3R72A

Apis mellifera odorant binding protein 5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
122
structure length
122
Chain Sequence
MSMSADQVEKLAKNMRKSCLQKIAITEELVDGMRRGEFPDDHDLQCYTTCIMKLLRTFKNGNFDFDMIVKQLEITMPPEEVVIGKEIVAVCRNEEYTGDDCQKTYQYVQCHYKQNPEKFFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein ASP5
publication title Crystal structure of Apis mellifera odorant binding protein 5
rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 43
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3r72A00
3FE8A 3S0GA 3S0BA 3FE6A 5EL2A 3B7AA 3D75A 1C3YA 3N7HA 3D77A 2L2CA 2WC5A 2WC6A 3QMEA 3BFBA 3R1PA 4OZDA 2P70A 3Q8IA 4INXA 3FE9A 2QEVA 3R1VA 1GM0A 1TUJA 2KPHA 1P28A 3S0AA 3K1EA 2H8VA 2QDIA 3D78A 3BJHA 5DICA 3CDNA 2WCLA 1OW4A 3B86A 3B87A 3D73A 3NHIA 3OGNA 3DZTA 3RZSA 1DQEA 2WCJA 2WCMA 3S0DA 3DY9A 3BFHA 2QEBA 4FQTA 3DYEA 3L4AA 3D76A 3R72A 1OOHA 1C3ZA 1ORGA 3CZ0A 3PJIA 1OOIX 1T14A 1OOGA 1TWOA 3DXLA 2QEOA 1XFRA 2FJYA 3CYZA 2GTEA 3NGVA 2P71A 2PQLA 2ERBA 2JPOA 3L4LA 1OOFA 3NHTA 3CZ1A 4PT1A 1LS8A 3B6XA 3R1OA 3B88A 3L47A 3V2LA 3CZ2A 3S0EA 2QEHA 3CABA 3BFAA 4JD9A 3S0FA 4INWA 2WCKA 1QWVA 3D74A 4F7FA 2WCHA 3VB1A
chains in the Genus database with same CATH superfamily
1CLMA 3DD4A 3GK1A 1J7PA 3KPXA 1XFUO 1SSEB 4OVNF 2ZRSA 1NP8A 1KSOA 3S0GA 3PM8A 1NPQA 4MZLA 3S0BA 1LXFC 1QX5B 1FBVA 1QXPA 1K2HA 3EK7A 2R2IA 4M2PA 3D75A 1KK8C 4YGBB 5AEQA 1BR1B 3VRRA 3IQQA 1XO5A 2K7DA 4MBEA 4PE0A 1ODBA 3D0YB 1XFXO 2WOSA 4OCIA 2MBXA 2LHIA 1Z4HA 2KFFA 2MLEC 1YTZC 3CR5X 3R1PA 2BNXA 3VRPA 1CM1A 3DVEA 1QATA 5PALA 1DF0B 1M45A 1NWDA 2NLNA 2BCAA 2P70A 1PVBA 2JWWA 4FTGA 4MRXA 3I5FB 1E8AA 4QJ5B 1MXEA 1SCMB 4AOMA 1CB1A 1GM0A 1QS7A 3SG3A 3OBVA 1W7JB 1Y1UA 5I2LA 3SG4A 2F2PA 2PSRA 1QTXA 2GV5A 2JC2A 4YGDB 4UPGA 2JNFA 3ZNIA 3ICBA 5DKNA 1GJYA 2WCLA 1KK7Z 2PASA 4PDZA 3I5IB 1PVAA 1QX7A 4MSPA 2I2RE 1SPYA 2LANA 1IKUA 2EHBA 1CDLA 1SL7A 1YVHA 3RZSA 4ORCB 2JXLA 3C1VA 2LC5A 4PE4A 5CPVA 1DJGA 5I2OA 4MN0A 4TNCA 2QEBA 2H61A 1A03A 4U8DA 