1FW4A

Crystal structure of e. coli fragment tr2c from calmodulin to 1.7 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
SEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords CALMODULIN
publication title Structure of Escherichia coli fragment TR2C from calmodulin to 1.7 A resolution.
pubmed doi rcsb
source organism Bos taurus
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2000-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fw4A00
2KNEA 1AVSA 1A29A 4GGNA 3BUMB 1SCMC 4C0LA 2HQ8A 2OPOA 3JTDC 1ODBA 4JWQA 1S5GY 2L0PA 2H61A 2CTNA 2JT0A 3PATA 2A4JA 1AUIB 1M63B 1M45A 1CFFA 1FBVA 2V53A 2MBXA 3K21A 3MSEB 3PN7C 1A75B 2CXJA 2JPTA 1IWQA 3KF9A 3NSLA 3VRPA 1F4OA 5AERA 1F55A 2M9GA 4OVNF 2MHHA 4YGDB 5GQQC 1Y1UA 1JFJA 1JSAA 1BR4B 3AAKA 4M2OA 2SCPA 4XYNA 1KCYA 1S6CA 3SG7A 1AJ5A 1ZMZA 1SL9A 1BMOA 3PN7B 5DKNA 1NX3A 2ZRSA 3JVTC 5IBWA 2K2AA 3D10A 3D0YA 4HREE 1BJFA 2KQYA 2LANA 4QJ4B 2CBLA 2KI4C 1SL8A 3FWBA 1KK7Z 2MLFC 4YI8A 4M2QA 3BOWB 1U5IB 4BY5A 3PM8A 1UUSA 2LE9B 1XO5A 1CM4A 5JJGA 1QIVA 1YVLA 1CM1A 2M29A 2Y4QA 1B8RA 2BBNA 2JWWA 3I5GB 1ZACA 1PRWA 3O6BA 1NX2A 4ORCB 1G8IA 2JU0A 4YBHB 1RWYA 1C7WA 2KDHA 4OKHA 1NX1A 2PVBA 1MXLC 5DKRA 4GPLB 1AK8A 5HLOA 1OZOA 2KFFA 2VRGA 2ZRTA 4U8DA 1RJVA 5CSNA 1F71A 2LLSA 1K2HA 2KOTA 2I7AA 1JBAA 4MN0A 1SYMA 2NCPA 4NDCA 2RGIA 2FOTA 3OB2B 4I5KA 1WRZA 1QJTA 2KAXA 1NYAA 1QTXA 1HQVA 1LXFC 1V1FA 2M1UA 4QJ5B 2G2BA 3SG2A 1F4QA 4HRHA 1JFKA 4L9MA 1KFUS 2I18A 1SKTA 1VRKA 4F0ZB 1EXRA 4YGEB 2TN4A 2QPTA 2M97A 1CMFA 3I5FC 3WHTB 3DVEA 2OTGB 1MHOA 4MRXA 4OCIA 1UHKA 1NWDA 5CSFA 3PALA 1MWNA 1QLKA 1KK8C 1XA5A 1WLMA 1GGWA 1LA0A 2ZFDA 3FIAA 3EK7A 2NZ0A 3D0YB 4I5LB 4YGAA 4QJ3B 1KK7Y 3SG5A 2P6BB 1RROA 1BT6A 2FJUB 2JXLA 2L4IA 2PALA 3I5FB 4MRYA 2KGBC 1QASA 5HKZA 4NDDA 1XFVO 4HRGA 1DF0A 5G08A 1DJXA 1LA3A 2LMUA 1Q80A 2JC2A 2D8NA 1SNLA 3CS1A 1SR6C 1ZFSA 1ZOTB 1B9AA 1AP4A 2AUCA 3DVKA 1YX7A 3GK1A 1DT7B 3OX5A 1QV1A 4MZKA 3ZNIA 1SCVA 3AAJA 1JUOA 2LMVA 1CDNA 2LP2A 1XFXO 1N65A 3O4YA 2KYCA 2CNPA 2ZNDA 2LMTA 4WRIA 5F6TA 2PRUA 2K61A 2SASA 2HQWA 2B1UA 2WNDA 2KSPA 2IS9A 3KPXA 4C0KA 1SPYA 4FQOA 1IQ5A 2EHBA 1SW8A 1N2DA 3FWCA 1NCYA 1EH2A 4ORAB 1TNWA 1MR8A 4MZJA 2GV5A 3SG6A 1B1GA 2JRFA 5FYXA 2G9BA 1OE9B 4IL1A 1NSHA 3BYAA 5KTYA 1J7QA 1JC2A 2WCFA 4CLNA 1GGZA 4JQ0D 1DJGA 1K9KA 1SCMB 1LINA 5JOLA 2KFHA 1H4BA 2MAZA 3JTDB 3EK4A 3H4SE 1QVIZ 1BLQA 3BUOB 2LC5A 4JPZB 1OMRA 2BKHB 3C1VA 1OOJA 1A03A 1S1EA 2WC8A 2BE4A 2JQ6A 4PE7A 4WQ2A 2JOJA 1KQMC 1ZUZA 3ICBA 2R2IA 1RK9A 2WCEA 1DF0B 2F8PA 2BECA 1KSOA 1B7TZ 1A2XA 2JULA 5HLVA 2I94A 4DIRA 3OHMB 1J1DA 3RLZA 2L5XB 1ALVA 1DJYA 3BUNB 1TTXA 3I5IC 5ER4X 1HT9A 1EL4A 2NLNA 5CPVA 3JVTB 2BCXA 4D1EA 3PFVA 2HF5A 2Q4UA 4PE1A 3CTNA 4AQIA 1TIZA 2M3WA 1OZSA 2KGRA 1QIWA 1TNQA 2KI4B 2OS8C 3M0WA 5J3XA 2BBMA 1YUSA 1DGVA 4AOMA 1GJYA 4MVFA 1MXEA 2LNKA 4MZLA 4P2YB 4DCKA 1PALA 1OMVA 1S3PA 1TCOB 3NSKA 1DJIA 2K8MB 2M49B 4PCWA 3NSOA 5B8IB 4AQJA 5I2OA 1QS7A 4TNCA 3LK0A 3IF7A 4ORBB 4HSZA 3SG3A 3DVMA 1QX5B 2MRDA 1XFWO 1R6PA 1K90D 2Y1MA 1NX0A 1CFCA 3LK1A 4GBAA 3WNXB 1DTLA 3SJSA 1QLSA 3F45A 3DVJA 1NIWA 1QVIY 1D1OA 2LLUA 2Q91A 1V1GA 4PHJA 2JNXA 4A4CA 1CNPA 2H2KA 1WRLA 1F8HA 2F3ZA 1FW4A 2CT9A 2F2OA 5AEQA 4PE0A 3EVRA 5ER5A 5CSJA 1KQVA 1JF0A 2KI6D 2M8UA 1SBJA 4PALA 3EK8A 1B7TY 1QX2A 1QX7A 2Y1NA 2K7OA 5AFPA 1TCFA 1RECA 2M1KB 1KSMA 2WORA 4R1EA 4PHNA 1QATA 2JZIA 2MJWB 2F33A 1UHNA 1KK8B 4MSPA 1DVIA 2F3YA 3LLEA 1YRTB 4N5XA 1SK6D 5I8NA 1UP5A 3O2PA 2JTZA 4PE4A 1CFPA 4CFQA 3SIBA 1BODA 1XK4A 4Q04A 3RM1A 1K9UA 1J1EA 1DMOA 1AHRA 3IQOA 4OR9B 4PHKA 2BE6A 3SG4A 2MLEC 2LV7A 2BCAA 2ZN8A 3KHEA 1B47A 2LLTA 1SL7A 3TDIA 1JF2A 1SR6B 1YURA 1J55A 1G33A 2KHNA 4GUKA 3GK4X 3CZTX 3TDZA 2KAYA 1Y0VH 2WOSA 3BOWA 1IG5A 1X02A 2LVJA 3DD4A 2KAVA 4ETOA 1TRFA 2AAOA 1M31A 2K7DA 4E68A 1QV0A 3ZWHA 1KFXL 3KEVA 1YVHA 1XYDA 1NUBA 3OB1B 2LP3A 2HPSA 1BOCA 1BU3A 1TN4A 4USLA 3LL8B 4MLWA 1C7VA 2K0JA 3NXAA 5AXIA 1RTP1 3CGAA 3BUWB 2LUCA 4P5OE 3A4UB 3A8RA 4MBEA 1S6IA 4YGBB 1F54A 1K94A 2GGMA 1CDPA 4OV2A 1H8BA 2JNFA 2KYFA 1NCXA 4N1GA 1W7IB 1MQ1A 5HYDA 2L4HA 3FS7A 3OP0A 4DRWA 1JWDA 4I5JA 1DJWA 1XK4C 5AANA 1IGVA 1UHHA 4GGFA 2ZNEA 1K93D 3TS5C 3I5HC 1Y1AA 4WQ3A 1R2UA 4GNKB 2M7LA 4CPVA 1FF1A 1UHJA 1AJ4A 2LVKA 2BCBA 3BXKA 4A4BA 1RFJA 2EC6C 2LHIA 2ZN9A 3PLFB 4NDBA 4YGCB 4CIDA 1SRAA 3TDUA 3TUYC 1MF8B 1WRKA 2QACA 1YTZC 3CWGA 5DKQA 1K96A 3VGOA 1CLMA 1J7RA 1Y6WA 3PSRA 4PHMA 1Y1XA 1KQMB 1OQPA 1EG4A 2M7NA 3BQ3A 2M0RA 3TS5B 2KI6C 3I5HB 1IQ3A 5HKYA 3BUXB 1OMDA 4GFTA 2L98A 2JT8A 2K2FA 3E3RA 3GOFA 2EC6B 3I5GC 4UPGA 5CSIA 3TUYB 1A4PA 2NXQA 1J7PA 2BKIB 2LUXA 1C07A 3I5IB 1WY9A 2HETA 4GAOA 3EVUA 1FI6A 5BPJA 1QXPA 2E30A 3LCPC 2L50A 2Y5IA 2K7CA 1CB1A 1CDLA 3CR2A 1NPQA 2LVIA 2OS8B 1M46A 1CTRA 1UHIA 1DJZA 1EJ3A 3GK2A 2LVVA 2PMYA 1TNXA 2WCBA 3VROA 5TNCA 1PVBA 3CR5X 4ZCUA 4CFRA 2KBIA 2GGZA 2H61C 4GGFC 1BG1A 1SMGA 2EGDA 2CCMA 1KWOC 1S26D 3CLNA 2F2PA 4XJKA 3EKHA 1PK0D 1ALWA 1XVJA 1YRUB 2ISDA 2L51A 4YI9A 1MUXA 1XFYO 3VRRA 2LCPA 3VRNA 4C0JA 1FPWA 1UURA 3DF0A 1G4YR 1GQMA 1K8UA 1K9PA 2NCOA 4ZCVA 1YUUA 2JXCA 1EG3A 3TZ1A 3EVVA 1IJ5A 2PASA 1KWOB 2OTGC 1PULA 5I2QA 2LAPA 5D69A 1DGUA 1YUTA 5I2LA 1B8CA 2AMIA 1S5GZ 1SY9A 3OX6A 1K95A 1PVAA 1XFUO 1IRJA 1CLLA 3WXAA 1OSAA 2E6WA 1IJ6A 2KQ6A 4DS7A 4FTGA 5K89A 1A75A 1L2OC 1BR1B 1YR5A 1F70A 4BY4A 1KFUL 1W7JB 5KU1A 1WLZA 3SIAA 3WHUB 5PALA 1CDMA 2L2EA 1DJHA 1FI5A 1TOPA 1B8LA 1NP8A 3EKJA 2I2RE 1PSRA 3AKAA 4M2PA 1N0YA 1PSBA 1S6JA 4PDZA 1IH0A 4N1FA 1UWOA 1L7ZA 2O5GA 3IQQA 2COLB 2K7BA 3VRQA 1YX8A 1L2OB 2DOQA 3NSIA 1TNPA 2KFGA 1KFXS 2LHLA 4NQGA 2BL0C 1BF5A 1M39A 2JTTA 2PSRA 2O60A 3HCMA 1NCZA 4ICBA 1LKJA 2LM5A 3CR4X 1U5IA 1B4CA 2MA2A 4YRUA 1CFDA 5KSZA 4I5NB 1E8AA 1WDCC 2ZKMX 3QRXA 2KBMA 1S36A 4XJKB 1IKUA 3HX4A 5HKWA 3AKBA 2FCEA 2BL0B 1XFZO 3KO0A 3O78A 5D7FA 1CKKA 1CLBA 3DF0B 4DUQA 4MEWA 2JT3A 2FCDA 1LVCD 1J7OA 1WDCB 1CMGA
