2Y5IA

S100z from zebrafish in complex with calcium
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
97
structure length
97
Chain Sequence
b'SKLEGAMDALITVFHNYSGSEGDKYKLSKGELKELLNAELTDFLMSQKDPMLVEKIMNDLDSNKDNEVDFNEFVVLVAALTVACNDFFQEQQKKRSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 CALCIUM BINDING PROTEIN Z
publication title The Crystal Structure of Zebrafish S100Z: Implications for Calcium-Promoted S100 Protein Oligomerisation.
pubmed doi rcsb
source organism Danio rerio
molecule tags Metal binding protein
total genus 39
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2y5iA00
3E3RA 1ZOTB 3BXKA 1HT9A 2ZNEA 1B4CA 3A8RA 2COLB 1W7JB 2M1KB 1CFPA 2LLTA 3KEVA 1K96A 2FOTA 4I5JA 3QRXA 1DJZA 2JNXA 2I18A 2Y1MA 1CM4A 2WNDA 4N1GA 5GQQC 2KAYA 1QTXA 2VRGA 4HREE 1FPWA 3O78A 1K9UA 1KFXS 1KFXL 5KTYA 3SG4A 3LL8B 1CDLA 3SIAA 3WXAA 4UPGA 2CCMA 3CLNA 3JTDB 2CT9A 3I5GC 1B8RA 1AJ4A 4NDDA 2BBNA 2IS9A 5FYXA 3DVEA 1QJTA 2F2OA 1HQVA 1CLBA 3EK4A 4TNCA 1WRZA 5KSZA 3D0YA 1YRUB 1IG5A 4HSZA 1OOJA 4U8DA 3C1VA 5HLOA 1BF5A 4Q04A 1XA5A 2M1UA 1OMVA 2ZFDA 4PHJA 3TDUA 1TTXA 1YURA 1UHNA 2F8PA 1NUBA 1QASA 5CSIA 4MSPA 1RJVA 5I8NA 3I5FC 1DGVA 2I94A 1TRFA 2KFFA 3EVUA 3GOFA 1CKKA 3GK2A 2KBIA 2EC6B 3D0YB 3PN7C 5I2LA 1TNWA 1J7QA 1LINA 5CSFA 1YUUA 2K7BA 1C7VA 2KI4C 1SYMA 1CNPA 1DTLA 1IJ5A 1ZMZA 4BY5A 1YRTB 5CSJA 1AVSA 1G8IA 5KU1A 2G2BA 2LAPA 1CM1A 1EXRA 5TNCA 1NPQA 3OB1B 4NQGA 5F6TA 5HLVA 1GQMA 1W7IB 3CWGA 1OMDA 1A4PA 2K8MB 1CLMA 1KK8C 1OE9B 4DCKA 1DJGA 1BU3A 1S6CA 2L0PA 1SBJA 4MLWA 1J1DA 1R2UA 4C0KA 4ORAB 4YGCB 2PALA 2LP2A 1DF0A 1S26D 1C7WA 2LVIA 2KOTA 1H4BA 3O2PA 3O6BA 5J3XA 4PE1A 3PALA 1CDMA 1F4OA 4P5OE 5G08A 1OQPA 1WLMA 1M39A 3OX6A 5I2OA 4GAOA 2NZ0A 3SG2A 1SY9A 1DJXA 4A4BA 3F45A 2JZIA 4MRXA 3M0WA 2WC8A 1Y6WA 4GBAA 2BE4A 2LV7A 1OSAA 3EK8A 2HQWA 3CTNA 2PRUA 2LMUA 1AUIB 2L2EA 3IQQA 1KCYA 1F70A 4PCWA 1JUOA 3MSEB 3PATA 1QV1A 3VRQA 1UURA 1YX7A 1XK4A 4QJ4B 5B8IB 3OX5A 2MBXA 2BL0B 1WY9A 1KQMC 1KQMB 3AAJA 1BT6A 1IGVA 1B7TY 1KWOC 3RLZA 4PE4A 1CDNA 1XYDA 3TS5B 2JC2A 1RTP1 1YUSA 3JVTC 2KGRA 1N2DA 2KI6C 1QIWA 2GGZA 1UP5A 2JULA 4I5KA 4P2YB 3SG3A 1MUXA 1KK7Z 2M9GA 4JPZB 4GGNA 5AEQA 1CFCA 1XK4C 2A4JA 2M7LA 3NXAA 1TIZA 3SJSA 1QX2A 2CBLA 1NX2A 1PVAA 4F0ZB 1WRKA 1PSBA 2MRDA 2NCOA 4YGBB 1IQ5A 1BMOA 1ZACA 3DF0B 5ER5A 2MAZA 4OR9B 4OV2A 2QACA 1NCXA 2KSPA 3SG5A 4PALA 1NX0A 1CMGA 1JC2A 2P6BB 1BR1B 2KNEA 1JWDA 1RECA 2LM5A 1TNXA 3ZWHA 1A2XA 1S6IA 4ORBB 1ZFSA 4E68A 2SASA 2R2IA 2ZKMX 3GK1A 1F55A 1M63B 1TCFA 1RROA 1V1FA 3ICBA 3O4YA 2OTGC 2JU0A 3FIAA 1F4QA 2OS8C 4YI8A 1GGWA 1Y0VH 4C0LA 1UWOA 1S3PA 1PVBA 2Y4QA 3CGAA 1SKTA 1J55A 3I5GB 1S5GY 3TUYC 1CLLA 5HKZA 2F3YA 2HPSA 3EKJA 1F8HA 3PFVA 2FCDA 2WCBA 2K7OA 1ALVA 3CS1A 2LHLA 1V1GA 1XFWO 3OHMB 2LVJA 1OMRA 4YGAA 2KAVA 1MHOA 1CB1A 1SL7A 4NDBA 2JRFA 3AAKA 4FTGA 2MLEC 2AMIA 1B8LA 4USLA 2LMVA 5AFPA 2H61A 2LVVA 3FWCA 3KF9A 1S6JA 2WORA 4GFTA 4OVNF 3I5FB 1FF1A 1XFXO 1KFUS 1KFUL 1Y1AA 2KYFA 1QX7A 2LMTA 4AQJA 2K7CA 2Q91A 1DJIA 3DVJA 3PN7B 1ZUZA 2ZN8A 1PALA 2KI4B 4GNKB 3HX4A 1B47A 1DVIA 2H61C 1XFUO 1QXPA 2CXJA 2LP3A 3GK4X 1IWQA 3LK0A 2KYCA 1A75A 2M29A 1CTRA 5AANA 1KSOA 1MXEA 1OZSA 1SK6D 2KDHA 2CNPA 1KK8B 1M45A 4XYNA 1LA0A 4FQOA 3TDZA 1JBAA 3WNXB 4GPLB 3KO0A 5CSNA 4MRYA 1WDCC 3SG6A 1NCYA 2DOQA 4CIDA 2M8UA 2EGDA 1G33A 2KFGA 1U5IA 2LCPA 1SPYA 1PK0D 4ORCB 2L4HA 3I5HC 1BOCA 2Y1NA 1RWYA 2O60A 4I5NB 1UUSA 1YR5A 3BUMB 2BCBA 2JT3A 4BY4A 1Y1UA 2KBMA 3BUXB 2JT0A 3DVKA 1MF8B 4N1FA 1AJ5A 4YGDB 2K2FA 1KSMA 4R1EA 1DF0B 3I5IC 2I2RE 2JOJA 4MVFA 2SCPA 1Q80A 4GGFA 1DJHA 1EG4A 3SIBA 1J7OA 1SR6C 3LK1A 2WOSA 1UHIA 1SL9A 2GV5A 4M2QA 1TNPA 3RM1A 3WHUB 1YX8A 1PULA 1SRAA 1UHJA 1KWOB 2ISDA 1B8CA 1NWDA 1G4YR 3JVTB 3K21A 4GGFC 2BKHB 2K7DA 2O5GA 4PE0A 3LLEA 4NDCA 2WCFA 2NXQA 2K2AA 1CFDA 1XFZO 3H4SE 3BOWA 4ZCUA 1F54A 1XO5A 1LXFC 2LE9B 1MQ1A 4PHMA 1EH2A 1JSAA 5BPJA 2JPTA 1K94A 2JTZA 1S1EA 1S36A 2HQ8A 5AERA 1JF2A 4CFRA 2KHNA 1BLQA 1C07A 1JFJA 5HKYA 1QATA 1YVHA 1E8AA 3LCPC 4HRHA 1QVIY 2PMYA 1AK8A 2LLSA 5IBWA 1IQ3A 1FI6A 1LKJA 2Y5IA 1PSRA 1J7PA 3BUWB 2FCEA 1AP4A 5D69A 2F33A 3BQ3A 3BUOB 4YI9A 1CFFA 2LNKA 3IQOA 5CPVA 4DS7A 4AQIA 4MEWA 3KPXA 1NIWA 4WQ2A 1PRWA 1BR4B 4YGEB 2OTGB 1BJFA 1JFKA 2OS8B 2GGMA 1N0YA 5I2QA 5DKRA 1KQVA 1YUTA 3VROA 3VRNA 1IRJA 3BYAA 3TUYB 2JXLA 2BECA 1UHKA 2MA2A 5AXIA 3TZ1A 3VRPA 5PALA 1M31A 2TN4A 2G9BA 3TDIA 1AHRA 3A4UB 3IF7A 1NSHA 1RK9A 2HETA 2KGBC 2ZN9A 2ZNDA 2I7AA 3CR4X 3BUNB 2JTTA 1QIVA 2M0RA 1A03A 1F71A 1SMGA 3EVVA 1YTZC 1D1OA 1QS7A 5HKWA 1KK7Y 1NCZA 4MN0A 2M7NA 3OB2B 4AOMA 2LLUA 3JTDC 4PDZA 2M97A 5ER4X 1LVCD 1Y1XA 3DVMA 5HYDA 1XFVO 3AKBA 4JWQA 4OKHA 4QJ3B 2MJWB 1FBVA 4MZKA 1GGZA 1SCMC 1SCMB 3VRRA 2NCPA 1MXLC 2D8NA 4MBEA 2LANA 2JNFA 2ZRSA 1TOPA 2JXCA 4MZLA 2E30A 2KQ6A 5DKQA 4XJKA 1QX5B 2JT8A 1B9AA 3VGOA 1NP8A 1SW8A 3EKHA 4PHKA 2BCXA 4M2OA 3EK7A 3PLFB 1K93D 2KI6D 2JQ6A 1K9KA 1DT7B 1M46A 4CFQA 2L5XB 4IL1A 5DKNA 1B7TZ 2WCEA 4D1EA 2EHBA 1TCOB 2EC6C 1WDCB 3NSIA 1IJ6A 1DJWA 2F2PA 2L4IA 1JF0A 4N5XA 4XJKB 4YRUA 3WHTB 1VRKA 4PHNA 4ICBA 1QLKA 1EG3A 2PASA 2BKIB 3DD4A 1EJ3A 1N65A 3I5HB 1BG1A 1MR8A 1A75B 2V53A 2AAOA 3FWBA 1NYAA 4DRWA 1K2HA 4M2PA 4OCIA 4I5LB 1SL8A 1L7ZA 1ODBA 1EL4A 2LUXA 4CLNA 2OPOA 3NSLA 2L50A 1J7RA 3I5IB 1X02A 1XFYO 4GUKA 3AKAA 1DGUA 3SG7A 4DIRA 1U5IB 1SR6B 1QVIZ 3NSKA 3ZNIA 1BODA 2H2KA 4A4CA 3CZTX 2KAXA 1CMFA 2K61A 2LC5A 4WRIA 3CR5X 2MHHA 1DMOA 2KFHA 5JOLA 4YBHB 2M3WA 1WRLA 1J1EA 1TNQA 1LA3A 1XVJA 2F3ZA 1FW4A 2Q4UA 1K8UA 1K9PA 2LVKA 4JQ0D 5JJGA 3FS7A 2KQYA 2NLNA 4MZJA 2QPTA 1IH0A 1K95A 1MWNA 2ZRTA 2K0JA 1OZOA 3NSOA 2PVBA 3PM8A 1TN4A 1L2OC 1L2OB 1S5GZ 2FJUB 2LUCA 3HCMA 2CTNA 4ETOA 2BL0C 1SNLA 2HF5A 2AUCA 3CR2A 2E6WA 3TS5C 1WLZA 1K90D 1YVLA 4C0JA 3DF0A 3KHEA 1QLSA 2MLFC 3OP0A 2BBMA 2M49B 4PE7A 1ALWA 2BE6A 2LHIA 1A29A 3D10A 3PSRA 3BOWB 4WQ3A 1NX1A 2L51A 4DUQA 5K89A 4QJ5B 2JWWA 1NX3A 4L9MA 1SCVA 2BCAA 2B1UA 4CPVA 1QV0A 1FI5A 1CDPA 2PSRA 5D7FA 1B1GA 1H8BA 1RFJA 1UHHA 1DJYA 4ZCVA 2L98A 1IKUA 1GJYA 2RGIA 4HRGA 1R6PA 3EVRA