1S36A 2Y1MA 1Y6WA 4FQTA 1TN4A 2MJWB 1QIWA 1Q80A 2BE4A 3SJSA 1JC2A 4GBAA 4GGNA 2KFGA 2LMUA 2BAPA 3PN7B 4PALA 4YI9A 1H4BA 1CDNA 1C07A 1J7QA 2JNXA 2BBNA 1XA5A 1C3ZA 1MUXA 2CCMA 2YGUA 1TIZA 1B8LA 1WDCC 1DJWA 3CGAA 1F55A 1LVCD 1A75A 1DJYA 1SKTA 1TCOB 1W9ZA 1PULA 4I5NB 1T14A 1EG4A 3EKJA 5HKZA 3GOFA 1OMRA 2KFHA 2M3WA 1YUTA 3IF7A 2KLEA 1SK6D 1OE9B 2JZIA 1MF8B 2PQLA 1NX2A 1A29A 2ERBA 1JFJA 4C0JA 2OS8C 2AMIA 3I5GB 4YGAA 1MWNA 2KAYA 1R2UA 2VRGA 4CIDA 1GGWA 1LS8A 3B6XA 1CMGA 1YVLA 1Y0VH 2FCDA 5FI2A 1ZFSA 3B88A 1G4YR 1RK9A 2BE6A 3L47A 2BECA 4FQOA 4BY5A 1M39A 2LHLA 4PCWA 2Y5IA 4CFRA 1NX3A 4E68A 1ZUZA 2LV7A 1B8CA 2ZNEA 1CFPA 1KFUL 1B1GA 2KAXA 1FI5A 5F6TA 1UWOA 4XYNA 2KNEA 2KI6C 1KFXS 4JWQA 3TS5B 4BY4A 4JD9A 5G08A 5I8NA 1K95A 1EJ3A 2WCKA 1DMOA 4NDCA 3KHEA 1KWOB 2EC6C 1QVIZ 2KGRA 1UHKA 2HQWA 1B7TY 4QJ3B 2F3YA 2ZNDA 1SR6B 3FE8A 2LNKA 5B8IB 1RFJA 1SBJA 1TTXA 2WORA 2EGDA 2PYQA 4N5XA 4MZJA 1F8HA 3BQ3A 4N1GA 4R1EA 1FI6A 4IL1A 3FE6A 3OX6A 4N1FA 2OTGC 3NSOA 3N7HA 1C3YA 3JTDB 3WHUB 4GPLB 1QVIY 3D77A 4DCKA 2KI4B 3OX5A 1WRZA 1YURA 3O6BA 3SG2A 1C7VA 1DJHA 3QMEA 2E6WA 2A4JA 2L5YA 3QRXA 3LLEA 3M0WA 2WCFA 4OZDA 1TNWA 2JRFA 5HLOA 1IRJA 1QLSA 2Q91A 3E3RA 5I2QA 1IIOA 1NYAA 1Z2CB 3A8RA 1J7OA 1NCYA 2HQ8A 1CKKA 1B47A 2QPTA 3FE9A 2QEVA 3R1VA 1CLBA 2LVVA 1OMVA 2FCEA 2PVBA 3NXAA 2LP2A 1KCYA 1N2DA 3S0AA 5CSIA 1A4PA 2O5GA 3K1EA 1DVIA 5IBWA 2SCPA 4GAOA 1BF5A 1NCZA 3BJHA 1A75B 1OQPA 3DVMA 3O78A 1OMDA 3TZ1A 4MLWA 1JSAA 3H4SE 2F2OA 2GGZA 3D73A 2LUCA 5AERA 3DF0A 3OGNA 5HKYA 1F54A 3DZTA 3BXKA 5AXIA 3SIAA 1CNPA 4AQIA 4JQ0D 1XFVO 2L2EA 1DJXA 1HQVA 3BUNB 1QV1A 2FJUB 2MHHA 4MZKA 4NQGA 1MHOA 2LMVA 1JBAA 3FIAA 1IH0A 1L2OC 2FOTA 2HPSA 3TUYC 3D76A 1YUUA 1M31A 2I7AA 3K21A 1BLQA 2BL0B 1EH2A 1SMGA 1ALWA 3I5IC 4YBHB 1KQMC 3SG6A 1BU3A 1R6PA 1BT6A 1DT7B 4XJKA 2SASA 1BODA 1ZMZA 4ETOA 1KK8B 2GGMA 2M7NA 3HCMA 5DKRA 1S6JA 1RROA 3NSLA 1PSBA 1QJTA 1DTLA 3SG7A 1K96A 2PRUA 1XFRA 2FJYA 1ALVA 1YUSA 2GTEA 2JXCA 3CYZA 5FYXA 1DJIA 4D1EA 3PFVA 1K9PA 