3L4LA

Crystal structure of an anopheles gambiae odorant-binding protein agamobp22a with bound odorant benzaldehyde
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
134
structure length
119
Chain Sequence
NESVIESCSNAVQGAANDELKVHYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENLGNSDDADEEFVAKHRACLEAKNLETIEDLCERAYSAFQCLREDYEMYQNELWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant binding protein (AGAP010409-PA)
publication title Crystal Structures of an Anopheles gambiae Odorant-binding Protein Agam22a and Complexes with Bound Odorants
rcsb
source organism Anopheles gambiae
total genus 45
structure length 119
sequence length 134
ec nomenclature
pdb deposition date 2009-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3l4lA00
3S0DA 4FQTA 3R1PA 1OOHA 1OW4A 1ORGA 2WC5A 1DQEA 3BFBA 1OOGA 1TUJA 2KPHA 2QEBA 3CABA 3NHTA 5DICA 2QDIA 2PQLA 3S0BA 3BFAA 3OGNA 3B88A 2WCJA 3D73A 2WCLA 1OOFA 2P71A 2P70A 3VB1A 3DZTA 3K1EA 3R1OA 3D77A 3B87A 3DY9A 3S0EA 2GTEA 2L2CA 1QWVA 3S0FA 4INWA 2ERBA 2WCHA 3R1VA 3V2LA 4PT1A 3L4LA 3NHIA 1P28A 3N7HA 3BFHA 3B7AA 1T14A 1GM0A 1XFRA 3R72A 3CZ1A 4INXA 1C3YA 1LS8A 2QEVA 3B6XA 3NGVA 3D74A 4OZDA 3PJIA 3D75A 3CYZA 3CZ0A 2JPOA 3Q8IA 3RZSA 2WCMA 3BJHA 1OOIX 3QMEA 2QEOA 3CZ2A 2H8VA 2FJYA 3B86A 3L4AA 4F7FA 3S0AA 2WC6A 3L47A 3DXLA 2QEHA 3D76A 1C3ZA 3CDNA 3FE9A 3DYEA 3S0GA 2WCKA 3FE8A 3D78A 3FE6A 5EL2A 1TWOA 4JD9A
chains in the Genus database with same CATH superfamily
3S0DA 3I5IB 1EL4A 3R1PA 3CLNA 1S6IA 3O6BA 1MXEA 2L5XB 2WC5A 1FBVA 1JF0A 1RFJA 2FCEA 1FI6A 1LKJA 1U5IB 1WDCB 3SS3A 1Z4HA 3I5GC 1KWOB 1LA3A 1UHJA 2WNDA 3KO0A 2KPHA 2LMVA 1NX0A 2BCBA 1G4YR 2LVVA 4GUKA 1QATA 4IL1A 5GQQC 3TS5C 1IH0A 2LP2A 2JZIA 3E3RA 3WHUB 3LK0A 4MN0A 4N1FA 3UNWA 1SCMC 1XA5A 1M39A 2JPTA 4PHJA 3K21A 2D8NA 3OGNA 3B88A 3SG5A 1M31A 3GK1A 2M49B 1SMGA 2AUCA 3NSOA 1OOFA 2NCOA 1TUZA 1MR8A 4OR9B 4MZJA 2HQWA 2P70A 4GNKB 4PE1A 3SG6A 3VROA 3M0WA 3PLFB 4KYNA 3TDZA 3O4YA 4A4BA 1UUSA 1XFUO 1JFKA 1K2HA 2M1UA 1C7WA 1CDPA 2JWWA 1Y1XA 2GTEA 4MLWA 3KPXA 3DD4A 5CPVA 4DS7A 5ER4X 1FW4A 4JWQA 1YR5A 2GGMA 3CTNA 3EK7A 4AOMA 5G08A 2EC6C 2F3YA 1NUBA 1BODA 2M0RA 2ERBA 5AEQA 3EVRA 1D1OA 2Y1NA 1KFXS 1K9UA 1ZFSA 1XK4C 2M7NA 1S6CA 4NDCA 3NHIA 3TDUA 2KI6D 3JVTC 2NXQA 3B7AA 1XVJA 2JU0A 1BOCA 1FPWA 1M63B 4MVFA 2KLEA 5I8NA 2KAVA 4P2YB 5AXIA 2BCAA 2EHBA 2KI4C 1AP4A 3FWCA 2JQ6A 3R72A 1OZOA 4INXA 4BY5A 1LS8A 2KFFA 3I5GB 4YGAA 2KSPA 3GOFA 2HPSA 3MSEB 3ZWHA 