chains in the Genus database with same CATH superfamily
3E3RA 1ZOTB 3BXKA 1TWOA 1HT9A 2P70A 2ZNEA 1B4CA 3A8RA 2COLB 1W7JB 2M1KB 1CFPA 2LLTA 3KEVA 1K96A 4JD9A 2FOTA 3S0EA 4I5JA 3QRXA 1DJZA 2JNXA 2I18A 2Y1MA 1CM4A 2WNDA 4N1GA 5GQQC 2KAYA 1QTXA 2VRGA 3OBVA 3PM2A 4HREE 1FPWA 2WCLA 3O78A 1K9UA 1KFXS 1KFXL 5KTYA 3SG4A 3LL8B 1CDLA 3SIAA 3WXAA 4UPGA 2CCMA 3CLNA 3JTDB 2CT9A 3I5GC 3Q8IA 1B8RA 1AJ4A 4NDDA 2BBNA 2IS9A 5FYXA 3DVEA 1QJTA 2F2OA 3V2LA 1HQVA 1CLBA 3D76A 3EK4A 3S0GA 4TNCA 1WRZA 5KSZA 3D0YA 1YRUB 1IG5A 4HSZA 3NHIA 1OOJA 4U8DA 3C1VA 5HLOA 1BF5A 2WCKA 1XA5A 4Q04A 2QDIA 3B86A 2M1UA 1OMVA 2ZFDA 4PHJA 3TDUA 1ORGA 1TTXA 1YURA 1UHNA 2F8PA 1NUBA 1QASA 5CSIA 4MSPA 1RJVA 5I8NA 3I5FC 1DGVA 2I94A 1TRFA 2KFFA 3EVUA 3GOFA 1CKKA 3GK2A 2KBIA 4F7FA 2EC6B 3D0YB 3PN7C 5I2LA 1TNWA 2PQLA 1J7QA 1LINA 2KLDA 5CSFA 1DC1A 1YUUA 2K7BA 1C7VA 2KI4C 1SYMA 1CNPA 1DTLA 1IJ5A 1ZMZA 4BY5A 1DELA 3FE9A 1YRTB 5CSJA 1AVSA 3CDNA 1G8IA 5KU1A 2G2BA 2LAPA 1CM1A 1EXRA 2WC5A 5TNCA 1NPQA 3OB1B 4NQGA 5F6TA 5HLVA 1GQMA 1W7IB 3CWGA 1OMDA 1A4PA 2K8MB 1CLMA 1KK8C 1OE9B 1SSEB 4DCKA 3IVTA 1DJGA 1BU3A 1S6CA 2L0PA 1SBJA 4MLWA 1J1DA 1R2UA 4C0KA 4ORAB 4YGCB 2PALA 2LP2A 1DF0A 1S26D 1C7WA 2LVIA 2KOTA 1H4BA 3O2PA 1OOFA 3O6BA 5J3XA 4PE1A 3PALA 1CDMA 1F4OA 4P5OE 3FE8A 5G08A 1OQPA 1WLMA 3D75A 1M39A 3OX6A 5I2OA 4GAOA 2NZ0A 3SG2A 1SY9A 1DJXA 2GTEA 4A4BA 4JKTA 3F45A 1C3YA 2JZIA 4MRXA 3M0WA 2WC8A 1Y6WA 4GBAA 2BE4A 2LV7A 1OSAA 3EK8A 1T14A 2HQWA 3CTNA 2PRUA 2LMUA 1AUIB 2L2EA 3IQQA 1KCYA 1F70A 4PCWA 1JUOA 3MSEB 3N7HA 3PATA 1P28A 1QV1A 3VRQA 2BNXA 1UURA 1YX7A 1XK4A 4QJ4B 3SS3A 5B8IB 3OX5A 2MBXA 2BL0B 1WY9A 1KQMC 1KQMB 3AAJA 1BT6A 1IGVA 1B7TY 1KWOC 3RLZA 4PE4A 1CDNA 1XYDA 3TS5B 2JC2A 1RTP1 1YUSA 3JVTC 2KGRA 1N2DA 2KI6C 1Z2CB 1QIWA 2GGZA 1UP5A 2JULA 4I5KA 4P2YB 3SG3A 1MUXA 1KK7Z 1OW4A 2M9GA 4GGNA 4JPZB 5AEQA 1CFCA 1XK4C 2A4JA 3NGVA 2M7LA 3NXAA 1TIZA 3SJSA 1QX2A 2CBLA 1NX2A 1PVAA 4F0ZB 1WRKA 1PSBA 2MRDA 2QEBA 2NCOA 4YGBB 1IQ5A 1BMOA 1ZACA 3DF0B 3L47A 5ER5A 2MAZA 4OR9B 4OV2A 2QACA 2KPHA 1NCXA 2KSPA 3DZTA 4PALA 1NX0A 3SG5A 3S0FA 1CMGA 2P6BB 1JC2A 1BR1B 2KNEA 1JWDA 1RECA 2LM5A 3QMEA 1TNXA 3ZWHA 1A2XA 1S6IA 4ORBB 1ZFSA 3CYZA 4E68A 2SASA 2R2IA 2ZKMX 3GK1A 1F55A 1M63B 1TCFA 1RROA 1V1FA 3ICBA 3O4YA 2OTGC 2JU0A 3FIAA 1F4QA 2OS8C 4YI8A 1GGWA 1Y0VH 4C0LA 1UWOA 3CABA 4OZDA 1S3PA 1PVBA 2Y4QA 3CGAA 3CZ2A 1SKTA 1J55A 3I5GB 1S5GY 3TUYC 1CLLA 3O4XA 5HKZA 2F3YA 2HPSA 3EKJA 3CZ0A 1F8HA 3PFVA 1W9ZA 3PJIA 5I94A 2FCDA 2WCBA 2K7OA 1OOHA 1ALVA 3CS1A 2LHLA 2WCMA 1V1GA 1XFWO 3OHMB 2ERBA 3DXLA 2LVJA 3S0AA 1OMRA 4YGAA 2KAVA 1MHOA 3L4LA 1CB1A 1SL7A 4NDBA 2JRFA 3AAKA 4FTGA 2MLEC 2AMIA 1B8LA 2WCHA 3BJHA 4USLA 2LMVA 5AFPA 2H61A 2LVVA 3FWCA 3KF9A 1S6JA 2WORA 4GFTA 4OVNF 3I5FB 1FF1A 1XFXO 1KFUS 1KFUL 1Y1AA 2KYFA 1QX7A 2LMTA 2YGUA 4AQJA 2K7CA 2Q91A 1DJIA 3FE6A 3DVJA 3PN7B 1ZUZA 2ZN8A 1PALA 3B87A 2KI4B 4GNKB 3HX4A 1B47A 1DVIA 2H61C 1XFUO 1QXPA 2CXJA 3D74A 2LP3A 3GK4X 1IWQA 4KYNA 3LK0A 2KYCA 1A75A 2M29A 1CTRA 5AANA 3K1EA 1KSOA 1MXEA 1OZSA 1SK6D 2KDHA 2CNPA 1LS8A 1KK8B 1M45A 4XYNA 1LA0A 4FQOA 3TDZA 1JBAA 3WNXB 4GPLB 3KO0A 5CSNA 4MRYA 1WDCC 3SG6A 1NCYA 2DOQA 4CIDA 2M8UA 2EGDA 1G33A 2KFGA 1U5IA 2LCPA 1SPYA 1PK0D 4ORCB 2L4HA 3I5HC 1BOCA 1OOIX 2Y1NA 1RWYA 2O60A 4I5NB 1UUSA 1YR5A 3BUMB 2BCBA 2JT3A 4BY4A 2P71A 5FI7A 1Y1UA 2KBMA 3BUXB 1TUZA 2JT0A 3DVKA 1MF8B 2WCJA 4N1FA 1AJ5A 3UO9A 4YGDB 2K2FA 1KSMA 4R1EA 1DF0B 3I5IC 3B7AA 2I2RE 2JOJA 4MVFA 2SCPA 1Q80A 4GGFA 1DJHA 1EG4A 3R1VA 3R72A 3SIBA 1SR6C 3LK1A 2WOSA 1J7OA 1UHIA 1SL9A 2GV5A 4INXA 4M2QA 3EG5B 1TNPA 3RM1A 2WC6A 3WHUB 1YX8A 1PULA 2BAPA 1SRAA 1UHJA 1KWOB 2ISDA 1B8CA 1NWDA 1G4YR 3JVTB 3K21A 4GGFC 2BKHB 3DY9A 2K7DA 2O5GA 4PE0A 3LLEA 4NDCA 2WCFA 2NXQA 2K2AA 3SS5A 2QEVA 1CFDA 1XFZO 3H4SE 3BOWA 4ZCUA 4PT1A 1XO5A 1F54A 1LXFC 2LE9B 1MQ1A 4PHMA 1EH2A 1JSAA 5BPJA 2JPTA 1K94A 2JTZA 1S1EA 3D77A 1S36A 2HQ8A 5AERA 1JF2A 4CFRA 3VB1A 2KHNA 1BLQA 1C07A 1JFJA 5HKYA 1QATA 1YVHA 1E8AA 2FJYA 3LCPC 1QVIY 2PMYA 4HRHA 2LLSA 5IBWA 1AK8A 1IQ3A 1LKJA 1FI6A 2Y5IA 1PSRA 1J7PA 3BUWB 2FCEA 3R1PA 1AP4A 5D69A 2F33A 3BQ3A 3BUOB 4YI9A 1CFFA 2LNKA 2L2CA 3IQOA 5CPVA 4DS7A 4AQIA 4MEWA 3KPXA 1NIWA 4WQ2A 1PRWA 2H8VA 1DEKA 1BR4B 4YGEB 2OTGB 1BJFA 1JFKA 2OS8B 2GGMA 1N0YA 5I2QA 5DKRA 5DICA 1KQVA 1YUTA 2KLEA 3VRNA 1IRJA 3CZ1A 3VROA 3RZSA 1C3ZA 3BYAA 2JXLA 2BECA 1UHKA 2MA2A 5AXIA 3TUYB 3TZ1A 3VRPA 5PALA 1M31A 2TN4A 2G9BA 3BFHA 3TDIA 1AHRA 3A4UB 3IF7A 1NSHA 1RK9A 1Z4HA 2HETA 2KGBC 2ZN9A 2ZNDA 2I7AA 3CR4X 3BUNB 2JTTA 2K60A 1QIVA 4FQTA 2M0RA 1A03A 1F71A 1SMGA 3EVVA 1YTZC 1D1OA 1XFRA 1QS7A 5HKWA 1KK7Y 1NCZA 4MN0A 2M7NA 3OB2B 4AOMA 2LLUA 3JTDC 4INWA 4PDZA 2M97A 5ER4X 1LVCD 1Y1XA 3DVMA 5HYDA 1XFVO 3AKBA 4JWQA 2JPOA 4OKHA 2MJWB 4QJ3B 1FBVA 4MZKA 1GGZA 1SCMC 1SCMB 2L5YA 3VRRA 2NCPA 3D73A 1MXLC 2D8NA 4MBEA 2LANA 2JNFA 2ZRSA 1TOPA 