3D10A

Crystal structure of s100b in the calcium and zinc loaded state at ph 10.0
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The crystal structures of human S100B in the zinc- and calcium-loaded state at three pH values reveal zinc ligand swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3d10A00
1Y1AA 2OTGB 4YRUA 5I2QA 1SMGA 1UP5A 2JXCA 1YURA 1RTP1 3OB1B 5KU1A 1S36A 2FCDA 5I2OA 1TCOB 1EL4A 1DJYA 1KCYA 3WNXB 3GK4X 5AERA 2MJWB 4UPGA 2KQ6A 1IG5A 5JOLA 2KI4C 1DJIA 1IKUA 1XFUO 4PE1A 4CLNA 4DS7A 3JVTB 1DJWA 1QTXA 4A4CA 2O5GA 2JWWA 5CPVA 2LMUA 4FTGA 3PLFB 1KSMA 1KSOA 4QJ4B 1TNWA 2EGDA 3HX4A 2WCEA 1TCFA 2LUCA 3SIAA 1KFXL 5HLOA 1X02A 3WHTB 2AMIA 1XK4A 2P6BB 4N1GA 2WC8A 2KSPA 2GV5A 1A75A 4AOMA 2M9GA 2BCBA 5K89A 1S1EA 2K7CA 1LA0A 3QRXA 1CDLA 5F6TA 1XO5A 1S3PA 4GBAA 4MRYA 2KI4B 1JF0A 3EK4A 2LANA 1NWDA 1CLLA 5DKNA 3PALA 4GFTA 1LXFC 1FPWA 1QVIZ 2BCXA 2D8NA 4GAOA 2BCAA 3VRRA 1B7TY 1CFCA 3FWBA 4P5OE 1J7PA 2I94A 2LV7A 2M97A 3MSEB 5CSJA 1EG3A 1SPYA 1NX0A 1U5IB 1WLZA 1EH2A 2BE6A 1TRFA 4NQGA 3CGAA 1DJXA 1K9UA 1L2OC 4I5KA 1CMGA 2BKIB 1MWNA 2KBIA 3SG5A 4GUKA 2V53A 2QACA 3JTDC 1EJ3A 3BOWB 4CFRA 1B8CA 4YGAA 1B47A 3PSRA 1OZOA 2KGRA 1WDCC 1Y1UA 1DMOA 1AHRA 1DGVA 1K96A 3RLZA 2JT8A 1GGZA 1SCMC 2GGMA 2ZNDA 3GOFA 1AJ4A 3AKBA 4P2YB 3NSIA 2M1KB 2I18A 1NPQA 4MLWA 1MHOA 2R2IA 2PASA 1SRAA 2CXJA 2K61A 2LVKA 2CTNA 5HKZA 3D0YB 4I5LB 5HKWA 1S6CA 2NLNA 3BXKA 4GPLB 4YI9A 1DJHA 4YGEB 1L2OB 1L7ZA 1BLQA 1K9KA 4OVNF 4M2PA 2JTZA 2M1UA 2JTTA 2I7AA 4MEWA 2JZIA 3JTDB 4MZKA 1V1FA 2LUXA 4HRGA 5CSNA 5DKQA 3TDZA 1F55A 3PM8A 2KAYA 3SG4A 1RJVA 1SNLA 1UUSA 1WDCB 3O78A 1SR6C 1AUIB 1F70A 1JUOA 1PSBA 3BQ3A 2M7NA 3PATA 2G2BA 1A03A 2FJUB 3EKJA 4MZLA 1XFWO 1JC2A 3C1VA 3CR5X 4XJKB 1WLMA 1SL9A 3EK8A 2PMYA 3EKHA 1XVJA 2KFHA 1OOJA 3AAJA 3BUWB 5HYDA 1BR1B 3KF9A 4ORCB 1BR4B 2KGBC 3CS1A 3ZWHA 5HLVA 5B8IB 2KI6C 5FYXA 1FW4A 1NUBA 2CCMA 3I5HB 2LAPA 1S6JA 1ZOTB 2MHHA 4DUQA 4USLA 4YGCB 1IQ5A 1J7OA 2O60A 1DGUA 2G9BA 2KNEA 1XK4C 1M63B 3ZNIA 3CR4X 1SR6B 3I5GC 2JU0A 3LK0A 4PE0A 2JULA 2JPTA 3DVJA 4PHJA 4QJ5B 1TNPA 1IWQA 1QS7A 1J1DA 1SCVA 3CWGA 1CKKA 3SG3A 3DVEA 2EHBA 2HQWA 2JOJA 2L4HA 3F45A 2WCFA 4MRXA 4BY5A 5PALA 1B4CA 1YRTB 3IQQA 4MVFA 3EVUA 4YBHB 3PFVA 1YR5A 1UHJA 2NXQA 1J55A 1F71A 3GK1A 1B1GA 4PCWA 1AJ5A 3EK7A 2I2RE 4ETOA 1CFFA 2NCOA 3EVVA 1UHIA 2FCEA 1A75B 2H61A 2PALA 1NX2A 3I5GB 3NSLA 4ORBB 2F3YA 1JWDA 2LVVA 1CM1A 5ER5A 1Y6WA 3AAKA 5KSZA 2Q4UA 2LHIA 3BUOB 5D69A 2SASA 3CTNA 5HKYA 1AP4A 1DTLA 1LVCD 2MLFC 3FS7A 1NYAA 5J3XA 1KFUS 4FQOA 2KI6D 1M46A 4GGNA 1NCYA 2JQ6A 1HQVA 2MRDA 1XFZO 1XA5A 2ZNEA 4YGBB 3I5IC 3VROA 1QV1A 3VRQA 5AANA 2K7BA 1B7TZ 4DRWA 1YRUB 2RGIA 1QLKA 4L9MA 1MQ1A 4M2OA 5CSIA 1YUUA 1G4YR 5IBWA 3OHMB 2BBMA 1R2UA 4HRHA 1OMRA 4M2QA 2LLSA 1NCZA 1IQ3A 3HCMA 1CFDA 1QLSA 5CSFA 1QVIY 2K0JA 1S5GZ 1UURA 3PN7C 2K7OA 3TUYC 3O4YA 4R1EA 4WQ3A 3LL8B 4ORAB 1N2DA 3NSOA 3OX5A 4AQIA 1PALA 2PRUA 1H4BA 3KO0A 1NSHA 4N1FA 3NSKA 1FI5A 1KFXS 3H4SE 1A29A 2TN4A 2NCPA 3I5IB 2KYFA 1FBVA 4I5NB 4DCKA 4JWQA 1K90D 1OMDA 4PHMA 3E3RA 4A4BA 2BE4A 2L50A 2CNPA 5D7FA 2F3ZA 3KHEA 2L4IA 1CDPA 2IS9A 1JFKA 1KK7Z 2DOQA 3WXAA 3D10A 3SG6A 1TNQA 1UHKA 2LLUA 5ER4X 3TS5C 1ZFSA 1QX5B 3I5HC 1C07A 1GGWA 1XFXO 4YGDB 1B8LA 2K2FA 2F2PA 1SL8A 2HF5A 2LVJA 1PULA 3PN7B 3A4UB 3TUYB 2JT0A 3VRNA 2F2OA 1CB1A 4E68A 2BL0B 3CR2A 1KQMC 2JC2A 1S26D 3M0WA 1QIWA 1MR8A 5DKRA 1PK0D 1SY9A 2K7DA 4PHKA 1H8BA 2ZKMX 1J7QA 3DF0A 4IL1A 3LCPC 1OQPA 1M45A 1K8UA 1K94A 2EC6B 4GGFA 1A2XA 3BUNB 4CFQA 4JQ0D 4QJ3B 2WCBA 1WRKA 1RWYA 3SJSA 1YUTA 1LA3A 2H2KA 2K8MB 3TS5B 2JNFA 1NP8A 2LC5A 5G08A 2ZN8A 1GJYA 3EVRA 3GK2A 4ZCUA 1F8HA 1YX8A 1N0YA 2LM5A 1CDNA 1IGVA 2H61C 3I5FB 2MLEC 3K21A 1BG1A 1BODA 1E8AA 4GNKB 4MZJA 5KTYA 1KQMB 4NDBA 2ZN9A 1A4PA 4CPVA 2M29A 1YVLA 2CBLA 2KFFA 2LCPA 1IJ5A 1BU3A 2BKHB 1KQVA 2E6WA 4WQ2A 1SK6D 1RECA 1RROA 1PRWA 1UHHA 1HT9A 3CZTX 3BUXB 1TN4A 1DJZA 1XFVO 1OZSA 2MA2A 2L51A 2WNDA 1CNPA 1OSAA 2QPTA 1B8RA 1XFYO 2M49B 1DF0A 4C0JA 2M3WA 1EG4A 1QXPA 5BPJA 1NX1A 1K2HA 2WOSA 1MXEA 1M31A 1AVSA 1K9PA 5AXIA 1UWOA 1KK8C 1IRJA 4D1EA 1XYDA 3FIAA 1JSAA 2HPSA 2ZRSA 1ODBA 1ZMZA 1QATA 3TDIA 1FF1A 1QV0A 1YTZC 4HSZA 1JF2A 1QX7A 1MF8B 2LP3A 4HREE 4YI8A 3IQOA 4MBEA 1IJ6A 2Y5IA 2M7LA 3RM1A 2OPOA 2SCPA 4AQJA 4PE7A 2F33A 2Y4QA 3LK1A 2BBNA 2VRGA 2MBXA 3BUMB 1JFJA 1R6PA 2LP2A 1SKTA 1DJGA 2M0RA 1LKJA 4Q04A 2AAOA 1K93D 1WY9A 2KHNA 1CLBA 1KK8B 2GGZA 2PSRA 4MSPA 3AKAA 1BMOA 1K95A 1EXRA 1ZACA 1BOCA 3IF7A 2B1UA 1BF5A 2KAXA 2WORA 4CIDA 1OE9B 1RFJA 2KOTA 4NDDA 1V1GA 4PHNA 1PSRA 5AFPA 1W7IB 1VRKA 3A8RA 1FI6A 5TNCA 4OR9B 1OMVA 1F54A 2NZ0A 4ICBA 1DT7B 1D1OA 2BL0C 1J7RA 3TZ1A 1CFPA 1G8IA 3CLNA 1TTXA 3WHUB 4NDCA 2PVBA 1SBJA 2L2EA 2JNXA 2L98A 3OX6A 4GGFC 1CLMA 2HETA 3FWCA 3SG2A 2KBMA 1U5IA 1SYMA 2EC6C 2M8UA 1YUSA 1KWOC 1S5GY 2KQYA 1ZUZA 2CT9A 4ZCVA 3O2PA 1MXLC 1N65A 3KEVA 5GQQC 1IH0A 1B9AA 1JBAA 1MUXA 1W7JB 3TDUA 2L5XB 3BOWA 1PVAA 4BY4A 1SW8A 2LVIA 2K2AA 4OKHA 4I5JA 2KAVA 3I5FC 2OS8C 4TNCA 5I2LA 3DD4A 3SIBA 1ALWA 3VGOA 1QASA 2LNKA 1J1EA 1M39A 2LLTA 2A4JA 4N5XA 2COLB 3DF0B 1DVIA 1KK7Y 2ZRTA 3DVKA 4XYNA 5I8NA 2LE9B 1QX2A 3O6BA 2Y1NA 1TIZA 1Y1XA 2L0PA 3VRPA 1WRLA 3BYAA 4MN0A 4PALA 1CDMA 3D0YA 4JPZB 2Q91A 4DIRA 1KWOB 4C0LA 1NIWA 1F4OA 4F0ZB 2MAZA 4OV2A 2LMVA 1ALVA 2FOTA 2OTGC 1PVBA 1YVHA 1CM4A 2Y1MA 1TOPA 3ICBA 3KPXA 1S6IA 1QIVA 1SCMB 2ZFDA 4PDZA 2OS8B 3NXAA 1GQMA 1NX3A 2JXLA 4C0KA 1WRZA 2AUCA 1QJTA 2F8PA 2LHLA 2LMTA 5AEQA 1AK8A 2KYCA 2HQ8A 4WRIA 1C7WA 4XJKA 1BT6A 1NCXA 1F4QA 4PE4A 3LLEA 2E30A 3DVMA 1SL7A 1Q80A 5JJGA 1UHNA 1LINA 1TNXA 2KDHA 1BJFA 3SG7A 2BECA 3JVTC 1G33A 2KFGA 1RK9A 1CMFA 2ISDA 4U8DA 4OCIA 1C7VA 1DF0B 1CTRA 2JRFA 2JT3A 3OB2B 1KFUL 1YX7A 3OP0A 1Y0VH
