  2LVV A;  3CTN A;  2BNX A;  1DJI A;  2K60 A;  4OVN F;  4YGA A;  1GGZ A;  3S0G A;  4CFR A;  4ICB A;  4GBA A;  1NP8 A;  2TN4 A;  1V1G A;  1QAT A;  3LK1 A;  1PAL A;  4AQI A;  5BPJ A;  1IRJ A;  2K7C A;  4PHN A;  1BU3 A;  1DEK A;  1OW4 A;  1F4O A;  1V1F A;  3CR5 X;  3DY9 A;  5CSN A;  1K94 A;  2PRU A;  5D3O A;  3MSE B;  3NXA A;  3CS1 A;  3VGO A;  1XFX O;  4P5O E;  2BE6 A;  2PAL A;  3OHM B;  1M31 A;  2JTT A;  1K9P A;  4DUQ A;  3CZ2 A;  4A4C A;  1K90 D;  4PHJ A;  3BXK A;  5I2O A;  2I2R E;  3OB1 B;  2CNP A;  1DC1 A;  1PUL A;  1HT9 A;  3DF0 B;  2WCF A;  3EVV A;  3BFH A;  5J3X A;  2BCB A;  1KWO B;  1QJT A;  1XFR A;  1G4Y R;  2WC5 A;  2ISD A;  4UPG A;  1RWY A;  2SCP A;  3KEV A;  1EJ3 A;  4MZJ A;  2FCD A;  2KI4 C;  2KSP A;  1K2H A;  2L4I A;  4PT1 A;  5HLO A;  4FQO A;  4E68 A;  1SMG A;  3BUN B;  3LLE A;  4ETO A;  3D0Y B;  1SPY A;  4OKH A;  3SJS A;  1UWO A;  5HYD A;  4JPZ B;  2JPO A;  4MVF A;  5HKZ A;  1OOJ A;  1B7T Z;  1OOI X;  2OS8 C;  1H8B A;  1GQM A;  1QX5 B;  1UHH A;  1GM0 A;  3FWC A;  3A8R A;  2KFH A;  1WLM A;  3AKA A;  3I5H C;  3K1E A;  1FI6 A;  1SW8 A;  2LLU A;  3GK1 A;  1KQM B;  2M49 B;  5I94 A;  3BFB A;  3QRX A;  2BBM A;  1Y6W A;  2LC5 A;  2LLT A;  4MN0 A;  3UO9 A;  3FE8 A;  2O60 A;  2K7B A;  2QDI A;  2WCE A;  2ERB A;  1MQ1 A;  2AMI A;  3NGV A;  1TNQ A;  2BCX A;  1SYM A;  2FJU B;  2BL0 C;  4GGF C;  2JT8 A;  2EC6 B;  2O5G A;  4PE1 A;  5DKN A;  1OZO A;  3B7A A;  3SG6 A;  1DJW A;  2BEC A;  2YGU A;  2M7L A;  4CFQ A;  5KTY A;  1KSO A;  1AJ5 A;  1L2O B;  1YRU B;  2HQ8 A;  2LVJ A;  2H2K A;  2M29 A;  3SIA A;  2GGM A;  1NPQ A;  3OB2 B;  4YBH B;  2NCP A;  3OBV A;  2ZNE A;  3NHT A;  4PAL A;  1YVL A;  2Y5I A;  1DGU A;  1LS8 A;  1UHI A;  2F33 A;  2I18 A;  2JPT A;  3EKH A;  3DXL A;  1CDP A;  2Q91 A;  3DD4 A;  4F7F A;  3CDN A;  3IQQ A;  1OMR A;  2KI6 D;  1KFU S;  1F4Q A;  1CKK A;  2CTN A;  3TUY B;  1BOC A;  5HKW A;  1TNX A;  1XO5 A;  3VRR A;  1J7Q A;  3S0E A;  1NCY A;  2F8P A;  