1FW4A

Crystal structure of e. coli fragment tr2c from calmodulin to 1.7 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
SEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALMODULIN
publication title Structure of Escherichia coli fragment TR2C from calmodulin to 1.7 A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2000-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fw4A00
1XO5A 1BMOA 1JF0A 1QLSA 2LP3A 4MRYA 4MZKA 3FIAA 2OS8B 1TNWA 1KQVA 1SL8A 2BL0C 1SPYA 1AJ4A 3DD4A 3CWGA 2QPTA 5AANA 1K2HA 1OZOA 4MZLA 2WC8A 1AHRA 2WORA 3PSRA 5G08A 3LL8B 3PM8A 5IBWA 4YGBB 1BR1B 3PN7C 2NXQA 3TUYB 2HPSA 4DUQA 1NCYA 4GAOA 3SG5A 1UP5A 2KFHA 1IKUA 1B8RA 2OPOA 1JF2A 4IL1A 2HF5A 1XA5A 1TOPA 1SCVA 2PSRA 2I2RE 2LM5A 1BLQA 1QASA 2CTNA 3LK0A 1H8BA 2I7AA 2PALA 5ER5A 3D0YA 4ZCVA 1PALA 3EK8A 1A03A 2ZRSA 1DJIA 1SR6C 1YX8A 2FOTA 3VRQA 5J3XA 1TTXA 5AXIA 2O60A 1KK8B 1MF8B 1K9PA 1TNQA 1XFXO 1EL4A 1PK0D 2M49B 2LMUA 4I5NB 1Y1UA 1BR4B 3BOWB 1J1EA 5F6TA 3NXAA 1SL7A 4WQ2A 5K89A 1EH2A 1WLMA 3EK7A 1F8HA 1MUXA 2LMTA 1ZMZA 5HLOA 5PALA 5CSNA 3SG2A 1QTXA 1QJTA 4R1EA 2KGBC 1F4QA 2F2OA 3BXKA 2WNDA 3CLNA 1OOJA 3O78A 4GGFA 1UUSA 2KGRA 3KHEA 3LK1A 1WRZA 3DVEA 1GGZA 4OKHA 4P2YB 1S5GY 1ZUZA 1FW4A 4GFTA 2I94A 2IS9A 2K7DA 1LA3A 1QVIY 1YVLA 2EC6C 2K7CA 1GJYA 3GOFA 1C07A 1KQMC 1XK4A 1YUSA 4ORBB 2LCPA 1EG3A 1BG1A 1CFDA 1JC2A 4GPLB 1F55A 1SW8A 2KFFA 2H61C 1AP4A 1OMDA 1K96A 1WY9A 1CDMA 2KQ6A 1AVSA 5HKZA 3SIBA 1DJWA 3MSEB 1DVIA 2LP2A 2F2PA 4I5KA 2FCDA 3EK4A 2JNFA 2F8PA 2JNXA 1U5IA 2BCXA 4PE0A 1SBJA 2R2IA 1B47A 3I5FB 4PHJA 1C7WA 2CXJA 5DKQA 2NZ0A 4YGCB 2KDHA 2BL0B 1QS7A 3SG7A 1WDCC 4A4CA 1CNPA 1S1EA 2LAPA 1OSAA 4QJ3B 3WXAA 5I8NA 2B1UA 4YGDB 2FCEA 4XYNA 1IQ5A 1LXFC 1SCMB 2LV7A 1TRFA 5CSIA 1IQ3A 5D7FA 1PRWA 2LANA 3O6BA 4MVFA 3I5GC 1DT7B 1RWYA 1NWDA 1B7TY 1QIWA 4PE1A 4OV2A 4MEWA 1OMRA 1ALWA 4N1GA 1JUOA 2ZRTA 2LC5A 3CTNA 1ZOTB 4FQOA 4YGAA 1J55A 1S5GZ 4C0LA 1F4OA 4F0ZB 1WLZA 4BY4A 1J1DA 1UHHA 3I5FC 3IF7A 1B8CA 2M7LA 1YR5A 3BUXB 1S6JA 3GK2A 5AEQA 5HKYA 3PFVA 3F45A 1UWOA 4QJ5B 3EKHA 3M0WA 1SR6B 1BF5A 2KOTA 1BU3A 3KO0A 1S26D 5KU1A 1XFWO 1XYDA 3FS7A 2K2FA 4PHNA 4HREE 1SCMC 3SG6A 3SIAA 3TS5C 3LLEA 2KFGA 1KSOA 2M0RA 1QXPA 3A8RA 4XJKA 2KBIA 3EKJA 2BBMA 1OZSA 1N2DA 2LVKA 1J7RA 1XFYO 1CMGA 2Y4QA 3EVUA 3OX6A 2MLFC 2P6BB 2CBLA 1IG5A 1IRJA 4C0JA 2BKIB 1UHNA 2K7OA 2M8UA 2SASA 3OB1B 4C0KA 1MQ1A 1GQMA 1W7IB 3DF0B 4PHKA 1BODA 3I5HC 2L51A 1A4PA 1MXLC 1NPQA 1QV1A 2LVIA 1DMOA 3NSOA 1ODBA 2Q91A 1DF0B 3HX4A 1B7TZ 1MWNA 1A2XA 4GBAA 1CFCA 2EC6B 1KSMA 3D10A 1PSRA 4CIDA 5CSJA 1KQMB 2F3ZA 2LLTA 4NDBA 5KSZA 3PATA 4MBEA 4Q04A 1F71A 1NX1A 4MSPA 2L4IA 2LLUA 2GV5A 2JXCA 2M1UA 4YRUA 3VRPA 1KFXL 4HRGA 2K7BA 4JQ0D 1NYAA 4GGNA 4NDCA 2DOQA 1CLMA 4WRIA 2AUCA 1KCYA 2BBNA 1A75B 1K9KA 1DJZA 1KFXS 1OMVA 2JT8A 2M97A 1SKTA 2H2KA 4M2PA 3WNXB 1F54A 3DVKA 1XVJA 1UHIA 3OP0A 4WQ3A 2ZFDA 5CPVA 1YX7A 1XK4C 2HETA 3TDZA 1QATA 3JTDC 2A4JA 3BUMB 1YUTA 2BKHB 2MA2A 1WDCB 5B8IB 2MRDA 1JBAA 2LVJA 4A4BA 1QX5B 2MAZA 2PMYA 1SY9A 1Y6WA 1DGVA 1PULA 3O4YA 2JQ6A 1K8UA 2NCPA 4I5LB 3I5GB 3WHTB 4CPVA 5HLVA 2MBXA 1CM1A 1MHOA 1YRTB 3CR4X 1Y1XA 4HRHA 2Y1MA 1DJYA 1XFVO 3PLFB 1V1FA 4P5OE 2JC2A 2JTZA 1B8LA 2BE6A 1TN4A 2KYCA 4DS7A 2G2BA 1JFKA 2ZNEA 1HT9A 2AMIA 1AK8A 1JFJA 4E68A 5GQQC 1QLKA 3NSIA 3JVTC 2VRGA 1FI6A 2K61A 1RECA 2KQYA 2D8NA 1BT6A 2LNKA 1PVBA 1Y1AA 2JULA 3AAJA 1S36A 1ZACA 1K93D 4MLWA 3TS5B 1HQVA 4YGEB 1RK9A 2BE4A 3BOWA 5HKWA 3VGOA 1S3PA 4DCKA 1CDNA 3ZNIA 2NLNA 1B9AA 2LUCA 2KAVA 2KAXA 3CR5X 3RLZA 3SJSA 1E8AA 1Y0VH 3SG3A 1M31A 1M46A 2WOSA 1CKKA 3FWCA 1TIZA 1LVCD 3D0YB 4M2QA 4CFQA 3OB2B 2JXLA 1SK6D 3OX5A 4ETOA 1QVIZ 1W7JB 1R6PA 1A29A 1NX0A 2ZKMX 5TNCA 2LE9B 3I5HB 4MN0A 1NP8A 4PE4A 4DIRA 1BJFA 2KAYA 4YI9A 1NCZA 3QRXA 3PALA 2OTGB 4ORCB 1BOCA 2KBMA 4NDDA 1SMGA 4D1EA 2MLEC 1RJVA 1UHKA 5BPJA 4GNKB 3BUNB 1KWOC 3GK4X 1TNPA 2M29A 1WRKA 2KHNA 2ZN8A 3BUOB 2TN4A 1CTRA 4I5JA 2K8MB 1QV0A 2WCFA 2BCBA 1L2OC 3AKAA 1UURA 1CM4A 1QIVA 1QX2A 2JT0A 2JPTA 3VRNA 1B4CA 2Y5IA 2NCOA 4HSZA 1DTLA 1G8IA 1RTP1 2KI4C 2Y1NA 2MJWB 2M9GA 1K94A 3CGAA 3NSLA 4PHMA 2V53A 1F70A 2JTTA 1D1OA 1FPWA 1M63B 1IH0A 4JWQA 1XFZO 2KSPA 1VRKA 1OQPA 2LVVA 4L9MA 1X02A 2CT9A 3BUWB 2EGDA 4PE7A 3IQOA 2FJUB 2HQWA 3BYAA 3WHUB 4BY5A 2EHBA 1QX7A 2CNPA 2OTGC 3I5IC 1CB1A 5CSFA 2JOJA 2F33A 4PCWA 1OE9B 3JTDB 3TDUA 4USLA 1DJGA 1Q80A 2LMVA 1NIWA 1S6IA 2M3WA 1KK7Y 4AQIA 1SRAA 3BQ3A 5JJGA 1EG4A 3FWBA 2HQ8A 5JOLA 1FBVA 4ICBA 5D69A 2PASA 1N65A 1NCXA 4OVNF 5AERA 2OS8C 4GGFC 5DKRA 4MZJA 2JRFA 4AQJA 1U5IB 1LKJA 3LCPC 5ER4X 2PRUA 4PDZA 1IGVA 1FI5A 2PVBA 2L98A 2LHIA 1YTZC 1YVHA 1V1GA 4OCIA 3KPXA 2I18A 1G33A 2L50A 5FYXA 1J7QA 3JVTB 1XFUO 4TNCA 1JSAA 2Q4UA 4YI8A 1ZFSA 1DJXA 1SNLA 1MR8A 3TUYC 2E30A 2QACA 4AOMA 2JU0A 1CFFA 3EVVA 1WRLA 1CMFA 1FF1A 1DGUA 3IQQA 3GK1A 3O2PA 4YBHB 1CDLA 2O5GA 5HYDA 4PALA 2JT3A 1K90D 1YRUB 3RM1A 4JPZB 1NUBA 2K0JA 2BCAA 3CR2A 2SCPA 4FTGA 1EJ3A 1N0YA 1NX3A 2KYFA 3DF0A 1S6CA 2KI6D 3C1VA 1KK8C 1YURA 1AJ5A 2JZIA 4ZCUA 5DKNA 4DRWA 4QJ4B 3E3RA 1M39A 2L5XB 4MRXA 1CLBA 4U8DA 1GGWA 4NQGA 3CS1A 1SYMA 2ZN9A 1SL9A 1DF0A 1G4YR 4UPGA 1KK7Z 2K2AA 1TCFA 1CLLA 4OR9B 1M45A 4N1FA 4CLNA 3TZ1A 3VROA 4XJKB 1PSBA 1K9UA 2AAOA 1YUUA 2GGMA 3EVRA 3NSKA 3A4UB 1UHJA 1CFPA 1KWOB 1TNXA 1IWQA 1CDPA 2CCMA 3AKBA 2LHLA 3DVMA 1H4BA 3K21A 2WCBA 1RROA 1PVAA 2JWWA 1J7PA 2H61A 2ZNDA 1EXRA 1LA0A 3HCMA 4CFRA 2M1KB 1L2OB 1R2UA 2WCEA 1RFJA 4ORAB 2BECA 4GUKA 1A75A 1LINA 3AAKA 3CZTX 4M2OA 4N5XA 5I2OA 2KI4B 1JWDA 2L4HA 2KNEA 5AFPA 3VRRA 1K95A 3ICBA 2RGIA 3ZWHA 2L2EA 2L0PA 1KFUL 1NX2A 3KEVA 1TCOB 1IJ6A 1ALVA 2F3YA 2LLSA 1NSHA 1IJ5A 3OHMB 1C7VA 2LUXA 3SG4A 1KFUS 2GGZA 2KI6C 3TDIA 3I5IB 1AUIB 2MHHA 3KF9A 3PN7B 5I2QA 3DVJA 2E6WA 2ISDA 2COLB 1J7OA 1DJHA 1MXEA 1L7ZA 2G9BA 1B1GA 5KTYA 3H4SE 2M7NA 5I2LA