chains in the Genus database with same CATH superfamily
1Y1AA 2OTGB 4YRUA 5I2QA 1SMGA 1UP5A 2JXCA 1YURA 1RTP1 3OB1B 5KU1A 1S36A 2FCDA 1XFRA 5I2OA 1TCOB 1EL4A 1DJYA 1KCYA 3WNXB 3GK4X 5AERA 2MJWB 4UPGA 2QEVA 2KQ6A 1IG5A 5JOLA 1DELA 2KI4C 1DJIA 1OOFA 1IKUA 1XFUO 4PE1A 4CLNA 4DS7A 3JVTB 1DJWA 1DQEA 1QTXA 4A4CA 3SS5A 2O5GA 3R1VA 2JWWA 1Z2CB 2LMUA 5CPVA 4FTGA 3PLFB 1KSMA 1KSOA 4QJ4B 3NHIA 1TUJA 1TNWA 2EGDA 3HX4A 2WCEA 1TCFA 2LUCA 3SIAA 3S0FA 1KFXL 5HLOA 1X02A 3WHTB 2AMIA 1XK4A 2P6BB 4N1GA 2WCHA 2WC8A 2KSPA 2GV5A 1A75A 4AOMA 2M9GA 3RZSA 2BCBA 5K89A 1DC1A 1S1EA 2K7CA 2QEHA 1LA0A 3QRXA 1CDLA 5F6TA 1XO5A 1S3PA 4GBAA 4MRYA 2KI4B 1JF0A 3EK4A 2LANA 1NWDA 1CLLA 5DICA 5DKNA 3PALA 4GFTA 1LXFC 3CDNA 1FPWA 1QVIZ 2BCXA 2D8NA 4GAOA 2BCAA 3VRRA 1B7TY 1CFCA 3FWBA 3OGNA 4P5OE 1J7PA 2QEOA 2I94A 2LV7A 2M97A 3MSEB 5CSJA 1EG3A 1SPYA 1NX0A 1U5IB 1WLZA 4INWA 1EH2A 2BE6A 2WCMA 2KPHA 1TRFA 4NQGA 3CGAA 1DJXA 1K9UA 1L2OC 1OOHA 4I5KA 1CMGA 2BKIB 1OOGA 1MWNA 2KBIA 3SG5A 4GUKA 2V53A 2QACA 3JTDC 1EJ3A 3BOWB 4CFRA 1B8CA 4YGAA 1B47A 3PSRA 1OZOA 2KGRA 1WDCC 1Y1UA 1DMOA 1AHRA 1DGVA 3K1EA 1K96A 3RLZA 2JT8A 1GGZA 1SCMC 2GGMA 2ZNDA 3GOFA 1AJ4A 3AKBA 4P2YB 3NSIA 3SS4A 3Q8IA 3EG5B 4JD9A 2M1KB 2I18A 1NPQA 4MLWA 1MHOA 2R2IA 2PASA 1SRAA 2CXJA 2K61A 2LVKA 2CTNA 3FE6A 5HKZA 3D0YB 4I5LB 5HKWA 3UNWA 1S6CA 2NLNA 3S0EA 3BXKA 4GPLB 4YI9A 1DJHA 4YGEB 1L2OB 1L7ZA 2WCJA 1BLQA 1K9KA 4OVNF 4M2PA 2JTZA 2M1UA 2JTTA 2I7AA 2FJYA 4MEWA 2JZIA 3JTDB 4MZKA 1V1FA 2LUXA 4HRGA 5CSNA 5DKQA 3TDZA 1F55A 3PM8A 2KAYA 3SG4A 1P28A 1RJVA 1SNLA 1UUSA 1WDCB 3O78A 1SR6C 1AUIB 1F70A 1JUOA 5FI6A 1PSBA 3BQ3A 2M7NA 2P71A 3O4XA 2G2BA 3PATA 3PM2A 2FJUB 1A03A 3EKJA 4MZLA 1XFWO 1JC2A 3C1VA 3CR5X 4XJKB 1WLMA 1SL9A 3UO9A 3EK8A 2PMYA 3EKHA 1XVJA 2KFHA 2WCLA 1OOJA 3AAJA 3BUWB 3CYZA 3R1PA 5HYDA 1BR1B 3KF9A 4ORCB 1BR4B 2KGBC 3CS1A 3ZWHA 5HLVA 5B8IB 2KI6C 3B88A 5FYXA 1FW4A 1NUBA 2CCMA 3I5HB 2LAPA 1S6JA 1ZOTB 2MHHA 3FE9A 4INXA 4USLA 4DUQA 4YGCB 1IQ5A 3PJIA 1J7OA 2O60A 1DGUA 2G9BA 2KNEA 1XK4C 1M63B 3ZNIA 3CR4X 4F7FA 1SR6B 3DZTA 3I5GC 2JU0A 3LK0A 4PE0A 2JULA 2JPTA 3QMEA 3DVJA 2BAPA 4PHJA 4QJ5B 1TNPA 1IWQA 1QS7A 1J1DA 1SCVA 3CWGA 1Z4HA 1CKKA 3SG3A 3DVEA 2EHBA 2HQWA 2JOJA 2L4HA 3F45A 2WCFA 5D3OA 4MRXA 4BY5A 5PALA 3BFAA 1B4CA 1YRTB 3IQQA 4MVFA 3EVUA 4YBHB 3PFVA 1YR5A 1UHJA 2NXQA 2QDIA 1J55A 1F71A 3GK1A 1B1GA 4PCWA 1AJ5A 3EK7A 2I2RE 4ETOA 1CFFA 2NCOA 3EVVA 1UHIA 2FCEA 1A75B 4PT1A 1GM0A 2H61A 2PALA 1NX2A 3I5GB 3NSLA 4ORBB 2F3YA 3DYEA 1JWDA 2LVVA 1CM1A 5ER5A 1Y6WA 2PQLA 3AAKA 5KSZA 2Q4UA 2LHIA 3BUOB 5D69A 2SASA 3CTNA 5HKYA 1AP4A 3BFBA 1DTLA 1LVCD 2MLFC 3FS7A 1NYAA 3CABA 5J3XA 1KFUS 4FQOA 2KI6D 1M46A 4GGNA 1NCYA 2JQ6A 1HQVA 2MRDA 1XFZO 1XA5A 2ZNEA 4YGBB 3I5IC 3VROA 1QV1A 5FI2A 3VRQA 5AANA 2K7BA 1B7TZ 3OBVA 4DRWA 1YRUB 2RGIA 3D78A 1QLKA 4L9MA 3D75A 1MQ1A 4M2OA 5CSIA 1YUUA 1G4YR 5IBWA 3OHMB 2BBMA 1R2UA 3B86A 1OMRA 4HRHA 4M2QA 2LLSA 1NCZA 1IQ3A 3HCMA 1CFDA 1QLSA 5CSFA 1QVIY 2K0JA 1S5GZ 1UURA 3PN7C 2K7OA 3L47A 3O4YA 3TUYC 4R1EA 4WQ3A 2YGUA 3LL8B 4ORAB 1N2DA 3NSOA 3D74A 3OX5A 4AQIA 5HL1A 1PALA 2PRUA 1H4BA 3KO0A 1NSHA 4N1FA 3NSKA 1FI5A 1KFXS 3H4SE 1A29A 2TN4A 2NCPA 3I5IB 2KYFA 1FBVA 4I5NB 1IIOA 4DCKA 4JWQA 1OW4A 1K90D 1OMDA 2BNXA 4PHMA 3E3RA 4A4BA 2BE4A 2L50A 2CNPA 5D7FA 2F3ZA 3KHEA 2L4IA 1CDPA 2IS9A 1JFKA 1KK7Z 2DOQA 3WXAA 3D10A 3SG6A 1TNQA 1UHKA 2LLUA 1OOIX 5ER4X 1QWVA 3TS5C 1ZFSA 1QX5B 3I5HC 1C07A 1GGWA 1XFXO 4YGDB 1B8LA 2K2FA 2F2PA 1SL8A 2HF5A 2LVJA 1PULA 3PN7B 1SSEB 3A4UB 3TUYB 2JT0A 2WC6A 3VRNA 2F2OA 1CB1A 4E68A 2BL0B 3CR2A 3FE8A 1KQMC 2JC2A 3NGVA 1S26D 3M0WA 2KLEA 1QIWA 1MR8A 5DKRA 1PK0D 1SY9A 2K7DA 4PHKA 1H8BA 2ZKMX 3S0DA 1J7QA 3DF0A 4IL1A 3LCPC 1OQPA 1M45A 2H8VA 3IVTA 1K8UA 1K94A 1C3ZA 2EC6B 4GGFA 1A2XA 3BUNB 4CFQA 4JQ0D 4QJ3B 2K60A 2WCBA 1WRKA 1RWYA 3SJSA 1YUTA 1LA3A 2H2KA 2K8MB 3TS5B 2JNFA 1NP8A 2LC5A 5G08A 2ZN8A 1GJYA 3EVRA 3GK2A 4ZCUA 2ERBA 1YX8A 1F8HA 1N0YA 2LM5A 4IJ7A 1CDNA 1IGVA 2H61C 3I5FB 2MLEC 3K21A 4FQTA 1BG1A 1E8AA 4GNKB 4MZJA 5KTYA 1BODA 1KQMB 4NDBA 2ZN9A 1A4PA 1LS8A 4CPVA 2M29A 1TUZA 1YVLA 2CBLA 2KFFA 2LCPA 1IJ5A 1BU3A 2BKHB 1KQVA 2E6WA 4JKTA 1SK6D 2GTEA 4WQ2A 1RECA 1RROA 1PRWA 1UHHA 1HT9A 3CZTX 3BUXB 3VB1A 1TN4A 1DJZA 1XFVO 4KYNA 1OZSA 2MA2A 2L51A 2WNDA 1CNPA 1OSAA 2QPTA 3N7HA 1B8RA 1XFYO 2M49B 1DF0A 4C0JA 2M3WA 1EG4A 1QXPA 5BPJA 1NX1A 3R72A 1K2HA 2WOSA 1MXEA 1M31A 1AVSA 1K9PA 5AXIA 1UWOA 1KK8C 1IRJA 4D1EA 1XYDA 3FIAA 1JSAA 2HPSA 2ZRSA 1T14A 1ODBA 1ZMZA 1QATA 3TDIA 1FF1A 1QV0A 1YTZC 4HSZA 1JF2A 1QX7A 1MF8B 2LP3A 4HREE 3S0GA 1DEKA 4YI8A 3IQOA 4MBEA 4OZDA 1IJ6A 2Y5IA 3CZ0A 3D77A 2M7LA 3RM1A 2OPOA 3S0BA 2SCPA 4AQJA 4PE7A 2F33A 2Y4QA 3LK1A 2BBNA 2VRGA 2MBXA 3BUMB 1JFJA 1R6PA 2JPOA 2LP2A 1SKTA 1DJGA 2M0RA 3R1OA 1LKJA 4Q04A 2AAOA 1K93D 2P70A 1WY9A 2KHNA 1CLBA 1KK8B 2GGZA 2PSRA 4MSPA 3AKAA 1BMOA 1K95A 1EXRA 1ZACA 1BOCA 3IF7A 2B1UA 1BF5A 2KAXA 2WORA 4CIDA 1OE9B 1RFJA 2KOTA 4NDDA 1V1GA 4PHNA 1PSRA 5AFPA 1W7IB 1VRKA 3A8RA 1FI6A 5TNCA 4OR9B 1OMVA 1F54A 3SS3A 2NZ0A 4ICBA 1DT7B 1D1OA 2BL0C 3B6XA 2L5YA 1J7RA 3TZ1A 1CFPA 1G8IA 