2JXCA 4MZLA 2E30A 2KQ6A 5DKQA 4XJKA 1QX5B 2JT8A 1B9AA 3VGOA 1NP8A 1SW8A 3EKHA 1IIOA 4PHKA 2BCXA 4M2OA 3EK7A 3PLFB 1K93D 2KI6D 2JQ6A 1K9KA 1DT7B 1M46A 4CFQA 2L5XB 4IL1A 5DKNA 1B7TZ 1TUJA 2WCEA 4D1EA 2EHBA 1TCOB 2EC6C 1WDCB 3NSIA 1IJ6A 1DJWA 2F2PA 2L4IA 1JF0A 4N5XA 4XJKB 5FI2A 4YRUA 5HL1A 3WHTB 1VRKA 4IJ7A 4ICBA 4PHNA 1QLKA 1EG3A 2PASA 2BKIB 3DD4A 1EJ3A 1N65A 3I5HB 1BG1A 1MR8A 1A75B 2V53A 2AAOA 3FWBA 1NYAA 4DRWA 1K2HA 4M2PA 4OCIA 4I5LB 1SL8A 1L7ZA 1ODBA 1EL4A 2LUXA 4CLNA 2OPOA 3BFBA 3NSLA 2L50A 1J7RA 3I5IB 1X02A 1XFYO 4GUKA 3AKAA 1DGUA 3S0DA 3SG7A 4DIRA 1U5IB 3BFAA 1SR6B 1QVIZ 3NSKA 3ZNIA 1GM0A 1BODA 2H2KA 2PYQA 4A4CA 3CZTX 2KAXA 1CMFA 2K61A 2LC5A 4WRIA 3CR5X 2MHHA 1DMOA 2KFHA 5JOLA 4YBHB 2M3WA 1WRLA 1J1EA 1TNQA 5EL2A 1LA3A 1XVJA 2F3ZA 1FW4A 2Q4UA 1K8UA 1K9PA 2LVKA 4JQ0D 3B88A 5JJGA 3FS7A 2KQYA 2NLNA 4MZJA 2QPTA 1IH0A 1K95A 1MWNA 2ZRTA 2K0JA 3NHTA 1OZOA 3B6XA 3NSOA 2PVBA 3PM8A 1TN4A 2QEHA 1L2OC 1L2OB 1S5GZ 2FJUB 2LUCA 3HCMA 2CTNA 4ETOA 2BL0C 1SNLA 1OOGA 2HF5A 2AUCA 3R1OA 3L4AA 3CR2A 2E6WA 3TS5C 1WLZA 1K90D 1YVLA 4C0JA 3DF0A 3KHEA 1QLSA 2MLFC 3OP0A 2BBMA 2M49B 5D3OA 4PE7A 1ALWA 3DYEA 5FI6A 2BE6A 1QWVA 2LHIA 1A29A 3D10A 3PSRA 3BOWB 4WQ3A 3SS4A 1NX1A 2L51A 4DUQA 5K89A 4QJ5B 2JWWA 1NX3A 3D78A 4L9MA 1SCVA 2B1UA 2BCAA 4CPVA 1QV0A 2QEOA 1FI5A 1CDPA 2PSRA 5D7FA 1B1GA 3UNWA 1H8BA 1DQEA 1RFJA 1UHHA 1DJYA 4ZCVA 2L98A 1IKUA 1GJYA 2RGIA 4HRGA 1R6PA 3EVRA 3S0BA 3OGNA
chains in the Genus database with same CATH topology
3E3RA 1ZOTB 3BXKA 1HT9A 2ZNEA 1B4CA 3A8RA 2COLB 1W7JB 2M1KB 1CFPA 2LLTA 3KEVA 1K96A 2FOTA 4I5JA 3QRXA 1DJZA 2JNXA 2I18A 2Y1MA 1CM4A 2WNDA 4N1GA 5GQQC 2KAYA 1QTXA 2VRGA 4HREE 1FPWA 3O78A 1K9UA 1KFXS 1KFXL 5KTYA 3SG4A 3LL8B 1CDLA 3SIAA 3WXAA 4UPGA 2CCMA 3CLNA 3JTDB 2CT9A 3I5GC 1B8RA 1AJ4A 4NDDA 2BBNA 2IS9A 5FYXA 3DVEA 1QJTA 2F2OA 1HQVA 1CLBA 3EK4A 4TNCA 1WRZA 5KSZA 3D0YA 1YRUB 1IG5A 4HSZA 1OOJA 4U8DA 3C1VA 5HLOA 1BF5A 4Q04A 1XA5A 2M1UA 1OMVA 2ZFDA 4PHJA 3TDUA 1TTXA 1YURA 1UHNA 2F8PA 1NUBA 1QASA 5CSIA 4MSPA 1RJVA 5I8NA 3I5FC 1DGVA 2I94A 1TRFA 2KFFA 3EVUA 3GOFA 1CKKA 3GK2A 2KBIA 2EC6B 3D0YB 3PN7C 5I2LA 1TNWA 1J7QA 1LINA 5CSFA 1YUUA 2K7BA 1C7VA 2KI4C 1SYMA 1CNPA 1DTLA 1IJ5A 1ZMZA 4BY5A 1YRTB 5CSJA 1AVSA 1G8IA 5KU1A 2G2BA 2LAPA 1CM1A 1EXRA 5TNCA 1NPQA 3OB1B 4NQGA 5F6TA 5HLVA 1GQMA 1W7IB 3CWGA 1OMDA 1A4PA 2K8MB 1CLMA 1KK8C 1OE9B 4DCKA 1DJGA 1BU3A 1S6CA 2L0PA 1SBJA 4MLWA 1J1DA 1R2UA 4C0KA 4ORAB 4YGCB 2PALA 2LP2A 1DF0A 1S26D 1C7WA 2LVIA 2KOTA 1H4BA 3O2PA 3O6BA 5J3XA 4PE1A 3PALA 1CDMA 1F4OA 4P5OE 5G08A 1OQPA 1WLMA 1M39A 3OX6A 5I2OA 4GAOA 2NZ0A 3SG2A 1SY9A 1DJXA 4A4BA 3F45A 2JZIA 4MRXA 3M0WA 2WC8A 1Y6WA 4GBAA 2BE4A 2LV7A 1OSAA 3EK8A 2HQWA 3CTNA 2PRUA 2LMUA 1AUIB 2L2EA 3IQQA 1KCYA 1F70A 4PCWA 1JUOA 3MSEB 3PATA 1QV1A 3VRQA 1UURA 1YX7A 1XK4A 4QJ4B 5B8IB 3OX5A 2MBXA 2BL0B 1WY9A 1KQMC 1KQMB 3AAJA 1BT6A 1IGVA 1B7TY 1KWOC 3RLZA 4PE4A 1CDNA 1XYDA 3TS5B 2JC2A 1RTP1 1YUSA 3JVTC 2KGRA 1N2DA 2KI6C 1QIWA 2GGZA 1UP5A 2JULA 4I5KA 4P2YB 3SG3A 1MUXA 1KK7Z 2M9GA 4JPZB 4GGNA 5AEQA 1CFCA 1XK4C 2A4JA 2M7LA 3NXAA 1TIZA 3SJSA 1QX2A 2CBLA 1NX2A 1PVAA 4F0ZB 1WRKA 1PSBA 2MRDA 2NCOA 4YGBB 1IQ5A 1BMOA 1ZACA 3DF0B 5ER5A 2MAZA 4OR9B 4OV2A 2QACA 1NCXA 2KSPA 3SG5A 4PALA 1NX0A 1CMGA 1JC2A 2P6BB 1BR1B 2KNEA 1JWDA 1RECA 2LM5A 1TNXA 3ZWHA 1A2XA 1S6IA 4ORBB 1ZFSA 4E68A 2SASA 2R2IA 2ZKMX 3GK1A 1F55A 1M63B 1TCFA 1RROA 1V1FA 3ICBA 3O4YA 2OTGC 2JU0A 3FIAA 1F4QA 2OS8C 4YI8A 1GGWA 1Y0VH 4C0LA 1UWOA 1S3PA 1PVBA 2Y4QA 3CGAA 1SKTA 1J55A 3I5GB 1S5GY 3TUYC 1CLLA 5HKZA 2F3YA 2HPSA 3EKJA 1F8HA 3PFVA 2FCDA 2WCBA 2K7OA 1ALVA 3CS1A 2LHLA 1V1GA 1XFWO 3OHMB 2LVJA 1OMRA 4YGAA 2KAVA 1MHOA 1CB1A 1SL7A 4NDBA 2JRFA 3AAKA 4FTGA 2MLEC 2AMIA 1B8LA 4USLA 2LMVA 5AFPA 2H61A 2LVVA 3FWCA 3KF9A 1S6JA 2WORA 4GFTA 4OVNF 3I5FB 1FF1A 1XFXO 1KFUS 1KFUL 1Y1AA 2KYFA 1QX7A 2LMTA 4AQJA 2K7CA 2Q91A 1DJIA 3DVJA 3PN7B 1ZUZA 2ZN8A 1PALA 2KI4B 4GNKB 3HX4A 1B47A 1DVIA 2H61C 1XFUO 1QXPA 2CXJA 2LP3A 3GK4X 1IWQA 3LK0A 2KYCA 1A75A 2M29A 1CTRA 5AANA 1KSOA 1MXEA 1OZSA 1SK6D 2KDHA 2CNPA 1KK8B 1M45A 4XYNA 1LA0A 4FQOA 3TDZA 1JBAA 3WNXB 4GPLB 3KO0A 5CSNA 4MRYA 1WDCC 3SG6A 1NCYA 2DOQA 4CIDA 2M8UA 2EGDA 1G33A 2KFGA 1U5IA 2LCPA 1SPYA 1PK0D 4ORCB 2L4HA 3I5HC 1BOCA 2Y1NA 1RWYA 2O60A 4I5NB 1UUSA 1YR5A 3BUMB 2BCBA 2JT3A 4BY4A 1Y1UA 2KBMA 3BUXB 2JT0A 3DVKA 1MF8B 4N1FA 1AJ5A 4YGDB 2K2FA 1KSMA 4R1EA 1DF0B 3I5IC 2I2RE 2JOJA 4MVFA 2SCPA 1Q80A 4GGFA 1DJHA 1EG4A 3SIBA 1J7OA 1SR6C 3LK1A 2WOSA 1UHIA 1SL9A 2GV5A 4M2QA 1TNPA 3RM1A 3WHUB 1YX8A 1PULA 1SRAA 1UHJA 1KWOB 2ISDA 1B8CA 1NWDA 1G4YR 3JVTB 3K21A 4GGFC 2BKHB 2K7DA 2O5GA 4PE0A 3LLEA 4NDCA 2WCFA 2NXQA 2K2AA 1CFDA 1XFZO 3H4SE 3BOWA 4ZCUA 1F54A 1XO5A 1LXFC 2LE9B 1MQ1A 4PHMA 1EH2A 1JSAA 5BPJA 2JPTA 1K94A 2JTZA 1S1EA 1S36A 2HQ8A 5AERA 1JF2A 4CFRA 2KHNA 1BLQA 1C07A 1JFJA 5HKYA 1QATA 1YVHA 1E8AA 3LCPC 4HRHA 1QVIY 2PMYA 1AK8A 2LLSA 5IBWA 1IQ3A 1FI6A 1LKJA 2Y5IA 1PSRA 1J7PA 3BUWB 2FCEA 1AP4A 5D69A 2F33A 3BQ3A 3BUOB 4YI9A 1CFFA 2LNKA 3IQOA 5CPVA 4DS7A 4AQIA 4MEWA 3KPXA 1NIWA 4WQ2A 1PRWA 1BR4B 4YGEB 2OTGB 1BJFA 1JFKA 2OS8B 2GGMA 1N0YA 5I2QA 5DKRA 1KQVA 1YUTA 3VROA 3VRNA 1IRJA 3BYAA 3TUYB 2JXLA 2BECA 1UHKA 2MA2A 5AXIA 3TZ1A 3VRPA 5PALA 1M31A 2TN4A 2G9BA 3TDIA 1AHRA 3A4UB 3IF7A 1NSHA 1RK9A 2HETA 2KGBC 2ZN9A 2ZNDA 2I7AA 3CR4X 3BUNB 2JTTA 1QIVA 2M0RA 1A03A 1F71A 1SMGA 3EVVA 1YTZC 1D1OA 1QS7A 5HKWA 1KK7Y 1NCZA 4MN0A 2M7NA 3OB2B 4AOMA 