3L4LA

Crystal structure of an anopheles gambiae odorant-binding protein agamobp22a with bound odorant benzaldehyde
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
134
structure length
119
Chain Sequence
NESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title Crystal Structures of an Anopheles gambiae Odorant-binding Protein Agam22a and Complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 45
structure length 119
sequence length 134
ec nomenclature
pdb deposition date 2009-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3l4lA00
3N7HA 4JD9A 2QEBA 2QEOA 3R1PA 2WCMA 3PJIA 3CZ1A 1P28A 3NHTA 3VB1A 1OOFA 1ORGA 2WCJA 3RZSA 1LS8A 1OOGA 3D74A 5DICA 3B87A 3V2LA 3S0FA 3DXLA 1OW4A 3BFBA 3DY9A 2WC6A 2KPHA 3CYZA 2P70A 3S0DA 2GTEA 1GM0A 2P71A 1OOIX 3S0BA 2WCHA 4OZDA 2WC5A 3L4LA 3K1EA 3R1OA 3D75A 3DZTA 4INWA 3S0GA 1QWVA 2WCKA 3QMEA 2WCLA 3BFAA 3R1VA 3R72A 4PT1A 3D73A 3D78A 3B86A 3BFHA 1T14A 1DQEA 3CDNA 3B7AA 3B6XA 1TWOA 3B88A 3Q8IA 3FE9A 5EL2A 3CABA 2QEVA 2PQLA 2JPOA 2ERBA 3CZ0A 3FE8A 3NHIA 1C3YA 3D76A 3S0EA 3FE6A 3L4AA 3DYEA 3OGNA 3NGVA 2H8VA 2FJYA 3CZ2A 3D77A 1OOHA 3L47A 1XFRA 1TUJA 2QEHA 4FQTA 2QDIA 4F7FA 1C3ZA 3BJHA 4INXA 3S0AA 2L2CA
chains in the Genus database with same CATH superfamily
1UHJA 1CLLA 3AKBA 3N7HA 4HSZA 1SCVA 2QEOA 2BL0C 2ZRTA 1DMOA 4MVFA 3SS4A 2WCMA 2KSPA 3CR5X 2WORA 3PJIA 4MBEA 3VRQA 3EVVA 1DJWA 1XO5A 3CZ1A 1CMFA 2LMUA 3K21A 3DF0A 5B8IB 4P5OE 1SBJA 5AFPA 2JWWA 4C0JA 1ORGA 2ISDA 1LS8A 1S6IA 3D74A 2NXQA 3EK8A 4PHNA 4NQGA 5DICA 3B87A 1CNPA 2QACA 5HLOA 1CM1A 1Y6WA 4QJ5B 4U8DA 1S36A 2HPSA 2LMVA 1CB1A 3O78A 1CFFA 2G2BA 2QPTA 3CYZA 1XFUO 1QTXA 2KFFA 1IG5A 5CSFA 2KHNA 2ZKMX 1A2XA 3HCMA 2P71A 5CSIA 3S0BA 3O2PA 5HYDA 1WDCC 3BUOB 1H4BA 1KCYA 2M8UA 1G8IA 3L4LA 3RM1A 5D3OA 2L2EA 1K96A 3FWBA 3K1EA 4UPGA 2M7NA 3D75A 1OMRA 3EG5B 1MXLC 4M2PA 1K94A 3H4SE 4GGNA 2I7AA 1YRUB 3PLFB 3WNXB 5J3XA 3EVUA 4PE0A 1NCZA 2PVBA 1MHOA 3OX5A 5AEQA 1NX1A 2SASA 3LL8B 1IH0A 4N5XA 2SCPA 4R1EA 1KQVA 3AAJA 1B47A 1DQEA 1K9PA 1K9UA 2L5YA 4JQ0D 5KSZA 1MR8A 1JSAA 2CXJA 1XFWO 3CDNA 2JXCA 1NX3A 1QIWA 1A75B 4N1GA 4NDDA 1FBVA 3TDIA 3SIAA 1HT9A 1SKTA 1GQMA 4XJKA 1TNXA 4PHJA 1OMVA 5D7FA 4PALA 4YI8A 1QXPA 1DGVA 2IS9A 1B8CA 2JNFA 1ZACA 3JTDB 3TS5C 2F3ZA 1ODBA 1PSRA 1NUBA 1M63B 2KNEA 2A4JA 3KPXA 3CR4X 1PK0D 3ZNIA 2M49B 2PRUA 3TUYC 4ZCUA 5I2LA 4AQJA 5ER5A 1TTXA 3L4AA 4MZKA 1Y1XA 1YURA 2HF5A 2FOTA 1AK8A 1B9AA 3CWGA 1M39A 