3CLNA 1TTXA 3WHUB 3V2LA 4NDCA 2PVBA 1SBJA 2WC5A 2L2EA 2JNXA 2L98A 5EL2A 3OX6A 4GGFC 1CLMA 2HETA 3FWCA 3SG2A 2KBMA 5FI7A 1U5IA 1SYMA 2EC6C 2M8UA 1YUSA 1KWOC 1S5GY 2KQYA 1ZUZA 2CT9A 3L4LA 4ZCVA 3O2PA 1MXLC 1N65A 3KEVA 5GQQC 1IH0A 3BJHA 1B9AA 1C3YA 1MUXA 1W7JB 3NHTA 3TDUA 1JBAA 2L5XB 3BOWA 1PVAA 2QEBA 1SW8A 3CZ2A 2LVIA 4BY4A 2K2AA 4OKHA 4I5JA 2KAVA 3BFHA 3I5FC 2OS8C 4TNCA 5I2LA 3DD4A 3SIBA 1ALWA 3VGOA 1QASA 3DXLA 5I8NA 2LNKA 1TWOA 3L4AA 1J1EA 1M39A 2LLTA 2KLDA 2A4JA 4N5XA 2COLB 3DF0B 1DVIA 1KK7Y 1ORGA 2ZRTA 3DVKA 4XYNA 1W9ZA 2LE9B 1QX2A 3CZ1A 3O6BA 2Y1NA 1TIZA 1Y1XA 2L0PA 3VRPA 3DY9A 1WRLA 3BYAA 4MN0A 4PALA 1CDMA 3D0YA 4JPZB 2Q91A 4DIRA 1KWOB 4C0LA 2L2CA 1NIWA 1F4OA 2PYQA 4F0ZB 2MAZA 4OV2A 2LMVA 1ALVA 2FOTA 2OTGC 1PVBA 1YVHA 1CM4A 2Y1MA 3B7AA 1TOPA 3ICBA 3KPXA 1S6IA 1QIVA 1SCMB 2ZFDA 4PDZA 2OS8B 3NXAA 1GQMA 1NX3A 2JXLA 4C0KA 1WRZA 2AUCA 1QJTA 2F8PA 2LHLA 2LMTA 3D73A 5AEQA 2KYCA 2HQ8A 4WRIA 1AK8A 1C7WA 4XJKA 1BT6A 1NCXA 1F4QA 3S0AA 4PE4A 3LLEA 2E30A 3DVMA 3D76A 1SL7A 1Q80A 5JJGA 1UHNA 1LINA 1TNXA 2KDHA 1BJFA 3B87A 2BECA 3JVTC 3SG7A 1G33A 2KFGA 5I94A 1RK9A 1CMFA 2ISDA 4U8DA 4OCIA 1C7VA 1DF0B 1CTRA 2JRFA 2JT3A 3OB2B 1KFUL 1YX7A 3OP0A 1Y0VH 2WCKA
chains in the Genus database with same CATH topology
1Y1AA 2OTGB 4YRUA 5I2QA 1SMGA 1UP5A 2JXCA 1YURA 1RTP1 3OB1B 5KU1A 1S36A 2FCDA 5I2OA 1TCOB 1EL4A 1DJYA 1KCYA 3WNXB 3GK4X 5AERA 2MJWB 4UPGA 2KQ6A 1IG5A 5JOLA 2KI4C 1DJIA 1IKUA 1XFUO 4PE1A 4CLNA 4DS7A 3JVTB 1DJWA 1QTXA 4A4CA 2O5GA 2JWWA 5CPVA 2LMUA 4FTGA 3PLFB 1KSMA 1KSOA 4QJ4B 1TNWA 2EGDA 3HX4A 2WCEA 1TCFA 2LUCA 3SIAA 1KFXL 5HLOA 1X02A 3WHTB 2AMIA 1XK4A 2P6BB 4N1GA 2WC8A 2KSPA 2GV5A 1A75A 4AOMA 2M9GA 2BCBA 5K89A 1S1EA 2K7CA 1LA0A 3QRXA 1CDLA 5F6TA 1XO5A 1S3PA 4GBAA 4MRYA 2KI4B 1JF0A 3EK4A 2LANA 1NWDA 1CLLA 5DKNA 3PALA 4GFTA 1LXFC 1FPWA 1QVIZ 2BCXA 2D8NA 4GAOA 2BCAA 3VRRA 1B7TY 1CFCA 3FWBA 4P5OE 1J7PA 2I94A 2LV7A 2M97A 3MSEB 5CSJA 1EG3A 1SPYA 1NX0A 1U5IB 1WLZA 1EH2A 2BE6A 1TRFA 4NQGA 3CGAA 1DJXA 1K9UA 1L2OC 4I5KA 1CMGA 2BKIB 1MWNA 2KBIA 3SG5A 4GUKA 2V53A 2QACA 3JTDC 1EJ3A 3BOWB 4CFRA 1B8CA 4YGAA 1B47A 3PSRA 1OZOA 2KGRA 1WDCC 1Y1UA 1DMOA 1AHRA 1DGVA 1K96A 3RLZA 2JT8A 1GGZA 1SCMC 2GGMA 2ZNDA 3GOFA 1AJ4A 3AKBA 4P2YB 3NSIA 2M1KB 2I18A 1NPQA 4MLWA 1MHOA 2R2IA 2PASA 1SRAA 2CXJA 2K61A 2LVKA 2CTNA 5HKZA 3D0YB 4I5LB 5HKWA 1S6CA 2NLNA 3BXKA 4GPLB 4YI9A 1DJHA 4YGEB 1L2OB 1L7ZA 1BLQA 1K9KA 4OVNF 4M2PA 2JTZA 2M1UA 2JTTA 2I7AA 4MEWA 2JZIA 3JTDB 4MZKA 1V1FA 2LUXA 4HRGA 5CSNA 5DKQA 3TDZA 1F55A 3PM8A 2KAYA 3SG4A 1RJVA 1SNLA 1UUSA 1WDCB 3O78A 1SR6C 1AUIB 1F70A 1JUOA 1PSBA 3BQ3A 2M7NA 3PATA 2G2BA 1A03A 2FJUB 3EKJA 4MZLA 1XFWO 1JC2A 3C1VA 3CR5X 4XJKB 1WLMA 1SL9A 3EK8A 2PMYA 3EKHA 1XVJA 2KFHA 1OOJA 3AAJA 3BUWB 5HYDA 1BR1B 3KF9A 4ORCB 1BR4B 2KGBC 3CS1A 3ZWHA 5HLVA 5B8IB 2KI6C 5FYXA 1FW4A 1NUBA 2CCMA 3I5HB 2LAPA 1S6JA 1ZOTB 2MHHA 4DUQA 4USLA 4YGCB 1IQ5A 1J7OA 2O60A 1DGUA 2G9BA 2KNEA 1XK4C 1M63B 3ZNIA 3CR4X 1SR6B 3I5GC 2JU0A 3LK0A 4PE0A 2JULA 2JPTA 3DVJA 4PHJA 4QJ5B 1TNPA 1IWQA 1QS7A 1J1DA 1SCVA 3CWGA 1CKKA 3SG3A 3DVEA 2EHBA 2HQWA 2JOJA 2L4HA 3F45A 2WCFA 4MRXA 4BY5A 5PALA 1B4CA 1YRTB 3IQQA 4MVFA 3EVUA 4YBHB 3PFVA 1YR5A 1UHJA 2NXQA 1J55A 1F71A 3GK1A 1B1GA 4PCWA 1AJ5A 3EK7A 2I2RE 4ETOA 1CFFA 2NCOA 3EVVA 1UHIA 2FCEA 1A75B 2H61A 2PALA 1NX2A 3I5GB 3NSLA 4ORBB 2F3YA 1JWDA 2LVVA 1CM1A 5ER5A 1Y6WA 3AAKA 5KSZA 2Q4UA 2LHIA 3BUOB 5D69A 2SASA 3CTNA 5HKYA 1AP4A 1DTLA 1LVCD 2MLFC 3FS7A 1NYAA 5J3XA 1KFUS 4FQOA 2KI6D 1M46A 4GGNA 1NCYA 2JQ6A 1HQVA 2MRDA 1XFZO 1XA5A 2ZNEA 4YGBB 3I5IC 3VROA 1QV1A 3VRQA 5AANA 2K7BA 1B7TZ 4DRWA 1YRUB 2RGIA 1QLKA 4L9MA 1MQ1A 4M2OA 5CSIA 1YUUA 1G4YR 5IBWA 3OHMB 2BBMA 1R2UA 4HRHA 1OMRA 4M2QA 2LLSA 1NCZA 1IQ3A 3HCMA 1CFDA 1QLSA 5CSFA 1QVIY 2K0JA 1S5GZ 1UURA 3PN7C 2K7OA 3TUYC 3O4YA 4R1EA 4WQ3A 3LL8B 4ORAB 1N2DA 3NSOA 3OX5A 4AQIA 1PALA 2PRUA 1H4BA 3KO0A 1NSHA 4N1FA 3NSKA 1FI5A 1KFXS 3H4SE 1A29A 2TN4A 2NCPA 3I5IB 2KYFA 1FBVA 4I5NB 4DCKA 4JWQA 1K90D 1OMDA 4PHMA 3E3RA 4A4BA 2BE4A 2L50A 2CNPA 5D7FA 2F3ZA 3KHEA 2L4IA 1CDPA 2IS9A 1JFKA 1KK7Z 2DOQA 3WXAA 3D10A 3SG6A 1TNQA 1UHKA 2LLUA 5ER4X 3TS5C 1ZFSA 1QX5B 3I5HC 1C07A 1GGWA 1XFXO 4YGDB 1B8LA 2K2FA 2F2PA 1SL8A 2HF5A 2LVJA 1PULA 3PN7B 3A4UB 3TUYB 2JT0A 3VRNA 2F2OA 1CB1A 4E68A 2BL0B 3CR2A 1KQMC 2JC2A 1S26D 3M0WA 1QIWA 1MR8A 5DKRA 1PK0D 1SY9A 2K7DA 4PHKA 1H8BA 2ZKMX 1J7QA 3DF0A 4IL1A 3LCPC 1OQPA 1M45A 1K8UA 1K94A 2EC6B 4GGFA 1A2XA 3BUNB 4CFQA 4JQ0D 4QJ3B 2WCBA 1WRKA 1RWYA 3SJSA 1YUTA 1LA3A 2H2KA 2K8MB 3TS5B 2JNFA 1NP8A 2LC5A 5G08A 2ZN8A 1GJYA 3EVRA 3GK2A 4ZCUA 1F8HA 1YX8A 1N0YA 2LM5A 1CDNA 1IGVA 2H61C 3I5FB 2MLEC 3K21A 1BG1A 1BODA 1E8AA 4GNKB 4MZJA 5KTYA 1KQMB 4NDBA 2ZN9A 1A4PA 4CPVA 2M29A 1YVLA 2CBLA 2KFFA 2LCPA 1IJ5A 1BU3A 2BKHB 1KQVA 2E6WA 4WQ2A 1SK6D 1RECA 1RROA 1PRWA 1UHHA 1HT9A 3CZTX 3BUXB 1TN4A 1DJZA 1XFVO 1OZSA 2MA2A 2L51A 2WNDA 1CNPA 1OSAA 2QPTA 1B8RA 1XFYO 2M49B 1DF0A 4C0JA 2M3WA 1EG4A 1QXPA 5BPJA 1NX1A 1K2HA 2WOSA 1MXEA 1M31A 1AVSA 1K9PA 5AXIA 1UWOA 1KK8C 1IRJA 4D1EA 1XYDA 3FIAA 1JSAA 2HPSA 2ZRSA 1ODBA 1ZMZA 1QATA 3TDIA 1FF1A 1QV0A 1YTZC 4HSZA 1JF2A 1QX7A 1MF8B 2LP3A 4HREE 4YI8A 3IQOA 4MBEA 1IJ6A 2Y5IA 2M7LA 3RM1A 2OPOA 2SCPA 4AQJA 4PE7A 2F33A 2Y4QA 3LK1A 2BBNA 2VRGA 2MBXA 3BUMB 1JFJA 1R6PA 2LP2A 1SKTA 1DJGA 2M0RA 1LKJA 4Q04A 2AAOA 1K93D 1WY9A 2KHNA 1CLBA 1KK8B 2GGZA 2PSRA 4MSPA 3AKAA 1BMOA 1K95A 1EXRA 