chains in the Genus database with same CATH superfamily
1XO5A 4INWA 1BMOA 1JF0A 1QLSA 2LP3A 4MRYA 4MZKA 3FIAA 2OS8B 1TNWA 1KQVA 1SL8A 3NGVA 2BL0C 1SPYA 1AJ4A 3DD4A 3CWGA 2QPTA 1Z2CB 5AANA 1K2HA 1OZOA 4MZLA 2WC8A 1AHRA 2WORA 3PSRA 5G08A 3LL8B 3PM8A 5IBWA 2BNXA 4YGBB 1BR1B 3PN7C 2NXQA 3TUYB 2HPSA 4DUQA 1NCYA 4GAOA 3B6XA 1UP5A 2KFHA 3SG5A 1B8RA 1IKUA 2OPOA 1JF2A 3R1PA 4IL1A 2HF5A 1XA5A 1TOPA 3PM2A 1SCVA 2PSRA 2PQLA 2I2RE 2LM5A 1BLQA 1QASA 2CTNA 3LK0A 1H8BA 2I7AA 3SS4A 3B87A 2PALA 5ER5A 3D0YA 4ZCVA 4OZDA 3D74A 3IVTA 1PALA 3EK8A 1A03A 2ZRSA 1DJIA 1SR6C 1YX8A 2FOTA 3VRQA 5J3XA 1ORGA 1TTXA 5AXIA 2O60A 1KK8B 1MF8B 1K9PA 1TNQA 1XFXO 1EL4A 3K1EA 1PK0D 2M49B 2LMUA 4I5NB 1Y1UA 3CABA 5FI6A 1BR4B 3BOWB 1J1EA 5F6TA 2WCJA 1SL7A 3NXAA 4WQ2A 5K89A 1EH2A 3QMEA 1WLMA 3EK7A 1F8HA 1MUXA 2LMTA 3R72A 1ZMZA 5HLOA 5PALA 5CSNA 3SG2A 1QTXA 1QJTA 4R1EA 2KGBC 3FE8A 1F4QA 2F2OA 3BXKA 2WNDA 3CLNA 1OOJA 3O78A 4GGFA 1UUSA 3RZSA 2KGRA 3KHEA 3LK1A 1WRZA 4INXA 3DVEA 1GGZA 4OKHA 4P2YB 1S5GY 1ZUZA 1FW4A 4GFTA 2I94A 2IS9A 3DYEA 2K7DA 1LA3A 1QVIY 1YVLA 2EC6C 2JPOA 2K7CA 3D77A 1GJYA 3GOFA 3L4LA 1C07A 1DQEA 1KQMC 1XK4A 3O4XA 1YUSA 4ORBB 3L4AA 2QDIA 1TUJA 2LCPA 1EG3A 1BG1A 1IIOA 1CFDA 1JC2A 5D3OA 4GPLB 1F55A 1SW8A 2KFFA 2H61C 1AP4A 1OMDA 1K96A 1WY9A 1CDMA 2KQ6A 1AVSA 5HKZA 3B88A 3SIBA 1DJWA 3MSEB 1DVIA 2LP2A 2P70A 3D75A 2F2PA 4I5KA 2FCDA 3EK4A 2JNFA 2F8PA 2JNXA 1U5IA 2YGUA 2BCXA 4PE0A 1SBJA 2R2IA 1B47A 3I5FB 4PHJA 1C3YA 1C7WA 2CXJA 5DKQA 2NZ0A 2WCHA 4IJ7A 4YGCB 2KDHA 2BL0B 1QS7A 1Z4HA 1WDCC 3SG7A 4A4CA 1CNPA 1S1EA 2LAPA 1OSAA 4QJ3B 3WXAA 5I8NA 2B1UA 4YGDB 2FCEA 4XYNA 1IQ5A 1LXFC 1SCMB 2WCLA 2LV7A 1TRFA 1XFRA 3S0EA 5CSIA 1IQ3A 5D7FA 1PRWA 2LANA 3O6BA 4MVFA 3I5GC 1DT7B 1RWYA 1NWDA 1B7TY 1QIWA 4PE1A 4OV2A 4MEWA 1OMRA 2QEHA 1ALWA 4N1GA 1JUOA 2ZRTA 2LC5A 3CTNA 1ZOTB 4FQOA 3BFHA 4YGAA 1J55A 1S5GZ 4C0LA 1F4OA 3S0DA 4F0ZB 1WLZA 4BY4A 1J1DA 5DICA 1UHHA 3I5FC 3IF7A 1B8CA 2M7LA 1YR5A 3BUXB 1S6JA 3GK2A 3NHIA 5AEQA 5HKYA 3PFVA 1QWVA 3F45A 1UWOA 4QJ5B 3EKHA 3M0WA 1SR6B 1BF5A 2KOTA 1BU3A 3KO0A 1S26D 4JKTA 5KU1A 1XFWO 1SSEB 1XYDA 3FS7A 2K2FA 4PHNA 4HREE 1SCMC 3SG6A 3SIAA 3TS5C 2PYQA 3L47A 3LLEA 2KFGA 1KSOA 2M0RA 1QXPA 3A8RA 5I94A 4XJKA 2KBIA 3EKJA 2BBMA 1OZSA 1N2DA 2FJYA 2LVKA 1J7RA 3Q8IA 1XFYO 1CMGA 2Y4QA 3EVUA 3CDNA 4KYNA 3OX6A 2MLFC 2P6BB 2CBLA 3FE6A 5FI2A 1IG5A 1IRJA 3OGNA 4C0JA 2BKIB 1UHNA 2K7OA 2M8UA 2SASA 3OB1B 4C0KA 2L2CA 3D76A 1MQ1A 1GQMA 1W7IB 1DELA 1W9ZA 3DF0B 4PHKA 3I5HC 1BODA 2L51A 2KLEA 1A4PA 1MXLC 1NPQA 1QV1A 2L5YA 2LVIA 3NHTA 1DMOA 3NSOA 1T14A 1ODBA 2Q91A 1DF0B 3HX4A 3PJIA 1B7TZ 1MWNA 1A2XA 2WC5A 4GBAA 2EC6B 1CFCA 1KSMA 3BJHA 3D10A 1PSRA 4CIDA 5CSJA 1KQMB 2F3ZA 2LLTA 4NDBA 5KSZA 3PATA 4MBEA 4Q04A 5EL2A 1F71A 1NX1A 4MSPA 2L4IA 2LLUA 2GV5A 2JXCA 2M1UA 4YRUA 3VRPA 1KFXL 4HRGA 2K7BA 4JQ0D 1NYAA 4GGNA 3S0AA 4NDCA 2DOQA 1CLMA 4WRIA 2AUCA 1KCYA 2BBNA 1A75B 1K9KA 1DJZA 1KFXS 1OMVA 2JT8A 2M97A 1SKTA 2H2KA 2P71A 4M2PA 3S0BA 3WNXB 3BFBA 1XVJA 3DVKA 1UHIA 3OP0A 4WQ3A 1P28A 2ZFDA 1YX7A 1XK4C 2HETA 5CPVA 3TDZA 1QATA 3JTDC 2A4JA 3BUMB 1YUTA 1C3ZA 2BKHB 2MA2A 1WDCB 5B8IB 2MRDA 1JBAA 2LVJA 3DZTA 3V2LA 4A4BA 1QX5B 2MAZA 2PMYA 1SY9A 1Y6WA 3SS3A 1DGVA 1PULA 3VB1A 3O4YA 2JQ6A 1K8UA 2NCPA 4I5LB 3I5GB 3WHTB 4CPVA 5HLVA 2MBXA 1CM1A 1MHOA 1YRTB 3CR4X 1Y1XA 4HRHA 2Y1MA 1DJYA 1XFVO 3PLFB 3S0FA 1V1FA 4P5OE 2JC2A 2JTZA 1B8LA 2BE6A 1TN4A 2KYCA 4DS7A 2G2BA 1JFKA 2ZNEA 1HT9A 2AMIA 1DC1A 1AK8A 1JFJA 3UNWA 4E68A 5GQQC 1QLKA 3NSIA 1TUZA 3JVTC 2VRGA 1FI6A 2K61A 2WCKA 1RECA 3N7HA 1OOFA 2KQYA 2D8NA 1BT6A 2LNKA 1PVBA 1Y1AA 2JULA 3AAJA 1S36A 2ERBA 1ZACA 3R1VA 1K93D 4MLWA 2QEOA 3TS5B 1HQVA 4YGEB 1RK9A 2BE4A 3BOWA 5HKWA 3VGOA 3EG5B 1S3PA 4DCKA 1CDNA 3ZNIA 2NLNA 1B9AA 2LUCA 2KAVA 2KAXA 3CR5X 1OW4A 3RLZA 3SJSA 1E8AA 1Y0VH 3SG3A 3D73A 1M31A 1M46A 1OOGA 2WOSA 1CKKA 3FWCA 1TIZA 1LVCD 3D0YB 4M2QA 4CFQA 3OB2B 2JXLA 1SK6D 2WC6A 3OX5A 4ETOA 1QVIZ 1W7JB 1R6PA 1A29A 1NX0A 2ZKMX 5TNCA 2LE9B 3I5HB 4MN0A 1NP8A 4PE4A 4DIRA 1BJFA 2KAYA 4YI9A 1NCZA 4PT1A 3QRXA 3PALA 2OTGB 4ORCB 1BOCA 2KBMA 4NDDA 1SMGA 4D1EA 2MLEC 1RJVA 1UHKA 5BPJA 4GNKB 3BUNB 1KWOC 3GK4X 1TNPA 2M29A 1WRKA 2KHNA 2ZN8A 3BUOB 2TN4A 1CTRA 4I5JA 2K8MB 3S0GA 1QV0A 2WCFA 2BCBA 1L2OC 3AKAA 1UURA 1CM4A 1QIVA 1QX2A 2JT0A 2JPTA 3VRNA 1B4CA 2Y5IA 2NCOA 4HSZA 1DTLA 1G8IA 1RTP1 2KI4C 2Y1NA 2WCMA 2MJWB 2M9GA 1K94A 3CGAA 3NSLA 3DXLA 4PHMA 2V53A 1F70A 2JTTA 3DY9A 1D1OA 1FPWA 1M63B 1IH0A 4JWQA 1XFZO 2KSPA 4JD9A 1VRKA 1OQPA 2LVVA 4L9MA 1X02A 2CT9A 3BUWB 2EGDA 2QEVA 3IQOA 2FJUB 2HQWA 3BYAA 3WHUB 4BY5A 3OBVA 2EHBA 1QX7A 2CNPA 2OTGC 3I5IC 1CB1A 5CSFA 2JOJA 2F33A 4PCWA 1OE9B 3JTDB 3TDUA 4USLA 3B7AA 1DJGA 1Q80A 2LMVA 1NIWA 1S6IA 2M3WA 1KK7Y 4AQIA 3UO9A 3R1OA 1SRAA 3BQ3A 5JJGA 1EG4A 3FWBA 2HQ8A 5JOLA 1FBVA 4ICBA 5D69A 2PASA 1N65A 1NCXA 1TWOA 4OVNF 5AERA 2OS8C 4GGFC 5DKRA 4MZJA 2JRFA 4AQJA 1U5IB 1LKJA 3LCPC 5ER4X 2PRUA 4PDZA 1IGVA 1FI5A 2PVBA 2L98A 1DEKA 2LHIA 1YTZC 1YVHA 1GM0A 1V1GA 4OCIA 3KPXA 2I18A 1G33A 1LS8A 2L50A 5FYXA 