chains in the Genus database with same CATH superfamily
2KNEA 1AVSA 1A29A 4GGNA 3BUMB 1SCMC 4C0LA 2HQ8A 2OPOA 3JTDC 1ODBA 3N7HA 4JWQA 1S5GY 2L0PA 2H61A 2CTNA 2JT0A 3PATA 2A4JA 3RZSA 1AUIB 1M63B 1M45A 1CFFA 1FBVA 2V53A 2MBXA 3K21A 3MSEB 3PN7C 1A75B 2CXJA 2JPTA 1IWQA 3KF9A 3NSLA 3VRPA 1F4OA 5AERA 1F55A 2M9GA 3R1PA 3NGVA 4OVNF 3B6XA 2MHHA 4YGDB 5GQQC 1Y1UA 1JFJA 1JSAA 1BR4B 3AAKA 1C3ZA 4M2OA 2SCPA 1T14A 4XYNA 1KCYA 3UO9A 1S6CA 3SG7A 1AJ5A 1ZMZA 1SL9A 2WCKA 1BMOA 3PN7B 3R1OA 4INXA 5DKNA 1NX3A 2ZRSA 3JVTC 5IBWA 2K2AA 3D10A 3D0YA 4HREE 1BJFA 2KQYA 2LANA 4FQTA 4QJ4B 2CBLA 2KI4C 1SL8A 3FWBA 1KK7Z 2MLFC 4YI8A 4M2QA 3BOWB 5FI6A 1U5IB 4BY5A 3PM8A 1UUSA 2LE9B 1XO5A 1CM4A 5JJGA 1QIVA 1YVLA 1CM1A 2M29A 2Y4QA 3CABA 1B8RA 2BBNA 1Z2CB 2JWWA 3I5GB 3S0DA 1ZACA 3D75A 1PRWA 3O6BA 1NX2A 4ORCB 1G8IA 3V2LA 2JU0A 4YBHB 1RWYA 1C7WA 2KDHA 4OKHA 1NX1A 2PVBA 1MXLC 5DKRA 4GPLB 1AK8A 5HLOA 1OZOA 1LS8A 2KFFA 2VRGA 2ZRTA 3O4XA 4U8DA 1RJVA 5CSNA 1F71A 2LLSA 1K2HA 2KOTA 2I7AA 1JBAA 4MN0A 1SYMA 2NCPA 1TUJA 4NDCA 2RGIA 2QDIA 2FOTA 3OB2B 4I5KA 1WRZA 1QJTA 2KAXA 1NYAA 1QTXA 1HQVA 1LXFC 1V1FA 2M1UA 4QJ5B 2G2BA 3SG2A 1F4QA 4HRHA 1JFKA 4L9MA 1KFUS 2I18A 1SKTA 1VRKA 4F0ZB 1EXRA 4YGEB 2TN4A 2QPTA 2M97A 1CMFA 3BJHA 3I5FC 3WHTB 3DVEA 2OTGB 1MHOA 4MRXA 4OCIA 1UHKA 5EL2A 1NWDA 2H8VA 2GTEA 3L4LA 1MWNA 1QLKA 1KK8C 3PALA 1XA5A 5CSFA 1WLMA 1GGWA 1LA0A 2ZFDA 3FIAA 3EK7A 2NZ0A 3D0YB 4I5LB 4YGAA 4QJ3B 1KK7Y 3SG5A 2P6BB 3DY9A 1RROA 1BT6A 2FJUB 2JXLA 2L4IA 2PALA 3I5FB 4MRYA 2KGBC 1QASA 3BFHA 5HKZA 4NDDA 1XFVO 3DZTA 4HRGA 1DF0A 5G08A 1DJXA 1LA3A 2LMUA 1Q80A 2JC2A 2D8NA 3PJIA 1SNLA 3CS1A 1SR6C 1ZFSA 1ZOTB 1B9AA 1AP4A 2AUCA 3DVKA 1YX7A 2WCMA 3GK1A 1DT7B 3OX5A 1QV1A 4MZKA 3ZNIA 1SCVA 4PT1A 1OOIX 3AAJA 4OZDA 1JUOA 2LMVA 2P71A 1CDNA 2LP2A 1XFXO 1N65A 3O4YA 2KYCA 2CNPA 2ZNDA 2LMTA 3NHIA 4WRIA 5F6TA 2PRUA 1ORGA 2K61A 2SASA 5D3OA 3EG5B 2HQWA 2B1UA 2WNDA 2KSPA 2IS9A 3KPXA 1TWOA 4C0KA 1SPYA 4FQOA 1IQ5A 2EHBA 1SW8A 1N2DA 3OBVA 3FWCA 1NCYA 1EH2A 4ORAB 1TNWA 1MR8A 4MZJA 2GV5A 3SG6A 1B1GA 2JRFA 5FYXA 2G9BA 1OE9B 4IL1A 2L5YA 1NSHA 3BYAA 5KTYA 2QEHA 1J7QA 1JC2A 2WCFA 4CLNA 1GGZA 4JQ0D 1DJGA 1K9KA 3D74A 1SCMB 1LINA 5JOLA 2KFHA 1H4BA 2MAZA 3JTDB 3EK4A 3H4SE 1QVIZ 3R1VA 1BLQA 2BAPA 2LC5A 3BUOB 3SS4A 4JPZB 1OMRA 2BKHB 3C1VA 3FE8A 1OOJA 1A03A 1S1EA 2WC8A 2BE4A 2ERBA 2JQ6A 4PE7A 4WQ2A 1IIOA 2JOJA 1KQMC 1ZUZA 3ICBA 2R2IA 4KYNA 3S0AA 1RK9A 2WCEA 1DF0B 2F8PA 2BECA 1KSOA 1B7TZ 2PYQA 1A2XA 2JULA 5HLVA 2I94A 4DIRA 3OHMB 1J1DA 3RLZA 2L5XB 1ALVA 1DJYA 3BUNB 1TTXA 3B88A 3I5IC 5ER4X 1HT9A 1EL4A 3VB1A 2NLNA 5CPVA 3JVTB 2BCXA 4D1EA 3PFVA 2HF5A 2Q4UA 3CZ1A 4PE1A 3CTNA 4AQIA 1TIZA 2M3WA 1OZSA 2KGRA 1QIWA 1TNQA 2KI4B 2KPHA 2OS8C 3M0WA 5J3XA 2BBMA 1YUSA 2YGUA 1DGVA 3CDNA 4AOMA 1GJYA 4MVFA 3DXLA 1MXEA 2LNKA 3QMEA 4MZLA 4P2YB 4DCKA 1PALA 2WC6A 1OMVA 1S3PA 1TCOB 3NSKA 1DJIA 2K8MB 2M49B 4PCWA 3NSOA 2JPOA 5B8IB 2WCLA 4AQJA 5I2OA 1QS7A 2P70A 4TNCA 1P28A 3LK0A 3IF7A 4ORBB 4HSZA 3SG3A 3DVMA 1QX5B 2MRDA 1XFWO 1R6PA 1K90D 2Y1MA 1NX0A 1CFCA 3LK1A 4GBAA 3WNXB 1DTLA 3SJSA 1QLSA 3F45A 3DVJA 1NIWA 1QVIY 1D1OA 3K1EA 2LLUA 3CYZA 2Q91A 1V1GA 4PHJA 4JD9A 2JNXA 4A4CA 2WCJA 1CNPA 2H2KA 1WRLA 1F8HA 2F3ZA 1FW4A 2CT9A 2F2OA 1DEKA 5AEQA 4PE0A 3EVRA 5ER5A 5CSJA 1KQVA 1JF0A 2KI6D 2M8UA 1SBJA 4PALA 3EK8A 1B7TY 1QX2A 1QX7A 2Y1NA 3B86A 2K7OA 5AFPA 1TCFA 1RECA 2M1KB 1KSMA 2WORA 4R1EA 1QWVA 4PHNA 1QATA 2JZIA 2MJWB 3SS5A 2F33A 1UHNA 1KK8B 4MSPA 1DVIA 2F3YA 3CZ2A 3LLEA 1YRTB 4N5XA 1SK6D 5I8NA 1UP5A 3O2PA 2JTZA 4PE4A 5DICA 1CFPA 4CFQA 3SIBA 1BODA 1XK4A 4Q04A 3RM1A 1K9UA 1J1EA 1DMOA 1AHRA 3IQOA 4OR9B 4PHKA 2BE6A 3SG4A 2MLEC 2WCHA 2LV7A 2BCAA 2ZN8A 3KHEA 1B47A 1TUZA 2LLTA 1SL7A 5I94A 2FJYA 3TDIA 1JF2A 1SR6B 1YURA 1J55A 1G33A 2KHNA 4GUKA 3GK4X 3CZTX 3Q8IA 3TDZA 3UNWA 2KAYA 1Y0VH 2WOSA 3BOWA 1IG5A 1X02A 2LVJA 3DD4A 2KAVA 4ETOA 1TRFA 2AAOA 1M31A 2K7DA 3BFAA 4E68A 1GM0A 1QV0A 3ZWHA 1KFXL 1OOHA 1YVHA 1XYDA 2PQLA 3KEVA 3D76A 3SS3A 1NUBA 3OB1B 2LP3A 2HPSA 1BOCA 1BU3A 1TN4A 4USLA 1W9ZA 3LL8B 2L2CA 4MLWA 3OGNA 3R72A 1C7VA 2K0JA 3NXAA 5AXIA 1RTP1 3CGAA 3BUWB 4IJ7A 2LUCA 4P5OE 3A4UB 3A8RA 4MBEA 3CZ0A 1S6IA 4YGBB 1F54A 1K94A 2GGMA 1CDPA 4OV2A 1H8BA 2JNFA 2KYFA 1NCXA 4N1GA 1W7IB 1MQ1A 5HYDA 2L4HA 3FS7A 3OP0A 4DRWA 1JWDA 4I5JA 1DJWA 1XK4C 5AANA 1C3YA 1IGVA 1UHHA 4GGFA 2ZNEA 3DYEA 3D77A 1K93D 3TS5C 3I5HC 1Y1AA 4WQ3A 1R2UA 4GNKB 2M7LA 4CPVA 1FF1A 1UHJA 1AJ4A 2LVKA 2BCBA 3BXKA 4A4BA 1RFJA 2EC6C 2LHIA 2ZN9A 3PLFB 4NDBA 4YGCB 3S0EA 1SRAA 4CIDA 3TDUA 3TUYC 1MF8B 1WRKA 2QACA 1YTZC 3CWGA 5DKQA 1K96A 3VGOA 1CLMA 1J7RA 1Y6WA 3PSRA 4PHMA 1Y1XA 1KQMB 1OQPA 1EG4A 1OW4A 2M7NA 2M0RA 3B7AA 2KI6C 3BQ3A 3I5HB 3PM2A 3TS5B 5HKYA 3BUXB 2QEBA 1OMDA 2QEOA 4GFTA 2L98A 2JT8A 2K2FA 3E3RA 3GOFA 1DELA 2EC6B 3I5GC 4UPGA 1IQ3A 5CSIA 3TUYB 1A4PA 2NXQA 1J7PA 2BKIB 2LUXA 1C07A 3I5IB 1WY9A 2HETA 4GAOA 3EVUA 3S0FA 1FI6A 5BPJA 1QXPA 2E30A 3LCPC 3S0BA 2L50A 2Y5IA 2K7CA 3IVTA 1CB1A 1CDLA 3CR2A 3NHTA 