2LLUA 3JTDC 4PDZA 2M97A 5ER4X 1LVCD 1Y1XA 3DVMA 5HYDA 1XFVO 3AKBA 4JWQA 4OKHA 4QJ3B 2MJWB 1FBVA 4MZKA 1GGZA 1SCMC 1SCMB 3VRRA 2NCPA 1MXLC 2D8NA 4MBEA 2LANA 2JNFA 2ZRSA 1TOPA 2JXCA 4MZLA 2E30A 2KQ6A 5DKQA 4XJKA 1QX5B 2JT8A 1B9AA 3VGOA 1NP8A 1SW8A 3EKHA 4PHKA 2BCXA 4M2OA 3EK7A 3PLFB 1K93D 2KI6D 2JQ6A 1K9KA 1DT7B 1M46A 4CFQA 2L5XB 4IL1A 5DKNA 1B7TZ 2WCEA 4D1EA 2EHBA 1TCOB 2EC6C 1WDCB 3NSIA 1IJ6A 1DJWA 2F2PA 2L4IA 1JF0A 4N5XA 4XJKB 4YRUA 3WHTB 1VRKA 4PHNA 4ICBA 1QLKA 1EG3A 2PASA 2BKIB 3DD4A 1EJ3A 1N65A 3I5HB 1BG1A 1MR8A 1A75B 2V53A 2AAOA 3FWBA 1NYAA 4DRWA 1K2HA 4M2PA 4OCIA 4I5LB 1SL8A 1L7ZA 1ODBA 1EL4A 2LUXA 4CLNA 2OPOA 3NSLA 2L50A 1J7RA 3I5IB 1X02A 1XFYO 4GUKA 3AKAA 1DGUA 3SG7A 4DIRA 1U5IB 1SR6B 1QVIZ 3NSKA 3ZNIA 1BODA 2H2KA 4A4CA 3CZTX 2KAXA 1CMFA 2K61A 2LC5A 4WRIA 3CR5X 2MHHA 1DMOA 2KFHA 5JOLA 4YBHB 2M3WA 1WRLA 1J1EA 1TNQA 1LA3A 1XVJA 2F3ZA 1FW4A 2Q4UA 1K8UA 1K9PA 2LVKA 4JQ0D 5JJGA 3FS7A 2KQYA 2NLNA 4MZJA 2QPTA 1IH0A 1K95A 1MWNA 2ZRTA 2K0JA 1OZOA 3NSOA 2PVBA 3PM8A 1TN4A 1L2OC 1L2OB 1S5GZ 2FJUB 2LUCA 3HCMA 2CTNA 4ETOA 2BL0C 1SNLA 2HF5A 2AUCA 3CR2A 2E6WA 3TS5C 1WLZA 1K90D 1YVLA 4C0JA 3DF0A 3KHEA 1QLSA 2MLFC 3OP0A 2BBMA 2M49B 4PE7A 1ALWA 2BE6A 2LHIA 1A29A 3D10A 3PSRA 3BOWB 4WQ3A 1NX1A 2L51A 4DUQA 5K89A 4QJ5B 2JWWA 1NX3A 4L9MA 1SCVA 2BCAA 2B1UA 4CPVA 1QV0A 1FI5A 1CDPA 2PSRA 5D7FA 1B1GA 1H8BA 1RFJA 1UHHA 1DJYA 4ZCVA 2L98A 1IKUA 1GJYA 2RGIA 4HRGA 1R6PA 3EVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3R A;  1ZOT B;  3BXK A;  1HT9 A;  2ZNE A;  1B4C A;  3A8R A;  2COL B;  1W7J B;  2M1K B;  1CFP A;  2LLT A;  3KEV A;  1K96 A;  2FOT A;  4I5J A;  3QRX A;  1DJZ A;  2JNX A;  2I18 A;  2Y1M A;  1CM4 A;  2WND A;  4N1G A;  5GQQ C;  2KAY A;  1QTX A;  2VRG A;  4HRE E;  1FPW A;  3O78 A;  1K9U A;  1KFX S;  1KFX L;  5KTY A;  3SG4 A;  3LL8 B;  1CDL A;  3SIA A;  3WXA A;  4UPG A;  2CCM A;  3CLN A;  3JTD B;  2CT9 A;  3I5G C;  1B8R A;  1AJ4 A;  4NDD A;  2BBN A;  2IS9 A;  5FYX A;  3DVE A;  1QJT A;  2F2O A;  1HQV A;  1CLB A;  3EK4 A;  4TNC A;  1WRZ A;  5KSZ A;  3D0Y A;  1YRU B;  1IG5 A;  4HSZ A;  1OOJ A;  4U8D A;  3C1V A;  5HLO A;  1BF5 A;  4Q04 A;  1XA5 A;  2M1U A;  1OMV A;  2ZFD A;  4PHJ A;  3TDU A;  1TTX A;  1YUR A;  1UHN A;  2F8P A;  1NUB A;  1QAS A;  5CSI A;  4MSP A;  1RJV A;  5I8N A;  3I5F C;  1DGV A;  2I94 A;  1TRF A;  2KFF A;  3EVU A;  3GOF A;  1CKK A;  3GK2 A;  2KBI A;  2EC6 B;  3D0Y B;  3PN7 C;  5I2L A;  1TNW A;  1J7Q A;  1LIN A;  5CSF A;  1YUU A;  2K7B A;  1C7V A;  2KI4 C;  1SYM A;  1CNP A;  1DTL A;  1IJ5 A;  1ZMZ A;  4BY5 A;  1YRT B;  5CSJ A;  1AVS A;  1G8I A;  5KU1 A;  2G2B A;  2LAP A;  1CM1 A;  1EXR A;  5TNC A;  1NPQ A;  3OB1 B;  4NQG A;  5F6T A;  5HLV A;  1GQM A;  1W7I B;  3CWG A;  1OMD A;  1A4P A;  2K8M B;  1CLM A;  1KK8 C;  1OE9 B;  4DCK A;  1DJG A;  1BU3 A;  1S6C A;  2L0P A;  1SBJ A;  4MLW A;  1J1D A;  1R2U A;  4C0K A;  4ORA B;  4YGC B;  2PAL A;  2LP2 A;  1DF0 A;  1S26 D;  1C7W A;  2LVI A;  2KOT A;  1H4B A;  3O2P A;  3O6B A;  5J3X A;  4PE1 A;  3PAL A;  1CDM A;  1F4O A;  4P5O E;  5G08 A;  1OQP A;  1WLM A;  1M39 A;  3OX6 A;  5I2O A;  4GAO A;  2NZ0 A;  3SG2 A;  1SY9 A;  1DJX A;  4A4B A;  3F45 A;  2JZI A;  4MRX A;  3M0W A;  2WC8 A;  1Y6W A;  4GBA A;  2BE4 A;  2LV7 A;  1OSA A;  3EK8 A;  2HQW A;  3CTN A;  2PRU A;  2LMU A;  1AUI B;  2L2E A;  3IQQ A;  1KCY A;  1F70 A;  4PCW A;  1JUO A;  3MSE B;  3PAT A;  1QV1 A;  3VRQ A;  1UUR A;  1YX7 A;  1XK4 A;  4QJ4 B;  5B8I B;  3OX5 A;  2MBX A;  2BL0 B;  1WY9 A;  1KQM C;  1KQM B;  3AAJ A;  1BT6 A;  1IGV A;  1B7T Y;  1KWO C;  3RLZ A;  4PE4 A;  1CDN A;  1XYD A;  3TS5 B;  2JC2 A;  1RTP 1;  1YUS A;  3JVT C;  2KGR A;  1N2D A;  2KI6 C;  1QIW A;  2GGZ A;  1UP5 A;  2JUL A;  4I5K A;  4P2Y B;  3SG3 A;  1MUX A;  1KK7 Z;  2M9G A;  4JPZ B;  4GGN A;  5AEQ A;  1CFC A;  1XK4 C;  2A4J A;  2M7L A;  3NXA A;  1TIZ A;  3SJS A;  1QX2 A;  2CBL A;  1NX2 A;  1PVA A;  4F0Z B;  1WRK A;  1PSB A;  2MRD A;  2NCO A;  4YGB B;  1IQ5 A;  1BMO A;  1ZAC A;  3DF0 B;  5ER5 A;  2MAZ A;  4OR9 B;  4OV2 A;  2QAC A;  1NCX A;  2KSP A;  3SG5 A;  4PAL A;  1NX0 A;  1CMG A;  1JC2 A;  2P6B B;  1BR1 B;  2KNE A;  1JWD A;  1REC A;  2LM5 A;  1TNX A;  3ZWH A;  1A2X A;  1S6I A;  4ORB B;  1ZFS A;  4E68 A;  2SAS A;  2R2I A;  2ZKM X;  3GK1 A;  1F55 A;  1M63 B;  1TCF A;  1RRO A;  1V1F A;  3ICB A;  3O4Y A;  2OTG C;  2JU0 A;  3FIA A;  1F4Q A;  2OS8 C;  4YI8 A;  1GGW A;  1Y0V H;  4C0L A;  1UWO A;  1S3P A;  1PVB A;  2Y4Q A;  3CGA A;  1SKT A;  1J55 A;  3I5G B;  1S5G Y;  3TUY C;  1CLL A;  5HKZ A;  2F3Y A;  2HPS A;  3EKJ A;  1F8H A;  3PFV A;  2FCD A;  2WCB A;  2K7O A;  1ALV A;  3CS1 A;  2LHL A;  1V1G A;  1XFW O;  3OHM B;  2LVJ A;  1OMR A;  4YGA A;  2KAV A;  1MHO A;  1CB1 A;  1SL7 A;  4NDB A;  2JRF A;  3AAK A;  4FTG A;  2MLE C;  2AMI A;  1B8L A;  4USL A;  2LMV A;  5AFP A;  2H61 A;  2LVV A;  3FWC A;  3KF9 A;  1S6J A;  2WOR A;  4GFT A;  4OVN F;  3I5F B;  1FF1 A;  1XFX O;  1KFU S;  1KFU L;  1Y1A A;  2KYF A;  1QX7 A;  2LMT A;  4AQJ A;  2K7C A;  2Q91 A;  1DJI A;  3DVJ A;  3PN7 B;  1ZUZ A;  2ZN8 A;  1PAL A;  2KI4 B;  4GNK B;  3HX4 A;  1B47 A;  1DVI A;  2H61 C;  1XFU O;  1QXP A;  2CXJ A;  2LP3 A;  3GK4 X;  1IWQ A;  3LK0 A;  2KYC A;  1A75 A;  2M29 A;  1CTR A;  5AAN A;  1KSO A;  1MXE A;  1OZS A;  1SK6 D;  2KDH A;  2CNP A;  1KK8 B;  1M45 A;  4XYN A;  1LA0 A;  4FQO A;  3TDZ A;  1JBA A;  3WNX B;  4GPL B;  