2I18A 1J7RA 3OHMB 4ICBA 1XK4C 3LLEA 5PALA 3PM8A 2NCOA 2TN4A 4DS7A 5AXIA 3QRXA 2BE4A 3OP0A 3L47A 2JULA 2MRDA 3BYAA 3NXAA 2QEHA 2WCEA 4FQTA 2QDIA 1KFUS 1YUUA 2LUXA 1V1GA 4JWQA 2ZN8A 1KQMC 2PASA 5DKNA 1TNWA 2LP2A 5FI2A 1LA3A 2BBNA 4PE1A 1SY9A 1MUXA 3ZWHA 1DJXA 1WLZA 3EK4A 1L2OB 3AAKA 3I5IC 1IRJA 3UO9A 2K8MB 4DCKA 1SCMB 1P28A 1WRKA 2KAXA 1FW4A 1PSBA 2Y1MA 4CPVA 3NHTA 4YGDB 2KFHA 3VB1A 1IQ3A 3TZ1A 3O6BA 1SL9A 3PSRA 1NX0A 4BY4A 2JXLA 2M29A 3RZSA 2WCJA 2KYCA 1OOGA 1S1EA 2KBIA 3CR2A 1A75A 4CLNA 1KFUL 2WCFA 1CFDA 3FIAA 5HKYA 2FJUB 5DKRA 1OW4A 4PCWA 4XJKB 3BFBA 1A29A 3CS1A 3DY9A 3WXAA 1PRWA 1BF5A 1FPWA 4QJ3B 1VRKA 1YTZC 3S0DA 2KAYA 1OOIX 4OVNF 4CFRA 1M46A 1F55A 1B7TZ 2H2KA 1H8BA 1DT7B 1RECA 1EJ3A 1B4CA 5G08A 1YUTA 1DJIA 2KQ6A 1GGWA 1J1EA 4INWA 3SIBA 1IJ6A 2LMTA 2OS8B 2WCKA 1RJVA 4MSPA 3I5FB 2LVKA 2JU0A 3OB2B 4KYNA 1EL4A 3BFAA 1IKUA 1N0YA 2MA2A 3SG4A 3A4UB 2NZ0A 2JRFA 2KLEA 5HLVA 5CPVA 1X02A 2BBMA 3CLNA 2P6BB 3SG7A 1B8LA 3VRRA 1RFJA 1Y0VH 5TNCA 1DF0B 4GGFA 5CSNA 4L9MA 4OCIA 1DJZA 1CLMA 1MF8B 2BE6A 3NSLA 1CM4A 3OB1B 1TWOA 3B88A 4YGEB 3WHTB 3GOFA 2L5XB 1GGZA 2LUCA 4QJ4B 4DRWA 3FE9A 2KAVA 2EC6B 1RWYA 2M1UA 2M1KB 2F2OA 4D1EA 1FI5A 1S5GZ 1Z2CB 1XVJA 2PQLA 4WQ3A 1J7OA 1QX7A 2CBLA 1UHKA 4MZJA 1DEKA 2JPOA 2AUCA 3BXKA 2OTGB 1J7PA 2JOJA 1SPYA 1XFYO 3KEVA 1KSMA 4GAOA 2JC2A 1K8UA 4CIDA 3EVRA 1XA5A 1BG1A 4XYNA 3I5GC 3JTDC 1PULA 1CDNA 2CT9A 1NPQA 5FYXA 2K7OA 3CGAA 1B8RA 1KK7Z 1DJHA 1QV0A 2BCBA 1UP5A 3S0EA 3LK1A 2KI4B 2LV7A 2CCMA 1K2HA 2LP3A 4HREE 3CZTX 4GUKA 4YGBB 5HKZA 1FI6A 3D10A 1BOCA 1JBAA 3I5HB 3NSIA 4BY5A 1SL8A 4GBAA 4OR9B 1TCFA 4PE7A 5I8NA 1JFJA 5HKWA 2LAPA 1F70A 1KK8B 2HETA 3SG3A 3PATA 1SR6B 1JUOA 2DOQA 2KOTA 2E30A 2LLSA 2L4IA 1Y1UA 3SG5A 2RGIA 1YX7A 1CTRA 4OKHA 5BPJA 1CFPA 1WY9A 3BOWB 4YGCB 4F7FA 3BJHA 3BUNB 1J55A 4INXA 4GGFC 2L2CA 1CDPA 3A8RA 1B7TY 1PVBA 1UUSA 2Q4UA 1F71A 5JJGA 1DELA 2LVVA 5DKQA 3IQQA 1OMDA 1R6PA 1FF1A 2K7CA 1DVIA 1U5IB 1TIZA 1M31A 1K93D 3AKAA 3EK7A 2QEBA 1W7IB 3R1PA 4TNCA 3VRPA 1A03A 4WRIA 3WHUB 1BT6A 1OSAA 5I2QA 1OQPA 5CSJA 1L2OC 1R2UA 1N2DA 2NLNA 2AAOA 2ZRSA 4I5JA 1OOFA 1SCMC 2BAPA 1V1FA 2VRGA 5IBWA 3DVKA 2CTNA 2LC5A 4GPLB 5I94A 1DF0A 3S0FA 1YVLA 2KQYA 1S26D 1TOPA 1KWOB 3PN7B 3JVTC 4GNKB 2WC6A 2KPHA 3E3RA 2BNXA 1C07A 1RTP1 3BUWB 4FQOA 5KU1A 2GTEA 5ER4X 2WNDA 2ZNDA 1IQ5A 1OZSA 2WCHA 4NDBA 4OZDA 4USLA 4CFQA 1TN4A 1QV1A 2WC5A 2I2RE 2I94A 2ZN9A 1YRTB 3EKJA 1QATA 1S5GY 2D8NA 3BQ3A 3R1OA 2BCXA 1WRZA 