2BCXA 3I5HC 5CSNA 2RGIA 5D69A 3BUWB 2WNDA 1DGVA 3AKBA 1WRKA 1LKJA 1TOPA 3PN7C 3VRNA 1QV0A 1S6CA 1K8UA 3KEVA 1DEKA 1BR4B 4A4CA 1SY9A 3EG5B 1DELA 2CTNA 2JULA 3NSKA 2M7LA 3TDUA 3BOWB 3UO9A 1K9UA 3EVUA 2L98A 1F70A 4IJ7A 2LLTA 3OP0A 1LINA 2KLDA 2JT0A 2L51A 3CABA 2CNPA 3BFAA 4PHMA 5I94A 1XK4C 2JTTA 1B9AA 2LLSA 3I5GC 3ZWHA 2K7BA 3OHMB 3FWBA 3EKHA 1QWVA 3D74A 1PALA 3BUOB 1TUZA 4YGCB 3VROA 4F7FA 2V53A 5KU1A 1W7IB 1WY9A 1UHIA 1YX7A 1IJ5A 5GQQC 1QLKA 4PHNA 1CLLA 1KFUS 1OOJA 2M0RA 4GGFC 4MVFA 1BG1A 2L5XB 1S26D 4I5JA 4I5LB 1NUBA 2I94A 1L7ZA 2CT9A 4KYNA 5HLVA 1FW4A 3FWCA 1F4OA 2JT3A 4OR9B 1IWQA 1SL8A 3LCPC 3PALA 2CBLA 5D3OA 1B7TZ 2MA2A 3TS5C 2G2BA 3MSEB 1UUSA 1Y1XA 1SNLA 1G33A 1PSRA 1MXLC 1WDCB 2KHNA 2L2CA 2M1KB 2WC5A 3EVRA 4DRWA 2F3ZA 5HYDA 1KWOC 3O2PA 1SYMA 3DF0B 2K0JA 1AVSA 2M1UA 3BFBA 1CMFA 3RLZA 4ORBB 1XVJA 1NIWA 1J1DA 3JVTC 2M97A 2M8UA 4INXA 1AHRA 1JFKA 1GGZA 1WRLA 1S3PA 2IS9A 3CTNA 4WQ3A 2KSPA 5FI6A 1OZOA 4I5KA 5K89A 1H8BA 3BYAA 4WRIA 3CLNA 1P28A 2M29A 3JTDC 4HREE 1WLMA 1F71A 1KSMA 1DJZA 2KYFA 5HKWA 5KTYA 4GNKB 4XJKB 1SL9A 3PATA 3CDNA 1ZACA 3IVTA 3SG5A 4C0LA 1OW4A 1UHHA 1N0YA 1S5GY 1AJ4A 2O60A 3B86A 3B87A 5D7FA 2WC8A 3A4UB 1JWDA 1TNQA 5J3XA 4C0KA 3EVVA 1DGUA 1DQEA 1QIVA 2JPTA 2Y4QA 3DY9A 1AJ5A 3GK2A 3OB1B 4DIRA 4CFQA 1NX0A 3UNWA 2LMTA 1KFXL 5FI7A 2LVKA 3FS7A 1J1EA 1QX2A 1CM4A 4Q04A 1TNXA 1CFFA 3DYEA 2B1UA 2COLB 3CS1A 2LCPA 3F45A 1RJVA 3R72A 2KQ6A 2KBIA 1UHJA 3DVKA 2JTZA 1GQMA 1AK8A 2KI6D 2KQYA 1MR8A 3SS4A 5ER5A 1FF1A 2OTGB 1BOCA 1BMOA 1TWOA 3DXLA 2QEOA 4WQ2A 2F33A 2DOQA 3I5FC 3NGVA 2P71A 1XK4A 4ZCUA 5TNCA 2AAOA 1X02A 1SCMC 2JPOA 1WLZA 1PRWA 2LP3A 1AUIB 2ZFDA 2ZN8A 3CR2A 2LAPA 1OOFA 1XFYO 3L4LA 2BKIB 3NHTA 5DKQA 1K90D 1YR5A 5KSZA 1BJFA 1K93D 4YGEB 2BL0C 3R1OA 1TNPA 4GGFA 4MRYA 1UURA 2WCBA 1D1OA 5HL1A 1XFZO 3BUXB 1M63B 2HETA 4GUKA 3V2LA 2LLUA 3PM2A 2OPOA 4OKHA 1SW8A 3S0EA 3SIBA 1AP4A 2KBMA 2QEHA 3D10A 1YRUB 5ER4X 1UHNA 2K61A 2LM5A 4HSZA 3S0FA 2L4HA 3PSRA 2NXQA 2JT8A 2Y1NA 1YX8A 2ZKMX 5CSFA 