3KO0 A;  5CSN A;  4MRY A;  1WDC C;  3SG6 A;  1NCY A;  2DOQ A;  4CID A;  2M8U A;  2EGD A;  1G33 A;  2KFG A;  1U5I A;  2LCP A;  1SPY A;  1PK0 D;  4ORC B;  2L4H A;  3I5H C;  1BOC A;  2Y1N A;  1RWY A;  2O60 A;  4I5N B;  1UUS A;  1YR5 A;  3BUM B;  2BCB A;  2JT3 A;  4BY4 A;  1Y1U A;  2KBM A;  3BUX B;  2JT0 A;  3DVK A;  1MF8 B;  4N1F A;  1AJ5 A;  4YGD B;  2K2F A;  1KSM A;  4R1E A;  1DF0 B;  3I5I C;  2I2R E;  2JOJ A;  4MVF A;  2SCP A;  1Q80 A;  4GGF A;  1DJH A;  1EG4 A;  3SIB A;  1J7O A;  1SR6 C;  3LK1 A;  2WOS A;  1UHI A;  1SL9 A;  2GV5 A;  4M2Q A;  1TNP A;  3RM1 A;  3WHU B;  1YX8 A;  1PUL A;  1SRA A;  1UHJ A;  1KWO B;  2ISD A;  1B8C A;  1NWD A;  1G4Y R;  3JVT B;  3K21 A;  4GGF C;  2BKH B;  2K7D A;  2O5G A;  4PE0 A;  3LLE A;  4NDC A;  2WCF A;  2NXQ A;  2K2A A;  1CFD A;  1XFZ O;  3H4S E;  3BOW A;  4ZCU A;  1F54 A;  1XO5 A;  1LXF C;  2LE9 B;  1MQ1 A;  4PHM A;  1EH2 A;  1JSA A;  5BPJ A;  2JPT A;  1K94 A;  2JTZ A;  1S1E A;  1S36 A;  2HQ8 A;  5AER A;  1JF2 A;  4CFR A;  2KHN A;  1BLQ A;  1C07 A;  1JFJ A;  5HKY A;  1QAT A;  1YVH A;  1E8A A;  3LCP C;  4HRH A;  1QVI Y;  2PMY A;  1AK8 A;  2LLS A;  5IBW A;  1IQ3 A;  1FI6 A;  1LKJ A;  2Y5I A;  1PSR A;  1J7P A;  3BUW B;  2FCE A;  1AP4 A;  5D69 A;  2F33 A;  3BQ3 A;  3BUO B;  4YI9 A;  1CFF A;  2LNK A;  3IQO A;  5CPV A;  4DS7 A;  4AQI A;  4MEW A;  3KPX A;  1NIW A;  4WQ2 A;  1PRW A;  1BR4 B;  4YGE B;  2OTG B;  1BJF A;  1JFK A;  2OS8 B;  2GGM A;  1N0Y A;  5I2Q A;  5DKR A;  1KQV A;  1YUT A;  3VRO A;  3VRN A;  1IRJ A;  3BYA A;  3TUY B;  2JXL A;  2BEC A;  1UHK A;  2MA2 A;  5AXI A;  3TZ1 A;  3VRP A;  5PAL A;  1M31 A;  2TN4 A;  2G9B A;  3TDI A;  1AHR A;  3A4U B;  3IF7 A;  1NSH A;  1RK9 A;  2HET A;  2KGB C;  2ZN9 A;  2ZND A;  2I7A A;  3CR4 X;  3BUN B;  2JTT A;  1QIV A;  2M0R A;  1A03 A;  1F71 A;  1SMG A;  3EVV A;  1YTZ C;  1D1O A;  1QS7 A;  5HKW A;  1KK7 Y;  1NCZ A;  4MN0 A;  2M7N A;  3OB2 B;  4AOM A;  2LLU A;  3JTD C;  4PDZ A;  2M97 A;  5ER4 X;  1LVC D;  1Y1X A;  3DVM A;  5HYD A;  1XFV O;  3AKB A;  4JWQ A;  4OKH A;  4QJ3 B;  2MJW B;  1FBV A;  4MZK A;  1GGZ A;  1SCM C;  1SCM B;  3VRR A;  2NCP A;  1MXL C;  2D8N A;  4MBE A;  2LAN A;  2JNF A;  2ZRS A;  1TOP A;  2JXC A;  4MZL A;  2E30 A;  2KQ6 A;  5DKQ A;  4XJK A;  1QX5 B;  2JT8 A;  1B9A A;  3VGO A;  1NP8 A;  1SW8 A;  3EKH A;  4PHK A;  2BCX A;  4M2O A;  3EK7 A;  3PLF B;  1K93 D;  2KI6 D;  2JQ6 A;  1K9K A;  1DT7 B;  1M46 A;  4CFQ A;  2L5X B;  4IL1 A;  5DKN A;  1B7T Z;  2WCE A;  4D1E A;  2EHB A;  1TCO B;  2EC6 C;  1WDC B;  3NSI A;  1IJ6 A;  1DJW A;  2F2P A;  2L4I A;  1JF0 A;  4N5X A;  4XJK B;  4YRU A;  3WHT B;  1VRK A;  4PHN A;  4ICB A;  1QLK A;  1EG3 A;  2PAS A;  2BKI B;  3DD4 A;  1EJ3 A;  1N65 A;  3I5H B;  1BG1 A;  1MR8 A;  1A75 B;  2V53 A;  2AAO A;  3FWB A;  1NYA A;  4DRW A;  1K2H A;  4M2P A;  4OCI A;  4I5L B;  1SL8 A;  1L7Z A;  1ODB A;  1EL4 A;  2LUX A;  4CLN A;  2OPO A;  3NSL A;  2L50 A;  1J7R A;  3I5I B;  1X02 A;  1XFY O;  4GUK A;  3AKA A;  1DGU A;  3SG7 A;  4DIR A;  1U5I B;  1SR6 B;  1QVI Z;  3NSK A;  3ZNI A;  1BOD A;  2H2K A;  4A4C A;  3CZT X;  2KAX A;  1CMF A;  2K61 A;  2LC5 A;  4WRI A;  3CR5 X;  2MHH A;  1DMO A;  2KFH A;  5JOL A;  4YBH B;  2M3W A;  1WRL A;  1J1E A;  1TNQ A;  1LA3 A;  1XVJ A;  2F3Z A;  1FW4 A;  2Q4U A;  1K8U A;  1K9P A;  2LVK A;  4JQ0 D;  5JJG A;  3FS7 A;  2KQY A;  2NLN A;  4MZJ A;  2QPT A;  1IH0 A;  1K95 A;  1MWN A;  2ZRT A;  2K0J A;  1OZO A;  3NSO A;  2PVB A;  3PM8 A;  1TN4 A;  1L2O C;  1L2O B;  1S5G Z;  2FJU B;  2LUC A;  3HCM A;  2CTN A;  4ETO A;  2BL0 C;  1SNL A;  2HF5 A;  2AUC A;  3CR2 A;  2E6W A;  3TS5 C;  1WLZ A;  1K90 D;  1YVL A;  4C0J A;  3DF0 A;  3KHE A;  1QLS A;  2MLF C;  3OP0 A;  2BBM A;  2M49 B;  4PE7 A;  1ALW A;  2BE6 A;  2LHI A;  1A29 A;  3D10 A;  3PSR A;  3BOW B;  4WQ3 A;  1NX1 A;  2L51 A;  4DUQ A;  5K89 A;  4QJ5 B;  2JWW A;  1NX3 A;  4L9M A;  1SCV A;  2BCA A;  2B1U A;  4CPV A;  1QV0 A;  1FI5 A;  1CDP A;  2PSR A;  5D7F A;  1B1G A;  1H8B A;  1RFJ A;  1UHH A;  1DJY A;  4ZCV A;  2L98 A;  1IKU A;  1GJY A;  2RGI A;  4HRG A;  1R6P A;  3EVR A; 
#chains in the Genus database with same CATH topology
 3E3R A;  1ZOT B;  3BXK A;  1TWO A;  1HT9 A;  2P70 A;  2ZNE A;  1B4C A;  3A8R A;  2COL B;  1W7J B;  2M1K B;  1CFP A;  2LLT A;  3KEV A;  1K96 A;  4JD9 A;  2FOT A;  3S0E A;  4I5J A;  3QRX A;  1DJZ A;  2JNX A;  2I18 A;  2Y1M A;  1CM4 A;  2WND A;  4N1G A;  5GQQ C;  2KAY A;  1QTX A;  2VRG A;  3OBV A;  3PM2 A;  4HRE E;  1FPW A;  2WCL A;  3O78 A;  1K9U A;  1KFX S;  1KFX L;  5KTY A;  3SG4 A;  3LL8 B;  1CDL A;  3SIA A;  3WXA A;  4UPG A;  2CCM A;  3CLN A;  3JTD B;  2CT9 A;  3I5G C;  3Q8I A;  1B8R A;  1AJ4 A;  4NDD A;  2BBN A;  2IS9 A;  5FYX A;  3DVE A;  1QJT A;  2F2O A;  3V2L A;  1HQV A;  1CLB A;  3D76 A;  3EK4 A;  3S0G A;  4TNC A;  1WRZ A;  5KSZ A;  3D0Y A;  1YRU B;  1IG5 A;  4HSZ A;  3NHI A;  1OOJ A;  4U8D A;  3C1V A;  5HLO A;  1BF5 A;  2WCK A;  1XA5 A;  4Q04 A;  2QDI A;  3B86 A;  2M1U A;  1OMV A;  2ZFD A;  4PHJ A;  3TDU A;  1ORG A;  1TTX A;  1YUR A;  1UHN A;  2F8P A;  1NUB A;  1QAS A;  5CSI A;  4MSP A;  1RJV A;  5I8N A;  3I5F C;  1DGV A;  2I94 A;  1TRF A;  2KFF A;  3EVU A;  3GOF A;  1CKK A;  3GK2 A;  2KBI A;  4F7F A;  2EC6 B;  3D0Y B;  3PN7 C;  5I2L A;  1TNW A;  2PQL A;  1J7Q A;  1LIN A;  2KLD A;  5CSF A;  1DC1 A;  1YUU A;  2K7B A;  1C7V A;  2KI4 C;  1SYM A;  1CNP A;  