1NPQA 2LVIA 2OS8B 1M46A 1CTRA 3D78A 3BFBA 1UHIA 2K60A 1DJZA 1EJ3A 3GK2A 2LVVA 2PMYA 1TNXA 2WCBA 3VROA 5TNCA 1PVBA 1Z4HA 3CR5X 4ZCUA 4CFRA 2KBIA 2GGZA 2H61C 4GGFC 1BG1A 1SMGA 2EGDA 1KWOC 2CCMA 1S26D 3CLNA 2F2PA 4XJKA 3EKHA 1PK0D 1ALWA 1XVJA 1YRUB 2ISDA 2L51A 4YI9A 1MUXA 1XFYO 3VRRA 2LCPA 3VRNA 4C0JA 1FPWA 1UURA 3DF0A 1G4YR 1DQEA 1GQMA 1K8UA 1K9PA 2NCOA 4ZCVA 1YUUA 2JXCA 1EG3A 3TZ1A 3EVVA 1IJ5A 2PASA 1KWOB 2OTGC 1OOGA 1PULA 3L4AA 5I2QA 2LAPA 5D69A 1DGUA 1YUTA 5I2LA 1B8CA 2AMIA 1S5GZ 1SY9A 3OX6A 5FI2A 1K95A 1PVAA 1XFUO 1IRJA 1CLLA 3WXAA 4INWA 1OOFA 1OSAA 2E6WA 1IJ6A 2KQ6A 4JKTA 4DS7A 4FTGA 5K89A 3D73A 1A75A 1L2OC 1BR1B 1YR5A 1F70A 4BY4A 1KFUL 1W7JB 2KLEA 5KU1A 1WLZA 3SIAA 3WHUB 5PALA 1CDMA 2L2EA 1DJHA 1FI5A 1TOPA 1B8LA 1NP8A 3EKJA 2I2RE 1PSRA 3AKAA 4M2PA 1N0YA 1PSBA 1S6JA 4PDZA 4F7FA 4N1FA 1UWOA 1IH0A 1L7ZA 2O5GA 1SSEB 2COLB 2K7BA 3IQQA 3VRQA 1YX8A 1L2OB 2DOQA 3NSIA 2QEVA 1TNPA 2KFGA 1KFXS 2LHLA 4NQGA 2BL0C 1BF5A 1M39A 2JTTA 3B87A 3L47A 2PSRA 2O60A 3HCMA 1NCZA 4ICBA 1LKJA 2LM5A 3CR4X 1U5IA 1XFRA 2BNXA 1B4CA 2MA2A 4YRUA 1CFDA 5KSZA 1DC1A 4I5NB 1E8AA 1WDCC 2ZKMX 3QRXA 2KBMA 1S36A 4XJKB 1IKUA 3HX4A 3FE9A 3AKBA 5HKWA 2FCEA 2BL0B 5HL1A 5FI7A 1XFZO 2WC5A 3KO0A 3O78A 5D7FA 1CKKA 1CLBA 3DF0B 3S0GA 4DUQA 4MEWA 2JT3A 2FCDA 1LVCD 3FE6A 2KLDA 1J7OA 1WDCB 1CMGA
chains in the Genus database with same CATH topology
2KNEA 1AVSA 1A29A 4GGNA 3BUMB 1SCMC 4C0LA 2HQ8A 2OPOA 3JTDC 1ODBA 4JWQA 1S5GY 2L0PA 2H61A 2CTNA 2JT0A 3PATA 2A4JA 1AUIB 1M63B 1M45A 1CFFA 1FBVA 2V53A 2MBXA 3K21A 3MSEB 3PN7C 1A75B 2CXJA 2JPTA 1IWQA 3KF9A 3NSLA 3VRPA 1F4OA 5AERA 1F55A 2M9GA 4OVNF 2MHHA 4YGDB 5GQQC 1Y1UA 1JFJA 1JSAA 1BR4B 3AAKA 4M2OA 2SCPA 4XYNA 1KCYA 1S6CA 3SG7A 1AJ5A 1ZMZA 1SL9A 1BMOA 3PN7B 5DKNA 1NX3A 2ZRSA 3JVTC 5IBWA 2K2AA 3D10A 3D0YA 4HREE 1BJFA 2KQYA 2LANA 4QJ4B 2CBLA 2KI4C 1SL8A 3FWBA 1KK7Z 2MLFC 4YI8A 4M2QA 3BOWB 1U5IB 4BY5A 3PM8A 1UUSA 2LE9B 1XO5A 1CM4A 5JJGA 1QIVA 1YVLA 1CM1A 2M29A 2Y4QA 1B8RA 2BBNA 2JWWA 3I5GB 1ZACA 1PRWA 3O6BA 1NX2A 4ORCB 1G8IA 2JU0A 4YBHB 1RWYA 1C7WA 2KDHA 4OKHA 1NX1A 2PVBA 1MXLC 5DKRA 4GPLB 1AK8A 5HLOA 1OZOA 2KFFA 2VRGA 2ZRTA 4U8DA 1RJVA 5CSNA 1F71A 2LLSA 1K2HA 2KOTA 2I7AA 1JBAA 4MN0A 1SYMA 2NCPA 4NDCA 2RGIA 2FOTA 3OB2B 4I5KA 1WRZA 1QJTA 2KAXA 1NYAA 1QTXA 1HQVA 1LXFC 1V1FA 2M1UA 4QJ5B 2G2BA 3SG2A 1F4QA 4HRHA 1JFKA 4L9MA 1KFUS 2I18A 1SKTA 1VRKA 4F0ZB 1EXRA 4YGEB 2TN4A 2QPTA 2M97A 1CMFA 3I5FC 3WHTB 3DVEA 2OTGB 1MHOA 4MRXA 4OCIA 1UHKA 1NWDA 5CSFA 3PALA 1MWNA 1QLKA 1KK8C 1XA5A 1WLMA 1GGWA 1LA0A 2ZFDA 3FIAA 3EK7A 2NZ0A 3D0YB 4I5LB 4YGAA 4QJ3B 1KK7Y 3SG5A 2P6BB 1RROA 1BT6A 2FJUB 2JXLA 2L4IA 2PALA 3I5FB 4MRYA 2KGBC 1QASA 5HKZA 4NDDA 1XFVO 4HRGA 1DF0A 5G08A 1DJXA 1LA3A 2LMUA 1Q80A 2JC2A 2D8NA 1SNLA 3CS1A 1SR6C 1ZFSA 1ZOTB 1B9AA 1AP4A 2AUCA 3DVKA 1YX7A 3GK1A 1DT7B 3OX5A 1QV1A 4MZKA 3ZNIA 1SCVA 3AAJA 1JUOA 2LMVA 1CDNA 2LP2A 1XFXO 1N65A 3O4YA 2KYCA 2CNPA 2ZNDA 2LMTA 4WRIA 5F6TA 2PRUA 2K61A 2SASA 2HQWA 2B1UA 2WNDA 2KSPA 2IS9A 3KPXA 4C0KA 1SPYA 4FQOA 1IQ5A 2EHBA 1SW8A 1N2DA 3FWCA 1NCYA 1EH2A 4ORAB 1TNWA 1MR8A 4MZJA 2GV5A 3SG6A 1B1GA 2JRFA 5FYXA 2G9BA 1OE9B 4IL1A 1NSHA 3BYAA 5KTYA 1J7QA 1JC2A 2WCFA 4CLNA 1GGZA 4JQ0D 1DJGA 1K9KA 1SCMB 1LINA 5JOLA 2KFHA 1H4BA 2MAZA 3JTDB 3EK4A 3H4SE 1QVIZ 1BLQA 3BUOB 2LC5A 4JPZB 1OMRA 2BKHB 3C1VA 1OOJA 1A03A 1S1EA 2WC8A 2BE4A 2JQ6A 4PE7A 4WQ2A 2JOJA 1KQMC 1ZUZA 3ICBA 2R2IA 1RK9A 2WCEA 1DF0B 2F8PA 2BECA 1KSOA 1B7TZ 1A2XA 2JULA 5HLVA 2I94A 4DIRA 3OHMB 1J1DA 3RLZA 2L5XB 1ALVA 1DJYA 3BUNB 1TTXA 3I5IC 5ER4X 1HT9A 1EL4A 2NLNA 5CPVA 3JVTB 2BCXA 4D1EA 3PFVA 2HF5A 2Q4UA 4PE1A 3CTNA 4AQIA 1TIZA 2M3WA 1OZSA 2KGRA 1QIWA 1TNQA 2KI4B 2OS8C 3M0WA 5J3XA 2BBMA 1YUSA 1DGVA 4AOMA 1GJYA 4MVFA 1MXEA 2LNKA 4MZLA 4P2YB 4DCKA 1PALA 1OMVA 1S3PA 1TCOB 3NSKA 1DJIA 2K8MB 2M49B 4PCWA 3NSOA 5B8IB 4AQJA 5I2OA 1QS7A 4TNCA 3LK0A 3IF7A 4ORBB 4HSZA 3SG3A 3DVMA 1QX5B 2MRDA 1XFWO 1R6PA 1K90D 2Y1MA 1NX0A 1CFCA 3LK1A 4GBAA 3WNXB 1DTLA 3SJSA 1QLSA 3F45A 3DVJA 1NIWA 1QVIY 1D1OA 2LLUA 2Q91A 1V1GA 4PHJA 2JNXA 4A4CA 1CNPA 2H2KA 1WRLA 1F8HA 2F3ZA 1FW4A 2CT9A 2F2OA 5AEQA 4PE0A 3EVRA 5ER5A 5CSJA 1KQVA 1JF0A 2KI6D 2M8UA 1SBJA 4PALA 3EK8A 1B7TY 1QX2A 1QX7A 2Y1NA 2K7OA 5AFPA 1TCFA 1RECA 2M1KB 1KSMA 2WORA 4R1EA 4PHNA 1QATA 2JZIA 2MJWB 2F33A 1UHNA 1KK8B 4MSPA 1DVIA 2F3YA 3LLEA 1YRTB 4N5XA 1SK6D 5I8NA 1UP5A 3O2PA 2JTZA 4PE4A 1CFPA 4CFQA 3SIBA 1BODA 1XK4A 4Q04A 3RM1A 1K9UA 1J1EA 1DMOA 1AHRA 3IQOA 4OR9B 4PHKA 2BE6A 3SG4A 2MLEC 2LV7A 2BCAA 2ZN8A 3KHEA 1B47A 2LLTA 1SL7A 3TDIA 1JF2A 1SR6B 1YURA 1J55A 1G33A 2KHNA 4GUKA 3GK4X 3CZTX 3TDZA 2KAYA 1Y0VH 2WOSA 3BOWA 1IG5A 1X02A 2LVJA 3DD4A 2KAVA 4ETOA 1TRFA 2AAOA 1M31A 2K7DA 4E68A 1QV0A 3ZWHA 1KFXL 3KEVA 1YVHA 1XYDA 1NUBA 3OB1B 2LP3A 2HPSA 1BOCA 1BU3A 1TN4A 4USLA 3LL8B 4MLWA 1C7VA 2K0JA 3NXAA 5AXIA 1RTP1 3CGAA 3BUWB 2LUCA 4P5OE 3A4UB 3A8RA 4MBEA 1S6IA 4YGBB 1F54A 1K94A 2GGMA 1CDPA 4OV2A 1H8BA 2JNFA 2KYFA 1NCXA 4N1GA 1W7IB 1MQ1A 5HYDA 2L4HA 3FS7A 3OP0A 4DRWA 1JWDA 4I5JA 1DJWA 1XK4C 5AANA 1IGVA 1UHHA 4GGFA 2ZNEA 1K93D 3TS5C 3I5HC 1Y1AA 4WQ3A 1R2UA 4GNKB 2M7LA 4CPVA 1FF1A 1UHJA 1AJ4A 2LVKA 2BCBA 3BXKA 4A4BA 1RFJA 2EC6C 2LHIA 2ZN9A 3PLFB 4NDBA 4YGCB 4CIDA 1SRAA 3TDUA 3TUYC 1MF8B 1WRKA 2QACA 1YTZC 3CWGA 5DKQA 1K96A 3VGOA 1CLMA 1J7RA 1Y6WA 3PSRA 4PHMA 1Y1XA 1KQMB 1OQPA 1EG4A 2M7NA 3BQ3A 2M0RA 3TS5B 2KI6C 3I5HB 1IQ3A 5HKYA 3BUXB 1OMDA 4GFTA 2L98A 