1BMOA 2F33A 4PDZA 4WQ3A 5BPJA 2OPOA 1R2UA 2BBMA 1Y0VH 1B47A 1A75A 1YTZC 4OZDA 3TS5B 1CM4A 4M2QA 2HQ8A 1LVCD 4DCKA 3CZ0A 1SCMB 2LNKA 4JPZB 3SJSA 3OBVA 3TZ1A 5DKQA 1XFWO 1AHRA 1XK4A 5AERA 2JRFA 1ZMZA 2KGBC 2SASA 3QMEA 5HKYA 1GGZA 1WY9A 1J55A 2LV7A 1GGWA 3I5FC 3PM8A 4WRIA 1M46A 2KDHA 4F7FA 1B4CA 2BECA 3PSRA 4HRHA 2I7AA 2KBIA 3BOWB 3DF0B 3DXLA 3D76A 1Q80A 2KQ6A 3DVJA 2ZRTA 2G2BA 2Y4QA 3CDNA 3H4SE 1PULA 1CDNA 1NSHA 1G8IA 1SW8A 4I5NB 2L5YA 5D3OA 3NSIA 1A4PA 1TCFA 3FIAA 3DVEA 5DKRA 2CBLA 1AJ5A 3FE8A 2EC6B 5EL2A 4GAOA 2LLTA 3BXKA 2K61A 2LC5A 4JQ0D 3EK8A 3IQOA 1K94A 1U5IA 2SCPA 3EVUA 1K95A 1TNXA 3D0YB 5CSJA 1J7PA 1S5GZ 4IJ7A 1IWQA 2JTTA 3JVTB 1YVHA 1OOGA 1SL9A 2TN4A 2KNEA 5FI2A 1DELA 4N5XA 1A03A 2QEBA 3NHTA 1K90D 1SCVA 1OQPA 2KI6C 3GK2A 2BKHB 2M9GA 1KFUL 2MJWB 2KI4B 4GGFA 2QDIA 3A4UB 1OMDA 1W9ZA 1YVLA 1QIVA 3BQ3A 1WRLA 2KYCA 1ALWA 2WCFA 2WCJA 2WCLA 4QJ4B 5KTYA 4MRXA 2L2EA 5JOLA 1S5GY 1ZACA 3GK4X 1DJHA 2K7DA 1MQ1A 2IS9A 1EG3A 3KHEA 4C0JA 4U8DA 1V1GA 2WORA 1XFXO 3OP0A 1IJ5A 1QTXA 2E6WA 1NX2A 1TNPA 3PM2A 1CLLA 3I5FB 1QASA 1H8BA 3S0EA 2EGDA 2CNPA 5I2QA 1BLQA 1PSRA 1MWNA 2L2CA 1UP5A 2YGUA 4Q04A 3S0FA 2KQYA 1PSBA 3CR2A 1PK0D 2ZRSA 3VGOA 1B8LA 1NP8A 2LVKA 5I2LA 1TTXA 2MLEC 3V2LA 2L4IA 2WC8A 4GFTA 4PHNA 2K2FA 3D10A 5HYDA 5J3XA 1C7VA 1OE9B 2CTNA 3BFHA 1IQ3A 2KGRA 2K7CA 2LANA 2BBNA 2K7OA 1SY9A 4OCIA 2ZN9A 1QX7A 5TNCA 1XFRA 3CWGA 2F8PA 1JF2A 3CZ1A 1H4BA 1TCOB 1JC2A 1EH2A 1JWDA 5CSNA 3UO9A 1KQMC 1WLZA 3OB2B 1DEKA 3B6XA 4NQGA 3DVKA 2Y5IA 4I5KA 1DC1A 1OOJA 3D74A 3NSKA 2A4JA 1IQ5A 2PSRA 3SG2A 1AJ4A 2KBMA 1QVIZ 3JTDC 3RZSA 2LHIA 4ZCVA 1F55A 2BCXA 1J7RA 1NYAA 1OOIX 2JNFA 3AKBA 2QEOA 3CZ2A 2FJYA 3L4AA 3C1VA 5B8IB 3DF0A 3BOWA 1Y1UA 1CTRA 2F3ZA 4YGBB 1BT6A 5FI7A 1DGUA 1SRAA 1XYDA 2GGZA 2QPTA 4N1GA 4NDDA 1N65A 1LXFC 1C07A 1QVIY 5I94A 4MBEA 1XFZO 5CSIA 2ZN8A 1UHNA 2PYQA 1UWOA 3BUOB 4I5LB 4ZCUA 2B1UA 1LINA 5HKZA 3CS1A 1NCYA 1MF8B 1SL7A 4BY4A 2LMTA 3D78A 2JNXA 4GBAA 2JXCA 1MHOA 3BUNB 3VRRA 1XFVO 3D0YA 2MHHA 4JD9A 4ETOA 1DT7B 4YI8A 2WCBA 1PVBA 4FQTA 2PALA 1SYMA 2MBXA 5HLVA 1ORGA 1ZUZA 1DF0B 1WLMA 1DQEA 5KU1A 4YI9A 1SPYA 1RK9A 1TUJA 2MAZA 2COLB 2KYFA 5K89A 1LA0A 1OMVA 3CABA 4MEWA 2JOJA 1F4OA 4ORAB 1KQVA 1L7ZA 2OTGC 5D69A 2ISDA 2PQLA 4OKHA 2KAYA 1Z2CB 2HETA 4ICBA 3VRQA 1FF1A 3BFAA 1UHIA 1KQMB 1ALVA 1ODBA 4ORBB 1QJTA 2JT8A 1KSMA 3I5HC 4DRWA 2M7LA 4USLA 3D73A 3WNXB 4CFRA 3BUWB 2JC2A 1B8CA 1CLMA 1DJXA 2K2AA 1IIOA 1DTLA 2P71A 4YGCB 4XYNA 1CFCA 5HL1A 1CM1A 3IVTA 