1J7QA 3JVTB 1XFUO 4TNCA 1JSAA 2H8VA 4PE7A 2Q4UA 4YI8A 1ZFSA 5HL1A 1DJXA 2KPHA 1SNLA 1MR8A 3TUYC 2E30A 2QACA 4AOMA 2JU0A 1CFFA 3EVVA 1WRLA 1CMFA 1FF1A 1DGUA 3IQQA 3GK1A 3O2PA 4YBHB 1CDLA 2O5GA 5HYDA 4PALA 2JT3A 3D78A 1K90D 1YRUB 3RM1A 3CZ0A 4JPZB 1NUBA 2K0JA 2BCAA 3CR2A 2SCPA 4FTGA 1EJ3A 1N0YA 1NX3A 2KYFA 3DF0A 1S6CA 2KI6D 3C1VA 3BFAA 1KK8C 1YURA 1AJ5A 2JZIA 3CYZA 5DKNA 4ZCUA 4DRWA 3E3RA 1M39A 2L5XB 4MRXA 4QJ4B 4U8DA 1CLBA 4NQGA 3CS1A 1GGWA 1SYMA 2ZN9A 1SL9A 1DF0A 1OOHA 1G4YR 2K60A 4UPGA 1KK7Z 2K2AA 1TCFA 1CLLA 2BAPA 4OR9B 1M45A 4N1FA 4CLNA 3CZ1A 3TZ1A 3VROA 4XJKB 1PSBA 1K9UA 2AAOA 2GTEA 1YUUA 2GGMA 3EVRA 3NSKA 3A4UB 1UHJA 1CFPA 1KWOB 1TNXA 1IWQA 1CDPA 2CCMA 3AKBA 2LHLA 3DVMA 1H4BA 3K21A 2WCBA 1RROA 1PVAA 2JWWA 1J7PA 2H61A 1F54A 2ZNDA 3SS5A 1EXRA 1LA0A 3HCMA 4CFRA 4F7FA 2M1KB 1L2OB 1R2UA 2WCEA 5FI7A 1OOIX 1RFJA 4ORAB 2BECA 4GUKA 1A75A 1LINA 3AAKA 3CZTX 4M2OA 4N5XA 5I2OA 2KI4B 1JWDA 2L4HA 2KNEA 5AFPA 2QEBA 3VRRA 1K95A 3ICBA 2RGIA 3ZWHA 2L2EA 2L0PA 1KFUL 1NX2A 3KEVA 1TCOB 1IJ6A 1ALVA 2F3YA 2LLSA 1NSHA 1IJ5A 3OHMB 3FE9A 1C7VA 2LUXA 3CZ2A 3SG4A 1KFUS 2GGZA 2KI6C 3TDIA 3I5IB 1AUIB 2MHHA 3KF9A 3PN7B 5I2QA 3DVJA 3B86A 2E6WA 2ISDA 4FQTA 2COLB 2KLDA 1J7OA 1DJHA 1MXEA 1L7ZA 2G9BA 1B1GA 5KTYA 3H4SE 2M7NA 5I2LA
chains in the Genus database with same CATH topology
1XO5A 1BMOA 1JF0A 1QLSA 2LP3A 4MRYA 4MZKA 3FIAA 2OS8B 1TNWA 1KQVA 1SL8A 2BL0C 1SPYA 1AJ4A 3DD4A 3CWGA 2QPTA 5AANA 1K2HA 1OZOA 4MZLA 2WC8A 1AHRA 2WORA 3PSRA 5G08A 3LL8B 3PM8A 5IBWA 4YGBB 1BR1B 3PN7C 2NXQA 3TUYB 2HPSA 4DUQA 1NCYA 4GAOA 3SG5A 1UP5A 2KFHA 1IKUA 1B8RA 2OPOA 1JF2A 4IL1A 2HF5A 1XA5A 1TOPA 1SCVA 2PSRA 2I2RE 2LM5A 1BLQA 1QASA 2CTNA 3LK0A 1H8BA 2I7AA 2PALA 5ER5A 3D0YA 4ZCVA 1PALA 3EK8A 1A03A 2ZRSA 1DJIA 1SR6C 1YX8A 2FOTA 3VRQA 5J3XA 1TTXA 5AXIA 2O60A 1KK8B 1MF8B 1K9PA 1TNQA 1XFXO 1EL4A 1PK0D 2M49B 2LMUA 4I5NB 1Y1UA 1BR4B 3BOWB 1J1EA 5F6TA 3NXAA 1SL7A 4WQ2A 5K89A 1EH2A 1WLMA 3EK7A 1F8HA 1MUXA 2LMTA 1ZMZA 5HLOA 5PALA 5CSNA 3SG2A 1QTXA 1QJTA 4R1EA 2KGBC 1F4QA 2F2OA 3BXKA 2WNDA 3CLNA 1OOJA 3O78A 4GGFA 1UUSA 2KGRA 3KHEA 3LK1A 1WRZA 3DVEA 1GGZA 4OKHA 4P2YB 1S5GY 1ZUZA 1FW4A 4GFTA 2I94A 2IS9A 2K7DA 1LA3A 1QVIY 1YVLA 2EC6C 2K7CA 1GJYA 3GOFA 1C07A 1KQMC 1XK4A 1YUSA 4ORBB 2LCPA 1EG3A 1BG1A 1CFDA 1JC2A 4GPLB 1F55A 1SW8A 2KFFA 2H61C 1AP4A 1OMDA 1K96A 1WY9A 1CDMA 2KQ6A 1AVSA 5HKZA 3SIBA 1DJWA 3MSEB 1DVIA 2LP2A 2F2PA 4I5KA 2FCDA 3EK4A 2JNFA 2F8PA 2JNXA 1U5IA 2BCXA 4PE0A 1SBJA 2R2IA 1B47A 3I5FB 4PHJA 1C7WA 2CXJA 5DKQA 2NZ0A 4YGCB 2KDHA 2BL0B 1QS7A 3SG7A 1WDCC 4A4CA 1CNPA 1S1EA 2LAPA 1OSAA 4QJ3B 3WXAA 5I8NA 2B1UA 4YGDB 2FCEA 4XYNA 1IQ5A 1LXFC 1SCMB 2LV7A 1TRFA 5CSIA 1IQ3A 5D7FA 1PRWA 2LANA 3O6BA 4MVFA 3I5GC 1DT7B 1RWYA 1NWDA 1B7TY 1QIWA 4PE1A 4OV2A 4MEWA 1OMRA 1ALWA 4N1GA 1JUOA 2ZRTA 2LC5A 3CTNA 1ZOTB 4FQOA 4YGAA 1J55A 1S5GZ 4C0LA 1F4OA 4F0ZB 1WLZA 4BY4A 1J1DA 1UHHA 3I5FC 3IF7A 1B8CA 2M7LA 1YR5A 3BUXB 1S6JA 3GK2A 5AEQA 5HKYA 3PFVA 3F45A 1UWOA 4QJ5B 3EKHA 3M0WA 1SR6B 1BF5A 2KOTA 1BU3A 3KO0A 1S26D 5KU1A 1XFWO 1XYDA 3FS7A 2K2FA 4PHNA 4HREE 1SCMC 3SG6A 3SIAA 3TS5C 3LLEA 2KFGA 1KSOA 2M0RA 1QXPA 3A8RA 4XJKA 2KBIA 3EKJA 2BBMA 1OZSA 1N2DA 2LVKA 1J7RA 1XFYO 1CMGA 2Y4QA 3EVUA 3OX6A 2MLFC 2P6BB 2CBLA 1IG5A 1IRJA 4C0JA 2BKIB 1UHNA 2K7OA 2M8UA 2SASA 3OB1B 4C0KA 1MQ1A 1GQMA 1W7IB 3DF0B 4PHKA 1BODA 3I5HC 2L51A 1A4PA 1MXLC 1NPQA 1QV1A 2LVIA 1DMOA 3NSOA 1ODBA 2Q91A 1DF0B 3HX4A 1B7TZ 1MWNA 1A2XA 4GBAA 1CFCA 2EC6B 1KSMA 3D10A 1PSRA 4CIDA 5CSJA 1KQMB 2F3ZA 2LLTA 4NDBA 5KSZA 3PATA 4MBEA 4Q04A 1F71A 1NX1A 4MSPA 2L4IA 2LLUA 2GV5A 2JXCA 2M1UA 4YRUA 3VRPA 1KFXL 4HRGA 2K7BA 4JQ0D 1NYAA 4GGNA 4NDCA 2DOQA 1CLMA 4WRIA 2AUCA 1KCYA 2BBNA 1A75B 1K9KA 1DJZA 1KFXS 1OMVA 2JT8A 2M97A 1SKTA 2H2KA 4M2PA 3WNXB 1F54A 3DVKA 1XVJA 1UHIA 3OP0A 4WQ3A 2ZFDA 5CPVA 1YX7A 1XK4C 2HETA 3TDZA 1QATA 3JTDC 2A4JA 3BUMB 1YUTA 2BKHB 2MA2A 1WDCB 5B8IB 2MRDA 1JBAA 2LVJA 4A4BA 1QX5B 2MAZA 2PMYA 1SY9A 1Y6WA 1DGVA 1PULA 3O4YA 2JQ6A 1K8UA 2NCPA 4I5LB 3I5GB 3WHTB 4CPVA 5HLVA 2MBXA 1CM1A 1MHOA 1YRTB 3CR4X 1Y1XA 4HRHA 2Y1MA 1DJYA 1XFVO 3PLFB 1V1FA 4P5OE 2JC2A 2JTZA 1B8LA 2BE6A 1TN4A 2KYCA 4DS7A 2G2BA 1JFKA 2ZNEA 1HT9A 2AMIA 1AK8A 1JFJA 4E68A 5GQQC 1QLKA 3NSIA 3JVTC 2VRGA 1FI6A 2K61A 1RECA 2KQYA 2D8NA 1BT6A 2LNKA 1PVBA 1Y1AA 2JULA 3AAJA 1S36A 1ZACA 1K93D 4MLWA 3TS5B 1HQVA 4YGEB 1RK9A 2BE4A 3BOWA 5HKWA 3VGOA 1S3PA 4DCKA 1CDNA 3ZNIA 2NLNA 1B9AA 2LUCA 2KAVA 2KAXA 3CR5X 3RLZA 3SJSA 1E8AA 1Y0VH 3SG3A 1M31A 1M46A 2WOSA 1CKKA 3FWCA 1TIZA 1LVCD 3D0YB 4M2QA 4CFQA 3OB2B 2JXLA 1SK6D 3OX5A 4ETOA 1QVIZ 1W7JB 1R6PA 1A29A 1NX0A 2ZKMX 5TNCA 2LE9B 3I5HB 4MN0A 1NP8A 4PE4A 4DIRA 1BJFA 2KAYA 4YI9A 1NCZA 3QRXA 3PALA 2OTGB 4ORCB 1BOCA 2KBMA 4NDDA 1SMGA 4D1EA 2MLEC 1RJVA 1UHKA 5BPJA 4GNKB 3BUNB 1KWOC 3GK4X 1TNPA 2M29A 1WRKA 2KHNA 2ZN8A 3BUOB 2TN4A 1CTRA 4I5JA 2K8MB 1QV0A 2WCFA 2BCBA 1L2OC 3AKAA 1UURA 1CM4A 1QIVA 1QX2A 2JT0A 2JPTA 3VRNA 1B4CA 2Y5IA 2NCOA 4HSZA 1DTLA 1G8IA 1RTP1 2KI4C 2Y1NA 2MJWB 2M9GA 1K94A 3CGAA 3NSLA 4PHMA 2V53A 1F70A 2JTTA 1D1OA 1FPWA 1M63B 1IH0A 4JWQA 1XFZO 2KSPA 1VRKA 1OQPA 2LVVA 4L9MA 1X02A 2CT9A 3BUWB 2EGDA 4PE7A 3IQOA 2FJUB 2HQWA 3BYAA 3WHUB 4BY5A 2EHBA 1QX7A 2CNPA 2OTGC 3I5IC 1CB1A 5CSFA 2JOJA 2F33A 4PCWA 1OE9B 3JTDB 3TDUA 4USLA 1DJGA 1Q80A 2LMVA 1NIWA 1S6IA 2M3WA 1KK7Y 4AQIA 1SRAA 3BQ3A 5JJGA 1EG4A 3FWBA 2HQ8A 5JOLA 1FBVA 4ICBA 5D69A 2PASA 1N65A 1NCXA 