2JT8A 2K2FA 3E3RA 3GOFA 2EC6B 3I5GC 4UPGA 5CSIA 3TUYB 1A4PA 2NXQA 1J7PA 2BKIB 2LUXA 1C07A 3I5IB 1WY9A 2HETA 4GAOA 3EVUA 1FI6A 5BPJA 1QXPA 2E30A 3LCPC 2L50A 2Y5IA 2K7CA 1CB1A 1CDLA 3CR2A 1NPQA 2LVIA 2OS8B 1M46A 1CTRA 1UHIA 1DJZA 1EJ3A 3GK2A 2LVVA 2PMYA 1TNXA 2WCBA 3VROA 5TNCA 1PVBA 3CR5X 4ZCUA 4CFRA 2KBIA 2GGZA 2H61C 4GGFC 1BG1A 1SMGA 2EGDA 2CCMA 1KWOC 1S26D 3CLNA 2F2PA 4XJKA 3EKHA 1PK0D 1ALWA 1XVJA 1YRUB 2ISDA 2L51A 4YI9A 1MUXA 1XFYO 3VRRA 2LCPA 3VRNA 4C0JA 1FPWA 1UURA 3DF0A 1G4YR 1GQMA 1K8UA 1K9PA 2NCOA 4ZCVA 1YUUA 2JXCA 1EG3A 3TZ1A 3EVVA 1IJ5A 2PASA 1KWOB 2OTGC 1PULA 5I2QA 2LAPA 5D69A 1DGUA 1YUTA 5I2LA 1B8CA 2AMIA 1S5GZ 1SY9A 3OX6A 1K95A 1PVAA 1XFUO 1IRJA 1CLLA 3WXAA 1OSAA 2E6WA 1IJ6A 2KQ6A 4DS7A 4FTGA 5K89A 1A75A 1L2OC 1BR1B 1YR5A 1F70A 4BY4A 1KFUL 1W7JB 5KU1A 1WLZA 3SIAA 3WHUB 5PALA 1CDMA 2L2EA 1DJHA 1FI5A 1TOPA 1B8LA 1NP8A 3EKJA 2I2RE 1PSRA 3AKAA 4M2PA 1N0YA 1PSBA 1S6JA 4PDZA 1IH0A 4N1FA 1UWOA 1L7ZA 2O5GA 3IQQA 2COLB 2K7BA 3VRQA 1YX8A 1L2OB 2DOQA 3NSIA 1TNPA 2KFGA 1KFXS 2LHLA 4NQGA 2BL0C 1BF5A 1M39A 2JTTA 2PSRA 2O60A 3HCMA 1NCZA 4ICBA 1LKJA 2LM5A 3CR4X 1U5IA 1B4CA 2MA2A 4YRUA 1CFDA 5KSZA 4I5NB 1E8AA 1WDCC 2ZKMX 3QRXA 2KBMA 1S36A 4XJKB 1IKUA 3HX4A 5HKWA 3AKBA 2FCEA 2BL0B 1XFZO 3KO0A 3O78A 5D7FA 1CKKA 1CLBA 3DF0B 4DUQA 4MEWA 2JT3A 2FCDA 1LVCD 1J7OA 1WDCB 1CMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNE A;  1AVS A;  1A29 A;  4GGN A;  3BUM B;  1SCM C;  4C0L A;  2HQ8 A;  2OPO A;  3JTD C;  1ODB A;  4JWQ A;  1S5G Y;  2L0P A;  2H61 A;  2CTN A;  2JT0 A;  3PAT A;  2A4J A;  1AUI B;  1M63 B;  1M45 A;  1CFF A;  1FBV A;  2V53 A;  2MBX A;  3K21 A;  3MSE B;  3PN7 C;  1A75 B;  2CXJ A;  2JPT A;  1IWQ A;  3KF9 A;  3NSL A;  3VRP A;  1F4O A;  5AER A;  1F55 A;  2M9G A;  4OVN F;  2MHH A;  4YGD B;  5GQQ C;  1Y1U A;  1JFJ A;  1JSA A;  1BR4 B;  3AAK A;  4M2O A;  2SCP A;  4XYN A;  1KCY A;  1S6C A;  3SG7 A;  1AJ5 A;  1ZMZ A;  1SL9 A;  1BMO A;  3PN7 B;  5DKN A;  1NX3 A;  2ZRS A;  3JVT C;  5IBW A;  2K2A A;  3D10 A;  3D0Y A;  4HRE E;  1BJF A;  2KQY A;  2LAN A;  4QJ4 B;  2CBL A;  2KI4 C;  1SL8 A;  3FWB A;  1KK7 Z;  2MLF C;  4YI8 A;  4M2Q A;  3BOW B;  1U5I B;  4BY5 A;  3PM8 A;  1UUS A;  2LE9 B;  1XO5 A;  1CM4 A;  5JJG A;  1QIV A;  1YVL A;  1CM1 A;  2M29 A;  2Y4Q A;  1B8R A;  2BBN A;  2JWW A;  3I5G B;  1ZAC A;  1PRW A;  3O6B A;  1NX2 A;  4ORC B;  1G8I A;  2JU0 A;  4YBH B;  1RWY A;  1C7W A;  2KDH A;  4OKH A;  1NX1 A;  2PVB A;  1MXL C;  5DKR A;  4GPL B;  1AK8 A;  5HLO A;  1OZO A;  2KFF A;  2VRG A;  2ZRT A;  4U8D A;  1RJV A;  5CSN A;  1F71 A;  2LLS A;  1K2H A;  2KOT A;  2I7A A;  1JBA A;  4MN0 A;  1SYM A;  2NCP A;  4NDC A;  2RGI A;  2FOT A;  3OB2 B;  4I5K A;  1WRZ A;  1QJT A;  2KAX A;  1NYA A;  1QTX A;  1HQV A;  1LXF C;  1V1F A;  2M1U A;  4QJ5 B;  2G2B A;  3SG2 A;  1F4Q A;  4HRH A;  1JFK A;  4L9M A;  1KFU S;  2I18 A;  1SKT A;  1VRK A;  4F0Z B;  1EXR A;  4YGE B;  2TN4 A;  2QPT A;  2M97 A;  1CMF A;  3I5F C;  3WHT B;  3DVE A;  2OTG B;  1MHO A;  4MRX A;  4OCI A;  1UHK A;  1NWD A;  5CSF A;  3PAL A;  1MWN A;  1QLK A;  1KK8 C;  1XA5 A;  1WLM A;  1GGW A;  1LA0 A;  2ZFD A;  3FIA A;  3EK7 A;  2NZ0 A;  3D0Y B;  4I5L B;  4YGA A;  4QJ3 B;  1KK7 Y;  3SG5 A;  2P6B B;  1RRO A;  1BT6 A;  2FJU B;  2JXL A;  2L4I A;  2PAL A;  3I5F B;  4MRY A;  2KGB C;  1QAS A;  5HKZ A;  4NDD A;  1XFV O;  4HRG A;  1DF0 A;  5G08 A;  1DJX A;  1LA3 A;  2LMU A;  1Q80 A;  2JC2 A;  2D8N A;  1SNL A;  3CS1 A;  1SR6 C;  1ZFS A;  1ZOT B;  1B9A A;  1AP4 A;  2AUC A;  3DVK A;  1YX7 A;  3GK1 A;  1DT7 B;  3OX5 A;  1QV1 A;  4MZK A;  3ZNI A;  1SCV A;  3AAJ A;  1JUO A;  2LMV A;  1CDN A;  2LP2 A;  1XFX O;  1N65 A;  3O4Y A;  2KYC A;  2CNP A;  2ZND A;  2LMT A;  4WRI A;  5F6T A;  2PRU A;  2K61 A;  2SAS A;  2HQW A;  2B1U A;  2WND A;  2KSP A;  2IS9 A;  3KPX A;  4C0K A;  1SPY A;  4FQO A;  1IQ5 A;  2EHB A;  1SW8 A;  1N2D A;  3FWC A;  1NCY A;  1EH2 A;  4ORA B;  1TNW A;  1MR8 A;  4MZJ A;  2GV5 A;  3SG6 A;  1B1G A;  2JRF A;  5FYX A;  2G9B A;  1OE9 B;  4IL1 A;  1NSH A;  3BYA A;  5KTY A;  1J7Q A;  1JC2 A;  2WCF A;  4CLN A;  1GGZ A;  4JQ0 D;  1DJG A;  1K9K A;  1SCM B;  1LIN A;  5JOL A;  2KFH A;  1H4B A;  2MAZ A;  3JTD B;  3EK4 A;  3H4S E;  1QVI Z;  1BLQ A;  3BUO B;  2LC5 A;  4JPZ B;  1OMR A;  2BKH B;  3C1V A;  1OOJ A;  1A03 A;  1S1E A;  2WC8 A;  2BE4 A;  2JQ6 A;  4PE7 A;  4WQ2 A;  2JOJ A;  1KQM C;  1ZUZ A;  3ICB A;  2R2I A;  1RK9 A;  2WCE A;  1DF0 B;  2F8P A;  2BEC A;  1KSO A;  1B7T Z;  1A2X A;  2JUL A;  5HLV A;  2I94 A;  4DIR A;  3OHM B;  1J1D A;  3RLZ A;  2L5X B;  1ALV A;  1DJY A;  3BUN B;  1TTX A;  3I5I C;  5ER4 X;  1HT9 A;  1EL4 A;  2NLN A;  5CPV A;  3JVT B;  2BCX A;  4D1E A;  3PFV A;  2HF5 A;  2Q4U A;  4PE1 A;  3CTN A;  4AQI A;  1TIZ A;  2M3W A;  1OZS A;  2KGR A;  1QIW A;  1TNQ A;  2KI4 B;  2OS8 C;  3M0W A;  5J3X A;  2BBM A;  1YUS A;  1DGV A;  4AOM A;  1GJY A;  4MVF A;  1MXE A;  2LNK A;  4MZL A;  4P2Y B;  4DCK A;  1PAL A;  1OMV A;  1S3P A;  1TCO B;  3NSK A;  1DJI A;  2K8M B;  2M49 B;  4PCW A;  3NSO A;  5B8I B;  4AQJ A;  5I2O A;  1QS7 A;  4TNC A;  3LK0 A;  3IF7 A;  4ORB B;  4HSZ A;  3SG3 A;  3DVM A;  1QX5 B;  2MRD A;  1XFW O;  1R6P A;  1K90 D;  2Y1M A;  1NX0 A;  1CFC A;  3LK1 A;  4GBA A;  3WNX B;  1DTL A;  3SJS A;  1QLS A;  3F45 A;  3DVJ A;  1NIW A;  1QVI Y;  1D1O A;  2LLU A;  2Q91 A;  1V1G A;  4PHJ A;  2JNX A;  4A4C A;  