2M3WA 3JTDB 3SS5A 1TIZA 3KF9A 3VB1A 4QJ5B 1RTP1 1S26D 3F45A 1TRFA 4D1EA 3DZTA 1E8AA 1BR1B 5ER5A 3R1OA 1DJZA 3SS4A 3B87A 1JBAA 1UHHA 2I94A 4MSPA 2LUCA 1RJVA 1S1EA 3DY9A 1GQMA 2WCEA 3LK1A 4PE4A 1CNPA 2MA2A 3WHTB 1B9AA 3EKJA 1NPQA 4HREE 4DIRA 1UHKA 4INWA 1IG5A 1QLSA 2MLFC 2BNXA 1PRWA 3QRXA 5AANA 1B1GA 4AQIA 1L2OC 4QJ3B 4C0KA 4E68A 4YGDB 1EJ3A 2VRGA 3RM1A 2LMUA 3L4LA 4HSZA 2NCPA 4MZLA 2L98A 3EKHA 1J1EA 3N7HA 3OX6A 1OMRA 1YUUA 2BE6A 1BG1A 2LLSA 1S3PA 1VRKA 1YUTA 3EK4A 2H2KA 1K93D 3PALA 2L50A 5IBWA 1SR6C 4R1EA 2KLDA 1KCYA 3FWBA 2QACA 1SK6D 1A2XA 1K96A 1QV0A 1TN4A 3OB1B 2QEVA 3NXAA 5FYXA 1BJFA 1JSAA 3NGVA 4MZKA 4XJKB 5I2OA 2BAPA 1RWYA 2OTGB 1GJYA 3CR5X 1OSAA 2G9BA 3CYZA 2FOTA 3D75A 3PJIA 2HF5A 3SIBA 2JPOA 1KFXL 3PN7C 1DJWA 3Q8IA 1SNLA 4A4CA 5KSZA 3I5HB 3CZTX 4P5OE 3BJHA 1SKTA 3HCMA 2KHNA 2KOTA 3RLZA 1BF5A 4CFQA 1KK8B 1CMGA 1AVSA 4YBHB 3B86A 1V1FA 4PHKA 3ZNIA 4PALA 1KK7Z 2WC6A 3S0AA 1Y1AA 1QV1A 2O60A 2Q4UA 3CGAA 1K8UA 5JJGA 1W7JB 4DUQA 2JULA 2L4HA 2PASA 3BUMB 2F2PA 1X02A 3PATA 1QLKA 2FJUB 1JUOA 4YGEB 3IQQA 4GGNA 2M97A 1KFUS 3FE9A 4MRYA 4HRGA 2E30A 3EG5B 1NIWA 1F8HA 1XO5A 3DYEA 3SIAA 1EG4A 1DJIA 1F54A 1B8RA 2F2OA 3FE6A 1RECA 1NWDA 1TOPA 3EVVA 1W7IB 1TWOA 3O78A 2L51A 5D7FA 3WXAA 5AFPA 1KK7Y 2V53A 1AK8A 5DKNA 5HKWA 4CLNA 1ZOTB 3LCPC 1L2OB 1DF0A 1YX8A 5F6TA 2L0PA 1IJ6A 1OOHA 3A8RA 5FI6A 1OW4A 3NSLA 3O4XA 1XFYO 2NZ0A 4NDBA 2BL0C 3BFBA 2NLNA 1DJGA 4PHMA 3VRPA 2Y1MA 2BE4A 2KFHA 2BKIB 1YRTB 1SR6B 5DICA 1F4QA 1QIWA 2CXJA 3TDIA 1HQVA 1YUSA 3BYAA 4GPLB 2H61C 3DVMA 3S0BA 2GV5A 1SL8A 4UPGA 1AUIB 4L9MA 1MXLC 4PE0A 1QX2A 2P6BB 2M8UA 3LLEA 4TNCA 2LE9B 1WRKA 4M2PA 1BU3A 1K9PA 1QX5B 3AAKA 2LUXA 1OZSA 2K8MB 1CFFA 2JTZA 2ZNDA 3KEVA 4JKTA 2LP3A 2OS8C 3AKAA 3PN7B 1CB1A 1S6JA 5CSFA 1K9KA 2LLUA 3K1EA 1NCZA 5PALA 3D77A 2AMIA 1PVAA 1RROA 2K60A 2WOSA 3LL8B 1DMOA 1NX1A 4F0ZB 2LHLA 4FQOA 1TNQA 2K7BA 3TUYC 1CMFA 2PVBA 1QWVA 2LVJA 2JT0A 4PE7A 1CDLA 1Y6WA 1DJYA 2H61A 1TNWA 2I18A 1NCXA 2WCHA 1M45A 3IF7A 2JXLA 3I5IC 1N2DA 2PMYA 2CT9A 2CCMA 3R1VA 4OV2A 4C0LA 3SG3A 2JT3A 1KK8C 3AAJA 3ICBA 1CDMA 4PT1A 1WRZA 2RGIA 4OVNF 1P28A 1YRUB 4M2OA 2Q91A 1WDCC 3VRNA 1B7TZ 1KWOC 1YURA 1IRJA 2ZFDA 1T14A 1PALA 1GM0A 3SG7A 1EXRA 1J1DA 1J7OA 1N0YA 1C3YA 2BL0B 1CLBA 1R6PA 3OX5A 3OHMB 4WQ2A 1J7QA 4GGFC 4XJKA 1SSEB 4ORCB 1NX3A 2LVIA 2R2IA 1DVIA 3HX4A 4AQJA 2M29A 2MRDA 4CPVA 1B7TY 1A75B 2DOQA 3PFVA 2WCMA 3FS7A 2AAOA 1S36A 1FI5A 2H8VA 2FCDA 2ZKMX 1MUXA 1UURA 4YRUA 2OS8B 2KFGA 1CFPA 3CR4X 1DGVA 5HLOA 3L47A 4I5JA 2QEHA 2I2RE 1C3ZA 1IGVA 1CFDA 1BR4B 4CIDA 3O2PA 2ZNEA 4PCWA 2LM5A 1HT9A 1KSOA 1YX7A 2K0JA 2PRUA 3TUYB 1G33A 2KAXA 1IKUA 1SBJA 1A29A 2WCKA 1QXPA 4FTGA 1QS7A 3S0GA 1JFJA 1F70A 2LAPA 1CKKA 2M1KB 3SG4A 1F71A 2LCPA 2O5GA 3BUXB