3O4XA 1CMGA 4C0LA 1JF2A 3DZTA 3LK0A 5AERA 1G33A 3S0GA 1ALWA 5KTYA 1QWVA 1DJYA 2L51A 1AHRA 2KDHA 3QMEA 1D1OA 2JT3A 1SW8A 3TDUA 1CDLA 1AJ5A 1MXEA 2HQWA 1BLQA 2OS8C 1QJTA 1KK7Y 3I5FC 3D73A 1BODA 1EXRA 2Y1NA 1S3PA 2Y4QA 1SSEB 2WC8A 2ZFDA 3VROA 3BFHA 1T14A 2HQ8A 1ZOTB 4DIRA 2Q91A 5AANA 1Z4HA 3VRNA 1JFKA 2JZIA 3KHEA 2M3WA 3BOWA 4MLWA 1QS7A 3IF7A 3SS3A 1Q80A 5EL2A 3SJSA 4PE4A 2Y5IA 1SK6D 1W7JB 2L98A 2QEVA 1U5IA 2E6WA 3O4YA 2EC6C 2ERBA 3BUXB 1J1DA 2COLB 1Y1AA 3VGOA 3TDZA 3DVMA 4ZCVA 2K2AA 2LCPA 2JPTA 3NHIA 3DVJA 1SNLA 2GGMA 5JOLA 4MZLA 1J7QA 3PFVA 2MJWB 1KFXS 4ORCB 2F33A 1C3YA 3D76A 1W9ZA 3HX4A 4E68A 4HRGA 4ORBB 3FE6A 1BJFA 1CLBA 2LHLA 4IJ7A 4OV2A 2JNXA 4AOMA 4ETOA 2R2IA 3D0YB 2H8VA 3NGVA 1F4OA 1NCXA 2KI4C 1F4QA 1BMOA 3FS7A 3CZ2A 2NCPA 3OX6A 4YI9A 1F54A 3FWCA 3D77A 5I2OA 1F8HA 3I5HC 4C0KA 2LVJA 1LKJA 2EHBA 3SS5A 4I5KA 1LVCD 1ZMZA 1KK8C 1JF0A 2M0RA 1SR6C 1YX8A 1WRLA 4DUQA 1C3ZA 1IIOA 3RLZA 4YRUA 1UHNA 2EGDA 1KFXL 1MWNA 1NCYA 2BL0B 3IVTA 1JC2A 1G4YR 3KF9A 1RROA 3PM2A 4N1FA 1UHIA 4JD9A 1QVIZ 2KBMA 1QIVA 1SL7A 1UHHA 1B1GA 1K95A 3MSEB 2PSRA 2K61A 3KO0A 4PHKA 3F45A 3PALA 2KFGA 2F8PA 1EG4A 1QLKA 2MHHA 2LHIA 1TNPA 4P2YB 1GJYA 1TUZA 2JTTA 2OPOA 1MQ1A 3DD4A 3V2LA 1EG3A 1XK4A 2GGZA 1OE9B 4JPZB 3DXLA 2JQ6A 1DTLA 2BCAA 1UURA 2M97A 1NX2A 3LCPC 4M2OA 1C7VA 2GV5A 2MAZA 2LLTA 2CNPA 2LNKA 1RK9A 1WDCB 2M7LA 1LXFC 2P70A 1N65A 2V53A 5FI6A 2BKIB 1JWDA 1GM0A 1KWOC 1QX5B 3PN7C 5F6TA 2B1UA 4A4CA 2H61A 3NSKA 1TRFA 1AJ4A 2KLDA 4I5LB 2BECA 5HL1A 2MLFC 2PMYA 1SRAA 1K90D 1E8AA 1UWOA 1AVSA 3GK2A 1DGUA 2KI6C 2L50A 2KGBC 1K9KA 1IGVA 2WCBA 2YGUA 3GK4X 2KGRA 3I5GB 4MRXA 1DC1A 1ALVA 2WCLA 1LA0A 3R1VA 3R72A 4ORAB 4PT1A 1ZFSA 2MBXA 2K60A 1ZUZA 3D78A 3B86A 1DJGA 1OOJA 3SG2A 3D0YA 2PYQA 3DF0B 1M45A 1XFVO 2LM5A 4Q04A 1S6JA 3CTNA 4F0ZB 5FI7A 1TNQA 1NP8A 4YBHB 2LVIA 2F3YA 1NYAA 3B7AA 3B6XA 4A4BA 1QX2A 3M0WA 2F2PA 2WOSA 2ZNEA 2G9BA 4PHMA 3SG6A 3Q8IA 4IL1A 1SMGA 2O5GA 1QLSA 3CABA 3OBVA 4FTGA 3TS5B 1AUIB 1TCOB 1NSHA 2FCDA 2KI6D 5K89A 4JKTA 4AQIA 2L0PA 1CDMA 4HRHA 2LLUA 4MRYA 2BKHB 3CZ0A 4PDZA 2H61C 3EKHA 1XFXO 4MN0A 4WQ2A 1QVIY 3TUYB 2K0JA 3FE8A 2JTZA 1AP4A 2M9GA 1OZOA 1BU3A 1NIWA 3UNWA 1BR1B 2FCEA 2LE9B 2K7BA 1L7ZA 1SYMA 2JT0A 2L4HA 3BUMB 3DYEA 3NSOA 1IWQA 1KSOA 4I5NB 4M2QA 4NDCA 4YGAA 1XFZO 3OGNA 3GK1A 1HQVA 2K2FA 2FJYA 1S6CA 1WLMA 1YR5A 3C1VA 5GQQC 1XYDA 1EH2A 1C7WA 1LINA 1OOHA 1CKKA 1XFRA 1TUJA 2LANA 3ICBA 1YUSA 2MLEC 3JVTB 4MEWA 3IQOA 1KQMB 2PALA 1IJ5A 5D69A 4GFTA 3S0AA 2JT8A 2K7DA 1QASA 2KYFA 2O60A 3DVEA 1BR4B 1PALA 1PVAA 2OTGC 1CFCA 3I5IB 1YVHA 1NWDA 2AMIA 1A4PA