2LAN A;  1G33 A;  1ALW A;  2LLS A;  3LK0 A;  4QJ3 B;  2KDH A;  4MBE A;  2VRG A;  1ZUZ A;  2JWW A;  1B8C A;  3CR4 X;  2L2E A;  1FPW A;  5AFP A;  1PVB A;  2COL B;  3N7H A;  1YRT B;  1SCM B;  1N2D A;  1JUO A;  1P28 A;  3BOW A;  3VRO A;  1OSA A;  1FBV A;  2M1U A;  1TUZ A;  2EGD A;  2I94 A;  2QEH A;  1YX7 A;  2V53 A;  4CID A;  4I5N B;  3DYE A;  1NWD A;  1S6J A;  5KSZ A;  2MLE C;  3D78 A;  1KK8 C;  3CYZ A;  2KFF A;  1E8A A;  5CSJ A;  3DVM A;  4XJK A;  3I5I C;  1CLM A;  2D8N A;  2KAV A;  1MXL C;  2Q4U A;  4A4B A;  1ZAC A;  1NCZ A;  1T14 A;  1SL9 A;  1WRZ A;  1N0Y A;  2HPS A;  1BLQ A;  1BR1 B;  2JTZ A;  3CLN A;  1WRK A;  3CGA A;  2L5X B;  1A75 A;  1QXP A;  3WXA A;  1K93 D;  3RM1 A;  1D1O A;  3D74 A;  1XVJ A;  1B9A A;  3SG2 A;  1QIW A;  1NX3 A;  5HLV A;  2AUC A;  4YGB B;  3EK4 A;  4INX A;  1K96 A;  1TUJ A;  5JOL A;  4NDC A;  3PAL A;  2MA2 A;  1CFD A;  3GOF A;  5EL2 A;  5DKQ A;  1KQV A;  4PCW A;  3BUO B;  3EG5 B;  5IBW A;  2MAZ A;  3OGN A;  2QEO A;  3FS7 A;  4I5L B;  1G8I A;  4MEW A;  2L50 A;  1WDC B;  3AAJ A;  3PAT A;  3EVU A;  4MLW A;  1AVS A;  3CZT X;  4YGC B;  1TCF A;  2H61 C;  1IG5 A;  2QEB A;  3PJI A;  1OZS A;  1BF5 A;  1QV1 A;  1UHJ A;  3IQO A;  3WNX B;  3VRP A;  1QX7 A;  2NXQ A;  3OX5 A;  3D73 A;  5CSI A;  3ZNI A;  2MLF C;  1NIW A;  3BFA A;  1AUI B;  3H4S E;  2F3Y A;  2CT9 A;  3R1P A;  5CPV A;  4P2Y B;  1FI5 A;  2KGB C;  4PHM A;  2PMY A;  1C7W A;  2KLE A;  3I5G B;  1UP5 A;  4USL A;  3I5F B;  2K7O A;  1KK7 Y;  2B1U A;  1ALV A;  2L0P A;  3JVT B;  1VRK A;  1TTX A;  2MHH A;  1KWO C;  2KBM A;  1NX1 A;  2WCK A;  1Y1A A;  3CAB A;  3KPX A;  3E3R A;  2PSR A;  1BJF A;  1U5I A;  2K0J A;  2LMV A;  3SS3 A;  4DRW A;  1WLZ A;  2JT0 A;  2OTG B;  1SR6 B;  1SRA A;  5DIC A;  3TZ1 A;  2KI6 C;  1CFF A;  1S5G Y;  2LCP A;  4HRH A;  4YI8 A;  3C1V A;  2QAC A;  2LVK A;  3SS5 A;  4R1E A;  2LP2 A;  1K9U A;  4NDD A;  2E6W A;  1DQE A;  2A4J A;  4OV2 A;  1JWD A;  2K8M B;  1FW4 A;  3Q8I A;  4JQ0 