4OVNF 5AERA 2OS8C 4GGFC 5DKRA 4MZJA 2JRFA 4AQJA 1U5IB 1LKJA 3LCPC 5ER4X 2PRUA 4PDZA 1IGVA 1FI5A 2PVBA 2L98A 2LHIA 1YTZC 1YVHA 1V1GA 4OCIA 3KPXA 2I18A 1G33A 2L50A 5FYXA 1J7QA 3JVTB 1XFUO 4TNCA 1JSAA 2Q4UA 4YI8A 1ZFSA 1DJXA 1SNLA 1MR8A 3TUYC 2E30A 2QACA 4AOMA 2JU0A 1CFFA 3EVVA 1WRLA 1CMFA 1FF1A 1DGUA 3IQQA 3GK1A 3O2PA 4YBHB 1CDLA 2O5GA 5HYDA 4PALA 2JT3A 1K90D 1YRUB 3RM1A 4JPZB 1NUBA 2K0JA 2BCAA 3CR2A 2SCPA 4FTGA 1EJ3A 1N0YA 1NX3A 2KYFA 3DF0A 1S6CA 2KI6D 3C1VA 1KK8C 1YURA 1AJ5A 2JZIA 4ZCUA 5DKNA 4DRWA 4QJ4B 3E3RA 1M39A 2L5XB 4MRXA 1CLBA 4U8DA 1GGWA 4NQGA 3CS1A 1SYMA 2ZN9A 1SL9A 1DF0A 1G4YR 4UPGA 1KK7Z 2K2AA 1TCFA 1CLLA 4OR9B 1M45A 4N1FA 4CLNA 3TZ1A 3VROA 4XJKB 1PSBA 1K9UA 2AAOA 1YUUA 2GGMA 3EVRA 3NSKA 3A4UB 1UHJA 1CFPA 1KWOB 1TNXA 1IWQA 1CDPA 2CCMA 3AKBA 2LHLA 3DVMA 1H4BA 3K21A 2WCBA 1RROA 1PVAA 2JWWA 1J7PA 2H61A 2ZNDA 1EXRA 1LA0A 3HCMA 4CFRA 2M1KB 1L2OB 1R2UA 2WCEA 1RFJA 4ORAB 2BECA 4GUKA 1A75A 1LINA 3AAKA 3CZTX 4M2OA 4N5XA 5I2OA 2KI4B 1JWDA 2L4HA 2KNEA 5AFPA 3VRRA 1K95A 3ICBA 2RGIA 3ZWHA 2L2EA 2L0PA 1KFUL 1NX2A 3KEVA 1TCOB 1IJ6A 1ALVA 2F3YA 2LLSA 1NSHA 1IJ5A 3OHMB 1C7VA 2LUXA 3SG4A 1KFUS 2GGZA 2KI6C 3TDIA 3I5IB 1AUIB 2MHHA 3KF9A 3PN7B 5I2QA 3DVJA 2E6WA 2ISDA 2COLB 1J7OA 1DJHA 1MXEA 1L7ZA 2G9BA 1B1GA 5KTYA 3H4SE 2M7NA 5I2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XO5 A;  1BMO A;  1JF0 A;  1QLS A;  2LP3 A;  4MRY A;  4MZK A;  3FIA A;  2OS8 B;  1TNW A;  1KQV A;  1SL8 A;  2BL0 C;  1SPY A;  1AJ4 A;  3DD4 A;  3CWG A;  2QPT A;  5AAN A;  1K2H A;  1OZO A;  4MZL A;  2WC8 A;  1AHR A;  2WOR A;  3PSR A;  5G08 A;  3LL8 B;  3PM8 A;  5IBW A;  4YGB B;  1BR1 B;  3PN7 C;  2NXQ A;  3TUY B;  2HPS A;  4DUQ A;  1NCY A;  4GAO A;  3SG5 A;  1UP5 A;  2KFH A;  1IKU A;  1B8R A;  2OPO A;  1JF2 A;  4IL1 A;  2HF5 A;  1XA5 A;  1TOP A;  1SCV A;  2PSR A;  2I2R E;  2LM5 A;  1BLQ A;  1QAS A;  2CTN A;  3LK0 A;  1H8B A;  2I7A A;  2PAL A;  5ER5 A;  3D0Y A;  4ZCV A;  1PAL A;  3EK8 A;  1A03 A;  2ZRS A;  1DJI A;  1SR6 C;  1YX8 A;  2FOT A;  3VRQ A;  5J3X A;  1TTX A;  5AXI A;  2O60 A;  1KK8 B;  1MF8 B;  1K9P A;  1TNQ A;  1XFX O;  1EL4 A;  1PK0 D;  2M49 B;  2LMU A;  4I5N B;  1Y1U A;  1BR4 B;  3BOW B;  1J1E A;  5F6T A;  3NXA A;  1SL7 A;  4WQ2 A;  5K89 A;  1EH2 A;  1WLM A;  3EK7 A;  1F8H A;  1MUX A;  2LMT A;  1ZMZ A;  5HLO A;  5PAL A;  5CSN A;  3SG2 A;  1QTX A;  1QJT A;  4R1E A;  2KGB C;  1F4Q A;  2F2O A;  3BXK A;  2WND A;  3CLN A;  1OOJ A;  3O78 A;  4GGF A;  1UUS A;  2KGR A;  3KHE A;  3LK1 A;  1WRZ A;  3DVE A;  1GGZ A;  4OKH A;  4P2Y B;  1S5G Y;  1ZUZ A;  1FW4 A;  4GFT A;  2I94 A;  2IS9 A;  2K7D A;  1LA3 A;  1QVI Y;  1YVL A;  2EC6 C;  2K7C A;  1GJY A;  3GOF A;  1C07 A;  1KQM C;  1XK4 A;  1YUS A;  4ORB B;  2LCP A;  1EG3 A;  1BG1 A;  1CFD A;  1JC2 A;  4GPL B;  1F55 A;  1SW8 A;  2KFF A;  2H61 C;  1AP4 A;  1OMD A;  1K96 A;  1WY9 A;  1CDM A;  2KQ6 A;  1AVS A;  5HKZ A;  3SIB A;  1DJW A;  3MSE B;  1DVI A;  2LP2 A;  2F2P A;  4I5K A;  2FCD A;  3EK4 A;  2JNF A;  2F8P A;  2JNX A;  1U5I A;  2BCX A;  4PE0 A;  1SBJ A;  2R2I A;  1B47 A;  3I5F B;  4PHJ A;  1C7W A;  2CXJ A;  5DKQ A;  2NZ0 A;  4YGC B;  2KDH A;  2BL0 B;  1QS7 A;  3SG7 A;  1WDC C;  4A4C A;  1CNP A;  1S1E A;  2LAP A;  1OSA A;  4QJ3 B;  3WXA A;  5I8N A;  2B1U A;  4YGD B;  2FCE A;  4XYN A;  1IQ5 A;  1LXF C;  1SCM B;  2LV7 A;  1TRF A;  5CSI A;  1IQ3 A;  5D7F A;  1PRW A;  2LAN A;  3O6B A;  4MVF A;  3I5G C;  1DT7 B;  1RWY A;  1NWD A;  1B7T Y;  1QIW A;  4PE1 A;  4OV2 A;  4MEW A;  1OMR A;  1ALW A;  4N1G A;  1JUO A;  2ZRT A;  2LC5 A;  3CTN A;  1ZOT B;  4FQO A;  4YGA A;  1J55 A;  1S5G Z;  4C0L A;  1F4O A;  4F0Z B;  1WLZ A;  4BY4 A;  1J1D A;  1UHH A;  3I5F C;  3IF7 A;  1B8C A;  2M7L A;  1YR5 A;  3BUX B;  1S6J A;  3GK2 A;  5AEQ A;  5HKY A;  3PFV A;  3F45 A;  1UWO A;  4QJ5 B;  3EKH A;  3M0W A;  1SR6 B;  1BF5 A;  2KOT A;  1BU3 A;  3KO0 A;  1S26 D;  5KU1 A;  1XFW O;  1XYD A;  3FS7 A;  2K2F A;  4PHN A;  4HRE E;  1SCM C;  3SG6 A;  3SIA A;  3TS5 C;  3LLE A;  2KFG A;  1KSO A;  2M0R A;  1QXP A;  3A8R A;  4XJK A;  2KBI A;  3EKJ A;  2BBM A;  1OZS A;  1N2D A;  2LVK A;  1J7R A;  1XFY O;  1CMG A;  2Y4Q A;  3EVU A;  3OX6 A;  2MLF C;  2P6B B;  2CBL A;  1IG5 A;  1IRJ A;  4C0J A;  2BKI B;  1UHN A;  2K7O A;  2M8U A;  2SAS A;  3OB1 B;  4C0K A;  1MQ1 A;  1GQM A;  1W7I B;  3DF0 B;  4PHK A;  1BOD A;  3I5H C;  2L51 A;  1A4P A;  1MXL C;  1NPQ A;  1QV1 A;  2LVI A;  1DMO A;  3NSO A;  1ODB A;  2Q91 A;  1DF0 B;  3HX4 A;  1B7T Z;  1MWN A;  1A2X A;  4GBA A;  1CFC A;  2EC6 B;  1KSM A;  3D10 A;  1PSR A;  4CID A;  5CSJ A;  1KQM B;  2F3Z A;  2LLT A;  4NDB A;  5KSZ A;  3PAT A;  4MBE A;  4Q04 A;  1F71 A;  1NX1 A;  4MSP A;  2L4I A;  2LLU A;  2GV5 A;  2JXC A;  2M1U A;  4YRU A;  3VRP A;  1KFX L;  4HRG A;  2K7B A;  4JQ0 D;  1NYA A;  4GGN A;  4NDC A;  2DOQ A;  1CLM A;  4WRI A;  2AUC A;  1KCY A;  2BBN A;  1A75 B;  1K9K A;  1DJZ A;  1KFX S;  1OMV A;  2JT8 A;  2M97 A;  1SKT A;  2H2K A;  4M2P A;  3WNX B;  1F54 A;  3DVK A;  1XVJ A;  1UHI A;  3OP0 A;  4WQ3 A;  2ZFD A;  5CPV A;  1YX7 A;  1XK4 C;  2HET A;  3TDZ A;  1QAT A;  3JTD C;  2A4J A;  3BUM B;  1YUT A;  2BKH B;  2MA2 A;  1WDC B;  5B8I B;  2MRD A;  1JBA A;  2LVJ A;  4A4B A;  1QX5 B;  2MAZ A;  2PMY A;  1SY9 A;  1Y6W A;  1DGV A;  1PUL A;  3O4Y A;  2JQ6 A;  1K8U A;  2NCP A;  4I5L B;  3I5G B;  3WHT B;  4CPV A;  5HLV A;  2MBX