chains in the Genus database with same CATH topology
3N7HA 4JD9A 2QEBA 2QEOA 3R1PA 2WCMA 3PJIA 3CZ1A 1P28A 3NHTA 3VB1A 1OOFA 1ORGA 2WCJA 3RZSA 1LS8A 1OOGA 3D74A 5DICA 3B87A 3V2LA 3S0FA 3DXLA 1OW4A 3BFBA 3DY9A 2WC6A 2KPHA 3CYZA 2P70A 3S0DA 2GTEA 1GM0A 2P71A 1OOIX 3S0BA 2WCHA 4OZDA 2WC5A 3L4LA 3K1EA 3R1OA 3D75A 3DZTA 4INWA 3S0GA 1QWVA 2WCKA 3QMEA 2WCLA 3BFAA 3R1VA 3R72A 4PT1A 3D73A 3D78A 3B86A 3BFHA 1T14A 1DQEA 3CDNA 3B7AA 3B6XA 1TWOA 3B88A 3Q8IA 3FE9A 5EL2A 3CABA 2QEVA 2PQLA 2JPOA 2ERBA 3CZ0A 3FE8A 3NHIA 1C3YA 3D76A 3S0EA 3FE6A 3L4AA 3DYEA 3OGNA 3NGVA 2H8VA 2FJYA 3CZ2A 3D77A 1OOHA 3L47A 1XFRA 1TUJA 2QEHA 4FQTA 2QDIA 4F7FA 1C3ZA 3BJHA 4INXA 3S0AA 2L2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7H A;  4JD9 A;  2QEB A;  2QEO A;  3R1P A;  2WCM A;  3PJI A;  3CZ1 A;  1P28 A;  3NHT A;  3VB1 A;  1OOF A;  1ORG A;  2WCJ A;  3RZS A;  1LS8 A;  1OOG A;  3D74 A;  5DIC A;  3B87 A;  3V2L A;  3S0F A;  3DXL A;  1OW4 A;  3BFB A;  3DY9 A;  2WC6 A;  2KPH A;  3CYZ A;  2P70 A;  3S0D A;  2GTE A;  1GM0 A;  2P71 A;  1OOI X;  3S0B A;  2WCH A;  4OZD A;  2WC5 A;  3L4L A;  3K1E A;  3R1O A;  3D75 A;  3DZT A;  4INW A;  3S0G A;  1QWV A;  2WCK A;  3QME A;  2WCL A;  3BFA A;  3R1V A;  3R72 A;  4PT1 A;  3D73 A;  3D78 A;  3B86 A;  3BFH A;  1T14 A;  1DQE A;  3CDN A;  3B7A A;  3B6X A;  1TWO A;  3B88 A;  3Q8I A;  3FE9 A;  5EL2 A;  3CAB A;  2QEV A;  2PQL A;  2JPO A;  2ERB A;  3CZ0 A;  3FE8 A;  3NHI A;  1C3Y A;  3D76 A;  3S0E A;  3FE6 A;  3L4A A;  3DYE A;  3OGN A;  3NGV A;  2H8V A;  2FJY A;  3CZ2 A;  3D77 A;  1OOH A;  3L47 A;  1XFR A;  1TUJ A;  2QEH A;  4FQT A;  2QDI A;  4F7F A;  1C3Z A;  3BJH A;  4INX A;  3S0A A;  2L2C A; 
#chains in the Genus database with same CATH topology
 1UHJ A;  1CLL A;  3AKB A;  3N7H A;  4HSZ A;  1SCV A;  2QEO A;  2BL0 C;  2ZRT A;  1DMO A;  4MVF A;  3SS4 A;  2WCM A;  2KSP A;  3CR5 X;  2WOR A;  3PJI A;  4MBE A;  3VRQ A;  3EVV A;  1DJW A;  1XO5 A;  3CZ1 A;  1CMF A;  2LMU A;  3K21 A;  3DF0 A;  5B8I B;  4P5O E;  1SBJ A;  5AFP A;  2JWW A;  4C0J A;  1ORG A;  2ISD A;  1LS8 A;  1S6I A;  3D74 A;  2NXQ A;  3EK8 A;  4PHN A;  4NQG A;  5DIC A;  3B87 A;  1CNP A;  2QAC A;  5HLO A;  1CM1 A;  1Y6W A;  4QJ5 B;  4U8D A;  1S36 A;  2HPS A;  2LMV A;  1CB1 A;  3O78 A;  1CFF A;  2G2B A;  2QPT A;  3CYZ A;  