D;  1C3Z A;  4F0Z B;  3O4Y A;  2KFG A;  1QVI Y;  4M2O A;  2MJW B;  1JC2 A;  3BUX B;  2M8U A;  4GGF A;  1TWO A;  4L9M A;  1BR4 B;  1SCV A;  1ODB A;  1XK4 C;  1H4B A;  1KQM C;  2M9G A;  1QS7 A;  2JC2 A;  1SBJ A;  1JFK A;  2WCH A;  2WND A;  1MXE A;  4M2P A;  3VRN A;  3SG3 A;  3UNW A;  1TNW A;  1CFP A;  2KLD A;  2L4H A;  1ORG A;  5GQQ C;  4GUK A;  4IL1 A;  1F70 A;  1NCX A;  2LUX A;  2ZFD A;  4MSP A;  1XFW O;  1SNL A;  1LA0 A;  1SSE B;  1CTR A;  3R1V A;  1LIN A;  3M0W A;  2EC6 C;  1S6I A;  3GK2 A;  2CCM A;  2KHN A;  2KQY A;  1DF0 A;  1RJV A;  3TDZ A;  1TRF A;  1L2O C;  2LUC A;  2HET A;  3PLF B;  4XYN A;  4BY5 A;  1AHR A;  3IF7 A;  5B8I B;  3DVJ A;  2BKI B;  3R1O A;  1GJY A;  2NLN A;  4ORC B;  1NSH A;  2BAP A;  1A2X A;  2WOR A;  2JU0 A;  2LMT A;  1REC A;  4ORB B;  1OQP A;  1Y0V H;  1C3Y A;  1A4P A;  1CMG A;  2JZI A;  2CBL A;  2PAS A;  2DOQ A;  1OOG A;  1R6P A;  3VRQ A;  3AAK A;  1DJG A;  1JF2 A;  2RGI A;  4FQT A;  3TUY C;  2ZRT A;  3DVE A;  4N5X A;  1M45 A;  1SL8 A;  1J7P A;  1PSR A;  1PVA A;  3B87 A;  1A03 A;  4WQ3 A;  4BY4 A;  3O6B A;  1QX2 A;  2KOT A;  1B7T Y;  1Y1X A;  5G08 A;  1DGV A;  1IIO A;  2E30 A;  1M46 A;  3B86 A;  1KFX L;  2ZRS A;  2ZKM X;  3PSR A;  1RK9 A;  3NSO A;  4GFT A;  3OP0 A;  5CSF A;  1CDM A;  3WHU B;  1QLS A;  2BCA A;  5AAN A;  4DIR A;  4JD9 A;  2BBN A;  1BMO A;  1QAS A;  2LP3 A;  1SCM C;  1NX2 A;  2PVB A;  3L47 A;  2JXC A;  1MR8 A;  1IJ6 A;  1MHO A;  2EHB A;  4FTG A;  1S26 D;  4Q04 A;  2JQ6 A;  1CNP A;  1RTP 1;  1YX8 A;  2WCJ A;  1N65 A;  2P6B B;  3F45 A;  3PN7 B;  1OE9 B;  5FI7 A;  1PRW A;  5TNC A;  4PE4 A;  1YUR A;  3BOW B;  3SG4 A;  1JBA A;  3B6X A;  3S0A A;  4JKT A;  2GGZ A;  2WC8 A;  1OOH A;  3FE6 A;  1QWV A;  3HX4 A;  5I8N A;  3BUW B;  3CZ0 A;  1UUR A;  1XFZ O;  2K2F A;  1SL7 A;  2KYC A;  1SKT A;  1Z2C B;  3EVR A;  3L4A A;  1R2U A;  4OCI A;  4DCK A;  1TOP A;  4GNK B;  1IH0 A;  5PAL A;  2Y1N A;  1Z4H A;  3SIB A;  4XJK B;  1W7J B;  3JTD B;  