chains in the Genus database with same CATH topology
3S0DA 4FQTA 3R1PA 1OOHA 1OW4A 1ORGA 2WC5A 1DQEA 3BFBA 1OOGA 1TUJA 2KPHA 2QEBA 3CABA 3NHTA 5DICA 2QDIA 2PQLA 3S0BA 3BFAA 3OGNA 3B88A 2WCJA 3D73A 2WCLA 1OOFA 2P71A 2P70A 3VB1A 3DZTA 3K1EA 3R1OA 3D77A 3B87A 3DY9A 3S0EA 2GTEA 2L2CA 1QWVA 3S0FA 4INWA 2ERBA 2WCHA 3R1VA 3V2LA 4PT1A 3L4LA 3NHIA 1P28A 3N7HA 3BFHA 3B7AA 1T14A 1GM0A 1XFRA 3R72A 3CZ1A 4INXA 1C3YA 1LS8A 2QEVA 3B6XA 3NGVA 3D74A 4OZDA 3PJIA 3D75A 3CYZA 3CZ0A 2JPOA 3Q8IA 3RZSA 2WCMA 3BJHA 1OOIX 3QMEA 2QEOA 3CZ2A 2H8VA 2FJYA 3B86A 3L4AA 4F7FA 3S0AA 2WC6A 3L47A 3DXLA 2QEHA 3D76A 1C3ZA 3CDNA 3FE9A 3DYEA 3S0GA 2WCKA 3FE8A 3D78A 3FE6A 5EL2A 1TWOA 4JD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0D A;  4FQT A;  3R1P A;  1OOH A;  1OW4 A;  1ORG A;  2WC5 A;  1DQE A;  3BFB A;  1OOG A;  1TUJ A;  2KPH A;  2QEB A;  3CAB A;  3NHT A;  5DIC A;  2QDI A;  2PQL A;  3S0B A;  3BFA A;  3OGN A;  3B88 A;  2WCJ A;  3D73 A;  2WCL A;  1OOF A;  2P71 A;  2P70 A;  3VB1 A;  3DZT A;  3K1E A;  3R1O A;  3D77 A;  3B87 A;  3DY9 A;  3S0E A;  2GTE A;  2L2C A;  1QWV A;  3S0F A;  4INW A;  2ERB A;  2WCH A;  3R1V A;  3V2L A;  4PT1 A;  3L4L A;  3NHI A;  1P28 A;  3N7H A;  3BFH A;  3B7A A;  1T14 A;  1GM0 A;  1XFR A;  3R72 A;  3CZ1 A;  4INX A;  1C3Y A;  1LS8 A;  2QEV A;  3B6X A;  3NGV A;  3D74 A;  4OZD A;  3PJI A;  3D75 A;  3CYZ A;  3CZ0 A;  2JPO A;  3Q8I A;  3RZS A;  2WCM A;  3BJH A;  1OOI X;  3QME A;  2QEO A;  3CZ2 A;  2H8V A;  2FJY A;  3B86 A;  3L4A A;  4F7F A;  3S0A A;  2WC6 A;  3L47 A;  3DXL A;  2QEH A;  3D76 A;  1C3Z A;  3CDN A;  3FE9 A;  3DYE A;  3S0G A;  2WCK A;  3FE8 A;  3D78 A;  3FE6 A;  5EL2 A;  1TWO A;  4JD9 A; 
#chains in the Genus database with same CATH topology
 3S0D A;  3I5I B;  1EL4 A;  3R1P A;  3CLN A;  1S6I A;  3O6B A;  1MXE A;  2L5X B;  2WC5 A;  1FBV A;  1JF0 A;  1RFJ A;  2FCE A;  1FI6 A;  1LKJ A;  1U5I B;  1WDC B;  3SS3 A;  1Z4H A;  3I5G C;  1KWO B;  1LA3 A;  1UHJ A;  2WND A;  3KO0 A;  2KPH A;  2LMV A;  1NX0 A;  2BCB A;  1G4Y R;  2LVV A;  4GUK A;  1QAT A;  4IL1 A;  5GQQ C;  3TS5 C;  1IH0 A;  2LP2 A;  2JZI A;  3E3R A;  3WHU B;  3LK0 A;  4MN0 A;  4N1F A;  3UNW A;  1SCM C;  1XA5 A;  1M39 A;  