1ZACA 1BOCA 3IF7A 2B1UA 1BF5A 2KAXA 2WORA 4CIDA 1OE9B 1RFJA 2KOTA 4NDDA 1V1GA 4PHNA 1PSRA 5AFPA 1W7IB 1VRKA 3A8RA 1FI6A 5TNCA 4OR9B 1OMVA 1F54A 2NZ0A 4ICBA 1DT7B 1D1OA 2BL0C 1J7RA 3TZ1A 1CFPA 1G8IA 3CLNA 1TTXA 3WHUB 4NDCA 2PVBA 1SBJA 2L2EA 2JNXA 2L98A 3OX6A 4GGFC 1CLMA 2HETA 3FWCA 3SG2A 2KBMA 1U5IA 1SYMA 2EC6C 2M8UA 1YUSA 1KWOC 1S5GY 2KQYA 1ZUZA 2CT9A 4ZCVA 3O2PA 1MXLC 1N65A 3KEVA 5GQQC 1IH0A 1B9AA 1JBAA 1MUXA 1W7JB 3TDUA 2L5XB 3BOWA 1PVAA 4BY4A 1SW8A 2LVIA 2K2AA 4OKHA 4I5JA 2KAVA 3I5FC 2OS8C 4TNCA 5I2LA 3DD4A 3SIBA 1ALWA 3VGOA 1QASA 2LNKA 1J1EA 1M39A 2LLTA 2A4JA 4N5XA 2COLB 3DF0B 1DVIA 1KK7Y 2ZRTA 3DVKA 4XYNA 5I8NA 2LE9B 1QX2A 3O6BA 2Y1NA 1TIZA 1Y1XA 2L0PA 3VRPA 1WRLA 3BYAA 4MN0A 4PALA 1CDMA 3D0YA 4JPZB 2Q91A 4DIRA 1KWOB 4C0LA 1NIWA 1F4OA 4F0ZB 2MAZA 4OV2A 2LMVA 1ALVA 2FOTA 2OTGC 1PVBA 1YVHA 1CM4A 2Y1MA 1TOPA 3ICBA 3KPXA 1S6IA 1QIVA 1SCMB 2ZFDA 4PDZA 2OS8B 3NXAA 1GQMA 1NX3A 2JXLA 4C0KA 1WRZA 2AUCA 1QJTA 2F8PA 2LHLA 2LMTA 5AEQA 1AK8A 2KYCA 2HQ8A 4WRIA 1C7WA 4XJKA 1BT6A 1NCXA 1F4QA 4PE4A 3LLEA 2E30A 3DVMA 1SL7A 1Q80A 5JJGA 1UHNA 1LINA 1TNXA 2KDHA 1BJFA 3SG7A 2BECA 3JVTC 1G33A 2KFGA 1RK9A 1CMFA 2ISDA 4U8DA 4OCIA 1C7VA 1DF0B 1CTRA 2JRFA 2JT3A 3OB2B 1KFUL 1YX7A 3OP0A 1Y0VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1A A;  2OTG B;  4YRU A;  5I2Q A;  1SMG A;  1UP5 A;  2JXC A;  1YUR A;  1RTP 1;  3OB1 B;  5KU1 A;  1S36 A;  2FCD A;  5I2O A;  1TCO B;  1EL4 A;  1DJY A;  1KCY A;  3WNX B;  3GK4 X;  5AER A;  2MJW B;  4UPG A;  2KQ6 A;  1IG5 A;  5JOL A;  2KI4 C;  1DJI A;  1IKU A;  1XFU O;  4PE1 A;  4CLN A;  4DS7 A;  3JVT B;  1DJW A;  1QTX A;  4A4C A;  2O5G A;  2JWW A;  5CPV A;  2LMU A;  4FTG A;  3PLF B;  1KSM A;  1KSO A;  4QJ4 B;  1TNW A;  2EGD A;  3HX4 A;  2WCE A;  1TCF A;  2LUC A;  3SIA A;  1KFX L;  5HLO A;  1X02 A;  3WHT B;  2AMI A;  1XK4 A;  2P6B B;  4N1G A;  2WC8 A;  2KSP A;  2GV5 A;  1A75 A;  4AOM A;  2M9G A;  2BCB A;  5K89 A;  1S1E A;  2K7C A;  1LA0 A;  3QRX A;  1CDL A;  5F6T A;  1XO5 A;  1S3P A;  4GBA A;  4MRY A;  2KI4 B;  1JF0 A;  3EK4 A;  2LAN A;  1NWD A;  1CLL A;  5DKN A;  3PAL A;  4GFT A;  1LXF C;  1FPW A;  1QVI Z;  2BCX A;  2D8N A;  4GAO A;  2BCA A;  3VRR A;  1B7T Y;  1CFC A;  3FWB A;  4P5O E;  1J7P A;  2I94 A;  2LV7 A;  2M97 A;  3MSE B;  5CSJ A;  1EG3 A;  1SPY A;  1NX0 A;  1U5I B;  1WLZ A;  1EH2 A;  2BE6 A;  1TRF A;  4NQG A;  3CGA A;  1DJX A;  1K9U A;  1L2O C;  4I5K A;  1CMG A;  2BKI B;  1MWN A;  2KBI A;  3SG5 A;  4GUK A;  2V53 A;  2QAC A;  3JTD C;  1EJ3 A;  3BOW B;  4CFR A;  1B8C A;  4YGA A;  1B47 A;  3PSR A;  1OZO A;  2KGR A;  1WDC C;  1Y1U A;  1DMO A;  1AHR A;  1DGV A;  1K96 A;  3RLZ A;  2JT8 A;  1GGZ A;  1SCM C;  2GGM A;  2ZND A;  3GOF A;  1AJ4 A;  3AKB A;  4P2Y B;  3NSI A;  2M1K B;  2I18 A;  1NPQ A;  4MLW A;  1MHO A;  2R2I A;  2PAS A;  1SRA A;  2CXJ A;  2K61 A;  2LVK A;  2CTN A;  5HKZ A;  3D0Y B;  4I5L B;  5HKW A;  1S6C A;  2NLN A;  3BXK A;  4GPL B;  4YI9 A;  1DJH A;  4YGE B;  1L2O B;  1L7Z A;  1BLQ A;  1K9K A;  4OVN F;  4M2P A;  2JTZ A;  2M1U A;  2JTT A;  2I7A A;  4MEW A;  2JZI A;  3JTD B;  4MZK A;  1V1F A;  2LUX A;  4HRG A;  5CSN A;  5DKQ A;  3TDZ A;  1F55 A;  3PM8 A;  2KAY A;  3SG4 A;  1RJV A;  1SNL A;  1UUS A;  1WDC B;  3O78 A;  1SR6 C;  1AUI B;  1F70 A;  1JUO A;  1PSB A;  3BQ3 A;  2M7N A;  3PAT A;  2G2B A;  1A03 A;  2FJU B;  3EKJ A;  4MZL A;  1XFW O;  1JC2 A;  3C1V A;  3CR5 X;  4XJK B;  1WLM A;  1SL9 A;  3EK8 A;  2PMY A;  3EKH A;  1XVJ A;  2KFH A;  1OOJ A;  3AAJ A;  3BUW B;  5HYD A;  1BR1 B;  3KF9 A;  4ORC B;  1BR4 B;  2KGB C;  3CS1 A;  3ZWH A;  5HLV A;  5B8I B;  2KI6 C;  5FYX A;  1FW4 A;  1NUB A;  2CCM A;  3I5H B;  2LAP A;  1S6J A;  1ZOT B;  2MHH A;  4DUQ A;  4USL A;  4YGC B;  1IQ5 A;  1J7O A;  2O60 A;  1DGU A;  2G9B A;  2KNE A;  1XK4 C;  1M63 B;  3ZNI A;  3CR4 X;  1SR6 B;  3I5G C;  2JU0 A;  3LK0 A;  4PE0 A;  2JUL A;  2JPT A;  3DVJ A;  4PHJ A;  4QJ5 B;  1TNP A;  1IWQ A;  1QS7 A;  1J1D A;  1SCV A;  3CWG A;  1CKK A;  3SG3 A;  3DVE A;  2EHB A;  2HQW A;  2JOJ A;  2L4H A;  3F45 A;  2WCF A;  4MRX A;  4BY5 A;  5PAL A;  1B4C A;  1YRT B;  3IQQ A;  4MVF A;  3EVU A;  4YBH B;  3PFV A;  1YR5 A;  1UHJ A;  2NXQ A;  1J55 A;  1F71 A;  3GK1 A;  1B1G A;  4PCW A;  1AJ5 A;  3EK7 A;  2I2R E;  4ETO A;  1CFF A;  2NCO A;  3EVV A;  1UHI A;  2FCE A;  1A75 B;  2H61 A;  2PAL A;  1NX2 A;  3I5G B;  3NSL A;  4ORB B;  2F3Y A;  1JWD A;  2LVV A;  1CM1 A;  5ER5 A;  1Y6W A;  3AAK A;  5KSZ A;  2Q4U A;  2LHI A;  3BUO B;  5D69 A;  2SAS A;  3CTN A;  5HKY A;  1AP4 A;  1DTL A;  1LVC D;  2MLF C;  3FS7 A;  1NYA A;  5J3X A;  1KFU S;  4FQO A;  2KI6 D;  1M46 A;  4GGN A;  1NCY A;  2JQ6 A;  1HQV A;  2MRD A;  1XFZ O;  1XA5 A;  2ZNE A;  4YGB B;  3I5I C;  3VRO A;  1QV1 A;  3VRQ A;  5AAN A;  2K7B A;  1B7T Z;  4DRW A;  1YRU B;  2RGI A;  1QLK A;  4L9M A;  1MQ1 A;  4M2O A;  5CSI A;  1YUU A;  1G4Y R;  5IBW A;  3OHM B;  2BBM A;  1R2U A;  4HRH A;  1OMR A;  4M2Q A;  2LLS A;  1NCZ A;  1IQ3 A;  3HCM A;  1CFD A;  1QLS A;  5CSF A;  1QVI Y;  2K0J A;  1S5G Z;  1UUR A;  3PN7 C;  2K7O A;  3TUY C;  3O4Y A;  4R1E A;  4WQ3 A;  3LL8 B;  4ORA B;  1N2D A;  3NSO A;  3OX5 A;  4AQI A;  1PAL A;  2PRU A;  1H4B A;  3KO0 A;  1NSH A;  4N1F A;  3NSK A;  1FI5 A;  1KFX S;  3H4S E;  1A29 A;  2TN4 A;  2NCP A;  3I5I B;  2KYF A;  1FBV A;  4I5N B;  4DCK A;  4JWQ A;  1K90 D;  1OMD A;  