1QTX A;  2ZN8 A;  4HRE E;  1DMO A;  3FE9 A;  1JFJ A;  2BKH B;  3ICB A;  3TS5 B;  3R72 A;  2M7N A;  1EG4 A;  1F54 A;  1LA3 A;  2LMU A;  2HQW A;  2WC6 A;  2H61 A;  1A75 B;  1CDL A;  1M63 B;  1K9K A;  1S36 A;  1F8H A;  2M97 A;  1Y1U A;  2MRD A;  5F6T A;  3VB1 A;  4IJ7 A;  1GGW A;  1DEL A;  2QEV A;  2MBX A;  1EH2 A;  2JUL A;  1IQ5 A;  1EG3 A;  1ZOT B;  3PM2 A;  2L2C A;  1WDC C;  5ER4 X;  1SK6 D;  2LE9 B;  1DT7 B;  1YTZ C;  2L98 A;  1OMV A;  2LV7 A;  3OX6 A;  2GTE A;  3SS4 A;  1KSM A;  4JWQ A;  1YR5 A;  2R2I A;  3S0D A;  1B4C A;  4C0L A;  1TCO B;  1AP4 A;  3DF0 A;  2JT3 A;  2F3Z A;  3KHE A;  4MZK A;  1UHN A;  5DKR A;  3BYA A;  4I5J A;  3WHT B;  2LM5 A;  3CWG A;  3QME A;  1IQ3 A;  1FF1 A;  1CDN A;  1LXF C;  1MF8 B;  1HQV A;  3O78 A;  4D1E A;  4ORA B;  3D0Y A;  4YRU A;  1OMD A;  3I5G C;  1IGV A;  2M1K B;  3I5F C;  3EK8 A;  5KU1 A;  2FCE A;  3PM8 A;  3FIA A;  4MRX A;  5D7F A;  5I2L A;  3RZS A;  3JVT C;  1J7R A;  2FJY A;  2K2A A;  2KI4 B;  2CXJ A;  4C0K A;  3A4U B;  3BQ3 A;  1CLL A;  5HKY A;  1XK4 A;  2OTG C;  1NYA A;  1SR6 C;  5AEQ A;  2P70 A;  1IKU A;  1EXR A;  1DJX A;  1QV0 A;  2OS8 B;  3BJH A;  3DZT A;  2KNE A;  3HCM A;  3TDI A;  1OOF A;  2KBI A;  4ZCV A;  2WCM A;  1Q80 A;  2G2B A;  4N1F A;  1DVI A;  3D76 A;  4GPL B;  1U5I B;  3I5H B;  1DJH A;  4HSZ A;  4QJ4 B;  1B47 A;  3D10 A;  2JNX A;  1JSA A;  2BE4 A;  1CM1 A;  4DS7 A;  5FI6 A;  1J1D A;  1ZMZ A;  4QJ5 B;  3CZ1 A;  1CB1 A;  1TIZ A;  5ER5 A;  1ZFS A;  5D69 A;  1J7O A;  1DJZ A;  1NX0 A;  1M39 A;  1X02 A;  4CPV A;  4NDB A;  1TN4 A;  2KQ6 A;  3NSL A;  3RLZ A;  1KCY A;  2BL0 B;  1XFV O;  2G9B A;  1A29 A;  2I7A A;  1XA5 A;  1CFC A;  4CLN A;  1UHK A;  2F2P A;  3D75 A;  2AAO A;  1J55 A;  4MZL A;  1QIV A;  3FWB A;  1IJ5 A;  1KFU L;  1CLB A;  3O2P A;  1LVC D; 
#chains in the Genus database with same CATH homology