1XFU O;  1QTX A;  2KFF A;  1IG5 A;  5CSF A;  2KHN A;  2ZKM X;  1A2X A;  3HCM A;  2P71 A;  5CSI A;  3S0B A;  3O2P A;  5HYD A;  1WDC C;  3BUO B;  1H4B A;  1KCY A;  2M8U A;  1G8I A;  3L4L A;  3RM1 A;  5D3O A;  2L2E A;  1K96 A;  3FWB A;  3K1E A;  4UPG A;  2M7N A;  3D75 A;  1OMR A;  3EG5 B;  1MXL C;  4M2P A;  1K94 A;  3H4S E;  4GGN A;  2I7A A;  1YRU B;  3PLF B;  3WNX B;  5J3X A;  3EVU A;  4PE0 A;  1NCZ A;  2PVB A;  1MHO A;  3OX5 A;  5AEQ A;  1NX1 A;  2SAS A;  3LL8 B;  1IH0 A;  4N5X A;  2SCP A;  4R1E A;  1KQV A;  3AAJ A;  1B47 A;  1DQE A;  1K9P A;  1K9U A;  2L5Y A;  4JQ0 D;  5KSZ A;  1MR8 A;  1JSA A;  2CXJ A;  1XFW O;  3CDN A;  2JXC A;  1NX3 A;  1QIW A;  1A75 B;  4N1G A;  4NDD A;  1FBV A;  3TDI A;  3SIA A;  1HT9 A;  1SKT A;  1GQM A;  4XJK A;  1TNX A;  4PHJ A;  1OMV A;  5D7F A;  4PAL A;  4YI8 A;  1QXP A;  1DGV A;  2IS9 A;  1B8C A;  2JNF A;  1ZAC A;  3JTD B;  3TS5 C;  2F3Z A;  1ODB A;  1PSR A;  1NUB A;  1M63 B;  2KNE A;  2A4J A;  3KPX A;  3CR4 X;  1PK0 D;  3ZNI A;  2M49 B;  2PRU A;  3TUY C;  4ZCU A;  5I2L A;  4AQJ A;  5ER5 A;  1TTX A;  3L4A A;  4MZK A;  1Y1X A;  1YUR A;  2HF5 A;  2FOT A;  1AK8 A;  1B9A A;  3CWG A;  1M39 A;  2I18 A;  1J7R A;  3OHM B;  4ICB A;  1XK4 C;  3LLE A;  5PAL A;  3PM8 A;  2NCO A;  2TN4 A;  4DS7 A;  5AXI A;  3QRX A;  2BE4 A;  3OP0 A;  3L47 A;  2JUL A;  2MRD A;  3BYA A;  3NXA A;  2QEH A;  2WCE A;  4FQT A;  2QDI A;  1KFU S;  1YUU A;  2LUX A;  1V1G A;  4JWQ A;  2ZN8 A;  1KQM C;  2PAS A;  5DKN A;  1TNW A;  2LP2 A;  5FI2 A;  1LA3 A;  2BBN A;  4PE1 A;  1SY9 A;  1MUX A;  3ZWH A;  1DJX A;  1WLZ A;  3EK4 A;  1L2O B;  3AAK A;  3I5I C;  1IRJ A;  3UO9 A;  2K8M B;  4DCK A;  1SCM B;  1P28 A;  1WRK A;  2KAX A;  1FW4 A;  1PSB A;  2Y1M A;  4CPV A;  3NHT A;  4YGD B;  2KFH A;  3VB1 A;  1IQ3 A;  3TZ1 A;  3O6B A;  1SL9 A;  3PSR A;  1NX0 A;  4BY4 A;  2JXL A;  2M29 A;  3RZS A;  2WCJ A;  2KYC A;  1OOG A;  1S1E A;  2KBI A;  3CR2 A;  1A75 A;  4CLN A;  1KFU L;  2WCF A;  1CFD A;  3FIA A;  5HKY A;  2FJU B;  5DKR A;  1OW4 A;  4PCW A;  4XJK B;  3BFB A;  1A29 A;  3CS1 A;  3DY9 A;  3WXA A;  1PRW A;  1BF5 A;  1FPW A;  4QJ3 B;  1VRK A;  1YTZ C;  3S0D A;  2KAY A;  1OOI X;  4OVN F;  4CFR A;  1M46 A;  1F55 A;  1B7T Z;  2H2K A;  1H8B A;  1DT7 B;  1REC A;  1EJ3 A;  1B4C A;  5G08 A;  1YUT A;  1DJI A;  2KQ6 A;  1GGW A;  1J1E A;  4INW A;  3SIB A;  1IJ6 A;  2LMT A;  2OS8 B;  2WCK A;  1RJV A;  4MSP A;  3I5F B;  2LVK A;  2JU0 A;  