A;  1CM1 A;  1MHO A;  1YRT B;  3CR4 X;  1Y1X A;  4HRH A;  2Y1M A;  1DJY A;  1XFV O;  3PLF B;  1V1F A;  4P5O E;  2JC2 A;  2JTZ A;  1B8L A;  2BE6 A;  1TN4 A;  2KYC A;  4DS7 A;  2G2B A;  1JFK A;  2ZNE A;  1HT9 A;  2AMI A;  1AK8 A;  1JFJ A;  4E68 A;  5GQQ C;  1QLK A;  3NSI A;  3JVT C;  2VRG A;  1FI6 A;  2K61 A;  1REC A;  2KQY A;  2D8N A;  1BT6 A;  2LNK A;  1PVB A;  1Y1A A;  2JUL A;  3AAJ A;  1S36 A;  1ZAC A;  1K93 D;  4MLW A;  3TS5 B;  1HQV A;  4YGE B;  1RK9 A;  2BE4 A;  3BOW A;  5HKW A;  3VGO A;  1S3P A;  4DCK A;  1CDN A;  3ZNI A;  2NLN A;  1B9A A;  2LUC A;  2KAV A;  2KAX A;  3CR5 X;  3RLZ A;  3SJS A;  1E8A A;  1Y0V H;  3SG3 A;  1M31 A;  1M46 A;  2WOS A;  1CKK A;  3FWC A;  1TIZ A;  1LVC D;  3D0Y B;  4M2Q A;  4CFQ A;  3OB2 B;  2JXL A;  1SK6 D;  3OX5 A;  4ETO A;  1QVI Z;  1W7J B;  1R6P A;  1A29 A;  1NX0 A;  2ZKM X;  5TNC A;  2LE9 B;  3I5H B;  4MN0 A;  1NP8 A;  4PE4 A;  4DIR A;  1BJF A;  2KAY A;  4YI9 A;  1NCZ A;  3QRX A;  3PAL A;  2OTG B;  4ORC B;  1BOC A;  2KBM A;  4NDD A;  1SMG A;  4D1E A;  2MLE C;  1RJV A;  1UHK A;  5BPJ A;  4GNK B;  3BUN B;  1KWO C;  3GK4 X;  1TNP A;  2M29 A;  1WRK A;  2KHN A;  2ZN8 A;  3BUO B;  2TN4 A;  1CTR A;  4I5J A;  2K8M B;  1QV0 A;  2WCF A;  2BCB A;  1L2O C;  3AKA A;  1UUR A;  1CM4 A;  1QIV A;  1QX2 A;  2JT0 A;  2JPT A;  3VRN A;  1B4C A;  2Y5I A;  2NCO A;  4HSZ A;  1DTL A;  1G8I A;  1RTP 1;  2KI4 C;  2Y1N A;  2MJW B;  2M9G A;  1K94 A;  3CGA A;  3NSL A;  4PHM A;  2V53 A;  1F70 A;  2JTT A;  1D1O A;  1FPW A;  1M63 B;  1IH0 A;  4JWQ A;  1XFZ O;  2KSP A;  1VRK A;  1OQP A;  2LVV A;  4L9M A;  1X02 A;  2CT9 A;  3BUW B;  2EGD A;  4PE7 A;  3IQO A;  2FJU B;  2HQW A;  3BYA A;  3WHU B;  4BY5 A;  2EHB A;  1QX7 A;  2CNP A;  2OTG C;  3I5I C;  1CB1 A;  5CSF A;  2JOJ A;  2F33 A;  4PCW A;  1OE9 B;  3JTD B;  3TDU A;  4USL A;  1DJG A;  1Q80 A;  2LMV A;  1NIW A;  1S6I A;  2M3W A;  1KK7 Y;  4AQI A;  1SRA A;  3BQ3 A;  5JJG A;  1EG4 A;  3FWB A;  2HQ8 A;  5JOL A;  1FBV A;  4ICB A;  5D69 A;  2PAS A;  1N65 A;  1NCX A;  4OVN F;  5AER A;  2OS8 C;  4GGF C;  5DKR A;  4MZJ A;  2JRF A;  4AQJ A;  1U5I B;  1LKJ A;  3LCP C;  5ER4 X;  2PRU A;  4PDZ A;  1IGV A;  1FI5 A;  2PVB A;  2L98 A;  2LHI A;  1YTZ C;  1YVH A;  1V1G A;  4OCI A;  3KPX A;  2I18 A;  1G33 A;  2L50 A;  5FYX A;  1J7Q A;  3JVT B;  1XFU O;  4TNC A;  1JSA A;  2Q4U A;  4YI8 A;  1ZFS A;  1DJX A;  1SNL A;  1MR8 A;  3TUY C;  2E30 A;  2QAC A;  4AOM A;  2JU0 A;  1CFF A;  3EVV A;  1WRL A;  1CMF A;  1FF1 A;  1DGU A;  3IQQ A;  3GK1 A;  3O2P A;  4YBH B;  1CDL A;  2O5G A;  5HYD A;  4PAL A;  2JT3 A;  1K90 D;  1YRU B;  3RM1 A;  4JPZ B;  1NUB A;  2K0J A;  2BCA A;  3CR2 A;  2SCP A;  4FTG A;  1EJ3 A;  1N0Y A;  1NX3 A;  2KYF A;  3DF0 A;  1S6C A;  2KI6 D;  3C1V A;  1KK8 C;  1YUR A;  1AJ5 A;  2JZI A;  4ZCU A;  5DKN A;  4DRW A;  4QJ4 B;  3E3R A;  1M39 A;  2L5X B;  4MRX A;  1CLB A;  4U8D A;  1GGW A;  4NQG A;  3CS1 A;  1SYM A;  2ZN9 A;  1SL9 A;  1DF0 A;  1G4Y R;  4UPG A;  1KK7 Z;  2K2A A;  1TCF A;  1CLL A;  4OR9 B;  1M45 A;  4N1F A;  4CLN A;  3TZ1 A;  3VRO A;  4XJK B;  1PSB A;  1K9U A;  2AAO A;  1YUU A;  2GGM A;  3EVR A;  3NSK A;  3A4U B;  1UHJ A;  1CFP A;  1KWO B;  1TNX A;  1IWQ A;  1CDP A;  2CCM A;  3AKB A;  2LHL A;  3DVM A;  1H4B A;  3K21 A;  2WCB A;  1RRO A;  1PVA A;  2JWW A;  1J7P A;  2H61 A;  2ZND A;  1EXR A;  1LA0 A;  3HCM A;  4CFR A;  2M1K B;  1L2O B;  1R2U A;  2WCE A;  1RFJ A;  4ORA B;  2BEC A;  4GUK A;  1A75 A;  1LIN A;  3AAK A;  3CZT X;  4M2O A;  4N5X A;  5I2O A;  2KI4 B;  1JWD A;  2L4H A;  2KNE A;  5AFP A;  3VRR A;  1K95 A;  3ICB A;  2RGI A;  3ZWH A;  2L2E A;  2L0P A;  1KFU L;  1NX2 A;  3KEV A;  1TCO B;  1IJ6 A;  1ALV A;  2F3Y A;  2LLS A;  1NSH A;  1IJ5 A;  3OHM B;  1C7V A;  2LUX A;  3SG4 A;  1KFU S;  2GGZ A;  2KI6 C;  3TDI A;  3I5I B;  1AUI B;  2MHH A;  3KF9 A;  3PN7 B;  5I2Q A;  3DVJ A;  2E6W A;  2ISD A;  2COL B;  1J7O A;  1DJH A;  1MXE A;  1L7Z A;  2G9B A;  1B1G A;  5KTY A;  3H4S E;  2M7N A;  5I2L A; 
#chains in the Genus database with same CATH topology
 1XO5 A;  4INW A;  1BMO A;  1JF0 A;  1QLS A;  2LP3 A;  4MRY A;  4MZK A;  3FIA A;  2OS8 B;  1TNW A;  1KQV A;  1SL8 A;  3NGV A;  2BL0 C;  1SPY A;  1AJ4 A;  3DD4 A;  3CWG A;  2QPT A;  1Z2C B;  5AAN A;  1K2H A;  1OZO A;  4MZL A;  2WC8 A;  1AHR A;  2WOR A;  3PSR A;  5G08 A;  3LL8 B;  3PM8 A;  5IBW A;  2BNX A;  4YGB B;  1BR1 B;  3PN7 C;  2NXQ A;  3TUY B;  2HPS A;  4DUQ A;  1NCY A;  4GAO A;  3B6X A;  1UP5 A;  2KFH A;  3SG5 A;  1B8R A;  1IKU A;  2OPO A;  1JF2 A;  3R1P A;  4IL1 A;  2HF5 A;  1XA5 A;  1TOP A;  3PM2 A;  1SCV A;  2PSR A;  2PQL A;  2I2R E;  2LM5 A;  1BLQ A;  1QAS A;  2CTN A;  3LK0 A;  1H8B A;  2I7A A;  3SS4 A;  3B87 A;  2PAL A;  5ER5 A;  3D0Y A;  4ZCV A;  4OZD A;  3D74 A;  3IVT A;  1PAL A;  3EK8 A;  1A03 A;  2ZRS A;  1DJI A;  1SR6 C;  1YX8 A;  2FOT A;  3VRQ A;  5J3X A;  1ORG A;  1TTX A;  5AXI A;  2O60 A;  1KK8 B;  1MF8 B;  1K9P A;  1TNQ A;  1XFX O;  1EL4 A;  3K1E A;  1PK0 D;  2M49 B;  2LMU A;  4I5N B;  1Y1U A;  3CAB A;  5FI6 A;  1BR4 B;  3BOW B;  1J1E A;  5F6T A;  2WCJ A;  1SL7 A;  3NXA A;  4WQ2 A;  5K89 A;  1EH2 A;  3QME A;  1WLM A;  3EK7 A;  1F8H A;  1MUX A;  2LMT A;  3R72 A;  1ZMZ A;  5HLO A;  5PAL A;  5CSN A;  3SG2 A;  1QTX A;  1QJT A;  4R1E A;  2KGB C;  3FE8 A;  1F4Q A;  2F2O A;  3BXK A;  2WND A;  3CLN A;  1OOJ A;  3O78 A;  4GGF