 2IS9 A;  1CMF A;  3SG7 A;  5AXI A;  2HF5 A;  5FYX A;  1B1G A;  1F55 A;  4MRY A;  5JJG A;  4M2Q A;  2KAY A;  1XFY O;  2LNK A;  1B8R A;  3GK4 X;  4I5K A;  1JF0 A;  4YI9 A;  2SAS A;  2LHI A;  2OPO A;  1DF0 B;  3KF9 A;  4PHK A;  1YUT A;  1K95 A;  1W7I B;  2KGR A;  2ZND A;  2JOJ A;  1PSB A;  3K21 A;  1WRL A;  3LCP C;  3TDU A;  3ZWH A;  1AJ4 A;  1YUU A;  1QLK A;  1B8L A;  4PE0 A;  5I2Q A;  2NZ0 A;  2KAX A;  1IWQ A;  1YVH A;  1C07 A;  1YUS A;  2K61 A;  3PFV A;  3KO0 A;  4ZCU A;  1RFJ A;  3NSK A;  4AOM A;  1L7Z A;  3DVK A;  2LVI A;  4TNC A;  1DJY A;  2QPT A;  2M3W A;  1EL4 A;  1MWN A;  1PK0 D;  3EKJ A;  2LAP A;  2ZN9 A;  4WRI A;  1XYD A;  1DTL A;  4GGN A;  1LKJ A;  2GV5 A;  3CR2 A;  4OR9 B;  1KK8 B;  2M0R A;  3PN7 C;  1WY9 A;  1KFX S;  1UUS A;  3I5I B;  4NQG A;  1NUB A;  1S3P A;  3EK7 A;  2JRF A;  1XFU O;  1C7V A;  1K8U A;  1BOD A;  2JNF A;  1TNP A;  1KK7 Z;  2Y4Q A;  4PE7 A;  3AKB A;  4C0J A;  3SG5 A;  1CM4 A;  2NCO A;  2WCB A;  1AK8 A;  3LL8 B;  4N1G A;  2FOT A;  1J1E A;  2WOS A;  1S5G Z;  2L51 A;  1BT6 A;  1RRO A;  4U8D A;  3JTD C;  1S6C A;  4YGD B;  2Y1M A;  3TS5 C;  2KYF A;  4AQJ A;  1S1E A;  5K89 A;  4PDZ A;  5AER A;  1QVI Z;  4GAO A;  2F2O A;  4YGE B;  1MUX A;  3NSI A;  1SY9 A;  2LHL A;  4WQ2 A;  1F71 A;  2K7D A;  2JXL A;  4HRG A;  3BUM B;  1BG1 A;  2LVV A;  3CTN A;  1DJI A;  4OVN F;  4YGA A;  1GGZ A;  4CFR A;  4ICB A;  4GBA A;  1NP8 A;  2TN4 A;  1V1G A;  1QAT A;  3LK1 A;  1PAL A;  4AQI A;  5BPJ A;  1IRJ A;  2K7C A;  4PHN A;  1BU3 A;  1F4O A;  1V1F A;  3CR5 X;  5CSN A;  1K94 A;  2PRU A;  3MSE B;  3NXA A;  3CS1 A;  3VGO A;  1XFX O;  4P5O E;  2BE6 A;  2PAL A;  3OHM B;  1M31 A;  2JTT A;  1K9P A;  4DUQ A;  4A4C A;  1K90 D;  4PHJ A;  3BXK A;  5I2O A;  2I2R E;  3OB1 B;  2CNP A;  1PUL A;  1HT9 A;  3DF0 B;  2WCF A;  3EVV A;  5J3X A;  2BCB A;  1KWO B;  1QJT A;  1G4Y R;  2ISD A;  4UPG A;  1RWY A;  2SCP A;  3KEV A;  1EJ3 A;  4MZJ A;  2FCD A;  2KI4 C;  2KSP A;  1K2H A;  2L4I A;  5HLO A;  4FQO A;  4E68 A;  1SMG A;  3BUN B;  3LLE A;  4ETO A;  3D0Y B;  1SPY A;  4OKH A;  3SJS A;  1UWO A;  