3OB2 B;  4KYN A;  1EL4 A;  3BFA A;  1IKU A;  1N0Y A;  2MA2 A;  3SG4 A;  3A4U B;  2NZ0 A;  2JRF A;  2KLE A;  5HLV A;  5CPV A;  1X02 A;  2BBM A;  3CLN A;  2P6B B;  3SG7 A;  1B8L A;  3VRR A;  1RFJ A;  1Y0V H;  5TNC A;  1DF0 B;  4GGF A;  5CSN A;  4L9M A;  4OCI A;  1DJZ A;  1CLM A;  1MF8 B;  2BE6 A;  3NSL A;  1CM4 A;  3OB1 B;  1TWO A;  3B88 A;  4YGE B;  3WHT B;  3GOF A;  2L5X B;  1GGZ A;  2LUC A;  4QJ4 B;  4DRW A;  3FE9 A;  2KAV A;  2EC6 B;  1RWY A;  2M1U A;  2M1K B;  2F2O A;  4D1E A;  1FI5 A;  1S5G Z;  1Z2C B;  1XVJ A;  2PQL A;  4WQ3 A;  1J7O A;  1QX7 A;  2CBL A;  1UHK A;  4MZJ A;  1DEK A;  2JPO A;  2AUC A;  3BXK A;  2OTG B;  1J7P A;  2JOJ A;  1SPY A;  1XFY O;  3KEV A;  1KSM A;  4GAO A;  2JC2 A;  1K8U A;  4CID A;  3EVR A;  1XA5 A;  1BG1 A;  4XYN A;  3I5G C;  3JTD C;  1PUL A;  1CDN A;  2CT9 A;  1NPQ A;  5FYX A;  2K7O A;  3CGA A;  1B8R A;  1KK7 Z;  1DJH A;  1QV0 A;  2BCB A;  1UP5 A;  3S0E A;  3LK1 A;  2KI4 B;  2LV7 A;  2CCM A;  1K2H A;  2LP3 A;  4HRE E;  3CZT X;  4GUK A;  4YGB B;  5HKZ A;  1FI6 A;  3D10 A;  1BOC A;  1JBA A;  3I5H B;  3NSI A;  4BY5 A;  1SL8 A;  4GBA A;  4OR9 B;  1TCF A;  4PE7 A;  5I8N A;  1JFJ A;  5HKW A;  2LAP A;  1F70 A;  1KK8 B;  2HET A;  3SG3 A;  3PAT A;  1SR6 B;  1JUO A;  2DOQ A;  2KOT A;  2E30 A;  2LLS A;  2L4I A;  1Y1U A;  3SG5 A;  2RGI A;  1YX7 A;  1CTR A;  4OKH A;  5BPJ A;  1CFP A;  1WY9 A;  3BOW B;  4YGC B;  4F7F A;  3BJH A;  3BUN B;  1J55 A;  4INX A;  4GGF C;  2L2C A;  1CDP A;  3A8R A;  1B7T Y;  1PVB A;  1UUS A;  2Q4U A;  1F71 A;  5JJG A;  1DEL A;  2LVV A;  5DKQ A;  3IQQ A;  1OMD A;  1R6P A;  1FF1 A;  2K7C A;  1DVI A;  1U5I B;  1TIZ A;  1M31 A;  1K93 D;  3AKA A;  3EK7 A;  2QEB A;  1W7I B;  3R1P A;  4TNC A;  3VRP A;  1A03 A;  4WRI A;  3WHU B;  1BT6 A;  1OSA A;  5I2Q A;  1OQP A;  5CSJ A;  1L2O C;  1R2U A;  1N2D A;  2NLN A;  2AAO A;  2ZRS A;  4I5J A;  1OOF A;  1SCM C;  2BAP A;  1V1F A;  2VRG A;  5IBW A;  3DVK A;  2CTN A;  2LC5 A;  4GPL B;  5I94 A;  1DF0 A;  3S0F A;  1YVL A;  2KQY A;  1S26 D;  1TOP A;  1KWO B;  3PN7 B;  3JVT C;  4GNK B;  2WC6 A;  2KPH A;  3E3R A;  2BNX A;  1C07 A;  1RTP 1;  3BUW B;  4FQO A;  5KU1 A;  2GTE A;  5ER4 X;  2WND A;  2ZND A;  1IQ5 A;  1OZS A;  2WCH A;  4NDB A;  4OZD A;  4USL A;  4CFQ A;  1TN4 A;  1QV1 A;  2WC5 A;  2I2R E;  2I94 A;  2ZN9 A;  1YRT B;  3EKJ A;  1QAT A;  1S5G Y;  2D8N A;  3BQ3 A;  3R1O A;  2BCX A;  1WRZ A;  3O4X A;  1CMG A;  4C0L A;  1JF2 