2JPT A;  4PHJ A;  3K21 A;  2D8N A;  3OGN A;  3B88 A;  3SG5 A;  1M31 A;  3GK1 A;  2M49 B;  1SMG A;  2AUC A;  3NSO A;  1OOF A;  2NCO A;  1TUZ A;  1MR8 A;  4OR9 B;  4MZJ A;  2HQW A;  2P70 A;  4GNK B;  4PE1 A;  3SG6 A;  3VRO A;  3M0W A;  3PLF B;  4KYN A;  3TDZ A;  3O4Y A;  4A4B A;  1UUS A;  1XFU O;  1JFK A;  1K2H A;  2M1U A;  1C7W A;  1CDP A;  2JWW A;  1Y1X A;  2GTE A;  4MLW A;  3KPX A;  3DD4 A;  5CPV A;  4DS7 A;  5ER4 X;  1FW4 A;  4JWQ A;  1YR5 A;  2GGM A;  3CTN A;  3EK7 A;  4AOM A;  5G08 A;  2EC6 C;  2F3Y A;  1NUB A;  1BOD A;  2M0R A;  2ERB A;  5AEQ A;  3EVR A;  1D1O A;  2Y1N A;  1KFX S;  1K9U A;  1ZFS A;  1XK4 C;  2M7N A;  1S6C A;  4NDC A;  3NHI A;  3TDU A;  2KI6 D;  3JVT C;  2NXQ A;  3B7A A;  1XVJ A;  2JU0 A;  1BOC A;  1FPW A;  1M63 B;  4MVF A;  2KLE A;  5I8N A;  2KAV A;  4P2Y B;  5AXI A;  2BCA A;  2EHB A;  2KI4 C;  1AP4 A;  3FWC A;  2JQ6 A;  3R72 A;  1OZO A;  4INX A;  4BY5 A;  1LS8 A;  2KFF A;  3I5G B;  4YGA A;  2KSP A;  3GOF A;  2HPS A;  3MSE B;  3ZWH A;  1BMO A;  2F33 A;  4PDZ A;  4WQ3 A;  5BPJ A;  2OPO A;  1R2U A;  2BBM A;  1Y0V H;  1B47 A;  1A75 A;  1YTZ C;  4OZD A;  3TS5 B;  1CM4 A;  4M2Q A;  2HQ8 A;  1LVC D;  4DCK A;  3CZ0 A;  1SCM B;  2LNK A;  4JPZ B;  3SJS A;  3OBV A;  3TZ1 A;  5DKQ A;  1XFW O;  1AHR A;  1XK4 A;  5AER A;  2JRF A;  1ZMZ A;  2KGB C;  2SAS A;  3QME A;  5HKY A;  1GGZ A;  1WY9 A;  1J55 A;  2LV7 A;  1GGW A;  3I5F C;  3PM8 A;  4WRI A;  1M46 A;  2KDH A;  4F7F A;  1B4C A;  2BEC A;  3PSR A;  4HRH A;  2I7A A;  2KBI A;  3BOW B;  3DF0 B;  3DXL A;  3D76 A;  1Q80 A;  2KQ6 A;  3DVJ A;  2ZRT A;  2G2B A;  2Y4Q A;  3CDN A;  3H4S E;  1PUL A;  1CDN A;  1NSH A;  1G8I A;  1SW8 A;  4I5N B;  2L5Y A;  5D3O A;  3NSI A;  1A4P A;  1TCF A;  3FIA A;  3DVE A;  5DKR A;  2CBL A;  1AJ5 A;  3FE8 A;  2EC6 B;  5EL2 A;  4GAO A;  2LLT A;  3BXK A;  2K61 A;  2LC5 A;  4JQ0 D;  3EK8 A;  3IQO A;  1K94 A;  1U5I A;  2SCP A;  3EVU A;  1K95 A;  1TNX A;  3D0Y B;  5CSJ A;  1J7P A;  1S5G Z;  4IJ7 A;  1IWQ A;  2JTT A;  3JVT B;  1YVH A;  1OOG A;  1SL9 A;  2TN4 A;  2KNE A;  5FI2 A;  1DEL A;  4N5X A;  1A03 A;  2QEB A;  3NHT A;  1K90 D;  1SCV A;  1OQP A;  2KI6 C;  3GK2 A;  2BKH B;  2M9G A;  1KFU L;  2MJW B;  2KI4 B;  4GGF A;  2QDI A;  3A4U B;  1OMD A;  1W9Z A;  1YVL A;  1QIV A;  3BQ3 A;  1WRL A;  2KYC A;  1ALW A;  2WCF A;  2WCJ A;  2WCL A;  4QJ4 B;  5KTY A;  4MRX A;  2L2E A;  5JOL A;  1S5G Y;  1ZAC A;  3GK4 X;  1DJH A;  2K7D A;  1MQ1 A;  2IS9 A;  1EG3 