1CNP A;  2H2K A;  1WRL A;  1F8H A;  2F3Z A;  1FW4 A;  2CT9 A;  2F2O A;  5AEQ A;  4PE0 A;  3EVR A;  5ER5 A;  5CSJ A;  1KQV A;  1JF0 A;  2KI6 D;  2M8U A;  1SBJ A;  4PAL A;  3EK8 A;  1B7T Y;  1QX2 A;  1QX7 A;  2Y1N A;  2K7O A;  5AFP A;  1TCF A;  1REC A;  2M1K B;  1KSM A;  2WOR A;  4R1E A;  4PHN A;  1QAT A;  2JZI A;  2MJW B;  2F33 A;  1UHN A;  1KK8 B;  4MSP A;  1DVI A;  2F3Y A;  3LLE A;  1YRT B;  4N5X A;  1SK6 D;  5I8N A;  1UP5 A;  3O2P A;  2JTZ A;  4PE4 A;  1CFP A;  4CFQ A;  3SIB A;  1BOD A;  1XK4 A;  4Q04 A;  3RM1 A;  1K9U A;  1J1E A;  1DMO A;  1AHR A;  3IQO A;  4OR9 B;  4PHK A;  2BE6 A;  3SG4 A;  2MLE C;  2LV7 A;  2BCA A;  2ZN8 A;  3KHE A;  1B47 A;  2LLT A;  1SL7 A;  3TDI A;  1JF2 A;  1SR6 B;  1YUR A;  1J55 A;  1G33 A;  2KHN A;  4GUK A;  3GK4 X;  3CZT X;  3TDZ A;  2KAY A;  1Y0V H;  2WOS A;  3BOW A;  1IG5 A;  1X02 A;  2LVJ A;  3DD4 A;  2KAV A;  4ETO A;  1TRF A;  2AAO A;  1M31 A;  2K7D A;  4E68 A;  1QV0 A;  3ZWH A;  1KFX L;  3KEV A;  1YVH A;  1XYD A;  1NUB A;  3OB1 B;  2LP3 A;  2HPS A;  1BOC A;  1BU3 A;  1TN4 A;  4USL A;  3LL8 B;  4MLW A;  1C7V A;  2K0J A;  3NXA A;  5AXI A;  1RTP 1;  3CGA A;  3BUW B;  2LUC A;  4P5O E;  3A4U B;  3A8R A;  4MBE A;  1S6I A;  4YGB B;  1F54 A;  1K94 A;  2GGM A;  1CDP A;  4OV2 A;  1H8B A;  2JNF A;  2KYF A;  1NCX A;  4N1G A;  1W7I B;  1MQ1 A;  5HYD A;  2L4H A;  3FS7 A;  3OP0 A;  4DRW A;  1JWD A;  4I5J A;  1DJW A;  1XK4 C;  5AAN A;  1IGV A;  1UHH A;  4GGF A;  2ZNE A;  1K93 D;  3TS5 C;  3I5H C;  1Y1A A;  4WQ3 A;  1R2U A;  4GNK B;  2M7L A;  4CPV A;  1FF1 A;  1UHJ A;  1AJ4 A;  2LVK A;  2BCB A;  3BXK A;  4A4B A;  1RFJ A;  2EC6 C;  2LHI A;  2ZN9 A;  3PLF B;  4NDB A;  4YGC B;  4CID A;  1SRA A;  3TDU A;  3TUY C;  1MF8 B;  1WRK A;  2QAC A;  1YTZ C;  3CWG A;  5DKQ A;  1K96 A;  3VGO A;  1CLM A;  1J7R A;  1Y6W A;  3PSR A;  4PHM A;  1Y1X A;  1KQM B;  1OQP A;  1EG4 A;  2M7N A;  3BQ3 A;  2M0R A;  3TS5 B;  2KI6 C;  3I5H B;  1IQ3 A;  5HKY A;  3BUX B;  1OMD A;  4GFT A;  2L98 A;  2JT8 A;  2K2F A;  3E3R A;  3GOF A;  2EC6 B;  3I5G C;  4UPG A;  5CSI A;  3TUY B;  1A4P A;  2NXQ A;  1J7P A;  2BKI B;  2LUX A;  1C07 A;  3I5I B;  1WY9 A;  2HET A;  4GAO A;  3EVU A;  1FI6 A;  5BPJ A;  1QXP A;  2E30 A;  3LCP C;  2L50 A;  2Y5I A;  2K7C A;  1CB1 A;  1CDL A;  3CR2 A;  1NPQ A;  2LVI A;  2OS8 B;  1M46 A;  1CTR A;  1UHI A;  1DJZ A;  1EJ3 A;  3GK2 A;  2LVV A;  2PMY A;  1TNX A;  2WCB A;  3VRO A;  5TNC A;  1PVB A;  3CR5 X;  4ZCU A;  4CFR A;  2KBI A;  2GGZ A;  2H61 C;  4GGF C;  1BG1 A;  1SMG A;  2EGD A;  2CCM A;  1KWO C;  1S26 D;  3CLN A;  2F2P A;  4XJK A;  3EKH A;  1PK0 D;  1ALW A;  1XVJ A;  1YRU B;  2ISD A;  2L51 A;  4YI9 A;  1MUX A;  1XFY O;  3VRR A;  2LCP A;  3VRN A;  4C0J A;  1FPW A;  1UUR A;  3DF0 A;  1G4Y R;  1GQM A;  1K8U A;  1K9P A;  2NCO A;  4ZCV A;  1YUU A;  2JXC A;  1EG3 A;  3TZ1 A;  3EVV A;  1IJ5 A;  2PAS A;  1KWO B;  2OTG C;  1PUL A;  5I2Q A;  2LAP A;  5D69 A;  1DGU A;  1YUT A;  5I2L A;  1B8C A;  2AMI A;  1S5G Z;  1SY9 A;  3OX6 A;  1K95 A;  1PVA A;  1XFU O;  1IRJ A;  1CLL A;  3WXA A;  1OSA A;  2E6W A;  1IJ6 A;  2KQ6 A;  4DS7 A;  4FTG A;  5K89 A;  1A75 A;  1L2O C;  1BR1 B;  1YR5 A;  1F70 A;  4BY4 A;  1KFU L;  1W7J B;  5KU1 A;  1WLZ A;  3SIA A;  3WHU B;  5PAL A;  1CDM A;  2L2E A;  1DJH A;  1FI5 A;  1TOP A;  1B8L A;  1NP8 A;  3EKJ A;  2I2R E;  1PSR A;  3AKA A;  4M2P A;  1N0Y A;  1PSB A;  1S6J A;  4PDZ A;  1IH0 A;  4N1F A;  1UWO A;  1L7Z A;  2O5G A;  3IQQ A;  2COL B;  2K7B A;  3VRQ A;  1YX8 A;  1L2O B;  2DOQ A;  3NSI A;  1TNP A;  2KFG A;  1KFX S;  2LHL A;  4NQG A;  2BL0 C;  1BF5 A;  1M39 A;  2JTT A;  2PSR A;  2O60 A;  3HCM A;  1NCZ A;  4ICB A;  1LKJ A;  2LM5 A;  3CR4 X;  1U5I A;  1B4C A;  2MA2 A;  4YRU A;  1CFD A;  5KSZ A;  4I5N B;  1E8A A;  1WDC C;  2ZKM X;  3QRX A;  2KBM A;  1S36 A;  4XJK B;  1IKU A;  3HX4 A;  5HKW A;  3AKB A;  2FCE A;  2BL0 B;  1XFZ O;  3KO0 A;  3O78 A;  5D7F A;  1CKK A;  1CLB A;  3DF0 B;  4DUQ A;  4MEW A;  2JT3 A;  2FCD A;  1LVC D;  1J7O A;  1WDC B;  1CMG A; 
#chains in the Genus database with same CATH topology
 2KNE A;  1AVS A;  1A29 A;  4GGN A;  3BUM B;  1SCM C;  4C0L A;  2HQ8 A;  2OPO A;  3JTD C;  1ODB A;  3N7H A;  4JWQ A;  1S5G Y;  2L0P A;  2H61 A;  2CTN A;  2JT0 A;  3PAT A;  2A4J A;  3RZS A;  1AUI B;  1M63 B;  1M45 A;  1CFF A;  1FBV A;  2V53 A;  2MBX A;  3K21 A;  3MSE B;  3PN7 C;  1A75 B;  2CXJ A;  2JPT A;  1IWQ A;  3KF9 A;  3NSL A;  3VRP A;  1F4O A;  5AER A;  1F55 A;  2M9G A;  3R1P A;  3NGV A;  4OVN F;  3B6X A;  2MHH A;  4YGD B;  5GQQ C;  1Y1U A;  1JFJ A;  1JSA A;  1BR4 B;  3AAK A;  1C3Z A;  4M2O A;  2SCP A;  1T14 A;  4XYN A;  1KCY A;  3UO9 A;  1S6C A;  3SG7 A;  1AJ5 A;  1ZMZ A;  1SL9 A;  2WCK A;  1BMO A;  3PN7 B;  3R1O A;  4INX A;  5DKN A;  1NX3 A;  2ZRS A;  3JVT C;  5IBW A;  2K2A A;  3D10 A;  3D0Y A;  4HRE E;  1BJF A;  2KQY A;  2LAN A;  4FQT A;  4QJ4 B;  2CBL A;  2KI4 C;  1SL8 A;  3FWB A;  1KK7 Z;  2MLF C;  4YI8 A;  4M2Q A;  3BOW B;  5FI6 A;  1U5I B;  4BY5 A;  3PM8 A;  1UUS A;  2LE9 B;  1XO5 A;  1CM4 A;  5JJG A;  1QIV A;  1YVL A;  1CM1 A;  2M29 A;  2Y4Q A;  3CAB A;  1B8R A;  2BBN A;  1Z2C B;  2JWW A;  3I5G B;  3S0D A;  1ZAC A;  3D75 A;  1PRW A;  3O6B A;  1NX2 A;  4ORC B;  1G8I A;  3V2L A;  2JU0 A;  4YBH B;  1RWY A;  1C7W A;  2KDH A;  4OKH A;  1NX1 A;  2PVB A;  1MXL C;  5DKR A;  4GPL B;  1AK8 A;  5HLO A;  1OZO A;  