A;  1UUS A;  3RZS A;  2KGR A;  3KHE A;  3LK1 A;  1WRZ A;  4INX A;  3DVE A;  1GGZ A;  4OKH A;  4P2Y B;  1S5G Y;  1ZUZ A;  1FW4 A;  4GFT A;  2I94 A;  2IS9 A;  3DYE A;  2K7D A;  1LA3 A;  1QVI Y;  1YVL A;  2EC6 C;  2JPO A;  2K7C A;  3D77 A;  1GJY A;  3GOF A;  3L4L A;  1C07 A;  1DQE A;  1KQM C;  1XK4 A;  3O4X A;  1YUS A;  4ORB B;  3L4A A;  2QDI A;  1TUJ A;  2LCP A;  1EG3 A;  1BG1 A;  1IIO A;  1CFD A;  1JC2 A;  5D3O A;  4GPL B;  1F55 A;  1SW8 A;  2KFF A;  2H61 C;  1AP4 A;  1OMD A;  1K96 A;  1WY9 A;  1CDM A;  2KQ6 A;  1AVS A;  5HKZ A;  3B88 A;  3SIB A;  1DJW A;  3MSE B;  1DVI A;  2LP2 A;  2P70 A;  3D75 A;  2F2P A;  4I5K A;  2FCD A;  3EK4 A;  2JNF A;  2F8P A;  2JNX A;  1U5I A;  2YGU A;  2BCX A;  4PE0 A;  1SBJ A;  2R2I A;  1B47 A;  3I5F B;  4PHJ A;  1C3Y A;  1C7W A;  2CXJ A;  5DKQ A;  2NZ0 A;  2WCH A;  4IJ7 A;  4YGC B;  2KDH A;  2BL0 B;  1QS7 A;  1Z4H A;  1WDC C;  3SG7 A;  4A4C A;  1CNP A;  1S1E A;  2LAP A;  1OSA A;  4QJ3 B;  3WXA A;  5I8N A;  2B1U A;  4YGD B;  2FCE A;  4XYN A;  1IQ5 A;  1LXF C;  1SCM B;  2WCL A;  2LV7 A;  1TRF A;  1XFR A;  3S0E A;  5CSI A;  1IQ3 A;  5D7F A;  1PRW A;  2LAN A;  3O6B A;  4MVF A;  3I5G C;  1DT7 B;  1RWY A;  1NWD A;  1B7T Y;  1QIW A;  4PE1 A;  4OV2 A;  4MEW A;  1OMR A;  2QEH A;  1ALW A;  4N1G A;  1JUO A;  2ZRT A;  2LC5 A;  3CTN A;  1ZOT B;  4FQO A;  3BFH A;  4YGA A;  1J55 A;  1S5G Z;  4C0L A;  1F4O A;  3S0D A;  4F0Z B;  1WLZ A;  4BY4 A;  1J1D A;  5DIC A;  1UHH A;  3I5F C;  3IF7 A;  1B8C A;  2M7L A;  1YR5 A;  3BUX B;  1S6J A;  3GK2 A;  3NHI A;  5AEQ A;  5HKY A;  3PFV A;  1QWV A;  3F45 A;  1UWO A;  4QJ5 B;  3EKH A;  3M0W A;  1SR6 B;  1BF5 A;  2KOT A;  1BU3 A;  3KO0 A;  1S26 D;  4JKT A;  5KU1 A;  1XFW O;  1SSE B;  1XYD A;  3FS7 A;  2K2F A;  4PHN A;  4HRE E;  1SCM C;  3SG6 A;  3SIA A;  3TS5 C;  2PYQ A;  3L47 A;  3LLE A;  2KFG A;  1KSO A;  2M0R A;  1QXP A;  3A8R A;  5I94 A;  4XJK A;  2KBI A;  3EKJ A;  2BBM A;  1OZS A;  1N2D A;  2FJY A;  2LVK A;  1J7R A;  3Q8I A;  1XFY O;  1CMG A;  2Y4Q A;  3EVU A;  3CDN A;  4KYN A;  3OX6 A;  2MLF C;  2P6B B;  2CBL A;  3FE6 A;  5FI2 A;  1IG5 A;  1IRJ A;  3OGN A;  4C0J A;  2BKI B;  1UHN A;  2K7O A;  2M8U A;  2SAS A;  3OB1 B;  4C0K A;  2L2C A;  3D76 A;  1MQ1 A;  1GQM A;  1W7I B;  1DEL A;  1W9Z A;  3DF0 B;  4PHK A;  3I5H C;  1BOD A;  2L51 A;  2KLE A;  1A4P A;  1MXL C;  1NPQ A;  1QV1 A;  2L5Y A;  2LVI A;  3NHT A;  1DMO A;  3NSO A;  1T14 A;  1ODB A;  2Q91 A;  1DF0 B;  3HX4 A;  3PJI A;  1B7T Z;  1MWN A;  1A2X A;  2WC5 A;  4GBA A;  2EC6 B;  1CFC A;  1KSM A;  3BJH A;  3D10 A;  1PSR A;  4CID A;  5CSJ A;  1KQM B;  2F3Z A;  2LLT A;  4NDB A;  5KSZ A;  3PAT A;  4MBE A;  4Q04 A;  5EL2 A;  1F71 A;  1NX1 A;  4MSP A;  2L4I A;  2LLU A;  2GV5 A;  2JXC A;  2M1U A;  4YRU A;  3VRP A;  1KFX L;  4HRG A;  2K7B A;  4JQ0 D;  1NYA A;  4GGN A;  3S0A A;  4NDC A;  2DOQ A;  1CLM A;  4WRI A;  2AUC A;  1KCY A;  2BBN A;  1A75 B;  1K9K A;  1DJZ A;  1KFX S;  1OMV A;  2JT8 A;  2M97 A;  1SKT A;  2H2K A;  2P71 A;  4M2P A;  3S0B A;  3WNX B;  3BFB A;  1XVJ A;  3DVK A;  1UHI A;  3OP0 A;  4WQ3 A;  1P28 A;  2ZFD A;  1YX7 A;  1XK4 C;  2HET A;  5CPV A;  3TDZ A;  1QAT A;  3JTD C;  2A4J A;  3BUM B;  1YUT A;  1C3Z A;  2BKH B;  2MA2 A;  1WDC B;  5B8I B;  2MRD A;  1JBA A;  2LVJ A;  3DZT A;  3V2L A;  4A4B A;  1QX5 B;  2MAZ A;  2PMY A;  1SY9 A;  1Y6W A;  3SS3 A;  1DGV A;  1PUL A;  3VB1 A;  3O4Y A;  2JQ6 A;  1K8U A;  2NCP A;  4I5L B;  3I5G B;  3WHT B;  4CPV A;  5HLV A;  2MBX A;  1CM1 A;  1MHO A;  1YRT B;  3CR4 X;  1Y1X A;  4HRH A;  2Y1M A;  1DJY A;  1XFV O;  3PLF B;  3S0F A;  1V1F A;  4P5O E;  2JC2 A;  2JTZ A;  1B8L A;  2BE6 A;  1TN4 A;  2KYC A;  4DS7 A;  2G2B A;  1JFK A;  2ZNE A;  1HT9 A;  2AMI A;  1DC1 A;  1AK8 A;  1JFJ A;  3UNW A;  4E68 A;  5GQQ C;  1QLK A;  3NSI A;  1TUZ A;  3JVT C;  2VRG A;  1FI6 A;  2K61 A;  2WCK A;  1REC A;  3N7H A;  1OOF A;  2KQY A;  2D8N A;  1BT6 A;  2LNK A;  1PVB A;  1Y1A A;  2JUL A;  3AAJ A;  1S36 A;  2ERB A;  1ZAC A;  3R1V A;  1K93 D;  4MLW A;  2QEO A;  3TS5 B;  1HQV A;  4YGE B;  1RK9 A;  2BE4 A;  3BOW A;  5HKW A;  3VGO A;  3EG5 B;  1S3P A;  4DCK A;  1CDN A;  3ZNI A;  2NLN A;  1B9A A;  2LUC A;  2KAV A;  2KAX A;  3CR5 X;  1OW4 A;  3RLZ A;  3SJS A;  1E8A A;  1Y0V H;  3SG3 A;  3D73 A;  1M31 A;  1M46 A;  1OOG A;  2WOS A;  1CKK A;  3FWC A;  1TIZ A;  1LVC D;  3D0Y B;  4M2Q A;  4CFQ A;  3OB2 B;  2JXL A;  1SK6 D;  2WC6 A;  3OX5 A;  4ETO A;  1QVI Z;  1W7J B;  1R6P A;  1A29 A;  1NX0 A;  2ZKM X;  5TNC A;  2LE9 B;  3I5H B;  4MN0 A;  1NP8 A;  4PE4 A;  4DIR A;  1BJF A;  2KAY A;  4YI9 A;  1NCZ A;  4PT1 A;  3QRX A;  3PAL A;  2OTG B;  4ORC B;  1BOC A;  2KBM A;  4NDD A;  1SMG A;  4D1E A;  2MLE C;  1RJV A;  1UHK A;  5BPJ A;  4GNK B;  3BUN B;  1KWO C;  3GK4 X;  1TNP A;  2M29 A;  1WRK A;  2KHN A;  2ZN8 A;  3BUO B;  2TN4 A;  1CTR A;  4I5J A;  2K8M B;  3S0G A;  1QV0 A;  2WCF A;  2BCB A;  1L2O C;  3AKA A;  1UUR A;  1CM4 A;  1QIV A;  1QX2 A;  2JT0 A;  2JPT A;  3VRN A;  1B4C A;  2Y5I A;  2NCO A;  4HSZ A;  1DTL A;  1G8I A;  1RTP 1;  2KI4 C;  2Y1N A;  2WCM A;  2MJW B;  2M9G A;  1K94 A;  3CGA A;  3NSL A;  3DXL A;  4PHM A;  2V53 A;  1F70 A;  2JTT A;  3DY9 A;  1D1O A;  1FPW A;  1M63 B;  1IH0 A;  4JWQ A;  1XFZ O;  2KSP A;  4JD9 A;  1VRK A;  1OQP A;  2LVV A;  4L9M A;  1X02 A;  2CT9 A;  3BUW B;  2EGD A;  2QEV A;  3IQO A;  2FJU B;  2HQW