4PHM A;  3E3R A;  4A4B A;  2BE4 A;  2L50 A;  2CNP A;  5D7F A;  2F3Z A;  3KHE A;  2L4I A;  1CDP A;  2IS9 A;  1JFK A;  1KK7 Z;  2DOQ A;  3WXA A;  3D10 A;  3SG6 A;  1TNQ A;  1UHK A;  2LLU A;  5ER4 X;  3TS5 C;  1ZFS A;  1QX5 B;  3I5H C;  1C07 A;  1GGW A;  1XFX O;  4YGD B;  1B8L A;  2K2F A;  2F2P A;  1SL8 A;  2HF5 A;  2LVJ A;  1PUL A;  3PN7 B;  3A4U B;  3TUY B;  2JT0 A;  3VRN A;  2F2O A;  1CB1 A;  4E68 A;  2BL0 B;  3CR2 A;  1KQM C;  2JC2 A;  1S26 D;  3M0W A;  1QIW A;  1MR8 A;  5DKR A;  1PK0 D;  1SY9 A;  2K7D A;  4PHK A;  1H8B A;  2ZKM X;  1J7Q A;  3DF0 A;  4IL1 A;  3LCP C;  1OQP A;  1M45 A;  1K8U A;  1K94 A;  2EC6 B;  4GGF A;  1A2X A;  3BUN B;  4CFQ A;  4JQ0 D;  4QJ3 B;  2WCB A;  1WRK A;  1RWY A;  3SJS A;  1YUT A;  1LA3 A;  2H2K A;  2K8M B;  3TS5 B;  2JNF A;  1NP8 A;  2LC5 A;  5G08 A;  2ZN8 A;  1GJY A;  3EVR A;  3GK2 A;  4ZCU A;  1F8H A;  1YX8 A;  1N0Y A;  2LM5 A;  1CDN A;  1IGV A;  2H61 C;  3I5F B;  2MLE C;  3K21 A;  1BG1 A;  1BOD A;  1E8A A;  4GNK B;  4MZJ A;  5KTY A;  1KQM B;  4NDB A;  2ZN9 A;  1A4P A;  4CPV A;  2M29 A;  1YVL A;  2CBL A;  2KFF A;  2LCP A;  1IJ5 A;  1BU3 A;  2BKH B;  1KQV A;  2E6W A;  4WQ2 A;  1SK6 D;  1REC A;  1RRO A;  1PRW A;  1UHH A;  1HT9 A;  3CZT X;  3BUX B;  1TN4 A;  1DJZ A;  1XFV O;  1OZS A;  2MA2 A;  2L51 A;  2WND A;  1CNP A;  1OSA A;  2QPT A;  1B8R A;  1XFY O;  2M49 B;  1DF0 A;  4C0J A;  2M3W A;  1EG4 A;  1QXP A;  5BPJ A;  1NX1 A;  1K2H A;  2WOS A;  1MXE A;  1M31 A;  1AVS A;  1K9P A;  5AXI A;  1UWO A;  1KK8 C;  1IRJ A;  4D1E A;  1XYD A;  3FIA A;  1JSA A;  2HPS A;  2ZRS A;  1ODB A;  1ZMZ A;  1QAT A;  3TDI A;  1FF1 A;  1QV0 A;  1YTZ C;  4HSZ A;  1JF2 A;  1QX7 A;  1MF8 B;  2LP3 A;  4HRE E;  4YI8 A;  3IQO A;  4MBE A;  1IJ6 A;  2Y5I A;  2M7L A;  3RM1 A;  2OPO A;  2SCP A;  4AQJ A;  4PE7 A;  2F33 A;  2Y4Q A;  3LK1 A;  2BBN A;  2VRG A;  2MBX A;  3BUM B;  1JFJ A;  1R6P A;  2LP2 A;  1SKT A;  1DJG A;  2M0R A;  1LKJ A;  4Q04 A;  2AAO A;  1K93 D;  1WY9 A;  2KHN A;  1CLB A;  1KK8 B;  2GGZ A;  2PSR A;  4MSP A;  3AKA A;  1BMO A;  1K95 A;  1EXR A;  1ZAC A;  1BOC A;  3IF7 A;  2B1U A;  1BF5 A;  2KAX A;  2WOR A;  4CID A;  1OE9 B;  1RFJ A;  2KOT A;  4NDD A;  1V1G A;  4PHN A;  1PSR A;  5AFP A;  1W7I B;  1VRK A;  3A8R A;  1FI6 A;  5TNC A;  4OR9 B;  1OMV A;  1F54 A;  2NZ0 A;  4ICB A;  1DT7 B;  1D1O A;  2BL0 C;  1J7R A;  3TZ1 A;  1CFP A;  1G8I A;  3CLN A;  1TTX A;  3WHU B;  4NDC A;  2PVB A;  1SBJ A;  2L2E A;  2JNX A;  2L98 A;  3OX6 A;  4GGF C;  1CLM A;  2HET A;  3FWC A;  3SG2 A;  2KBM A;  1U5I A;  1SYM A;  2EC6 C;  2M8U A;  1YUS A;  1KWO C;  1S5G Y;  2KQY A;  1ZUZ A;  2CT9 A;  4ZCV A;  3O2P A;  1MXL C;  1N65 A;  3KEV A;  5GQQ C;  1IH0 A;  1B9A A;  1JBA A;  1MUX A;  1W7J B;  3TDU A;  2L5X B;  3BOW A;  1PVA A;  4BY4 A;  1SW8 A;  2LVI A;  2K2A A;  4OKH A;  4I5J A;  2KAV A;  3I5F C;  2OS8 C;  4TNC A;  5I2L A;  3DD4 A;  3SIB A;  1ALW A;  3VGO A;  1QAS A;  2LNK A;  1J1E A;  1M39 A;  2LLT A;  2A4J A;  4N5X A;  2COL B;  3DF0 B;  1DVI A;  1KK7 Y;  2ZRT A;  3DVK A;  4XYN A;  5I8N A;  2LE9 B;  1QX2 A;  3O6B A;  2Y1N A;  1TIZ A;  1Y1X A;  2L0P A;  3VRP A;  1WRL A;  3BYA A;  4MN0 A;  4PAL A;  1CDM A;  3D0Y A;  4JPZ B;  2Q91 A;  4DIR A;  1KWO B;  4C0L A;  1NIW A;  1F4O A;  4F0Z B;  2MAZ A;  4OV2 A;  2LMV A;  1ALV A;  2FOT A;  2OTG C;  1PVB A;  1YVH A;  1CM4 A;  2Y1M A;  1TOP A;  3ICB A;  3KPX A;  1S6I A;  1QIV A;  1SCM B;  2ZFD A;  4PDZ A;  2OS8 B;  3NXA A;  1GQM A;  1NX3 A;  2JXL A;  4C0K A;  1WRZ A;  2AUC A;  1QJT A;  2F8P A;  2LHL A;  2LMT A;  5AEQ A;  1AK8 A;  2KYC A;  2HQ8 A;  4WRI A;  1C7W A;  4XJK A;  1BT6 A;  1NCX A;  1F4Q A;  4PE4 A;  3LLE A;  2E30 A;  3DVM A;  1SL7 A;  1Q80 A;  5JJG A;  1UHN A;  1LIN A;  1TNX A;  2KDH A;  1BJF A;  3SG7 A;  2BEC A;  3JVT C;  1G33 A;  2KFG A;  1RK9 A;  1CMF A;  2ISD A;  4U8D A;  4OCI A;  1C7V A;  1DF0 B;  1CTR A;  2JRF A;  2JT3 A;  3OB2 B;  1KFU L;  1YX7 A;  3OP0 A;  1Y0V H; 
#chains in the Genus database with same CATH topology
 1Y1A A;  2OTG B;  4YRU A;  5I2Q A;  1SMG A;  1UP5 A;  2JXC A;  1YUR A;  1RTP 1;  3OB1 B;  5KU1 A;  1S36 A;  2FCD A;  1XFR A;  5I2O A;  1TCO B;  1EL4 A;  1DJY A;  1KCY A;  3WNX B;  3GK4 X;  5AER A;  2MJW B;  4UPG A;  2QEV A;  2KQ6 A;  1IG5 A;  5JOL A;  1DEL A;  2KI4 C;  1DJI A;  1OOF A;  1IKU A;  1XFU O;  4PE1 A;  4CLN A;  4DS7 A;  3JVT B;  1DJW A;  1DQE A;  1QTX A;  4A4C A;  3SS5 A;  2O5G A;  3R1V A;  2JWW A;  1Z2C B;  2LMU A;  5CPV A;  4FTG A;  3PLF B;  1KSM A;  1KSO A;  4QJ4 B;  3NHI A;  1TUJ A;  1TNW A;  2EGD A;  3HX4 A;  2WCE A;  1TCF A;  2LUC A;  3SIA A;  3S0F A;  1KFX L;  5HLO A;  1X02 A;  3WHT B;  2AMI A;  1XK4 A;  2P6B B;  4N1G A;  2WCH A;  2WC8 A;  2KSP A;  2GV5 A;  1A75 A;  4AOM A;  2M9G A;  3RZS A;  2BCB A;  5K89 A;  1DC1 A;  1S1E A;  2K7C A;  2QEH A;  1LA0 A;  3QRX A;  1CDL A;  5F6T A;  1XO5 A;  1S3P A;  4GBA A;  4MRY A;  2KI4 B;  1JF0 A;  3EK4 A;  2LAN A;  1NWD A;  1CLL A;  5DIC A;  5DKN A;  3PAL A;  4GFT A;  1LXF C;  3CDN A;  1FPW A;  1QVI Z;  2BCX A;  2D8N A;  4GAO A;  2BCA A;  3VRR A;  1B7T Y;  1CFC A;  3FWB A;  3OGN A;  4P5O E;  1J7P A;  2QEO A;  2I94 A;  2LV7 A;  2M97 A;  3MSE B;  5CSJ A;  1EG3 A;  1SPY A;  1NX0 A;  1U5I B;  1WLZ A;  4INW A;  1EH2 A;  2BE6 A;  2WCM A;  2KPH A;  1TRF A;  4NQG A;  3CGA A;  1DJX A;  1K9U A;  1L2O C;  1OOH A;  4I5K A;  