1LS8 A;  2KFF A;  2VRG A;  2ZRT A;  3O4X A;  4U8D A;  1RJV A;  5CSN A;  1F71 A;  2LLS A;  1K2H A;  2KOT A;  2I7A A;  1JBA A;  4MN0 A;  1SYM A;  2NCP A;  1TUJ A;  4NDC A;  2RGI A;  2QDI A;  2FOT A;  3OB2 B;  4I5K A;  1WRZ A;  1QJT A;  2KAX A;  1NYA A;  1QTX A;  1HQV A;  1LXF C;  1V1F A;  2M1U A;  4QJ5 B;  2G2B A;  3SG2 A;  1F4Q A;  4HRH A;  1JFK A;  4L9M A;  1KFU S;  2I18 A;  1SKT A;  1VRK A;  4F0Z B;  1EXR A;  4YGE B;  2TN4 A;  2QPT A;  2M97 A;  1CMF A;  3BJH A;  3I5F C;  3WHT B;  3DVE A;  2OTG B;  1MHO A;  4MRX A;  4OCI A;  1UHK A;  5EL2 A;  1NWD A;  2H8V A;  2GTE A;  3L4L A;  1MWN A;  1QLK A;  1KK8 C;  3PAL A;  1XA5 A;  5CSF A;  1WLM A;  1GGW A;  1LA0 A;  2ZFD A;  3FIA A;  3EK7 A;  2NZ0 A;  3D0Y B;  4I5L B;  4YGA A;  4QJ3 B;  1KK7 Y;  3SG5 A;  2P6B B;  3DY9 A;  1RRO A;  1BT6 A;  2FJU B;  2JXL A;  2L4I A;  2PAL A;  3I5F B;  4MRY A;  2KGB C;  1QAS A;  3BFH A;  5HKZ A;  4NDD A;  1XFV O;  3DZT A;  4HRG A;  1DF0 A;  5G08 A;  1DJX A;  1LA3 A;  2LMU A;  1Q80 A;  2JC2 A;  2D8N A;  3PJI A;  1SNL A;  3CS1 A;  1SR6 C;  1ZFS A;  1ZOT B;  1B9A A;  1AP4 A;  2AUC A;  3DVK A;  1YX7 A;  2WCM A;  3GK1 A;  1DT7 B;  3OX5 A;  1QV1 A;  4MZK A;  3ZNI A;  1SCV A;  4PT1 A;  1OOI X;  3AAJ A;  4OZD A;  1JUO A;  2LMV A;  2P71 A;  1CDN A;  2LP2 A;  1XFX O;  1N65 A;  3O4Y A;  2KYC A;  2CNP A;  2ZND A;  2LMT A;  3NHI A;  4WRI A;  5F6T A;  2PRU A;  1ORG A;  2K61 A;  2SAS A;  5D3O A;  3EG5 B;  2HQW A;  2B1U A;  2WND A;  2KSP A;  2IS9 A;  3KPX A;  1TWO A;  4C0K A;  1SPY A;  4FQO A;  1IQ5 A;  2EHB A;  1SW8 A;  1N2D A;  3OBV A;  3FWC A;  1NCY A;  1EH2 A;  4ORA B;  1TNW A;  1MR8 A;  4MZJ A;  2GV5 A;  3SG6 A;  1B1G A;  2JRF A;  5FYX A;  2G9B A;  1OE9 B;  4IL1 A;  2L5Y A;  1NSH A;  3BYA A;  5KTY A;  2QEH A;  1J7Q A;  1JC2 A;  2WCF A;  4CLN A;  1GGZ A;  4JQ0 D;  1DJG A;  1K9K A;  3D74 A;  1SCM B;  1LIN A;  5JOL A;  2KFH A;  1H4B A;  2MAZ A;  3JTD B;  3EK4 A;  3H4S E;  1QVI Z;  3R1V A;  1BLQ A;  2BAP A;  2LC5 A;  3BUO B;  3SS4 A;  4JPZ B;  1OMR A;  2BKH B;  3C1V A;  3FE8 A;  1OOJ A;  1A03 A;  1S1E A;  2WC8 A;  2BE4 A;  2ERB A;  2JQ6 A;  4PE7 A;  4WQ2 A;  1IIO A;  2JOJ A;  1KQM C;  1ZUZ A;  3ICB A;  2R2I A;  4KYN A;  3S0A A;  1RK9 A;  2WCE A;  1DF0 B;  2F8P A;  2BEC A;  1KSO A;  1B7T Z;  2PYQ A;  1A2X A;  2JUL A;  5HLV A;  2I94 A;  4DIR A;  3OHM B;  1J1D A;  3RLZ A;  2L5X B;  1ALV A;  1DJY A;  3BUN B;  1TTX A;  3B88 A;  3I5I C;  5ER4 X;  1HT9 A;  1EL4 A;  3VB1 A;  2NLN A;  5CPV A;  3JVT B;  2BCX A;  4D1E A;  3PFV A;  2HF5 A;  2Q4U A;  3CZ1 A;  4PE1 A;  3CTN A;  4AQI A;  1TIZ A;  2M3W A;  1OZS A;  2KGR A;  1QIW A;  1TNQ A;  2KI4 B;  2KPH A;  2OS8 C;  3M0W A;  5J3X A;  2BBM A;  1YUS A;  2YGU A;  1DGV A;  3CDN A;  4AOM A;  1GJY A;  4MVF A;  3DXL A;  1MXE A;  2LNK A;  3QME A;  4MZL A;  4P2Y B;  4DCK A;  1PAL A;  2WC6 A;  1OMV A;  1S3P A;  1TCO B;  3NSK A;  1DJI A;  2K8M B;  2M49 B;  4PCW A;  3NSO A;  2JPO A;  5B8I B;  2WCL A;  4AQJ A;  5I2O A;  1QS7 A;  2P70 A;  4TNC A;  1P28 A;  3LK0 A;  3IF7 A;  4ORB B;  4HSZ A;  3SG3 A;  3DVM A;  1QX5 B;  2MRD A;  1XFW O;  1R6P A;  1K90 D;  2Y1M A;  1NX0 A;  1CFC A;  3LK1 A;  4GBA A;  3WNX B;  1DTL A;  3SJS A;  1QLS A;  3F45 A;  3DVJ A;  1NIW A;  1QVI Y;  1D1O A;  3K1E A;  2LLU A;  3CYZ A;  2Q91 A;  1V1G A;  4PHJ A;  4JD9 A;  2JNX A;  4A4C A;  2WCJ A;  1CNP A;  2H2K A;  1WRL A;  1F8H A;  2F3Z A;  1FW4 A;  2CT9 A;  2F2O A;  1DEK A;  5AEQ A;  4PE0 A;  3EVR A;  5ER5 A;  5CSJ A;  1KQV A;  1JF0 A;  2KI6 D;  2M8U A;  1SBJ A;  4PAL A;  3EK8 A;  1B7T Y;  1QX2 A;  1QX7 A;  2Y1N A;  3B86 A;  2K7O A;  5AFP A;  1TCF A;  1REC A;  2M1K B;  1KSM A;  2WOR A;  4R1E A;  1QWV A;  4PHN A;  1QAT A;  2JZI A;  2MJW B;  3SS5 A;  2F33 A;  1UHN A;  1KK8 B;  4MSP A;  1DVI A;  2F3Y A;  3CZ2 A;  3LLE A;  1YRT B;  4N5X A;  1SK6 D;  5I8N A;  1UP5 A;  3O2P A;  2JTZ A;  4PE4 A;  5DIC A;  1CFP A;  4CFQ A;  3SIB A;  1BOD A;  1XK4 A;  4Q04 A;  3RM1 A;  1K9U A;  1J1E A;  1DMO A;  1AHR A;  3IQO A;  4OR9 B;  4PHK A;  2BE6 A;  3SG4 A;  2MLE C;  2WCH A;  2LV7 A;  2BCA A;  2ZN8 A;  3KHE A;  1B47 A;  1TUZ A;  2LLT A;  1SL7 A;  5I94 A;  2FJY A;  3TDI A;  1JF2 A;  1SR6 B;  1YUR A;  1J55 A;  1G33 A;  2KHN A;  4GUK A;  3GK4 X;  3CZT X;  3Q8I A;  3TDZ A;  3UNW A;  2KAY A;  1Y0V H;  2WOS A;  3BOW A;  1IG5 A;  1X02 A;  2LVJ A;  3DD4 A;  2KAV A;  4ETO A;  1TRF A;  2AAO A;  1M31 A;  2K7D A;  3BFA A;  4E68 A;  1GM0 A;  1QV0 A;  3ZWH A;  1KFX L;  1OOH A;  1YVH A;  1XYD A;  2PQL A;  3KEV A;  3D76 A;  3SS3 A;  1NUB A;  3OB1 B;  2LP3 A;  2HPS A;  1BOC A;  1BU3 A;  1TN4 A;  4USL A;  1W9Z A;  3LL8 B;  2L2C A;  4MLW A;  3OGN A;  3R72 A;  1C7V A;  2K0J A;  3NXA A;  5AXI A;  1RTP 1;  3CGA A;  3BUW B;  4IJ7 A;  2LUC A;  4P5O E;  3A4U B;  3A8R A;  4MBE A;  3CZ0 A;  1S6I A;  4YGB B;  1F54 A;  1K94 A;  2GGM A;  1CDP A;  4OV2 A;  1H8B A;  2JNF A;  2KYF A;  1NCX A;  4N1G A;  1W7I B;  1MQ1 A;  5HYD A;  2L4H A;  3FS7 A;  3OP0 A;  4DRW A;  1JWD A;  4I5J A;  1DJW A;  1XK4 C;  5AAN A;  1C3Y A;  1IGV A;  1UHH A;  4GGF A;  2ZNE A;  3DYE A;  3D77 A;  1K93 D;  3TS5 C;  3I5H C;  1Y1A A;  4WQ3 A;  1R2U A;  4GNK B;  2M7L A;  4CPV A;  1FF1 A;  1UHJ A;  1AJ4 A;  2LVK A;  2BCB A;  3BXK A;  4A4B A;  1RFJ A;  2EC6 C;  2LHI A;  2ZN9 A;  3PLF B;  4NDB A;  4YGC B;  3S0E A;  1SRA A;  4CID A;  3TDU A;  3TUY C;  1MF8 B;  1WRK A;  