A;  3BYA A;  3WHU B;  4BY5 A;  3OBV A;  2EHB A;  1QX7 A;  2CNP A;  2OTG C;  3I5I C;  1CB1 A;  5CSF A;  2JOJ A;  2F33 A;  4PCW A;  1OE9 B;  3JTD B;  3TDU A;  4USL A;  3B7A A;  1DJG A;  1Q80 A;  2LMV A;  1NIW A;  1S6I A;  2M3W A;  1KK7 Y;  4AQI A;  3UO9 A;  3R1O A;  1SRA A;  3BQ3 A;  5JJG A;  1EG4 A;  3FWB A;  2HQ8 A;  5JOL A;  1FBV A;  4ICB A;  5D69 A;  2PAS A;  1N65 A;  1NCX A;  1TWO A;  4OVN F;  5AER A;  2OS8 C;  4GGF C;  5DKR A;  4MZJ A;  2JRF A;  4AQJ A;  1U5I B;  1LKJ A;  3LCP C;  5ER4 X;  2PRU A;  4PDZ A;  1IGV A;  1FI5 A;  2PVB A;  2L98 A;  1DEK A;  2LHI A;  1YTZ C;  1YVH A;  1GM0 A;  1V1G A;  4OCI A;  3KPX A;  2I18 A;  1G33 A;  1LS8 A;  2L50 A;  5FYX A;  1J7Q A;  3JVT B;  1XFU O;  4TNC A;  1JSA A;  2H8V A;  4PE7 A;  2Q4U A;  4YI8 A;  1ZFS A;  5HL1 A;  1DJX A;  2KPH A;  1SNL A;  1MR8 A;  3TUY C;  2E30 A;  2QAC A;  4AOM A;  2JU0 A;  1CFF A;  3EVV A;  1WRL A;  1CMF A;  1FF1 A;  1DGU A;  3IQQ A;  3GK1 A;  3O2P A;  4YBH B;  1CDL A;  2O5G A;  5HYD A;  4PAL A;  2JT3 A;  3D78 A;  1K90 D;  1YRU B;  3RM1 A;  3CZ0 A;  4JPZ B;  1NUB A;  2K0J A;  2BCA A;  3CR2 A;  2SCP A;  4FTG A;  1EJ3 A;  1N0Y A;  1NX3 A;  2KYF A;  3DF0 A;  1S6C A;  2KI6 D;  3C1V A;  3BFA A;  1KK8 C;  1YUR A;  1AJ5 A;  2JZI A;  3CYZ A;  5DKN A;  4ZCU A;  4DRW A;  3E3R A;  1M39 A;  2L5X B;  4MRX A;  4QJ4 B;  4U8D A;  1CLB A;  4NQG A;  3CS1 A;  1GGW A;  1SYM A;  2ZN9 A;  1SL9 A;  1DF0 A;  1OOH A;  1G4Y R;  2K60 A;  4UPG A;  1KK7 Z;  2K2A A;  1TCF A;  1CLL A;  2BAP A;  4OR9 B;  1M45 A;  4N1F A;  4CLN A;  3CZ1 A;  3TZ1 A;  3VRO A;  4XJK B;  1PSB A;  1K9U A;  2AAO A;  2GTE A;  1YUU A;  2GGM A;  3EVR A;  3NSK A;  3A4U B;  1UHJ A;  1CFP A;  1KWO B;  1TNX A;  1IWQ A;  1CDP A;  2CCM A;  3AKB A;  2LHL A;  3DVM A;  1H4B A;  3K21 A;  2WCB A;  1RRO A;  1PVA A;  2JWW A;  1J7P A;  2H61 A;  1F54 A;  2ZND A;  3SS5 A;  1EXR A;  1LA0 A;  3HCM A;  4CFR A;  4F7F A;  2M1K B;  1L2O B;  1R2U A;  2WCE A;  5FI7 A;  1OOI X;  1RFJ A;  4ORA B;  2BEC A;  4GUK A;  1A75 A;  1LIN A;  3AAK A;  3CZT X;  4M2O A;  4N5X A;  5I2O A;  2KI4 B;  1JWD A;  2L4H A;  2KNE A;  5AFP A;  2QEB A;  3VRR A;  1K95 A;  3ICB A;  2RGI A;  3ZWH A;  2L2E A;  2L0P A;  1KFU L;  1NX2 A;  3KEV A;  1TCO B;  1IJ6 A;  1ALV A;  2F3Y A;  2LLS A;  1NSH A;  1IJ5 A;  3OHM B;  3FE9 A;  1C7V A;  2LUX A;  3CZ2 A;  3SG4 A;  1KFU S;  2GGZ A;  2KI6 C;  3TDI A;  3I5I B;  1AUI B;  2MHH A;  3KF9 A;  3PN7 B;  5I2Q A;  3DVJ A;  3B86 A;  2E6W A;  2ISD A;  4FQT A;  2COL B;  2KLD A;  1J7O A;  1DJH A;  1MXE A;  1L7Z A;  2G9B A;  1B1G A;  5KTY A;  3H4S E;  2M7N A;  5I2L A; 
#chains in the Genus database with same CATH homology
 1XO5 A;  1BMO A;  1JF0 A;  1QLS A;  2LP3 A;  4MRY A;  4MZK A;  3FIA A;  2OS8 B;  1TNW A;  1KQV A;  1SL8 A;  2BL0 C;  1SPY A;  1AJ4 A;  3DD4 A;  3CWG A;  2QPT A;  5AAN A;  1K2H A;  1OZO A;  4MZL A;  2WC8 A;  1AHR A;  2WOR A;  3PSR A;  5G08 A;  3LL8 B;  3PM8 A;  5IBW A;  4YGB B;  1BR1 B;  3PN7 C;  2NXQ A;  3TUY B;  2HPS A;  4DUQ A;  1NCY A;  4GAO A;  3SG5 A;  1UP5 A;  2KFH A;  1IKU A;  1B8R A;  2OPO A;  1JF2 A;  4IL1 A;  2HF5 A;  1XA5 A;  1TOP A;  1SCV A;  2PSR A;  2I2R E;  2LM5 A;  1BLQ A;  1QAS A;  2CTN A;  3LK0 A;  1H8B A;  2I7A A;  2PAL A;  5ER5 A;  3D0Y A;  4ZCV A;  1PAL A;  3EK8 A;  1A03 A;  2ZRS A;  1DJI A;  1SR6 C;  1YX8 A;  2FOT A;  3VRQ A;  5J3X A;  1TTX A;  5AXI A;  2O60 A;  1KK8 B;  1MF8 B;  1K9P A;  1TNQ A;  1XFX O;  1EL4 A;  1PK0 D;  2M49 B;  2LMU A;  4I5N B;  1Y1U A;  1BR4 B;  3BOW B;  1J1E A;  5F6T A;  3NXA A;  1SL7 A;  4WQ2 A;  5K89 A;  1EH2 A;  1WLM A;  3EK7 A;  1F8H A;  1MUX A;  2LMT A;  1ZMZ A;  5HLO A;  5PAL A;  5CSN A;  3SG2 A;  1QTX A;  1QJT A;  4R1E A;  2KGB C;  1F4Q A;  2F2O A;  3BXK A;  2WND A;  3CLN A;  1OOJ A;  3O78 A;  4GGF A;  1UUS A;  2KGR A;  3KHE A;  3LK1 A;  1WRZ A;  3DVE A;  1GGZ A;  4OKH A;  4P2Y B;  1S5G Y;  1ZUZ A;  1FW4 A;  4GFT A;  2I94 A;  2IS9 A;  2K7D A;  1LA3 A;  1QVI Y;  1YVL A;  2EC6 C;  2K7C A;  1GJY A;  3GOF A;  1C07 A;  1KQM C;  1XK4 A;  1YUS A;  4ORB B;  2LCP A;  1EG3 A;  1BG1 A;  1CFD A;  1JC2 A;  4GPL B;  1F55 A;  1SW8 A;  2KFF A;  2H61 C;  1AP4 A;  1OMD A;  1K96 A;  1WY9 A;  1CDM A;  2KQ6 A;  1AVS A;  5HKZ A;  3SIB A;  1DJW A;  3MSE B;  1DVI A;  2LP2 A;  2F2P A;  4I5K A;  2FCD A;  3EK4 A;  2JNF A;  2F8P A;  2JNX A;  1U5I A;  2BCX A;  4PE0 A;  1SBJ A;  2R2I A;  1B47 A;  3I5F B;  4PHJ A;  1C7W A;  2CXJ A;  5DKQ A;  2NZ0 A;  4YGC B;  2KDH A;  2BL0 B;  1QS7 A;  3SG7 A;  1WDC C;  4A4C A;  1CNP A;  1S1E A;  2LAP A;  1OSA A;  4QJ3 B;  3WXA A;  5I8N A;  2B1U A;  4YGD B;  2FCE A;  4XYN A;  1IQ5 A;  1LXF C;  1SCM B;  2LV7 A;  1TRF A;  5CSI A;  1IQ3 A;  5D7F A;  1PRW A;  2LAN A;  3O6B A;  4MVF A;  3I5G C;  1DT7 B;  1RWY A;  1NWD A;  1B7T Y;  1QIW A;  4PE1 A;  4OV2 A;  4MEW A;  1OMR A;  1ALW A;  4N1G A;  1JUO A;  2ZRT A;  2LC5 A;  3CTN A;  1ZOT B;  4FQO A;  4YGA A;  1J55 A;  1S5G Z;  4C0L A;  1F4O A;  4F0Z B;  1WLZ A;  4BY4 A;  1J1D A;  1UHH A;  3I5F C;  3IF7 A;  1B8C A;  2M7L A;  1YR5 A;  3BUX B;  1S6J A;  3GK2 A;  5AEQ A;  5HKY A;  3PFV A;  3F45 A;  1UWO A;  4QJ5 B;  3EKH A;  3M0W A;  1SR6 B;  1BF5 A;  2KOT A;  1BU3 A;  3KO0 A;  1S26 D;  5KU1 A;  1XFW O;  1XYD A;  3FS7 A;  2K2F A;  4PHN A;  4HRE E;  1SCM C;  3SG6 A;  3SIA A;  3TS5 C;  3LLE A;  2KFG A;  1KSO A;  2M0R A;  1QXP A;  3A8R