A;  3KHE A;  4C0J A;  4U8D A;  1V1G A;  2WOR A;  1XFX O;  3OP0 A;  1IJ5 A;  1QTX A;  2E6W A;  1NX2 A;  1TNP A;  3PM2 A;  1CLL A;  3I5F B;  1QAS A;  1H8B A;  3S0E A;  2EGD A;  2CNP A;  5I2Q A;  1BLQ A;  1PSR A;  1MWN A;  2L2C A;  1UP5 A;  2YGU A;  4Q04 A;  3S0F A;  2KQY A;  1PSB A;  3CR2 A;  1PK0 D;  2ZRS A;  3VGO A;  1B8L A;  1NP8 A;  2LVK A;  5I2L A;  1TTX A;  2MLE C;  3V2L A;  2L4I A;  2WC8 A;  4GFT A;  4PHN A;  2K2F A;  3D10 A;  5HYD A;  5J3X A;  1C7V A;  1OE9 B;  2CTN A;  3BFH A;  1IQ3 A;  2KGR A;  2K7C A;  2LAN A;  2BBN A;  2K7O A;  1SY9 A;  4OCI A;  2ZN9 A;  1QX7 A;  5TNC A;  1XFR A;  3CWG A;  2F8P A;  1JF2 A;  3CZ1 A;  1H4B A;  1TCO B;  1JC2 A;  1EH2 A;  1JWD A;  5CSN A;  3UO9 A;  1KQM C;  1WLZ A;  3OB2 B;  1DEK A;  3B6X A;  4NQG A;  3DVK A;  2Y5I A;  4I5K A;  1DC1 A;  1OOJ A;  3D74 A;  3NSK A;  2A4J A;  1IQ5 A;  2PSR A;  3SG2 A;  1AJ4 A;  2KBM A;  1QVI Z;  3JTD C;  3RZS A;  2LHI A;  4ZCV A;  1F55 A;  2BCX A;  1J7R A;  1NYA A;  1OOI X;  2JNF A;  3AKB A;  2QEO A;  3CZ2 A;  2FJY A;  3L4A A;  3C1V A;  5B8I B;  3DF0 A;  3BOW A;  1Y1U A;  1CTR A;  2F3Z A;  4YGB B;  1BT6 A;  5FI7 A;  1DGU A;  1SRA A;  1XYD A;  2GGZ A;  2QPT A;  4N1G A;  4NDD A;  1N65 A;  1LXF C;  1C07 A;  1QVI Y;  5I94 A;  4MBE A;  1XFZ O;  5CSI A;  2ZN8 A;  1UHN A;  2PYQ A;  1UWO A;  3BUO B;  4I5L B;  4ZCU A;  2B1U A;  1LIN A;  5HKZ A;  3CS1 A;  1NCY A;  1MF8 B;  1SL7 A;  4BY4 A;  2LMT A;  3D78 A;  2JNX A;  4GBA A;  2JXC A;  1MHO A;  3BUN B;  3VRR A;  1XFV O;  3D0Y A;  2MHH A;  4JD9 A;  4ETO A;  1DT7 B;  4YI8 A;  2WCB A;  1PVB A;  4FQT A;  2PAL A;  1SYM A;  2MBX A;  5HLV A;  1ORG A;  1ZUZ A;  1DF0 B;  1WLM A;  1DQE A;  5KU1 A;  4YI9 A;  1SPY A;  1RK9 A;  1TUJ A;  2MAZ A;  2COL B;  2KYF A;  5K89 A;  1LA0 A;  1OMV A;  3CAB A;  4MEW A;  2JOJ A;  1F4O A;  4ORA B;  1KQV A;  1L7Z A;  2OTG C;  5D69 A;  2ISD A;  2PQL A;  4OKH A;  2KAY A;  1Z2C B;  2HET A;  4ICB A;  3VRQ A;  1FF1 A;  3BFA A;  1UHI A;  1KQM B;  1ALV A;  1ODB A;  4ORB B;  1QJT A;  2JT8 A;  1KSM A;  3I5H C;  4DRW A;  2M7L A;  4USL A;  3D73 A;  3WNX B;  4CFR A;  3BUW B;  2JC2 A;  1B8C A;  1CLM A;  1DJX A;  2K2A A;  1IIO A;  1DTL A;  2P71 A;  4YGC B;  4XYN A;  1CFC A;  5HL1 A;  1CM1 A;  3IVT A;  2M3W A;  3JTD B;  3SS5 A;  1TIZ A;  3KF9 A;  3VB1 A;  4QJ5 B;  1RTP 1;  1S26 D;  3F45 A;  1TRF A;  4D1E A;  3DZT A;  1E8A A;  1BR1 B;  5ER5 A;  3R1O A;  1DJZ A;  3SS4 A;  3B87 A;  1JBA A;  1UHH A;  2I94 A;  