1CMG A;  2BKI B;  1OOG A;  1MWN A;  2KBI A;  3SG5 A;  4GUK A;  2V53 A;  2QAC A;  3JTD C;  1EJ3 A;  3BOW B;  4CFR A;  1B8C A;  4YGA A;  1B47 A;  3PSR A;  1OZO A;  2KGR A;  1WDC C;  1Y1U A;  1DMO A;  1AHR A;  1DGV A;  3K1E A;  1K96 A;  3RLZ A;  2JT8 A;  1GGZ A;  1SCM C;  2GGM A;  2ZND A;  3GOF A;  1AJ4 A;  3AKB A;  4P2Y B;  3NSI A;  3SS4 A;  3Q8I A;  3EG5 B;  4JD9 A;  2M1K B;  2I18 A;  1NPQ A;  4MLW A;  1MHO A;  2R2I A;  2PAS A;  1SRA A;  2CXJ A;  2K61 A;  2LVK A;  2CTN A;  3FE6 A;  5HKZ A;  3D0Y B;  4I5L B;  5HKW A;  3UNW A;  1S6C A;  2NLN A;  3S0E A;  3BXK A;  4GPL B;  4YI9 A;  1DJH A;  4YGE B;  1L2O B;  1L7Z A;  2WCJ A;  1BLQ A;  1K9K A;  4OVN F;  4M2P A;  2JTZ A;  2M1U A;  2JTT A;  2I7A A;  2FJY A;  4MEW A;  2JZI A;  3JTD B;  4MZK A;  1V1F A;  2LUX A;  4HRG A;  5CSN A;  5DKQ A;  3TDZ A;  1F55 A;  3PM8 A;  2KAY A;  3SG4 A;  1P28 A;  1RJV A;  1SNL A;  1UUS A;  1WDC B;  3O78 A;  1SR6 C;  1AUI B;  1F70 A;  1JUO A;  5FI6 A;  1PSB A;  3BQ3 A;  2M7N A;  2P71 A;  3O4X A;  2G2B A;  3PAT A;  3PM2 A;  2FJU B;  1A03 A;  3EKJ A;  4MZL A;  1XFW O;  1JC2 A;  3C1V A;  3CR5 X;  4XJK B;  1WLM A;  1SL9 A;  3UO9 A;  3EK8 A;  2PMY A;  3EKH A;  1XVJ A;  2KFH A;  2WCL A;  1OOJ A;  3AAJ A;  3BUW B;  3CYZ A;  3R1P A;  5HYD A;  1BR1 B;  3KF9 A;  4ORC B;  1BR4 B;  2KGB C;  3CS1 A;  3ZWH A;  5HLV A;  5B8I B;  2KI6 C;  3B88 A;  5FYX A;  1FW4 A;  1NUB A;  2CCM A;  3I5H B;  2LAP A;  1S6J A;  1ZOT B;  2MHH A;  3FE9 A;  4INX A;  4USL A;  4DUQ A;  4YGC B;  1IQ5 A;  3PJI A;  1J7O A;  2O60 A;  1DGU A;  2G9B A;  2KNE A;  1XK4 C;  1M63 B;  3ZNI A;  3CR4 X;  4F7F A;  1SR6 B;  3DZT A;  3I5G C;  2JU0 A;  3LK0 A;  4PE0 A;  2JUL A;  2JPT A;  3QME A;  3DVJ A;  2BAP A;  4PHJ A;  4QJ5 B;  1TNP A;  1IWQ A;  1QS7 A;  1J1D A;  1SCV A;  3CWG A;  1Z4H A;  1CKK A;  3SG3 A;  3DVE A;  2EHB A;  2HQW A;  2JOJ A;  2L4H A;  3F45 A;  2WCF A;  5D3O A;  4MRX A;  4BY5 A;  5PAL A;  3BFA A;  1B4C A;  1YRT B;  3IQQ A;  4MVF A;  3EVU A;  4YBH B;  3PFV A;  1YR5 A;  1UHJ A;  2NXQ A;  2QDI A;  1J55 A;  1F71 A;  3GK1 A;  1B1G A;  4PCW A;  1AJ5 A;  3EK7 A;  2I2R E;  4ETO A;  1CFF A;  2NCO A;  3EVV A;  1UHI A;  2FCE A;  1A75 B;  4PT1 A;  1GM0 A;  2H61 A;  2PAL A;  1NX2 A;  3I5G B;  3NSL A;  4ORB B;  2F3Y A;  3DYE A;  1JWD A;  2LVV A;  1CM1 A;  5ER5 A;  1Y6W A;  2PQL A;  3AAK A;  5KSZ A;  2Q4U A;  2LHI A;  3BUO B;  5D69 A;  2SAS A;  3CTN A;  5HKY A;  1AP4 A;  3BFB A;  1DTL A;  1LVC D;  2MLF C;  3FS7 A;  1NYA A;  3CAB A;  5J3X A;  1KFU S;  4FQO A;  2KI6 D;  1M46 A;  4GGN A;  1NCY A;  2JQ6 A;  1HQV A;  2MRD A;  1XFZ O;  1XA5 A;  2ZNE A;  4YGB B;  3I5I C;  3VRO A;  1QV1 A;  5FI2 A;  3VRQ A;  5AAN A;  2K7B A;  1B7T Z;  3OBV A;  4DRW A;  1YRU B;  2RGI A;  3D78 A;  1QLK A;  4L9M A;  3D75 A;  1MQ1 A;  4M2O A;  5CSI A;  1YUU A;  1G4Y R;  5IBW A;  3OHM B;  2BBM A;  1R2U A;  3B86 A;  1OMR A;  4HRH A;  4M2Q A;  2LLS A;  1NCZ A;  1IQ3 A;  3HCM A;  1CFD A;  1QLS A;  5CSF A;  1QVI Y;  2K0J A;  1S5G Z;  1UUR A;  3PN7 C;  2K7O A;  3L47 A;  3O4Y A;  3TUY C;  4R1E A;  4WQ3 A;  2YGU A;  3LL8 B;  4ORA B;  1N2D A;  3NSO A;  3D74 A;  3OX5 A;  4AQI A;  5HL1 A;  1PAL A;  2PRU A;  1H4B A;  3KO0 A;  1NSH A;  4N1F A;  3NSK A;  1FI5 A;  1KFX S;  3H4S E;  1A29 A;  2TN4 A;  2NCP A;  3I5I B;  2KYF A;  1FBV A;  4I5N B;  1IIO A;  4DCK A;  4JWQ A;  1OW4 A;  1K90 D;  1OMD A;  2BNX A;  4PHM A;  3E3R A;  4A4B A;  2BE4 A;  2L50 A;  2CNP A;  5D7F A;  2F3Z A;  3KHE A;  2L4I A;  1CDP A;  2IS9 A;  1JFK A;  1KK7 Z;  2DOQ A;  3WXA A;  3D10 A;  3SG6 A;  1TNQ A;  1UHK A;  2LLU A;  1OOI X;  5ER4 X;  1QWV A;  3TS5 C;  1ZFS A;  1QX5 B;  3I5H C;  1C07 A;  1GGW A;  1XFX O;  4YGD B;  1B8L A;  2K2F A;  2F2P A;  1SL8 A;  2HF5 A;  2LVJ A;  1PUL A;  3PN7 B;  1SSE B;  3A4U B;  3TUY B;  2JT0 A;  2WC6 A;  3VRN A;  2F2O A;  1CB1 A;  4E68 A;  2BL0 B;  3CR2 A;  3FE8 A;  1KQM C;  2JC2 A;  3NGV A;  1S26 D;  3M0W A;  2KLE A;  1QIW A;  1MR8 A;  5DKR A;  1PK0 D;  1SY9 A;  2K7D A;  4PHK A;  1H8B A;  2ZKM X;  3S0D A;  1J7Q A;  3DF0 A;  4IL1 A;  3LCP C;  1OQP A;  1M45 A;  2H8V A;  3IVT A;  1K8U A;  1K94 A;  1C3Z A;  2EC6 B;  4GGF A;  1A2X A;  3BUN B;  4CFQ A;  4JQ0 D;  4QJ3 B;  2K60 A;  2WCB A;  1WRK A;  1RWY A;  3SJS A;  1YUT A;  1LA3 A;  2H2K A;  2K8M B;  3TS5 B;  2JNF A;  1NP8 A;  2LC5 A;  5G08 A;  2ZN8 A;  1GJY A;  3EVR A;  3GK2 A;  4ZCU A;  2ERB A;  1YX8 A;  1F8H A;  1N0Y A;  2LM5 A;  4IJ7 A;  1CDN A;  1IGV A;  2H61 C;  3I5F B;  2MLE C;  3K21 A;  4FQT A;  1BG1 A;  1E8A A;  4GNK B;  4MZJ A;  5KTY A;  1BOD A;  1KQM B;  4NDB A;  2ZN9 A;  1A4P A;  1LS8 A;  4CPV A;  2M29 A;  1TUZ A;  1YVL A;  2CBL A;  2KFF A;  2LCP A;  1IJ5 A;  1BU3 A;  2BKH B;  1KQV A;  2E6W A;  4JKT A;  1SK6 D;  2GTE A;  4WQ2 A;  1REC A;  1RRO A;  1PRW A;  1UHH A;  1HT9 A;  3CZT X;  3BUX B;  3VB1 A;  1TN4 A;  1DJZ A;  1XFV O;  4KYN A;  1OZS A;  2MA2 A;  2L51 A;  2WND A;  1CNP A;  1OSA A;  2QPT A;  3N7H A;  1B8R A;  1XFY O;  2M49 B;  1DF0 A;  4C0J A;  2M3W A;  1EG4 A;  1QXP A;  5BPJ A;  1NX1 A;  3R72 A;  1K2H A;  2WOS A;  1MXE A;  1M31 A;  1AVS A;  1K9P A;  5AXI A;  1UWO A;  1KK8 C;  1IRJ A;  4D1E A;  1XYD A;  3FIA A;  1JSA A;  2HPS A;  2ZRS A;  1T14 A;  1ODB A;  1ZMZ A;  1QAT A;  3TDI A;  1FF1 A;  1QV0 A;  1YTZ C;  4HSZ A;  1JF2 A;  1QX7 A;  1MF8 B;  2LP3 A;  4HRE E;  3S0G A;  1DEK A;  