1DTL A;  1IJ5 A;  1ZMZ A;  4BY5 A;  1DEL A;  3FE9 A;  1YRT B;  5CSJ A;  1AVS A;  3CDN A;  1G8I A;  5KU1 A;  2G2B A;  2LAP A;  1CM1 A;  1EXR A;  2WC5 A;  5TNC A;  1NPQ A;  3OB1 B;  4NQG A;  5F6T A;  5HLV A;  1GQM A;  1W7I B;  3CWG A;  1OMD A;  1A4P A;  2K8M B;  1CLM A;  1KK8 C;  1OE9 B;  1SSE B;  4DCK A;  3IVT A;  1DJG A;  1BU3 A;  1S6C A;  2L0P A;  1SBJ A;  4MLW A;  1J1D A;  1R2U A;  4C0K A;  4ORA B;  4YGC B;  2PAL A;  2LP2 A;  1DF0 A;  1S26 D;  1C7W A;  2LVI A;  2KOT A;  1H4B A;  3O2P A;  1OOF A;  3O6B A;  5J3X A;  4PE1 A;  3PAL A;  1CDM A;  1F4O A;  4P5O E;  3FE8 A;  5G08 A;  1OQP A;  1WLM A;  3D75 A;  1M39 A;  3OX6 A;  5I2O A;  4GAO A;  2NZ0 A;  3SG2 A;  1SY9 A;  1DJX A;  2GTE A;  4A4B A;  4JKT A;  3F45 A;  1C3Y A;  2JZI A;  4MRX A;  3M0W A;  2WC8 A;  1Y6W A;  4GBA A;  2BE4 A;  2LV7 A;  1OSA A;  3EK8 A;  1T14 A;  2HQW A;  3CTN A;  2PRU A;  2LMU A;  1AUI B;  2L2E A;  3IQQ A;  1KCY A;  1F70 A;  4PCW A;  1JUO A;  3MSE B;  3N7H A;  3PAT A;  1P28 A;  1QV1 A;  3VRQ A;  2BNX A;  1UUR A;  1YX7 A;  1XK4 A;  4QJ4 B;  3SS3 A;  5B8I B;  3OX5 A;  2MBX A;  2BL0 B;  1WY9 A;  1KQM C;  1KQM B;  3AAJ A;  1BT6 A;  1IGV A;  1B7T Y;  1KWO C;  3RLZ A;  4PE4 A;  1CDN A;  1XYD A;  3TS5 B;  2JC2 A;  1RTP 1;  1YUS A;  3JVT C;  2KGR A;  1N2D A;  2KI6 C;  1Z2C B;  1QIW A;  2GGZ A;  1UP5 A;  2JUL A;  4I5K A;  4P2Y B;  3SG3 A;  1MUX A;  1KK7 Z;  1OW4 A;  2M9G A;  4GGN A;  4JPZ B;  5AEQ A;  1CFC A;  1XK4 C;  2A4J A;  3NGV A;  2M7L A;  3NXA A;  1TIZ A;  3SJS A;  1QX2 A;  2CBL A;  1NX2 A;  1PVA A;  4F0Z B;  1WRK A;  1PSB A;  2MRD A;  2QEB A;  2NCO A;  4YGB B;  1IQ5 A;  1BMO A;  1ZAC A;  3DF0 B;  3L47 A;  5ER5 A;  2MAZ A;  4OR9 B;  4OV2 A;  2QAC A;  2KPH A;  1NCX A;  2KSP A;  3DZT A;  4PAL A;  1NX0 A;  3SG5 A;  3S0F A;  1CMG A;  2P6B B;  1JC2 A;  1BR1 B;  2KNE A;  1JWD A;  1REC A;  2LM5 A;  3QME A;  1TNX A;  3ZWH A;  1A2X A;  1S6I A;  4ORB B;  1ZFS A;  3CYZ A;  4E68 A;  2SAS A;  2R2I A;  2ZKM X;  3GK1 A;  1F55 A;  1M63 B;  1TCF A;  1RRO A;  1V1F A;  3ICB A;  3O4Y A;  2OTG C;  2JU0 A;  3FIA A;  1F4Q A;  2OS8 C;  4YI8 A;  1GGW A;  1Y0V H;  4C0L A;  1UWO A;  3CAB A;  4OZD A;  1S3P A;  1PVB A;  2Y4Q A;  3CGA A;  3CZ2 A;  1SKT A;  1J55 A;  3I5G B;  1S5G Y;  3TUY C;  1CLL A;  3O4X A;  5HKZ A;  2F3Y A;  2HPS A;  3EKJ A;  3CZ0 A;  1F8H A;  3PFV A;  1W9Z A;  3PJI A;  5I94 A;  2FCD A;  2WCB A;  2K7O A;  1OOH A;  1ALV A;  3CS1 A;  2LHL A;  2WCM A;  1V1G A;  1XFW O;  3OHM B;  2ERB A;  3DXL A;  2LVJ A;  3S0A A;  1OMR A;  4YGA A;  2KAV A;  1MHO A;  3L4L A;  1CB1 A;  1SL7 A;  4NDB A;  2JRF A;  3AAK A;  4FTG A;  2MLE C;  2AMI A;  1B8L A;  2WCH A;  3BJH A;  4USL A;  2LMV A;  5AFP A;  2H61 A;  2LVV A;  3FWC A;  3KF9 A;  1S6J A;  2WOR A;  4GFT A;  4OVN F;  3I5F B;  1FF1 A;  1XFX O;  1KFU S;  1KFU L;  1Y1A A;  2KYF A;  1QX7 A;  2LMT A;  2YGU A;  4AQJ A;  2K7C A;  2Q91 A;  1DJI A;  3FE6 A;  3DVJ A;  3PN7 B;  1ZUZ A;  2ZN8 A;  1PAL A;  3B87 A;  2KI4 B;  4GNK B;  3HX4 A;  1B47 A;  1DVI A;  2H61 C;  1XFU O;  1QXP A;  2CXJ A;  3D74 A;  2LP3 A;  3GK4 X;  1IWQ A;  4KYN A;  3LK0 A;  2KYC A;  1A75 A;  2M29 A;  1CTR A;  5AAN A;  3K1E A;  1KSO A;  1MXE A;  1OZS A;  1SK6 D;  2KDH A;  2CNP A;  1LS8 A;  1KK8 B;  1M45 A;  4XYN A;  1LA0 A;  4FQO A;  3TDZ A;  1JBA A;  3WNX B;  4GPL B;  3KO0 A;  5CSN A;  4MRY A;  1WDC C;  3SG6 A;  1NCY A;  2DOQ A;  4CID A;  2M8U A;  2EGD A;  1G33 A;  2KFG A;  1U5I A;  2LCP A;  1SPY A;  1PK0 D;  4ORC B;  2L4H A;  3I5H C;  1BOC A;  1OOI X;  2Y1N A;  1RWY A;  2O60 A;  4I5N B;  1UUS A;  1YR5 A;  3BUM B;  2BCB A;  2JT3 A;  4BY4 A;  2P71 A;  5FI7 A;  1Y1U A;  2KBM A;  3BUX B;  1TUZ A;  2JT0 A;  3DVK A;  1MF8 B;  2WCJ A;  4N1F A;  1AJ5 A;  3UO9 A;  4YGD B;  2K2F A;  1KSM A;  4R1E A;  1DF0 B;  3I5I C;  3B7A A;  2I2R E;  2JOJ A;  4MVF A;  2SCP A;  1Q80 A;  4GGF A;  1DJH A;  1EG4 A;  3R1V A;  3R72 A;  3SIB A;  1SR6 C;  3LK1 A;  2WOS A;  1J7O A;  1UHI A;  1SL9 A;  2GV5 A;  4INX A;  4M2Q A;  3EG5 B;  1TNP A;  3RM1 A;  2WC6 A;  3WHU B;  1YX8 A;  1PUL A;  2BAP A;  1SRA A;  1UHJ A;  1KWO B;  2ISD A;  1B8C A;  1NWD A;  1G4Y R;  3JVT B;  3K21 A;  4GGF C;  2BKH B;  3DY9 A;  2K7D A;  2O5G A;  4PE0 A;  3LLE A;  4NDC A;  2WCF A;  2NXQ A;  2K2A A;  3SS5 A;  2QEV A;  1CFD A;  1XFZ O;  3H4S E;  3BOW A;  4ZCU A;  4PT1 A;  1XO5 A;  1F54 A;  1LXF C;  2LE9 B;  1MQ1 A;  4PHM A;  1EH2 A;  1JSA A;  5BPJ A;  2JPT A;  1K94 A;  2JTZ A;  1S1E A;  3D77 A;  1S36 A;  2HQ8 A;  5AER A;  1JF2 A;  4CFR A;  3VB1 A;  2KHN A;  1BLQ A;  1C07 A;  1JFJ A;  5HKY A;  1QAT A;  1YVH A;  1E8A A;  2FJY A;  3LCP C;  1QVI Y;  2PMY A;  4HRH A;  2LLS A;  5IBW A;  1AK8 A;  1IQ3 A;  1LKJ A;  1FI6 A;  2Y5I A;  1PSR A;  1J7P A;  3BUW B;  2FCE A;  3R1P A;  1AP4 A;  5D69 A;  2F33 A;  3BQ3 A;  3BUO B;  4YI9 A;  1CFF A;  2LNK A;  2L2C A;  3IQO A;  5CPV A;  4DS7 A;  4AQI A;  4MEW A;  3KPX A;  1NIW A;  4WQ2 A;  1PRW A;  2H8V A;  1DEK A;  1BR4 B;  4YGE B;  2OTG B;  1BJF A;  1JFK A;  2OS8 B;  2GGM A;  1N0Y A;  5I2Q A;  5DKR A;  5DIC A;  1KQV A;  1YUT A;  2KLE A;  3VRN A;  1IRJ A;  3CZ1 A;  3VRO A;  3RZS A;  1C3Z A;  3BYA A;  2JXL A;  2BEC A;  1UHK A;  2MA2 A;  5AXI A;  3TUY B;  3TZ1 A;  3VRP A;  5PAL A;  1M31 A;  2TN4 A;  2G9B A;  3BFH A;  3TDI A;  1AHR A;  3A4U B;  3IF7 A;  1NSH A;  1RK9 A;  1Z4H A;  2HET A;  2KGB C;  2ZN9 A;  2ZND A;  2I7A A;  3CR4 X;  