A;  3DZT A;  3LK0 A;  5AER A;  1G33 A;  3S0G A;  1ALW A;  5KTY A;  1QWV A;  1DJY A;  2L51 A;  1AHR A;  2KDH A;  3QME A;  1D1O A;  2JT3 A;  1SW8 A;  3TDU A;  1CDL A;  1AJ5 A;  1MXE A;  2HQW A;  1BLQ A;  2OS8 C;  1QJT A;  1KK7 Y;  3I5F C;  3D73 A;  1BOD A;  1EXR A;  2Y1N A;  1S3P A;  2Y4Q A;  1SSE B;  2WC8 A;  2ZFD A;  3VRO A;  3BFH A;  1T14 A;  2HQ8 A;  1ZOT B;  4DIR A;  2Q91 A;  5AAN A;  1Z4H A;  3VRN A;  1JFK A;  2JZI A;  3KHE A;  2M3W A;  3BOW A;  4MLW A;  1QS7 A;  3IF7 A;  3SS3 A;  1Q80 A;  5EL2 A;  3SJS A;  4PE4 A;  2Y5I A;  1SK6 D;  1W7J B;  2L98 A;  2QEV A;  1U5I A;  2E6W A;  3O4Y A;  2EC6 C;  2ERB A;  3BUX B;  1J1D A;  2COL B;  1Y1A A;  3VGO A;  3TDZ A;  3DVM A;  4ZCV A;  2K2A A;  2LCP A;  2JPT A;  3NHI A;  3DVJ A;  1SNL A;  2GGM A;  5JOL A;  4MZL A;  1J7Q A;  3PFV A;  2MJW B;  1KFX S;  4ORC B;  2F33 A;  1C3Y A;  3D76 A;  1W9Z A;  3HX4 A;  4E68 A;  4HRG A;  4ORB B;  3FE6 A;  1BJF A;  1CLB A;  2LHL A;  4IJ7 A;  4OV2 A;  2JNX A;  4AOM A;  4ETO A;  2R2I A;  3D0Y B;  2H8V A;  3NGV A;  1F4O A;  1NCX A;  2KI4 C;  1F4Q A;  1BMO A;  3FS7 A;  3CZ2 A;  2NCP A;  3OX6 A;  4YI9 A;  1F54 A;  3FWC A;  3D77 A;  5I2O A;  1F8H A;  3I5H C;  4C0K A;  2LVJ A;  1LKJ A;  2EHB A;  3SS5 A;  4I5K A;  1LVC D;  1ZMZ A;  1KK8 C;  1JF0 A;  2M0R A;  1SR6 C;  1YX8 A;  1WRL A;  4DUQ A;  1C3Z A;  1IIO A;  3RLZ A;  4YRU A;  1UHN A;  2EGD A;  1KFX L;  1MWN A;  1NCY A;  2BL0 B;  3IVT A;  1JC2 A;  1G4Y R;  3KF9 A;  1RRO A;  3PM2 A;  4N1F A;  1UHI A;  4JD9 A;  1QVI Z;  2KBM A;  1QIV A;  1SL7 A;  1UHH A;  1B1G A;  1K95 A;  3MSE B;  2PSR A;  2K61 A;  3KO0 A;  4PHK A;  3F45 A;  3PAL A;  2KFG A;  2F8P A;  1EG4 A;  1QLK A;  2MHH A;  2LHI A;  1TNP A;  4P2Y B;  1GJY A;  1TUZ A;  2JTT A;  2OPO A;  1MQ1 A;  3DD4 A;  3V2L A;  1EG3 A;  1XK4 A;  2GGZ A;  1OE9 B;  4JPZ B;  3DXL A;  2JQ6 A;  1DTL A;  2BCA A;  1UUR A;  2M97 A;  1NX2 A;  3LCP C;  4M2O A;  1C7V A;  2GV5 A;  2MAZ A;  2LLT A;  2CNP A;  2LNK A;  1RK9 A;  1WDC B;  2M7L A;  1LXF C;  2P70 A;  1N65 A;  2V53 A;  5FI6 A;  2BKI B;  1JWD A;  1GM0 A;  1KWO C;  1QX5 B;  3PN7 C;  5F6T A;  2B1U A;  4A4C A;  2H61 A;  3NSK A;  1TRF A;  1AJ4 A;  2KLD A;  4I5L B;  2BEC A;  5HL1 A;  2MLF C;  2PMY A;  1SRA A;  1K90 D;  1E8A A;  1UWO A;  1AVS A;  3GK2 A;  1DGU A;  2KI6 C;  2L50 A;  2KGB C;  1K9K A;  1IGV A;  2WCB A;  2YGU A;  3GK4 X;  2KGR A;  3I5G B;  4MRX A;  1DC1 A;  1ALV A;  2WCL A;  1LA0 A;  