2QAC A;  1YTZ C;  3CWG A;  5DKQ A;  1K96 A;  3VGO A;  1CLM A;  1J7R A;  1Y6W A;  3PSR A;  4PHM A;  1Y1X A;  1KQM B;  1OQP A;  1EG4 A;  1OW4 A;  2M7N A;  2M0R A;  3B7A A;  2KI6 C;  3BQ3 A;  3I5H B;  3PM2 A;  3TS5 B;  5HKY A;  3BUX B;  2QEB A;  1OMD A;  2QEO A;  4GFT A;  2L98 A;  2JT8 A;  2K2F A;  3E3R A;  3GOF A;  1DEL A;  2EC6 B;  3I5G C;  4UPG A;  1IQ3 A;  5CSI A;  3TUY B;  1A4P A;  2NXQ A;  1J7P A;  2BKI B;  2LUX A;  1C07 A;  3I5I B;  1WY9 A;  2HET A;  4GAO A;  3EVU A;  3S0F A;  1FI6 A;  5BPJ A;  1QXP A;  2E30 A;  3LCP C;  3S0B A;  2L50 A;  2Y5I A;  2K7C A;  3IVT A;  1CB1 A;  1CDL A;  3CR2 A;  3NHT A;  1NPQ A;  2LVI A;  2OS8 B;  1M46 A;  1CTR A;  3D78 A;  3BFB A;  1UHI A;  2K60 A;  1DJZ A;  1EJ3 A;  3GK2 A;  2LVV A;  2PMY A;  1TNX A;  2WCB A;  3VRO A;  5TNC A;  1PVB A;  1Z4H A;  3CR5 X;  4ZCU A;  4CFR A;  2KBI A;  2GGZ A;  2H61 C;  4GGF C;  1BG1 A;  1SMG A;  2EGD A;  1KWO C;  2CCM A;  1S26 D;  3CLN A;  2F2P A;  4XJK A;  3EKH A;  1PK0 D;  1ALW A;  1XVJ A;  1YRU B;  2ISD A;  2L51 A;  4YI9 A;  1MUX A;  1XFY O;  3VRR A;  2LCP A;  3VRN A;  4C0J A;  1FPW A;  1UUR A;  3DF0 A;  1G4Y R;  1DQE A;  1GQM A;  1K8U A;  1K9P A;  2NCO A;  4ZCV A;  1YUU A;  2JXC A;  1EG3 A;  3TZ1 A;  3EVV A;  1IJ5 A;  2PAS A;  1KWO B;  2OTG C;  1OOG A;  1PUL A;  3L4A A;  5I2Q A;  2LAP A;  5D69 A;  1DGU A;  1YUT A;  5I2L A;  1B8C A;  2AMI A;  1S5G Z;  1SY9 A;  3OX6 A;  5FI2 A;  1K95 A;  1PVA A;  1XFU O;  1IRJ A;  1CLL A;  3WXA A;  4INW A;  1OOF A;  1OSA A;  2E6W A;  1IJ6 A;  2KQ6 A;  4JKT A;  4DS7 A;  4FTG A;  5K89 A;  3D73 A;  1A75 A;  1L2O C;  1BR1 B;  1YR5 A;  1F70 A;  4BY4 A;  1KFU L;  1W7J B;  2KLE A;  5KU1 A;  1WLZ A;  3SIA A;  3WHU B;  5PAL A;  1CDM A;  2L2E A;  1DJH A;  1FI5 A;  1TOP A;  1B8L A;  1NP8 A;  3EKJ A;  2I2R E;  1PSR A;  3AKA A;  4M2P A;  1N0Y A;  1PSB A;  1S6J A;  4PDZ A;  4F7F A;  4N1F A;  1UWO A;  1IH0 A;  1L7Z A;  2O5G A;  1SSE B;  2COL B;  2K7B A;  3IQQ A;  3VRQ A;  1YX8 A;  1L2O B;  2DOQ A;  3NSI A;  2QEV A;  1TNP A;  2KFG A;  1KFX S;  2LHL A;  4NQG A;  2BL0 C;  1BF5 A;  1M39 A;  2JTT A;  3B87 A;  3L47 A;  2PSR A;  2O60 A;  3HCM A;  1NCZ A;  4ICB A;  1LKJ A;  2LM5 A;  3CR4 X;  1U5I A;  1XFR A;  2BNX A;  1B4C A;  2MA2 A;  4YRU A;  1CFD A;  5KSZ A;  1DC1 A;  4I5N B;  1E8A A;  1WDC C;  2ZKM X;  3QRX A;  2KBM A;  1S36 A;  4XJK B;  1IKU A;  3HX4 A;  3FE9 A;  3AKB A;  5HKW A;  2FCE A;  2BL0 B;  5HL1 A;  5FI7 A;  1XFZ O;  2WC5 A;  3KO0 A;  3O78 A;  5D7F A;  1CKK A;  1CLB A;  3DF0 B;  3S0G A;  4DUQ A;  4MEW A;  2JT3 A;  2FCD A;  1LVC D;  3FE6 A;  2KLD A;  1J7O A;  1WDC B;  1CMG A; 
#chains in the Genus database with same CATH homology
 2KNE A;  1AVS A;  1A29 A;  4GGN A;  3BUM B;  1SCM C;  4C0L A;  2HQ8 A;  2OPO A;  3JTD C;  1ODB A;  4JWQ A;  1S5G Y;  2L0P A;  2H61 A;  2CTN A;  2JT0 A;  3PAT A;  2A4J A;  1AUI B;  1M63 B;  1M45 A;  1CFF A;  1FBV A;  2V53 A;  2MBX A;  3K21 A;  3MSE B;  3PN7 C;  1A75 B;  2CXJ A;  2JPT A;  1IWQ A;  3KF9 A;  3NSL A;  3VRP A;  1F4O A;  5AER A;  1F55 A;  2M9G A;  4OVN F;  2MHH A;  4YGD B;  5GQQ C;  1Y1U A;  1JFJ A;  1JSA A;  1BR4 B;  3AAK A;  4M2O A;  2SCP A;  4XYN A;  1KCY A;  1S6C A;  3SG7 A;  1AJ5 A;  1ZMZ A;  1SL9 A;  1BMO A;  3PN7 B;  5DKN A;  1NX3 A;  2ZRS A;  3JVT C;  5IBW A;  2K2A A;  3D10 A;  3D0Y A;  4HRE E;  1BJF A;  2KQY A;  2LAN A;  4QJ4 B;  2CBL A;  2KI4 C;  1SL8 A;  3FWB A;  1KK7 Z;  2MLF C;  4YI8 A;  4M2Q A;  3BOW B;  1U5I B;  4BY5 A;  3PM8 A;  1UUS A;  2LE9 B;  1XO5 A;  1CM4 A;  5JJG A;  1QIV A;  1YVL A;  1CM1 A;  2M29 A;  2Y4Q A;  1B8R A;  2BBN A;  2JWW A;  3I5G B;  1ZAC A;  1PRW A;  3O6B A;  1NX2 A;  4ORC B;  1G8I A;  2JU0 A;  4YBH B;  1RWY A;  1C7W A;  2KDH A;  4OKH A;  1NX1 A;  2PVB A;  1MXL C;  5DKR A;  4GPL B;  1AK8 A;  5HLO A;  1OZO A;  2KFF A;  2VRG A;  2ZRT A;  4U8D A;  1RJV A;  5CSN A;  1F71 A;  2LLS A;  1K2H A;  2KOT A;  2I7A A;  1JBA A;  4MN0 A;  1SYM A;  2NCP A;  4NDC A;  2RGI A;  2FOT A;  3OB2 B;  4I5K A;  1WRZ A;  1QJT A;  2KAX A;  1NYA A;  1QTX A;  1HQV A;  1LXF C;  1V1F A;  2M1U A;  4QJ5 B;  2G2B A;  3SG2 A;  1F4Q A;  4HRH A;  1JFK A;  4L9M A;  1KFU S;  2I18 A;  1SKT A;  1VRK A;  4F0Z B;  1EXR A;  4YGE B;  2TN4 A;  2QPT A;  2M97 A;  1CMF A;  3I5F C;  3WHT B;  3DVE A;  2OTG B;  1MHO A;  4MRX A;  4OCI A;  1UHK A;  1NWD A;  5CSF A;  3PAL A;  1MWN A;  1QLK A;  1KK8 C;  1XA5 A;  1WLM A;  1GGW A;  1LA0 A;  2ZFD A;  3FIA A;  3EK7 A;  2NZ0 A;  3D0Y B;  4I5L B;  4YGA A;  4QJ3 B;  1KK7 Y;  3SG5 A;  2P6B B;  1RRO A;  1BT6 A;  2FJU B;  2JXL A;  2L4I A;  2PAL A;  3I5F B;  4MRY A;  2KGB C;  1QAS A;  5HKZ A;  4NDD A;  1XFV O;  4HRG A;  1DF0 A;  5G08 A;  1DJX A;  1LA3 A;  2LMU A;  1Q80 A;  2JC2 A;  2D8N A;  1SNL A;  3CS1 A;  1SR6 C;  1ZFS A;  1ZOT B;  1B9A A;  1AP4 A;  2AUC A;  3DVK A;  1YX7 A;  3GK1 A;  1DT7 B;  3OX5 A;  1QV1 A;  4MZK A;  3ZNI A;  1SCV A;  3AAJ A;  1JUO A;  2LMV A;  1CDN A;  2LP2 A;  1XFX O;  1N65 A;  3O4Y A;  2KYC A;  2CNP A;  2ZND A;  2LMT A;  4WRI A;  5F6T A;  2PRU A;  2K61 A;  2SAS A;  2HQW A;  2B1U A;  2WND A;  2KSP A;  2IS9 A;  3KPX A;  4C0K A;  1SPY A;  4FQO A;  1IQ5 A;  2EHB A;  1SW8 A;  1N2D A;  3FWC A;  1NCY A;  1EH2 A;  4ORA B;  1TNW A;  1MR8 A;  4MZJ A;  2GV5 A;  3SG6 A;  1B1G A;  2JRF A;  5FYX A;  2G9B A;  1OE9 B;  4IL1 A;  1NSH A;  3BYA A;  5KTY A;  1J7Q A;  1JC2 A;  2WCF A;  4CLN A;  1GGZ A;  4JQ0 D;  1DJG A;  1K9K A;  1SCM B;  1LIN A;  5JOL A;  2KFH A;  1H4B A;  2MAZ A;  3JTD B;  3EK4 A;  3H4S E;  1QVI Z;  1BLQ A;  3BUO B;  2LC5 A;  4JPZ B;  1OMR A;  2BKH B;  3C1V A;  1OOJ A;  1A03 A;  1S1E A;  2WC8 A;  2BE4 A;  2JQ6 A;  4PE7 A;  4WQ2 A;  2JOJ A;  1KQM C;  1ZUZ A;  3ICB A;  2R2I A;  1RK9 A;  2WCE A;  1DF0 B;  2F8P A;  2BEC A;  1KSO A;  1B7T Z;  1A2X A;  2JUL A;  5HLV A;  2I94 A;  4DIR A;  3OHM B;  1J1D A;  3RLZ A;  2L5X B;  1ALV A;  1DJY A;  3BUN B;  1TTX A;  3I5I C;  5ER4 X;  1HT9 A;  1EL4 A;  2NLN A;  5CPV A;  3JVT B;  2BCX A;  4D1E A;  3PFV A;  2HF5 A;  2Q4U A;  4PE1 A;  3CTN A;  4AQI A;  1TIZ A;  2M3W A;  1OZS A;  2KGR A;  1QIW A;  1TNQ A;  2KI4 B;  2OS8 C;  3M0W A;  5J3X A;  2BBM A;  1YUS A;  1DGV A;  4AOM A;  1GJY A;  4MVF A;  1MXE A;  2LNK A;  4MZL A;  4P2Y B;  4DCK A;  1PAL A;  1OMV A;  1S3P A;  1TCO B;  3NSK A;  1DJI A;  2K8M B;  2M49 B;  4PCW A;  3NSO A;  5B8I B;  4AQJ A;  5I2O A;  1QS7 A;  4TNC A;  3LK0 A;  3IF7 A;  4ORB B;  4HSZ A;  3SG3 A;  3DVM A;  1QX5 B;  2MRD A;  1XFW O;  1R6P A;  1K90 D;  2Y1M A;  1NX0 A;  1CFC A;  3LK1 A;  4GBA A;  3WNX B;  1DTL A;  3SJS A;  1QLS A;  3F45 A;  3DVJ A;  1NIW A;  1QVI Y;  1D1O A;  2LLU A;  2Q91 A;  1V1G A;  4PHJ A;  2JNX A;  4A4C A;  1CNP A;  2H2K A;  1WRL A;  1F8H A;  2F3Z A;  1FW4 A;  2CT9 A;  2F2O A;  5AEQ A;  4PE0 A;  3EVR A;  5ER5 A;  5CSJ A;  1KQV A;  1JF0 A;  2KI6 D;  2M8U A;  1SBJ A;  4PAL A;  3EK8 A;  1B7T Y;  1QX2 A;  1QX7 A;  2Y1N A;  2K7O A;  5AFP A;  1TCF A;  1REC A;  2M1K B;  1KSM A;  2WOR A;  4R1E A;  4PHN A;  1QAT A;  2JZI A;  2MJW B;  2F33 A;  1UHN A;  1KK8 B;  4MSP A;  1DVI A;  2F3Y A;  3LLE A;  1YRT B;  4N5X A;  1SK6 D;  5I8N A;  1UP5 A;  3O2P A;  2JTZ A;  4PE4 A;  1CFP A;  4CFQ A;  3SIB A;  1BOD A;  1XK4 A;  4Q04 A;  3RM1 A;  1K9U A;  1J1E A;  1DMO A;  1AHR A;  3IQO A;  4OR9 B;  4PHK A;  2BE6 A;  3SG4 A;  2MLE C;  2LV7 A;  2BCA A;  2ZN8 A;  3KHE A;  1B47 A;  2LLT A;  1SL7 A;  3TDI A;  1JF2 A;  1SR6 B;  1YUR A;  1J55 A;  1G33 A;  2KHN A;  4GUK A;  3GK4 X;  3CZT X;  3TDZ A;  2KAY A;  1Y0V H;  2WOS A;  3BOW A;  1IG5 A;  1X02 A;  2LVJ A;  3DD4 A;  2KAV A;  4ETO A;  1TRF A;  2AAO A;  1M31 A;  2K7D A;  4E68 A;  1QV0 A;  3ZWH A;  1KFX L;  3KEV A;  1YVH A;  1XYD A;  1NUB A;  3OB1 B;  2LP3 A;  2HPS A;  1BOC A;  1BU3 A;  1TN4 A;  4USL A;  3LL8 B;  4MLW A;  1C7V A;  2K0J A;  3NXA A;  5AXI A;  1RTP 1;  3CGA A;  3BUW B;  2LUC A;  4P5O E;  3A4U B;  3A8R A;  4MBE A;  1S6I A;  4YGB B;  1F54 A;  1K94 A;  2GGM A;  1CDP A;  4OV2 A;  1H8B A;  2JNF A;  2KYF A;  1NCX A;  4N1G A;  1W7I B;  1MQ1 A;  5HYD A;  2L4H A;  3FS7 A;  3OP0 A;  4DRW A;  1JWD A;  4I5J A;  1DJW A;  1XK4 C;  5AAN A;  1IGV A;  1UHH A;  4GGF A;  2ZNE A;  1K93 D;  3TS5 C;  3I5H C;  1Y1A A;  4WQ3 A;  1R2U A;  4GNK B;  2M7L A;  4CPV A;  1FF1 A;  1UHJ A;  1AJ4 A;  2LVK A;  2BCB A;  3BXK A;  4A4B A;  1RFJ A;  2EC6 C;  2LHI A;  2ZN9 A;  3PLF B;  4NDB A;  4YGC B;  4CID A;  1SRA A;  3TDU A;  3TUY C;  1MF8 B;  1WRK A;  2QAC A;  1YTZ C;  3CWG A;  5DKQ A;  1K96 A;  3VGO A;  1CLM A;  1J7R A;  1Y6W A;  3PSR A;  4PHM A;  1Y1X A;  1KQM B;  1OQP A;  1EG4 A;  2M7N A;  3BQ3 A;  2M0R A;  3TS5 B;  2KI6 C;  3I5H B;  1IQ3 A;  5HKY A;  3BUX B;  1OMD A;  4GFT A;  2L98 A;  2JT8 A;  2K2F A;  3E3R A;  3GOF A;  2EC6 B;  3I5G C;  4UPG A;  5CSI A;  3TUY B;  1A4P A;  2NXQ A;  1J7P A;  2BKI B;  2LUX A;  1C07 A;  3I5I B;  1WY9 A;  2HET A;  4GAO A;  3EVU A;  1FI6 A;  5BPJ A;  1QXP A;  2E30 A;  3LCP C;  2L50 A;  2Y5I A;  2K7C A;  1CB1 A;  1CDL A;  3CR2 A;  1NPQ A;  2LVI A;  2OS8 B;  1M46 A;  1CTR A;  1UHI A;  1DJZ A;  1EJ3 A;  3GK2 A;  2LVV A;  2PMY A;  1TNX A;  2WCB A;  3VRO A;  5TNC A;  1PVB A;  3CR5 X;  4ZCU A;  4CFR A;  2KBI A;  2GGZ A;  2H61 C;  4GGF C;  1BG1 A;  1SMG A;  2EGD A;  2CCM A;  1KWO C;  1S26 D;  3CLN A;  2F2P A;  4XJK A;  3EKH A;  1PK0 D;  1ALW A;  1XVJ A;  1YRU B;  2ISD A;  2L51 A;  4YI9 A;  1MUX A;  1XFY O;  3VRR A;  2LCP A;  3VRN A;  4C0J A;  1FPW A;  1UUR A;  3DF0 A;  1G4Y R;  1GQM A;  1K8U A;  1K9P A;  2NCO A;  4ZCV A;  1YUU A;  2JXC A;  1EG3 A;  3TZ1 A;  3EVV A;  1IJ5 A;  2PAS A;  1KWO B;  2OTG C;  1PUL A;  5I2Q A;  2LAP A;  5D69 A;  1DGU A;  1YUT A;  5I2L A;  1B8C A;  2AMI A;  1S5G Z;  1SY9 A;  3OX6 A;  1K95 A;  1PVA A;  1XFU O;  1IRJ A;  1CLL A;  3WXA A;  1OSA A;  2E6W A;  1IJ6 A;  2KQ6 A;  4DS7 A;  4FTG A;  5K89 A;  1A75 A;  1L2O C;  1BR1 B;  1YR5 A;  1F70 A;  4BY4 A;  1KFU L;  1W7J B;  5KU1 A;  1WLZ A;  3SIA A;  3WHU B;  5PAL A;  1CDM A;  2L2E A;  1DJH A;  1FI5 A;  1TOP A;  1B8L A;  1NP8 A;  3EKJ A;  2I2R E;  1PSR A;  3AKA A;  4M2P A;  1N0Y A;  1PSB A;  1S6J A;  4PDZ A;  1IH0 A;  4N1F A;  1UWO A;  1L7Z A;  2O5G A;  3IQQ A;  2COL B;  2K7B A;  3VRQ A;  1YX8 A;  1L2O B;  2DOQ A;  3NSI A;  1TNP A;  2KFG A;  1KFX S;  2LHL A;  4NQG A;  2BL0 C;  1BF5 A;  1M39 A;  2JTT A;  2PSR A;  2O60 A;  3HCM A;  1NCZ A;  4ICB A;  1LKJ A;  2LM5 A;  3CR4 X;  1U5I A;  1B4C A;  2MA2 A;  4YRU A;  1CFD A;  5KSZ A;  4I5N B;  1E8A A;  1WDC C;  2ZKM X;  3QRX A;  2KBM A;  1S36 A;  4XJK B;  1IKU A;  3HX4 A;  5HKW A;  3AKB A;  2FCE A;  2BL0 B;  1XFZ O;  3KO0 A;  3O78 A;  5D7F A;  1CKK A;  1CLB A;  3DF0 B;  4DUQ A;  4MEW A;  2JT3 A;  2FCD A;  1LVC D;  1J7O A;  1WDC B;  1CMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...