3BUN B;  2JTT A;  2K60 A;  1QIV A;  4FQT A;  2M0R A;  1A03 A;  1F71 A;  1SMG A;  3EVV A;  1YTZ C;  1D1O A;  1XFR A;  1QS7 A;  5HKW A;  1KK7 Y;  1NCZ A;  4MN0 A;  2M7N A;  3OB2 B;  4AOM A;  2LLU A;  3JTD C;  4INW A;  4PDZ A;  2M97 A;  5ER4 X;  1LVC D;  1Y1X A;  3DVM A;  5HYD A;  1XFV O;  3AKB A;  4JWQ A;  2JPO A;  4OKH A;  2MJW B;  4QJ3 B;  1FBV A;  4MZK A;  1GGZ A;  1SCM C;  1SCM B;  2L5Y A;  3VRR A;  2NCP A;  3D73 A;  1MXL C;  2D8N A;  4MBE A;  2LAN A;  2JNF A;  2ZRS A;  1TOP A;  2JXC A;  4MZL A;  2E30 A;  2KQ6 A;  5DKQ A;  4XJK A;  1QX5 B;  2JT8 A;  1B9A A;  3VGO A;  1NP8 A;  1SW8 A;  3EKH A;  1IIO A;  4PHK A;  2BCX A;  4M2O A;  3EK7 A;  3PLF B;  1K93 D;  2KI6 D;  2JQ6 A;  1K9K A;  1DT7 B;  1M46 A;  4CFQ A;  2L5X B;  4IL1 A;  5DKN A;  1B7T Z;  1TUJ A;  2WCE A;  4D1E A;  2EHB A;  1TCO B;  2EC6 C;  1WDC B;  3NSI A;  1IJ6 A;  1DJW A;  2F2P A;  2L4I A;  1JF0 A;  4N5X A;  4XJK B;  5FI2 A;  4YRU A;  5HL1 A;  3WHT B;  1VRK A;  4IJ7 A;  4ICB A;  4PHN A;  1QLK A;  1EG3 A;  2PAS A;  2BKI B;  3DD4 A;  1EJ3 A;  1N65 A;  3I5H B;  1BG1 A;  1MR8 A;  1A75 B;  2V53 A;  2AAO A;  3FWB A;  1NYA A;  4DRW A;  1K2H A;  4M2P A;  4OCI A;  4I5L B;  1SL8 A;  1L7Z A;  1ODB A;  1EL4 A;  2LUX A;  4CLN A;  2OPO A;  3BFB A;  3NSL A;  2L50 A;  1J7R A;  3I5I B;  1X02 A;  1XFY O;  4GUK A;  3AKA A;  1DGU A;  3S0D A;  3SG7 A;  4DIR A;  1U5I B;  3BFA A;  1SR6 B;  1QVI Z;  3NSK A;  3ZNI A;  1GM0 A;  1BOD A;  2H2K A;  2PYQ A;  4A4C A;  3CZT X;  2KAX A;  1CMF A;  2K61 A;  2LC5 A;  4WRI A;  3CR5 X;  2MHH A;  1DMO A;  2KFH A;  5JOL A;  4YBH B;  2M3W A;  1WRL A;  1J1E A;  1TNQ A;  5EL2 A;  1LA3 A;  1XVJ A;  2F3Z A;  1FW4 A;  2Q4U A;  1K8U A;  1K9P A;  2LVK A;  4JQ0 D;  3B88 A;  5JJG A;  3FS7 A;  2KQY A;  2NLN A;  4MZJ A;  2QPT A;  1IH0 A;  1K95 A;  1MWN A;  2ZRT A;  2K0J A;  3NHT A;  1OZO A;  3B6X A;  3NSO A;  2PVB A;  3PM8 A;  1TN4 A;  2QEH A;  1L2O C;  1L2O B;  1S5G Z;  2FJU B;  2LUC A;  3HCM A;  2CTN A;  4ETO A;  2BL0 C;  1SNL A;  1OOG A;  2HF5 A;  2AUC A;  3R1O A;  3L4A A;  3CR2 A;  2E6W A;  3TS5 C;  1WLZ A;  1K90 D;  1YVL A;  4C0J A;  3DF0 A;  3KHE A;  1QLS A;  2MLF C;  3OP0 A;  2BBM A;  2M49 B;  5D3O A;  4PE7 A;  1ALW A;  3DYE A;  5FI6 A;  2BE6 A;  1QWV A;  2LHI A;  1A29 A;  3D10 A;  3PSR A;  3BOW B;  4WQ3 A;  3SS4 A;  1NX1 A;  2L51 A;  4DUQ A;  5K89 A;  4QJ5 B;  2JWW A;  1NX3 A;  3D78 A;  4L9M A;  1SCV A;  2B1U A;  2BCA A;  4CPV A;  1QV0 A;  2QEO A;  1FI5 A;  1CDP A;  2PSR A;  5D7F A;  1B1G A;  3UNW A;  1H8B A;  1DQE A;  1RFJ A;  1UHH A;  1DJY A;  4ZCV A;  2L98 A;  1IKU A;  1GJY A;  2RGI A;  4HRG A;  1R6P A;  3EVR A;  3S0B A;  3OGN A; 
#chains in the Genus database with same CATH homology
 3E3R A;  1ZOT B;  3BXK A;  1HT9 A;  2ZNE A;  1B4C A;  3A8R A;  2COL B;  1W7J B;  2M1K B;  1CFP A;  2LLT A;  3KEV A;  1K96 A;  2FOT A;  4I5J A;  3QRX A;  1DJZ A;  2JNX A;  2I18 A;  2Y1M A;  1CM4 A;  2WND A;  4N1G A;  5GQQ C;  2KAY A;  1QTX A;  2VRG A;  4HRE E;  1FPW A;  3O78 A;  1K9U A;  1KFX S;  1KFX L;  5KTY A;  3SG4 A;  3LL8 B;  1CDL A;  3SIA A;  3WXA A;  4UPG A;  2CCM A;  3CLN A;  3JTD B;  2CT9 A;  3I5G C;  1B8R A;  1AJ4 A;  4NDD A;  2BBN A;  2IS9 A;  5FYX A;  3DVE A;  1QJT A;  2F2O A;  1HQV A;  1CLB A;  3EK4 A;  4TNC A;  1WRZ A;  5KSZ A;  3D0Y A;  1YRU B;  1IG5 A;  4HSZ A;  1OOJ A;  4U8D A;  3C1V A;  5HLO A;  1BF5 A;  4Q04 A;  1XA5 A;  2M1U A;  1OMV A;  2ZFD A;  4PHJ A;  3TDU A;  1TTX A;  1YUR A;  1UHN A;  2F8P A;  1NUB A;  1QAS A;  5CSI A;  4MSP A;  1RJV A;  5I8N A;  3I5F C;  1DGV A;  2I94 A;  1TRF A;  2KFF A;  3EVU A;  3GOF A;  1CKK A;  3GK2 A;  2KBI A;  2EC6 B;  3D0Y B;  3PN7 C;  5I2L A;  1TNW A;  1J7Q A;  1LIN A;  5CSF A;  1YUU A;  2K7B A;  1C7V A;  2KI4 C;  1SYM A;  1CNP A;  1DTL A;  1IJ5 A;  1ZMZ A;  4BY5 A;  1YRT B;  5CSJ A;  1AVS A;  1G8I A;  5KU1 A;  2G2B A;  2LAP A;  1CM1 A;  1EXR A;  5TNC A;  1NPQ A;  3OB1 B;  4NQG A;  5F6T A;  5HLV A;  1GQM A;  1W7I B;  3CWG A;  1OMD A;  1A4P A;  2K8M B;  1CLM A;  1KK8 C;  1OE9 B;  4DCK A;  1DJG A;  1BU3 A;  1S6C A;  2L0P A;  1SBJ A;  4MLW A;  1J1D A;  1R2U A;  4C0K A;  4ORA B;  4YGC B;  2PAL A;  2LP2 A;  1DF0 A;  1S26 D;  1C7W A;  2LVI A;  2KOT A;  1H4B A;  3O2P A;  3O6B A;  5J3X A;  4PE1 A;  3PAL A;  1CDM A;  1F4O A;  4P5O E;  5G08 A;  1OQP A;  1WLM A;  1M39 A;  3OX6 A;  5I2O A;  4GAO A;  2NZ0 A;  3SG2 A;  1SY9 A;  1DJX A;  4A4B A;  3F45 A;  2JZI A;  4MRX A;  3M0W A;  2WC8 A;  1Y6W A;  4GBA A;  2BE4 A;  2LV7 A;  1OSA A;  3EK8 A;  2HQW A;  3CTN A;  2PRU A;  2LMU A;  1AUI B;  2L2E A;  3IQQ A;  1KCY A;  1F70 A;  4PCW A;  1JUO A;  3MSE B;  3PAT A;  1QV1 A;  3VRQ A;  1UUR A;  1YX7 A;  1XK4 A;  4QJ4 B;  5B8I B;  3OX5 A;  2MBX A;  2BL0 B;  1WY9 A;  1KQM C;  1KQM B;  3AAJ A;  1BT6 A;  1IGV A;  1B7T Y;  1KWO C;  3RLZ A;  4PE4 A;  1CDN A;  1XYD A;  3TS5 B;  2JC2 A;  1RTP 1;  1YUS A;  3JVT C;  2KGR A;  1N2D A;  2KI6 C;  1QIW A;  2GGZ A;  1UP5 A;  2JUL A;  4I5K A;  4P2Y B;  3SG3 A;  1MUX A;  1KK7 Z;  2M9G A;  4JPZ B;  4GGN A;  5AEQ A;  1CFC A;  1XK4 C;  2A4J A;  2M7L A;  3NXA A;  1TIZ A;  3SJS A;  1QX2 A;  2CBL A;  1NX2 A;  1PVA A;  4F0Z B;  1WRK A;  1PSB A;  2MRD A;  2NCO A;  4YGB B;  1IQ5 A;  1BMO A;  1ZAC A;  3DF0 B;  5ER5 A;  2MAZ A;  4OR9 B;  4OV2 A;  2QAC A;  1NCX A;  2KSP A;  3SG5 A;  4PAL A;  1NX0 A;  1CMG A;  1JC2 A;  2P6B B;  1BR1 B;  2KNE A;  1JWD