4MSP A;  2LUC A;  1RJV A;  1S1E A;  3DY9 A;  1GQM A;  2WCE A;  3LK1 A;  4PE4 A;  1CNP A;  2MA2 A;  3WHT B;  1B9A A;  3EKJ A;  1NPQ A;  4HRE E;  4DIR A;  1UHK A;  4INW A;  1IG5 A;  1QLS A;  2MLF C;  2BNX A;  1PRW A;  3QRX A;  5AAN A;  1B1G A;  4AQI A;  1L2O C;  4QJ3 B;  4C0K A;  4E68 A;  4YGD B;  1EJ3 A;  2VRG A;  3RM1 A;  2LMU A;  3L4L A;  4HSZ A;  2NCP A;  4MZL A;  2L98 A;  3EKH A;  1J1E A;  3N7H A;  3OX6 A;  1OMR A;  1YUU A;  2BE6 A;  1BG1 A;  2LLS A;  1S3P A;  1VRK A;  1YUT A;  3EK4 A;  2H2K A;  1K93 D;  3PAL A;  2L50 A;  5IBW A;  1SR6 C;  4R1E A;  2KLD A;  1KCY A;  3FWB A;  2QAC A;  1SK6 D;  1A2X A;  1K96 A;  1QV0 A;  1TN4 A;  3OB1 B;  2QEV A;  3NXA A;  5FYX A;  1BJF A;  1JSA A;  3NGV A;  4MZK A;  4XJK B;  5I2O A;  2BAP A;  1RWY A;  2OTG B;  1GJY A;  3CR5 X;  1OSA A;  2G9B A;  3CYZ A;  2FOT A;  3D75 A;  3PJI A;  2HF5 A;  3SIB A;  2JPO A;  1KFX L;  3PN7 C;  1DJW A;  3Q8I A;  1SNL A;  4A4C A;  5KSZ A;  3I5H B;  3CZT X;  4P5O E;  3BJH A;  1SKT A;  3HCM A;  2KHN A;  2KOT A;  3RLZ A;  1BF5 A;  4CFQ A;  1KK8 B;  1CMG A;  1AVS A;  4YBH B;  3B86 A;  1V1F A;  4PHK A;  3ZNI A;  4PAL A;  1KK7 Z;  2WC6 A;  3S0A A;  1Y1A A;  1QV1 A;  2O60 A;  2Q4U A;  3CGA A;  1K8U A;  5JJG A;  1W7J B;  4DUQ A;  2JUL A;  2L4H A;  2PAS A;  3BUM B;  2F2P A;  1X02 A;  3PAT A;  1QLK A;  2FJU B;  1JUO A;  4YGE B;  3IQQ A;  4GGN A;  2M97 A;  1KFU S;  3FE9 A;  4MRY A;  4HRG A;  2E30 A;  3EG5 B;  1NIW A;  1F8H A;  1XO5 A;  3DYE A;  3SIA A;  1EG4 A;  1DJI A;  1F54 A;  1B8R A;  2F2O A;  3FE6 A;  1REC A;  1NWD A;  1TOP A;  3EVV A;  1W7I B;  1TWO A;  3O78 A;  2L51 A;  5D7F A;  3WXA A;  5AFP A;  1KK7 Y;  2V53 A;  1AK8 A;  5DKN A;  5HKW A;  4CLN A;  1ZOT B;  3LCP C;  1L2O B;  1DF0 A;  1YX8 A;  5F6T A;  2L0P A;  1IJ6 A;  1OOH A;  3A8R A;  5FI6 A;  1OW4 A;  3NSL A;  3O4X A;  1XFY O;  2NZ0 A;  4NDB A;  2BL0 C;  3BFB A;  2NLN A;  1DJG A;  4PHM A;  3VRP A;  2Y1M A;  2BE4 A;  2KFH A;  2BKI B;  1YRT B;  1SR6 B;  5DIC A;  1F4Q A;  1QIW A;  2CXJ A;  3TDI A;  1HQV A;  1YUS A;  3BYA A;  4GPL B;  2H61 C;  3DVM A;  3S0B A;  2GV5 A;  1SL8 A;  4UPG A;  1AUI B;  4L9M A;  1MXL C;  4PE0 A;  1QX2 A;  2P6B B;  2M8U A;  3LLE A;  4TNC A;  2LE9 B;  1WRK A;  4M2P A;  1BU3 A;  1K9P A;  1QX5 B;  3AAK A;  2LUX A;  1OZS A;  2K8M B;  1CFF A;  2JTZ A;  2ZND A;  3KEV A;  4JKT A;  2LP3 A;  2OS8 C;  3AKA A;  3PN7 B;  1CB1 A;  1S6J A;  5CSF A;  1K9K A;  2LLU A;  3K1E A;  1NCZ A;  5PAL A;  