5HYD A;  4JPZ B;  4MVF A;  5HKZ A;  1H8B A;  1OOJ A;  1B7T Z;  2OS8 C;  1GQM A;  1QX5 B;  1UHH A;  3FWC A;  3A8R A;  2KFH A;  1WLM A;  3AKA A;  3I5H C;  1FI6 A;  1SW8 A;  2LLU A;  3GK1 A;  1KQM B;  2M49 B;  3QRX A;  2BBM A;  1Y6W A;  2LC5 A;  2LLT A;  4MN0 A;  2O60 A;  2K7B A;  2WCE A;  1MQ1 A;  2AMI A;  1TNQ A;  2BCX A;  1SYM A;  2FJU B;  2BL0 C;  4GGF C;  2JT8 A;  2EC6 B;  2O5G A;  4PE1 A;  5DKN A;  1OZO A;  3SG6 A;  2BEC A;  1DJW A;  4CFQ A;  2M7L A;  5KTY A;  1KSO A;  1AJ5 A;  1L2O B;  1YRU B;  2HQ8 A;  2LVJ A;  2H2K A;  2M29 A;  3SIA A;  2GGM A;  1NPQ A;  3OB2 B;  4YBH B;  2NCP A;  2ZNE A;  4PAL A;  1YVL A;  2Y5I A;  1DGU A;  1UHI A;  2F33 A;  2I18 A;  2JPT A;  3EKH A;  1CDP A;  2Q91 A;  3DD4 A;  3IQQ A;  1OMR A;  2KI6 D;  1KFU S;  1F4Q A;  1CKK A;  2CTN A;  3TUY B;  1BOC A;  5HKW A;  1TNX A;  1XO5 A;  3VRR A;  1J7Q A;  1NCY A;  2F8P A;  2LAN A;  1G33 A;  1ALW A;  2LLS A;  3LK0 A;  4QJ3 B;  2KDH A;  4MBE A;  2VRG A;  1ZUZ A;  2JWW A;  1B8C A;  3CR4 X;  2L2E A;  1FPW A;  5AFP A;  1PVB A;  2COL B;  1YRT B;  1SCM B;  1N2D A;  1JUO A;  3BOW A;  3VRO A;  1OSA A;  1FBV A;  2M1U A;  2EGD A;  2I94 A;  1YX7 A;  2V53 A;  4CID A;  4I5N B;  1NWD A;  1S6J A;  5KSZ A;  2MLE C;  1KK8 C;  5CSJ A;  2KFF A;  1E8A A;  3DVM A;  4XJK A;  3I5I C;  1CLM A;  2D8N A;  2KAV A;  1MXL C;  2Q4U A;  4A4B A;  1ZAC A;  1NCZ A;  1SL9 A;  1WRZ A;  1N0Y A;  2HPS A;  1BLQ A;  1BR1 B;  2JTZ A;  3CLN A;  1WRK A;  3CGA A;  2L5X B;  1A75 A;  1QXP A;  3WXA A;  1K93 D;  3RM1 A;  1D1O A;  1XVJ A;  1B9A A;  3SG2 A;  1QIW A;  1NX3 A;  5HLV A;  2AUC A;  4YGB B;  3EK4 A;  1K96 A;  5JOL A;  4NDC A;  3PAL A;  2MA2 A;  1CFD A;  3GOF A;  5DKQ A;  1KQV A;  4PCW A;  3BUO B;  5IBW A;  2MAZ A;  3FS7 A;  4I5L B;  1G8I A;  4MEW A;  2L50 A;  1WDC B;  3AAJ A;  3PAT A;  3EVU A;  4MLW A;  1AVS A;  3CZT X;  4YGC B;  1TCF A;  2H61 C;  1IG5 A;  1BF5 A;  1OZS A;  1QV1 A;  1UHJ A;  3IQO A;  3WNX B;  3VRP A;  1QX7 A;  2NXQ A;  3OX5 A;  5CSI A;  3ZNI A;  2MLF C;  1NIW A;  1AUI B;  3H4S E;  2F3Y A;  2CT9 A;  5CPV A;  4P2Y B;  1FI5 A;  2KGB C;  4PHM A;  2PMY A;  1C7W A;  3I5G B;  1UP5 A;  4USL A;  3I5F B;  2K7O A;  1KK7 Y;  2B1U A;  1ALV A;  2L0P A;  3JVT B;  1VRK A;  1TTX A;  2MHH A;  1KWO C;  2KBM A;  1NX1 A;  3KPX A;  1Y1A A;  3E3R A;  2PSR A;  1BJF A;  1U5I A;  2K0J A;  2LMV A;  4DRW A;  1WLZ A;  2JT0 A;  2OTG B;  1SR6 B;  1SRA A;  3TZ1 A;  1CFF A;  2KI6 C;  1S5G Y;  2LCP A;  4HRH A;  4YI8 A;  3C1V A;  2QAC A;  2LVK A;  4R1E A;  2LP2 A;  1K9U A;  4NDD A;  2E6W A;  4OV2 A;  2A4J A;  1JWD A;  2K8M B;  1FW4 A;  4JQ0 D;  4F0Z B;  3O4Y A;  2KFG A;  1QVI Y;  4M2O A;  2MJW B;  1JC2 A;  3BUX B;  2M8U A;  4GGF A;  4L9M A;  1BR4 B;  1SCV A;  1ODB A;  1XK4 C;  1H4B A;  1KQM C;  2M9G A;  1QS7 A;  2JC2 A;  1SBJ A;  1JFK A;  2WND A;  4M2P A;  1MXE A;  3VRN A;  1CFP A;  3SG3 A;  1TNW A;  2L4H A;  5GQQ C;  4GUK A;  4IL1 A;  1F70 A;  1NCX A;  2LUX A;  2ZFD A;  4MSP A;  1XFW O;  1SNL A;  1LA0 A;  1CTR A;  1LIN A;  3M0W A;  2EC6 C;  1S6I A;  3GK2 A;  2CCM A;  2KHN A;  2KQY A;  1DF0 A;  1RJV A;  3TDZ A;  1TRF A;  1L2O C;  2LUC A;  2HET A;  3PLF B;  4XYN A;  4BY5 A;  1AHR A;  3IF7 A;  5B8I B;  3DVJ A;  2BKI B;  1GJY A;  2NLN A;  4ORC B;  1NSH A;  1A2X A;  2WOR A;  2JU0 A;  2LMT A;  1REC A;  4ORB B;  1OQP A;  1Y0V H;  1A4P A;  1CMG A;  2JZI A;  2CBL A;  2PAS A;  2DOQ A;  1R6P A;  3VRQ A;  3AAK A;  1DJG A;  1JF2 A;  2RGI A;  3TUY C;  2ZRT A;  3DVE A;  4N5X A;  1M45 A;  1SL8 A;  1J7P A;  1PSR A;  1PVA A;  1A03 A;  4WQ3 A;  4BY4 A;  3O6B A;  1QX2 A;  2KOT A;  1B7T Y;  1Y1X A;  5G08 A;  1DGV A;  2E30 A;  1M46 A;  5CSF A;  1KFX L;  2ZRS A;  2ZKM X;  3PSR A;  1RK9 A;  3NSO A;  4GFT A;  3OP0 A;  3WHU B;  1CDM A;  1QLS A;  2BCA A;  5AAN A;  4DIR A;  2BBN A;  1BMO A;  1QAS A;  2LP3 A;  1SCM C;  1NX2 A;  2PVB A;  2JXC A;  1MR8 A;  1IJ6 A;  1MHO A;  2EHB A;  4FTG A;  1S26 D;  4Q04 A;  2JQ6 A;  1CNP A;  1RTP 1;  