A;  1REC A;  2LM5 A;  1TNX A;  3ZWH A;  1A2X A;  1S6I A;  4ORB B;  1ZFS A;  4E68 A;  2SAS A;  2R2I A;  2ZKM X;  3GK1 A;  1F55 A;  1M63 B;  1TCF A;  1RRO A;  1V1F A;  3ICB A;  3O4Y A;  2OTG C;  2JU0 A;  3FIA A;  1F4Q A;  2OS8 C;  4YI8 A;  1GGW A;  1Y0V H;  4C0L A;  1UWO A;  1S3P A;  1PVB A;  2Y4Q A;  3CGA A;  1SKT A;  1J55 A;  3I5G B;  1S5G Y;  3TUY C;  1CLL A;  5HKZ A;  2F3Y A;  2HPS A;  3EKJ A;  1F8H A;  3PFV A;  2FCD A;  2WCB A;  2K7O A;  1ALV A;  3CS1 A;  2LHL A;  1V1G A;  1XFW O;  3OHM B;  2LVJ A;  1OMR A;  4YGA A;  2KAV A;  1MHO A;  1CB1 A;  1SL7 A;  4NDB A;  2JRF A;  3AAK A;  4FTG A;  2MLE C;  2AMI A;  1B8L A;  4USL A;  2LMV A;  5AFP A;  2H61 A;  2LVV A;  3FWC A;  3KF9 A;  1S6J A;  2WOR A;  4GFT A;  4OVN F;  3I5F B;  1FF1 A;  1XFX O;  1KFU S;  1KFU L;  1Y1A A;  2KYF A;  1QX7 A;  2LMT A;  4AQJ A;  2K7C A;  2Q91 A;  1DJI A;  3DVJ A;  3PN7 B;  1ZUZ A;  2ZN8 A;  1PAL A;  2KI4 B;  4GNK B;  3HX4 A;  1B47 A;  1DVI A;  2H61 C;  1XFU O;  1QXP A;  2CXJ A;  2LP3 A;  3GK4 X;  1IWQ A;  3LK0 A;  2KYC A;  1A75 A;  2M29 A;  1CTR A;  5AAN A;  1KSO A;  1MXE A;  1OZS A;  1SK6 D;  2KDH A;  2CNP A;  1KK8 B;  1M45 A;  4XYN A;  1LA0 A;  4FQO A;  3TDZ A;  1JBA A;  3WNX B;  4GPL B;  3KO0 A;  5CSN A;  4MRY A;  1WDC C;  3SG6 A;  1NCY A;  2DOQ A;  4CID A;  2M8U A;  2EGD A;  1G33 A;  2KFG A;  1U5I A;  2LCP A;  1SPY A;  1PK0 D;  4ORC B;  2L4H A;  3I5H C;  1BOC A;  2Y1N A;  1RWY A;  2O60 A;  4I5N B;  1UUS A;  1YR5 A;  3BUM B;  2BCB A;  2JT3 A;  4BY4 A;  1Y1U A;  2KBM A;  3BUX B;  2JT0 A;  3DVK A;  1MF8 B;  4N1F A;  1AJ5 A;  4YGD B;  2K2F A;  1KSM A;  4R1E A;  1DF0 B;  3I5I C;  2I2R E;  2JOJ A;  4MVF A;  2SCP A;  1Q80 A;  4GGF A;  1DJH A;  1EG4 A;  3SIB A;  1J7O A;  1SR6 C;  3LK1 A;  2WOS A;  1UHI A;  1SL9 A;  2GV5 A;  4M2Q A;  1TNP A;  3RM1 A;  3WHU B;  1YX8 A;  1PUL A;  1SRA A;  1UHJ A;  1KWO B;  2ISD A;  1B8C A;  1NWD A;  1G4Y R;  3JVT B;  3K21 A;  4GGF C;  2BKH B;  2K7D A;  2O5G A;  4PE0 A;  3LLE A;  4NDC A;  2WCF A;  2NXQ A;  2K2A A;  1CFD A;  1XFZ O;  3H4S E;  3BOW A;  4ZCU A;  1F54 A;  1XO5 A;  1LXF C;  2LE9 B;  1MQ1 A;  4PHM A;  1EH2 A;  1JSA A;  5BPJ A;  2JPT A;  1K94 A;  2JTZ A;  1S1E A;  1S36 A;  2HQ8 A;  5AER A;  1JF2 A;  4CFR A;  2KHN A;  1BLQ A;  1C07 A;  1JFJ A;  5HKY A;  1QAT A;  1YVH A;  1E8A A;  3LCP C;  4HRH A;  1QVI Y;  2PMY A;  1AK8 A;  2LLS A;  5IBW A;  1IQ3 A;  1FI6 A;  1LKJ A;  2Y5I A;  1PSR A;  1J7P A;  3BUW B;  2FCE A;  1AP4 A;  5D69 A;  2F33 A;  3BQ3 A;  3BUO B;  4YI9 A;  1CFF A;  2LNK A;  3IQO A;  5CPV A;  4DS7 A;  4AQI A;  4MEW A;  3KPX A;  1NIW A;  4WQ2 A;  1PRW A;  1BR4 B;  4YGE B;  2OTG B;  1BJF A;  1JFK A;  2OS8 B;  2GGM A;  1N0Y A;  5I2Q A;  5DKR A;  1KQV A;  1YUT A;  3VRO A;  3VRN A;  1IRJ A;  3BYA A;  3TUY B;  2JXL A;  2BEC A;  1UHK A;  2MA2 A;  5AXI A;  3TZ1 A;  3VRP A;  5PAL A;  1M31 A;  2TN4 A;  2G9B A;  3TDI A;  1AHR A;  3A4U B;  3IF7 A;  1NSH A;  1RK9 A;  2HET A;  2KGB C;  2ZN9 A;  2ZND A;  2I7A A;  3CR4 X;  3BUN B;  2JTT A;  1QIV A;  2M0R A;  1A03 A;  1F71 A;  1SMG A;  3EVV A;  1YTZ C;  1D1O A;  1QS7 A;  5HKW A;  1KK7 Y;  1NCZ A;  4MN0 A;  2M7N A;  3OB2 B;  4AOM A;  2LLU A;  3JTD C;  4PDZ A;  2M97 A;  5ER4 X;  1LVC D;  1Y1X A;  3DVM A;  5HYD A;  1XFV O;  3AKB A;  4JWQ A;  4OKH A;  4QJ3 B;  2MJW B;  1FBV A;  4MZK A;  1GGZ A;  1SCM C;  1SCM B;  3VRR A;  2NCP A;  1MXL C;  2D8N A;  4MBE A;  2LAN A;  2JNF A;  2ZRS A;  1TOP A;  2JXC A;  4MZL A;  2E30 A;  2KQ6 A;  5DKQ A;  4XJK A;  1QX5 B;  2JT8 A;  1B9A A;  3VGO A;  1NP8 A;  1SW8 A;  3EKH A;  4PHK A;  2BCX A;  4M2O A;  3EK7 A;  3PLF B;  1K93 D;  2KI6 D;  2JQ6 A;  1K9K A;  1DT7 B;  1M46 A;  4CFQ A;  2L5X B;  4IL1 A;  5DKN A;  1B7T Z;  2WCE A;  4D1E A;  2EHB A;  1TCO B;  2EC6 C;  1WDC B;  3NSI A;  1IJ6 A;  1DJW A;  2F2P A;  2L4I A;  1JF0 A;  4N5X A;  4XJK B;  4YRU A;  3WHT B;  1VRK A;  4PHN A;  4ICB A;  1QLK A;  1EG3 A;  2PAS A;  2BKI B;  3DD4 A;  1EJ3 A;  1N65 A;  3I5H B;  1BG1 A;  1MR8 A;  1A75 B;  2V53 A;  2AAO A;  3FWB A;  1NYA A;  4DRW A;  1K2H A;  4M2P A;  4OCI A;  4I5L B;  1SL8 A;  1L7Z A;  1ODB A;  1EL4 A;  2LUX A;  4CLN A;  2OPO A;  3NSL A;  2L50 A;  1J7R A;  3I5I B;  1X02 A;  1XFY O;  4GUK A;  3AKA A;  1DGU A;  3SG7 A;  4DIR A;  1U5I B;  1SR6 B;  1QVI Z;  3NSK A;  3ZNI A;  1BOD A;  2H2K A;  4A4C A;  3CZT X;  2KAX A;  1CMF A;  2K61 A;  2LC5 A;  4WRI A;  3CR5 X;  2MHH A;  1DMO A;  2KFH A;  5JOL A;  4YBH B;  2M3W A;  1WRL A;  1J1E A;  1TNQ A;  1LA3 A;  1XVJ A;  2F3Z A;  1FW4 A;  2Q4U A;  1K8U A;  1K9P A;  2LVK A;  4JQ0 D;  5JJG A;  3FS7 A;  2KQY A;  2NLN A;  4MZJ A;  2QPT A;  1IH0 A;  1K95 A;  1MWN A;  2ZRT A;  2K0J A;  1OZO A;  3NSO A;  2PVB A;  3PM8 A;  1TN4 A;  1L2O C;  1L2O B;  1S5G Z;  2FJU B;  2LUC A;  3HCM A;  2CTN A;  4ETO A;  2BL0 C;  1SNL A;  2HF5 A;  2AUC A;  3CR2 A;  2E6W A;  3TS5 C;  1WLZ A;  1K90 D;  1YVL A;  4C0J A;  3DF0 A;  3KHE A;  1QLS A;  2MLF C;  3OP0 A;  2BBM A;  2M49 B;  4PE7 A;  1ALW A;  2BE6 A;  2LHI A;  1A29 A;  3D10 A;  3PSR A;  3BOW B;  4WQ3 A;  1NX1 A;  2L51 A;  4DUQ A;  5K89 A;  4QJ5 B;  2JWW A;  1NX3 A;  4L9M A;  1SCV A;  2BCA A;  2B1U A;  4CPV A;  1QV0 A;  1FI5 A;  1CDP A;  2PSR A;  5D7F A;  1B1G A;  1H8B A;  1RFJ A;  1UHH A;  1DJY A;  4ZCV A;  2L98 A;  1IKU A;  1GJY A;  2RGI A;  4HRG A;  1R6P A;  3EVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...