2WCHA 2KAVA 3VB1A 5AFPA 1TRFA 2AUCA 3WXAA 3AAJA 2CXJA 4PHKA 3AAKA 2LUXA 2MAZA 1M46A 2H2KA 2PMYA 3BUMB 3LK0A 2ZRTA 1L2OB 4ORAB 3IQOA 2F8PA 5EL2A 3TUYB 2I18A 3B7AA 2MRDA 2L0PA 1RECA 3CR4X 3HX4A 4MEWA 2G9BA 2BKHB 1KQMB 3EK8A 3SS3A 2WC6A 1U5IA 1SRAA 1EG3A 1IG5A 4JPZB 2P6BB 1B8RA 1LA0A 2WCEA 2JOJA 4NDDA 1JUOA 5CSJA 2L50A 1CTRA 1IQ3A 1NSHA 1YRTB 1OSAA 2K2AA 2TN4A 4USLA 1CFCA 2LVJA 3I5HB 3Q8IA 1C7WA 1XYDA 4ICBA 4JKTA 1PK0D 3SS5A 1DC1A 1KK7Y 1NCXA 3O4YA 4P5OE 4GFTA 1IJ6A 1MQ1A 1TUJA 1VRKA 2K60A 1SCVA 2KPHA 3PLFB 1UP5A 2D8NA 2H8VA 2LE9B 2QDIA 3D78A 4L9MA 4M2QA 4QJ4B 4PHJA 4HRHA 4F0ZB 2M9GA 1F4QA 5DICA 1FPWA 1J7RA 3D0YA 1V1GA 1XFWO 1EXRA 2KDHA 1NX1A 3NHIA 2QACA 1JF0A 1CDMA 1S1EA 4CLNA 2MLFC 1CFDA 1DF0A 2WCJA 2WCMA 3S0DA 1SR6C 3TDIA 2LVIA 2K7OA 2KYCA 2NCPA 3LL8B 3VRQA 4A4BA 1TCFA 3BFHA 1S5GZ 3KO0A 3KF9A 4PE7A 2OS8B 3EK4A 1S6IA 1A2XA 3L4AA 2ISDA 3AKAA 2BCBA 4P2YB 2L4IA 1N65A 1OOHA 4ZCVA 1ORGA 2JU0A 3CZ0A 2KI4C 2NZ0A 3VGOA 3PJIA 1K9KA 1OOIX 1B4CA 2KGBC 5JOLA 3WNXB 4HRGA 1OOGA 1Y1AA 1HT9A 3CWGA 4DS7A 2BBMA 4YI8A 3TDZA 2KOTA 4NDBA 1IQ5A 5AANA 2H61C 3WHTB 2K8MB 1K94A 1LA3A 1JF2A 2HF5A 3CZTX 3CZ1A 3DVJA 2EC6B 4PT1A 1J55A 4CPVA 3JVTB 2NCOA 3LK1A 3O4XA 2E30A 2JQ6A 4OV2A 1CDPA 2PALA 4PE1A 1RWYA 3BOWA 2M49B 2K2FA 1G8IA 1KQVA 1V1FA 3NSIA 2Q4UA 3CZ2A 4AQJA 1QASA 4M2OA 3RM1A 5JJGA 1EL4A 1U5IB 1ZOTB 3OB2B 4DUQA 4YRUA 3GK4X 5BPJA 4INWA 1RTP1 2ZN9A 2K7CA 1OZSA 1IGVA
chains in the Genus database with same CATH topology
3FE8A 3S0GA 3S0BA 3FE6A 5EL2A 3B7AA 3D75A 1C3YA 3N7HA 3D77A 2L2CA 2WC5A 2WC6A 3QMEA 3BFBA 3R1PA 4OZDA 2P70A 3Q8IA 4INXA 3FE9A 2QEVA 3R1VA 1GM0A 1TUJA 2KPHA 1P28A 3S0AA 3K1EA 2H8VA 2QDIA 3D78A 3BJHA 5DICA 3CDNA 2WCLA 1OW4A 3B86A 3B87A 3D73A 3NHIA 3OGNA 3DZTA 3RZSA 1DQEA 2WCJA 2WCMA 3S0DA 3DY9A 3BFHA 2QEBA 4FQTA 3DYEA 3L4AA 3D76A 3R72A 1OOHA 1C3ZA 1ORGA 3CZ0A 3PJIA 1OOIX 1T14A 1OOGA 1TWOA 3DXLA 2QEOA 1XFRA 2FJYA 3CYZA 2GTEA 3NGVA 2P71A 2PQLA 2ERBA 2JPOA 3L4LA 1OOFA 3NHTA 3CZ1A 4PT1A 1LS8A 3B6XA 