4YI8 A;  3IQO A;  4MBE A;  4OZD A;  1IJ6 A;  2Y5I A;  3CZ0 A;  3D77 A;  2M7L A;  3RM1 A;  2OPO A;  3S0B A;  2SCP A;  4AQJ A;  4PE7 A;  2F33 A;  2Y4Q A;  3LK1 A;  2BBN A;  2VRG A;  2MBX A;  3BUM B;  1JFJ A;  1R6P A;  2JPO A;  2LP2 A;  1SKT A;  1DJG A;  2M0R A;  3R1O A;  1LKJ A;  4Q04 A;  2AAO A;  1K93 D;  2P70 A;  1WY9 A;  2KHN A;  1CLB A;  1KK8 B;  2GGZ A;  2PSR A;  4MSP A;  3AKA A;  1BMO A;  1K95 A;  1EXR A;  1ZAC A;  1BOC A;  3IF7 A;  2B1U A;  1BF5 A;  2KAX A;  2WOR A;  4CID A;  1OE9 B;  1RFJ A;  2KOT A;  4NDD A;  1V1G A;  4PHN A;  1PSR A;  5AFP A;  1W7I B;  1VRK A;  3A8R A;  1FI6 A;  5TNC A;  4OR9 B;  1OMV A;  1F54 A;  3SS3 A;  2NZ0 A;  4ICB A;  1DT7 B;  1D1O A;  2BL0 C;  3B6X A;  2L5Y A;  1J7R A;  3TZ1 A;  1CFP A;  1G8I A;  3CLN A;  1TTX A;  3WHU B;  3V2L A;  4NDC A;  2PVB A;  1SBJ A;  2WC5 A;  2L2E A;  2JNX A;  2L98 A;  5EL2 A;  3OX6 A;  4GGF C;  1CLM A;  2HET A;  3FWC A;  3SG2 A;  2KBM A;  5FI7 A;  1U5I A;  1SYM A;  2EC6 C;  2M8U A;  1YUS A;  1KWO C;  1S5G Y;  2KQY A;  1ZUZ A;  2CT9 A;  3L4L A;  4ZCV A;  3O2P A;  1MXL C;  1N65 A;  3KEV A;  5GQQ C;  1IH0 A;  3BJH A;  1B9A A;  1C3Y A;  1MUX A;  1W7J B;  3NHT A;  3TDU A;  1JBA A;  2L5X B;  3BOW A;  1PVA A;  2QEB A;  1SW8 A;  3CZ2 A;  2LVI A;  4BY4 A;  2K2A A;  4OKH A;  4I5J A;  2KAV A;  3BFH A;  3I5F C;  2OS8 C;  4TNC A;  5I2L A;  3DD4 A;  3SIB A;  1ALW A;  3VGO A;  1QAS A;  3DXL A;  5I8N A;  2LNK A;  1TWO A;  3L4A A;  1J1E A;  1M39 A;  2LLT A;  2KLD A;  2A4J A;  4N5X A;  2COL B;  3DF0 B;  1DVI A;  1KK7 Y;  1ORG A;  2ZRT A;  3DVK A;  4XYN A;  1W9Z A;  2LE9 B;  1QX2 A;  3CZ1 A;  3O6B A;  2Y1N A;  1TIZ A;  1Y1X A;  2L0P A;  3VRP A;  3DY9 A;  1WRL A;  3BYA A;  4MN0 A;  4PAL A;  1CDM A;  3D0Y A;  4JPZ B;  2Q91 A;  4DIR A;  1KWO B;  4C0L A;  2L2C A;  1NIW A;  1F4O A;  2PYQ A;  4F0Z B;  2MAZ A;  4OV2 A;  2LMV A;  1ALV A;  2FOT A;  2OTG C;  1PVB A;  1YVH A;  1CM4 A;  2Y1M A;  3B7A A;  1TOP A;  3ICB A;  3KPX A;  1S6I A;  1QIV A;  1SCM B;  2ZFD A;  4PDZ A;  2OS8 B;  3NXA A;  1GQM A;  1NX3 A;  2JXL A;  4C0K A;  1WRZ A;  2AUC A;  1QJT A;  2F8P A;  2LHL A;  2LMT A;  3D73 A;  5AEQ A;  2KYC A;  2HQ8 A;  4WRI A;  1AK8 A;  1C7W A;  4XJK A;  1BT6 A;  1NCX A;  1F4Q A;  3S0A A;  4PE4 A;  3LLE A;  2E30 A;  3DVM A;  3D76 A;  1SL7 A;  1Q80 A;  5JJG A;  1UHN A;  1LIN A;  1TNX A;  2KDH A;  1BJF A;  3B87 A;  2BEC A;  3JVT C;  3SG7 A;  1G33 A;  2KFG A;  5I94 A;  1RK9 A;  1CMF A;  2ISD A;  4U8D A;  4OCI A;  1C7V A;  1DF0 B;  1CTR A;  2JRF A;  2JT3 A;  3OB2 B;  1KFU L;  1YX7 A;  3OP0 A;  1Y0V H;  2WCK A; 
#chains in the Genus database with same CATH homology
 1Y1A A;  2OTG B;  4YRU A;  5I2Q A;  1SMG A;  1UP5 A;  2JXC A;  1YUR A;  1RTP 1;  3OB1 B;  5KU1 A;  1S36 A;  2FCD A;  5I2O A;  1TCO B;  1EL4 A;  1DJY A;  1KCY A;  3WNX B;  3GK4 X;  5AER A;  2MJW B;  4UPG A;  2KQ6 A;  1IG5 A;  5JOL A;  2KI4 C;  1DJI A;  1IKU A;  1XFU O;  4PE1 A;  4CLN A;  4DS7 A;  3JVT B;  1DJW A;  1QTX A;  4A4C A;  2O5G A;  2JWW A;  5CPV A;  2LMU A;  4FTG A;  3PLF B;  1KSM A;  1KSO A;  4QJ4 B;  1TNW A;  2EGD A;  3HX4 A;  2WCE A;  1TCF A;  2LUC A;  3SIA A;  1KFX L;  5HLO A;  1X02 A;  3WHT B;  2AMI A;  1XK4 A;  2P6B B;  4N1G A;  2WC8 A;  2KSP A;  2GV5 A;  1A75 A;  4AOM A;  2M9G A;  2BCB A;  5K89 A;  1S1E A;  2K7C A;  1LA0 A;  3QRX A;  1CDL A;  5F6T A;  1XO5 A;  1S3P A;  4GBA A;  4MRY A;  2KI4 B;  1JF0 A;  3EK4 A;  2LAN A;  1NWD A;  1CLL A;  5DKN A;  3PAL A;  4GFT A;  1LXF C;  1FPW A;  1QVI Z;  2BCX A;  2D8N A;  4GAO A;  2BCA A;  3VRR A;  1B7T Y;  1CFC A;  3FWB A;  4P5O E;  1J7P A;  2I94 A;  2LV7 A;  2M97 A;  3MSE B;  5CSJ A;  1EG3 A;  1SPY A;  1NX0 A;  1U5I B;  1WLZ A;  1EH2 A;  2BE6 A;  1TRF A;  4NQG A;  3CGA A;  1DJX A;  1K9U A;  1L2O C;  4I5K A;  1CMG A;  2BKI B;  1MWN A;  2KBI A;  3SG5 A;  4GUK A;  2V53 A;  2QAC A;  3JTD C;  1EJ3 A;  3BOW B;  4CFR A;  1B8C A;  4YGA A;  1B47 A;  3PSR A;  1OZO A;  2KGR A;  1WDC C;  1Y1U A;  1DMO A;  1AHR A;  1DGV A;  1K96 A;  3RLZ A;  2JT8 A;  1GGZ A;  1SCM C;  2GGM A;  2ZND A;  3GOF A;  1AJ4 A;  3AKB A;  4P2Y B;  3NSI A;  2M1K B;  2I18 A;  1NPQ A;  4MLW A;  1MHO A;  2R2I A;  2PAS A;  1SRA A;  2CXJ A;  2K61 A;  2LVK A;  2CTN A;  5HKZ A;  3D0Y B;  4I5L B;  5HKW A;  1S6C A;  2NLN A;  3BXK A;  4GPL B;  4YI9 A;  1DJH A;  4YGE B;  1L2O B;  1L7Z A;  1BLQ A;  1K9K A;  4OVN F;  4M2P A;  2JTZ A;  2M1U A;  2JTT A;  2I7A A;  4MEW A;  2JZI A;  3JTD B;  4MZK A;  1V1F A;  2LUX A;  4HRG A;  5CSN A;  5DKQ A;  3TDZ A;  1F55 A;  3PM8 A;  2KAY A;  3SG4 A;  1RJV A;  1SNL A;  1UUS A;  1WDC B;  3O78 A;  1SR6 C;  1AUI B;  1F70 A;  1JUO A;  1PSB A;  3BQ3 A;  2M7N A;  3PAT A;  2G2B A;  1A03 A;  2FJU B;  3EKJ A;  4MZL A;  1XFW O;  1JC2 A;  3C1V A;  3CR5 X;  4XJK B;  1WLM A;  1SL9 A;  3EK8 A;  2PMY A;  3EKH A;  1XVJ A;  2KFH A;  1OOJ A;  3AAJ A;  3BUW B;  5HYD A;  1BR1 B;  3KF9 A;  4ORC B;  1BR4 B;  2KGB C;  3CS1 A;  3ZWH A;  5HLV A;  5B8I B;  2KI6 C;  5FYX A;  1FW4 A;  1NUB A;  2CCM A;  3I5H B;  2LAP A;  1S6J A;  1ZOT B;  2MHH A;  4DUQ A;  4USL A;  4YGC B;  1IQ5 A;  1J7O A;  2O60 A;  1DGU A;  2G9B A;  2KNE A;  1XK4 C;  1M63 B;  3ZNI A;  3CR4 X;  1SR6 B;  3I5G C;  2JU0 A;  3LK0 A;  4PE0 A;  2JUL A;  2JPT A;  3DVJ A;  4PHJ A;  4QJ5 B;  1TNP A;  1IWQ A;  1QS7 A;  1J1D A;  1SCV A;  3CWG A;  1CKK A;  3SG3 A;  3DVE