3D77 A;  2AMI A;  1PVA A;  1RRO A;  2K60 A;  2WOS A;  3LL8 B;  1DMO A;  1NX1 A;  4F0Z B;  2LHL A;  4FQO A;  1TNQ A;  2K7B A;  3TUY C;  1CMF A;  2PVB A;  1QWV A;  2LVJ A;  2JT0 A;  4PE7 A;  1CDL A;  1Y6W A;  1DJY A;  2H61 A;  1TNW A;  2I18 A;  1NCX A;  2WCH A;  1M45 A;  3IF7 A;  2JXL A;  3I5I C;  1N2D A;  2PMY A;  2CT9 A;  2CCM A;  3R1V A;  4OV2 A;  4C0L A;  3SG3 A;  2JT3 A;  1KK8 C;  3AAJ A;  3ICB A;  1CDM A;  4PT1 A;  1WRZ A;  2RGI A;  4OVN F;  1P28 A;  1YRU B;  4M2O A;  2Q91 A;  1WDC C;  3VRN A;  1B7T Z;  1KWO C;  1YUR A;  1IRJ A;  2ZFD A;  1T14 A;  1PAL A;  1GM0 A;  3SG7 A;  1EXR A;  1J1D A;  1J7O A;  1N0Y A;  1C3Y A;  2BL0 B;  1CLB A;  1R6P A;  3OX5 A;  3OHM B;  4WQ2 A;  1J7Q A;  4GGF C;  4XJK A;  1SSE B;  4ORC B;  1NX3 A;  2LVI A;  2R2I A;  1DVI A;  3HX4 A;  4AQJ A;  2M29 A;  2MRD A;  4CPV A;  1B7T Y;  1A75 B;  2DOQ A;  3PFV A;  2WCM A;  3FS7 A;  2AAO A;  1S36 A;  1FI5 A;  2H8V A;  2FCD A;  2ZKM X;  1MUX A;  1UUR A;  4YRU A;  2OS8 B;  2KFG A;  1CFP A;  3CR4 X;  1DGV A;  5HLO A;  3L47 A;  4I5J A;  2QEH A;  2I2R E;  1C3Z A;  1IGV A;  1CFD A;  1BR4 B;  4CID A;  3O2P A;  2ZNE A;  4PCW A;  2LM5 A;  1HT9 A;  1KSO A;  1YX7 A;  2K0J A;  2PRU A;  3TUY B;  1G33 A;  2KAX A;  1IKU A;  1SBJ A;  1A29 A;  2WCK A;  1QXP A;  4FTG A;  1QS7 A;  3S0G A;  1JFJ A;  1F70 A;  2LAP A;  1CKK A;  2M1K B;  3SG4 A;  1F71 A;  2LCP A;  2O5G A;  3BUX B; 
#chains in the Genus database with same CATH homology
 3S0D A;  4FQT A;  3R1P A;  1OOH A;  1OW4 A;  1ORG A;  2WC5 A;  1DQE A;  3BFB A;  1OOG A;  1TUJ A;  2KPH A;  2QEB A;  3CAB A;  3NHT A;  5DIC A;  2QDI A;  2PQL A;  3S0B A;  3BFA A;  3OGN A;  3B88 A;  2WCJ A;  3D73 A;  2WCL A;  1OOF A;  2P71 A;  2P70 A;  3VB1 A;  3DZT A;  3K1E A;  3R1O A;  3D77 A;  3B87 A;  3DY9 A;  3S0E A;  2GTE A;  2L2C A;  1QWV A;  3S0F A;  4INW A;  2ERB A;  2WCH A;  3R1V A;  3V2L A;  4PT1 A;  3L4L A;  3NHI A;  1P28 A;  3N7H A;  3BFH A;  3B7A A;  1T14 A;  1GM0 A;  1XFR A;  3R72 A;  3CZ1 A;  4INX A;  1C3Y A;  1LS8 A;  2QEV A;  3B6X A;  3NGV A;  3D74 A;  4OZD A;  3PJI A;  3D75 A;  3CYZ A;  3CZ0 A;  2JPO A;  3Q8I A;  3RZS A;  2WCM A;  3BJH A;  1OOI X;  3QME A;  2QEO A;  3CZ2 A;  2H8V A;  2FJY A;  3B86 A;  3L4A A;  4F7F A;  3S0A A;  2WC6 A;  3L47 A;  3DXL A;  2QEH A;  3D76 A;  1C3Z A;  3CDN A;  3FE9 A;  3DYE A;  3S0G A;  2WCK A;  3FE8 A;  3D78 A;  3FE6 A;  5EL2 A;  1TWO A;  4JD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...