1YX8 A;  3PN7 B;  1N65 A;  2P6B B;  3F45 A;  5TNC A;  1OE9 B;  1PRW A;  4PE4 A;  1YUR A;  3BOW B;  3SG4 A;  1JBA A;  2GGZ A;  2WC8 A;  3HX4 A;  5I8N A;  3BUW B;  1UUR A;  1XFZ O;  2K2F A;  1SL7 A;  2KYC A;  1SKT A;  3EVR A;  4DCK A;  1R2U A;  4OCI A;  1TOP A;  4GNK B;  1IH0 A;  5PAL A;  2Y1N A;  3SIB A;  4XJK B;  1W7J B;  3JTD B;  1QTX A;  2ZN8 A;  4HRE E;  1DMO A;  1JFJ A;  2BKH B;  3ICB A;  3TS5 B;  2M7N A;  1EG4 A;  1F54 A;  1LA3 A;  2LMU A;  2HQW A;  2H61 A;  1A75 B;  1CDL A;  1M63 B;  1K9K A;  1S36 A;  1F8H A;  2M97 A;  1Y1U A;  2MRD A;  5F6T A;  1GGW A;  2MBX A;  1EH2 A;  2JUL A;  1IQ5 A;  1EG3 A;  1ZOT B;  1WDC C;  5ER4 X;  1SK6 D;  2LE9 B;  1DT7 B;  1YTZ C;  2L98 A;  1OMV A;  2LV7 A;  3OX6 A;  1KSM A;  4JWQ A;  1YR5 A;  2R2I A;  1B4C A;  4C0L A;  1TCO B;  1AP4 A;  3DF0 A;  2JT3 A;  2F3Z A;  3KHE A;  4MZK A;  1UHN A;  5DKR A;  3BYA A;  4I5J A;  3WHT B;  2LM5 A;  3CWG A;  1IQ3 A;  1FF1 A;  1CDN A;  1LXF C;  1MF8 B;  1HQV A;  3O78 A;  4D1E A;  4ORA B;  3D0Y A;  4YRU A;  1OMD A;  3I5G C;  1IGV A;  2M1K B;  3I5F C;  3EK8 A;  5KU1 A;  2FCE A;  3PM8 A;  3FIA A;  4MRX A;  5D7F A;  5I2L A;  3JVT C;  1J7R A;  2K2A A;  2KI4 B;  2CXJ A;  4C0K A;  3A4U B;  3BQ3 A;  1CLL A;  5HKY A;  1XK4 A;  2OTG C;  1NYA A;  1SR6 C;  5AEQ A;  1IKU A;  1EXR A;  1DJX A;  1QV0 A;  2OS8 B;  3HCM A;  2KNE A;  3TDI A;  2KBI A;  4ZCV A;  1Q80 A;  2G2B A;  4N1F A;  1DVI A;  4GPL B;  1U5I B;  3I5H B;  1DJH A;  4HSZ A;  4QJ4 B;  1B47 A;  3D10 A;  2JNX A;  1JSA A;  2BE4 A;  1CM1 A;  4DS7 A;  1J1D A;  1ZMZ A;  4QJ5 B;  1CB1 A;  1TIZ A;  5ER5 A;  1ZFS A;  5D69 A;  1J7O A;  1DJZ A;  1NX0 A;  1M39 A;  1X02 A;  4CPV A;  4NDB A;  1TN4 A;  2KQ6 A;  3NSL A;  3RLZ A;  1KCY A;  2BL0 B;  1XFV O;  2G9B A;  1A29 A;  2I7A A;  1XA5 A;  1CFC A;  4CLN A;  1UHK A;  2F2P A;  2AAO A;  1J55 A;  4MZL A;  1QIV A;  3FWB A;  1IJ5 A;  1KFU L;  1CLB A;  3O2P A;  1LVC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...