A;  4XJK A;  2KBI A;  3EKJ A;  2BBM A;  1OZS A;  1N2D A;  2LVK A;  1J7R A;  1XFY O;  1CMG A;  2Y4Q A;  3EVU A;  3OX6 A;  2MLF C;  2P6B B;  2CBL A;  1IG5 A;  1IRJ A;  4C0J A;  2BKI B;  1UHN A;  2K7O A;  2M8U A;  2SAS A;  3OB1 B;  4C0K A;  1MQ1 A;  1GQM A;  1W7I B;  3DF0 B;  4PHK A;  1BOD A;  3I5H C;  2L51 A;  1A4P A;  1MXL C;  1NPQ A;  1QV1 A;  2LVI A;  1DMO A;  3NSO A;  1ODB A;  2Q91 A;  1DF0 B;  3HX4 A;  1B7T Z;  1MWN A;  1A2X A;  4GBA A;  1CFC A;  2EC6 B;  1KSM A;  3D10 A;  1PSR A;  4CID A;  5CSJ A;  1KQM B;  2F3Z A;  2LLT A;  4NDB A;  5KSZ A;  3PAT A;  4MBE A;  4Q04 A;  1F71 A;  1NX1 A;  4MSP A;  2L4I A;  2LLU A;  2GV5 A;  2JXC A;  2M1U A;  4YRU A;  3VRP A;  1KFX L;  4HRG A;  2K7B A;  4JQ0 D;  1NYA A;  4GGN A;  4NDC A;  2DOQ A;  1CLM A;  4WRI A;  2AUC A;  1KCY A;  2BBN A;  1A75 B;  1K9K A;  1DJZ A;  1KFX S;  1OMV A;  2JT8 A;  2M97 A;  1SKT A;  2H2K A;  4M2P A;  3WNX B;  1F54 A;  3DVK A;  1XVJ A;  1UHI A;  3OP0 A;  4WQ3 A;  2ZFD A;  5CPV A;  1YX7 A;  1XK4 C;  2HET A;  3TDZ A;  1QAT A;  3JTD C;  2A4J A;  3BUM B;  1YUT A;  2BKH B;  2MA2 A;  1WDC B;  5B8I B;  2MRD A;  1JBA A;  2LVJ A;  4A4B A;  1QX5 B;  2MAZ A;  2PMY A;  1SY9 A;  1Y6W A;  1DGV A;  1PUL A;  3O4Y A;  2JQ6 A;  1K8U A;  2NCP A;  4I5L B;  3I5G B;  3WHT B;  4CPV A;  5HLV A;  2MBX A;  1CM1 A;  1MHO A;  1YRT B;  3CR4 X;  1Y1X A;  4HRH A;  2Y1M A;  1DJY A;  1XFV O;  3PLF B;  1V1F A;  4P5O E;  2JC2 A;  2JTZ A;  1B8L A;  2BE6 A;  1TN4 A;  2KYC A;  4DS7 A;  2G2B A;  1JFK A;  2ZNE A;  1HT9 A;  2AMI A;  1AK8 A;  1JFJ A;  4E68 A;  5GQQ C;  1QLK A;  3NSI A;  3JVT C;  2VRG A;  1FI6 A;  2K61 A;  1REC A;  2KQY A;  2D8N A;  1BT6 A;  2LNK A;  1PVB A;  1Y1A A;  2JUL A;  3AAJ A;  1S36 A;  1ZAC A;  1K93 D;  4MLW A;  3TS5 B;  1HQV A;  4YGE B;  1RK9 A;  2BE4 A;  3BOW A;  5HKW A;  3VGO A;  1S3P A;  4DCK A;  1CDN A;  3ZNI A;  2NLN A;  1B9A A;  2LUC A;  2KAV A;  2KAX A;  3CR5 X;  3RLZ A;  3SJS A;  1E8A A;  1Y0V H;  3SG3 A;  1M31 A;  1M46 A;  2WOS A;  1CKK A;  3FWC A;  1TIZ A;  1LVC D;  3D0Y B;  4M2Q A;  4CFQ A;  3OB2 B;  2JXL A;  1SK6 D;  3OX5 A;  4ETO A;  1QVI Z;  1W7J B;  1R6P A;  1A29 A;  1NX0 A;  2ZKM X;  5TNC A;  2LE9 B;  3I5H B;  4MN0 A;  1NP8 A;  4PE4 A;  4DIR A;  1BJF A;  2KAY A;  4YI9 A;  1NCZ A;  3QRX A;  3PAL A;  2OTG B;  4ORC B;  1BOC A;  2KBM A;  4NDD A;  1SMG A;  4D1E A;  2MLE C;  1RJV A;  1UHK A;  5BPJ A;  4GNK B;  3BUN B;  1KWO C;  3GK4 X;  1TNP A;  2M29 A;  1WRK A;  2KHN A;  2ZN8 A;  3BUO B;  2TN4 A;  1CTR A;  4I5J A;  2K8M B;  1QV0 A;  2WCF A;  2BCB A;  1L2O C;  3AKA A;  1UUR A;  1CM4 A;  1QIV A;  1QX2 A;  2JT0 A;  2JPT A;  3VRN A;  1B4C A;  2Y5I A;  2NCO A;  4HSZ A;  1DTL A;  1G8I A;  1RTP 1;  2KI4 C;  2Y1N A;  2MJW B;  2M9G A;  1K94 A;  3CGA A;  3NSL A;  4PHM A;  2V53 A;  1F70 A;  2JTT A;  1D1O A;  1FPW A;  1M63 B;  1IH0 A;  4JWQ A;  1XFZ O;  2KSP A;  1VRK A;  1OQP A;  2LVV A;  4L9M A;  1X02 A;  2CT9 A;  3BUW B;  2EGD A;  4PE7 A;  3IQO A;  2FJU B;  2HQW A;  3BYA A;  3WHU B;  4BY5 A;  2EHB A;  1QX7 A;  2CNP A;  2OTG C;  3I5I C;  1CB1 A;  5CSF A;  2JOJ A;  2F33 A;  4PCW A;  1OE9 B;  3JTD B;  3TDU A;  4USL A;  1DJG A;  1Q80 A;  2LMV A;  1NIW A;  1S6I A;  2M3W A;  1KK7 Y;  4AQI A;  1SRA A;  3BQ3 A;  5JJG A;  1EG4 A;  3FWB A;  2HQ8 A;  5JOL A;  1FBV A;  4ICB A;  5D69 A;  2PAS A;  1N65 A;  1NCX A;  4OVN F;  5AER A;  2OS8 C;  4GGF C;  5DKR A;  4MZJ A;  2JRF A;  4AQJ A;  1U5I B;  1LKJ A;  3LCP C;  5ER4 X;  2PRU A;  4PDZ A;  1IGV A;  1FI5 A;  2PVB A;  2L98 A;  2LHI A;  1YTZ C;  1YVH A;  1V1G A;  4OCI A;  3KPX A;  2I18 A;  1G33 A;  2L50 A;  5FYX A;  1J7Q A;  3JVT B;  1XFU O;  4TNC A;  1JSA A;  2Q4U A;  4YI8 A;  1ZFS A;  1DJX A;  1SNL A;  1MR8 A;  3TUY C;  2E30 A;  2QAC A;  4AOM A;  2JU0 A;  1CFF A;  3EVV A;  1WRL A;  1CMF A;  1FF1 A;  1DGU A;  3IQQ A;  3GK1 A;  3O2P A;  4YBH B;  1CDL A;  2O5G A;  5HYD A;  4PAL A;  2JT3 A;  1K90 D;  1YRU B;  3RM1 A;  4JPZ B;  1NUB A;  2K0J A;  2BCA A;  3CR2 A;  2SCP A;  4FTG A;  1EJ3 A;  1N0Y A;  1NX3 A;  2KYF A;  3DF0 A;  1S6C A;  2KI6 D;  3C1V A;  1KK8 C;  1YUR A;  1AJ5 A;  2JZI A;  4ZCU A;  5DKN A;  4DRW A;  4QJ4 B;  3E3R A;  1M39 A;  2L5X B;  4MRX A;  1CLB A;  4U8D A;  1GGW A;  4NQG A;  3CS1 A;  1SYM A;  2ZN9 A;  1SL9 A;  1DF0 A;  1G4Y R;  4UPG A;  1KK7 Z;  2K2A A;  1TCF A;  1CLL A;  4OR9 B;  1M45 A;  4N1F A;  4CLN A;  3TZ1 A;  3VRO A;  4XJK B;  1PSB A;  1K9U A;  2AAO A;  1YUU A;  2GGM A;  3EVR A;  3NSK A;  3A4U B;  1UHJ A;  1CFP A;  1KWO B;  1TNX A;  1IWQ A;  1CDP A;  2CCM A;  3AKB A;  2LHL A;  3DVM A;  1H4B A;  3K21 A;  2WCB A;  1RRO A;  1PVA A;  2JWW A;  1J7P A;  2H61 A;  2ZND A;  1EXR A;  1LA0 A;  3HCM A;  4CFR A;  2M1K B;  1L2O B;  1R2U A;  2WCE A;  1RFJ A;  4ORA B;  2BEC A;  4GUK A;  1A75 A;  1LIN A;  3AAK A;  3CZT X;  4M2O A;  4N5X A;  5I2O A;  2KI4 B;  1JWD A;  2L4H A;  2KNE A;  5AFP A;  3VRR A;  1K95 A;  3ICB A;  2RGI A;  3ZWH A;  2L2E A;  2L0P A;  1KFU L;  1NX2 A;  3KEV A;  1TCO B;  1IJ6 A;  1ALV A;  2F3Y A;  2LLS A;  1NSH A;  1IJ5 A;  3OHM B;  1C7V A;  2LUX A;  3SG4 A;  1KFU S;  2GGZ A;  2KI6 C;  3TDI A;  3I5I B;  1AUI B;  2MHH A;  3KF9 A;  3PN7 B;  5I2Q A;  3DVJ A;  2E6W A;  2ISD A;  2COL B;  1J7O A;  1DJH A;  1MXE A;  1L7Z A;  2G9B A;  1B1G A;  5KTY A;  3H4S E;  2M7N A;  5I2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...