3R1V A;  3R72 A;  4ORA B;  4PT1 A;  1ZFS A;  2MBX A;  2K60 A;  1ZUZ A;  3D78 A;  3B86 A;  1DJG A;  1OOJ A;  3SG2 A;  3D0Y A;  2PYQ A;  3DF0 B;  1M45 A;  1XFV O;  2LM5 A;  4Q04 A;  1S6J A;  3CTN A;  4F0Z B;  5FI7 A;  1TNQ A;  1NP8 A;  4YBH B;  2LVI A;  2F3Y A;  1NYA A;  3B7A A;  3B6X A;  4A4B A;  1QX2 A;  3M0W A;  2F2P A;  2WOS A;  2ZNE A;  2G9B A;  4PHM A;  3SG6 A;  3Q8I A;  4IL1 A;  1SMG A;  2O5G A;  1QLS A;  3CAB A;  3OBV A;  4FTG A;  3TS5 B;  1AUI B;  1TCO B;  1NSH A;  2FCD A;  2KI6 D;  5K89 A;  4JKT A;  4AQI A;  2L0P A;  1CDM A;  4HRH A;  2LLU A;  4MRY A;  2BKH B;  3CZ0 A;  4PDZ A;  2H61 C;  3EKH A;  1XFX O;  4MN0 A;  4WQ2 A;  1QVI Y;  3TUY B;  2K0J A;  3FE8 A;  2JTZ A;  1AP4 A;  2M9G A;  1OZO A;  1BU3 A;  1NIW A;  3UNW A;  1BR1 B;  2FCE A;  2LE9 B;  2K7B A;  1L7Z A;  1SYM A;  2JT0 A;  2L4H A;  3BUM B;  3DYE A;  3NSO A;  1IWQ A;  1KSO A;  4I5N B;  4M2Q A;  4NDC A;  4YGA A;  1XFZ O;  3OGN A;  3GK1 A;  1HQV A;  2K2F A;  2FJY A;  1S6C A;  1WLM A;  1YR5 A;  3C1V A;  5GQQ C;  1XYD A;  1EH2 A;  1C7W A;  1LIN A;  1OOH A;  1CKK A;  1XFR A;  1TUJ A;  2LAN A;  3ICB A;  1YUS A;  2MLE C;  3JVT B;  4MEW A;  3IQO A;  1KQM B;  2PAL A;  1IJ5 A;  5D69 A;  4GFT A;  3S0A A;  2JT8 A;  2K7D A;  1QAS A;  2KYF A;  2O60 A;  3DVE A;  1BR4 B;  1PAL A;  1PVA A;  2OTG C;  1CFC A;  3I5I B;  1YVH A;  1NWD A;  2AMI A;  1A4P A; 
#chains in the Genus database with same CATH homology
 3N7H A;  4JD9 A;  2QEB A;  2QEO A;  3R1P A;  2WCM A;  3PJI A;  3CZ1 A;  1P28 A;  3NHT A;  3VB1 A;  1OOF A;  1ORG A;  2WCJ A;  3RZS A;  1LS8 A;  1OOG A;  3D74 A;  5DIC A;  3B87 A;  3V2L A;  3S0F A;  3DXL A;  1OW4 A;  3BFB A;  3DY9 A;  2WC6 A;  2KPH A;  3CYZ A;  2P70 A;  3S0D A;  2GTE A;  1GM0 A;  2P71 A;  1OOI X;  3S0B A;  2WCH A;  4OZD A;  2WC5 A;  3L4L A;  3K1E A;  3R1O A;  3D75 A;  3DZT A;  4INW A;  3S0G A;  1QWV A;  2WCK A;  3QME A;  2WCL A;  3BFA A;  3R1V A;  3R72 A;  4PT1 A;  3D73 A;  3D78 A;  3B86 A;  3BFH A;  1T14 A;  1DQE A;  3CDN A;  3B7A A;  3B6X A;  1TWO A;  3B88 A;  3Q8I A;  3FE9 A;  5EL2 A;  3CAB A;  2QEV A;  2PQL A;  2JPO A;  2ERB A;  3CZ0 A;  3FE8 A;  3NHI A;  1C3Y A;  3D76 A;  3S0E A;  3FE6 A;  3L4A A;  3DYE A;  3OGN A;  3NGV A;  2H8V A;  2FJY A;  3CZ2 A;  3D77 A;  1OOH A;  3L47 A;  1XFR A;  1TUJ A;  2QEH A;  4FQT A;  2QDI A;  4F7F A;  1C3Z A;  3BJH A;  4INX A;  3S0A A;  2L2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...