A;  2EHB A;  2HQW A;  2JOJ A;  2L4H A;  3F45 A;  2WCF A;  4MRX A;  4BY5 A;  5PAL A;  1B4C A;  1YRT B;  3IQQ A;  4MVF A;  3EVU A;  4YBH B;  3PFV A;  1YR5 A;  1UHJ A;  2NXQ A;  1J55 A;  1F71 A;  3GK1 A;  1B1G A;  4PCW A;  1AJ5 A;  3EK7 A;  2I2R E;  4ETO A;  1CFF A;  2NCO A;  3EVV A;  1UHI A;  2FCE A;  1A75 B;  2H61 A;  2PAL A;  1NX2 A;  3I5G B;  3NSL A;  4ORB B;  2F3Y A;  1JWD A;  2LVV A;  1CM1 A;  5ER5 A;  1Y6W A;  3AAK A;  5KSZ A;  2Q4U A;  2LHI A;  3BUO B;  5D69 A;  2SAS A;  3CTN A;  5HKY A;  1AP4 A;  1DTL A;  1LVC D;  2MLF C;  3FS7 A;  1NYA A;  5J3X A;  1KFU S;  4FQO A;  2KI6 D;  1M46 A;  4GGN A;  1NCY A;  2JQ6 A;  1HQV A;  2MRD A;  1XFZ O;  1XA5 A;  2ZNE A;  4YGB B;  3I5I C;  3VRO A;  1QV1 A;  3VRQ A;  5AAN A;  2K7B A;  1B7T Z;  4DRW A;  1YRU B;  2RGI A;  1QLK A;  4L9M A;  1MQ1 A;  4M2O A;  5CSI A;  1YUU A;  1G4Y R;  5IBW A;  3OHM B;  2BBM A;  1R2U A;  4HRH A;  1OMR A;  4M2Q A;  2LLS A;  1NCZ A;  1IQ3 A;  3HCM A;  1CFD A;  1QLS A;  5CSF A;  1QVI Y;  2K0J A;  1S5G Z;  1UUR A;  3PN7 C;  2K7O A;  3TUY C;  3O4Y A;  4R1E A;  4WQ3 A;  3LL8 B;  4ORA B;  1N2D A;  3NSO A;  3OX5 A;  4AQI A;  1PAL A;  2PRU A;  1H4B A;  3KO0 A;  1NSH A;  4N1F A;  3NSK A;  1FI5 A;  1KFX S;  3H4S E;  1A29 A;  2TN4 A;  2NCP A;  3I5I B;  2KYF A;  1FBV A;  4I5N B;  4DCK A;  4JWQ A;  1K90 D;  1OMD A;  4PHM A;  3E3R A;  4A4B A;  2BE4 A;  2L50 A;  2CNP A;  5D7F A;  2F3Z A;  3KHE A;  2L4I A;  1CDP A;  2IS9 A;  1JFK A;  1KK7 Z;  2DOQ A;  3WXA A;  3D10 A;  3SG6 A;  1TNQ A;  1UHK A;  2LLU A;  5ER4 X;  3TS5 C;  1ZFS A;  1QX5 B;  3I5H C;  1C07 A;  1GGW A;  1XFX O;  4YGD B;  1B8L A;  2K2F A;  2F2P A;  1SL8 A;  2HF5 A;  2LVJ A;  1PUL A;  3PN7 B;  3A4U B;  3TUY B;  2JT0 A;  3VRN A;  2F2O A;  1CB1 A;  4E68 A;  2BL0 B;  3CR2 A;  1KQM C;  2JC2 A;  1S26 D;  3M0W A;  1QIW A;  1MR8 A;  5DKR A;  1PK0 D;  1SY9 A;  2K7D A;  4PHK A;  1H8B A;  2ZKM X;  1J7Q A;  3DF0 A;  4IL1 A;  3LCP C;  1OQP A;  1M45 A;  1K8U A;  1K94 A;  2EC6 B;  4GGF A;  1A2X A;  3BUN B;  4CFQ A;  4JQ0 D;  4QJ3 B;  2WCB A;  1WRK A;  1RWY A;  3SJS A;  1YUT A;  1LA3 A;  2H2K A;  2K8M B;  3TS5 B;  2JNF A;  1NP8 A;  2LC5 A;  5G08 A;  2ZN8 A;  1GJY A;  3EVR A;  3GK2 A;  4ZCU A;  1F8H A;  1YX8 A;  1N0Y A;  2LM5 A;  1CDN A;  1IGV A;  2H61 C;  3I5F B;  2MLE C;  3K21 A;  1BG1 A;  1BOD A;  1E8A A;  4GNK B;  4MZJ A;  5KTY A;  1KQM B;  4NDB A;  2ZN9 A;  1A4P A;  4CPV A;  2M29 A;  1YVL A;  2CBL A;  2KFF A;  2LCP A;  1IJ5 A;  1BU3 A;  2BKH B;  1KQV A;  2E6W A;  4WQ2 A;  1SK6 D;  1REC A;  1RRO A;  1PRW A;  1UHH A;  1HT9 A;  3CZT X;  3BUX B;  1TN4 A;  1DJZ A;  1XFV O;  1OZS A;  2MA2 A;  2L51 A;  2WND A;  1CNP A;  1OSA A;  2QPT A;  1B8R A;  1XFY O;  2M49 B;  1DF0 A;  4C0J A;  2M3W A;  1EG4 A;  1QXP A;  5BPJ A;  1NX1 A;  1K2H A;  2WOS A;  1MXE A;  1M31 A;  1AVS A;  1K9P A;  5AXI A;  1UWO A;  1KK8 C;  1IRJ A;  4D1E A;  1XYD A;  3FIA A;  1JSA A;  2HPS A;  2ZRS A;  1ODB A;  1ZMZ A;  1QAT A;  3TDI A;  1FF1 A;  1QV0 A;  1YTZ C;  4HSZ A;  1JF2 A;  1QX7 A;  1MF8 B;  2LP3 A;  4HRE E;  4YI8 A;  3IQO A;  4MBE A;  1IJ6 A;  2Y5I A;  2M7L A;  3RM1 A;  2OPO A;  2SCP A;  4AQJ A;  4PE7 A;  2F33 A;  2Y4Q A;  3LK1 A;  2BBN A;  2VRG A;  2MBX A;  3BUM B;  1JFJ A;  1R6P A;  2LP2 A;  1SKT A;  1DJG A;  2M0R A;  1LKJ A;  4Q04 A;  2AAO A;  1K93 D;  1WY9 A;  2KHN A;  1CLB A;  1KK8 B;  2GGZ A;  2PSR A;  4MSP A;  3AKA A;  1BMO A;  1K95 A;  1EXR A;  1ZAC A;  1BOC A;  3IF7 A;  2B1U A;  1BF5 A;  2KAX A;  2WOR A;  4CID A;  1OE9 B;  1RFJ A;  2KOT A;  4NDD A;  1V1G A;  4PHN A;  1PSR A;  5AFP A;  1W7I B;  1VRK A;  3A8R A;  1FI6 A;  5TNC A;  4OR9 B;  1OMV A;  1F54 A;  2NZ0 A;  4ICB A;  1DT7 B;  1D1O A;  2BL0 C;  1J7R A;  3TZ1 A;  1CFP A;  1G8I A;  3CLN A;  1TTX A;  3WHU B;  4NDC A;  2PVB A;  1SBJ A;  2L2E A;  2JNX A;  2L98 A;  3OX6 A;  4GGF C;  1CLM A;  2HET A;  3FWC A;  3SG2 A;  2KBM A;  1U5I A;  1SYM A;  2EC6 C;  2M8U A;  1YUS A;  1KWO C;  1S5G Y;  2KQY A;  1ZUZ A;  2CT9 A;  4ZCV A;  3O2P A;  1MXL C;  1N65 A;  3KEV A;  5GQQ C;  1IH0 A;  1B9A A;  1JBA A;  1MUX A;  1W7J B;  3TDU A;  2L5X B;  3BOW A;  1PVA A;  4BY4 A;  1SW8 A;  2LVI A;  2K2A A;  4OKH A;  4I5J A;  2KAV A;  3I5F C;  2OS8 C;  4TNC A;  5I2L A;  3DD4 A;  3SIB A;  1ALW A;  3VGO A;  1QAS A;  2LNK A;  1J1E A;  1M39 A;  2LLT A;  2A4J A;  4N5X A;  2COL B;  3DF0 B;  1DVI A;  1KK7 Y;  2ZRT A;  3DVK A;  4XYN A;  5I8N A;  2LE9 B;  1QX2 A;  3O6B A;  2Y1N A;  1TIZ A;  1Y1X A;  2L0P A;  3VRP A;  1WRL A;  3BYA A;  4MN0 A;  4PAL A;  1CDM A;  3D0Y A;  4JPZ B;  2Q91 A;  4DIR A;  1KWO B;  4C0L A;  1NIW A;  1F4O A;  4F0Z B;  2MAZ A;  4OV2 A;  2LMV A;  1ALV A;  2FOT A;  2OTG C;  1PVB A;  1YVH A;  1CM4 A;  2Y1M A;  1TOP A;  3ICB A;  3KPX A;  1S6I A;  1QIV A;  1SCM B;  2ZFD A;  4PDZ A;  2OS8 B;  3NXA A;  1GQM A;  1NX3 A;  2JXL A;  4C0K A;  1WRZ A;  2AUC A;  1QJT A;  2F8P A;  2LHL A;  2LMT A;  5AEQ A;  1AK8 A;  2KYC A;  2HQ8 A;  4WRI A;  1C7W A;  4XJK A;  1BT6 A;  1NCX A;  1F4Q A;  4PE4 A;  3LLE A;  2E30 A;  3DVM A;  1SL7 A;  1Q80 A;  5JJG A;  1UHN A;  1LIN A;  1TNX A;  2KDH A;  1BJF A;  3SG7 A;  2BEC A;  3JVT C;  1G33 A;  2KFG A;  1RK9 A;  1CMF A;  2ISD A;  4U8D A;  4OCI A;  1C7V A;  1DF0 B;  1CTR A;  2JRF A;  2JT3 A;  3OB2 B;  1KFU L;  1YX7 A;  3OP0 A;  1Y0V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...