3R1OA 3B88A 3L47A 3V2LA 3CZ2A 3S0EA 2QEHA 3CABA 3BFAA 4JD9A 3S0FA 4INWA 2WCKA 1QWVA 3D74A 4F7FA 2WCHA 3VB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE8 A;  3S0G A;  3S0B A;  3FE6 A;  5EL2 A;  3B7A A;  3D75 A;  1C3Y A;  3N7H A;  3D77 A;  2L2C A;  2WC5 A;  2WC6 A;  3QME A;  3BFB A;  3R1P A;  4OZD A;  2P70 A;  3Q8I A;  4INX A;  3FE9 A;  2QEV A;  3R1V A;  1GM0 A;  1TUJ A;  2KPH A;  1P28 A;  3S0A A;  3K1E A;  2H8V A;  2QDI A;  3D78 A;  3BJH A;  5DIC A;  3CDN A;  2WCL A;  1OW4 A;  3B86 A;  3B87 A;  3D73 A;  3NHI A;  3OGN A;  3DZT A;  3RZS A;  1DQE A;  2WCJ A;  2WCM A;  3S0D A;  3DY9 A;  3BFH A;  2QEB A;  4FQT A;  3DYE A;  3L4A A;  3D76 A;  3R72 A;  1OOH A;  1C3Z A;  1ORG A;  3CZ0 A;  3PJI A;  1OOI X;  1T14 A;  1OOG A;  1TWO A;  3DXL A;  2QEO A;  1XFR A;  2FJY A;  3CYZ A;  2GTE A;  3NGV A;  2P71 A;  2PQL A;  2ERB A;  2JPO A;  3L4L A;  1OOF A;  3NHT A;  3CZ1 A;  4PT1 A;  1LS8 A;  3B6X A;  3R1O A;  3B88 A;  3L47 A;  3V2L A;  3CZ2 A;  3S0E A;  2QEH A;  3CAB A;  3BFA A;  4JD9 A;  3S0F A;  4INW A;  2WCK A;  1QWV A;  3D74 A;  4F7F A;  2WCH A;  3VB1 A; 
#chains in the Genus database with same CATH topology
 1CLM A;  3DD4 A;  3GK1 A;  1J7P A;  3KPX A;  1XFU O;  1SSE B;  4OVN F;  2ZRS A;  1NP8 A;  1KSO A;  3S0G A;  3PM8 A;  1NPQ A;  4MZL A;  3S0B A;  1LXF C;  1QX5 B;  1FBV A;  1QXP A;  1K2H A;  3EK7 A;  2R2I A;  4M2P A;  3D75 A;  1KK8 C;  4YGB B;  5AEQ A;  1BR1 B;  3VRR A;  3IQQ A;  1XO5 A;  2K7D A;  4MBE A;  4PE0 A;  1ODB A;  3D0Y B;  1XFX O;  2WOS A;  4OCI A;  2MBX A;  2LHI A;  1Z4H A;  2KFF A;  2MLE C;  1YTZ C;  3CR5 X;  3R1P A;  2BNX A;  3VRP A;  1CM1 A;  3DVE A;  1QAT A;  5PAL A;  1DF0 B;  1M45 A;  1NWD A;  2NLN A;  2BCA A;  2P70 A;  1PVB A;  2JWW A;  4FTG A;  4MRX A;  3I5F B;  1E8A A;  4QJ5 B;  1MXE A;  1SCM B;  4AOM A;  1CB1 A;  1GM0 A;  1QS7 A;  3SG3 A;  3OBV A;  1W7J B;  1Y1U A;  5I2L A;  3SG4 A;  2F2P A;  2PSR A;  1QTX A;  2GV5 A;  2JC2 A;  4YGD B;  4UPG A;  2JNF A;  3ZNI A;  3ICB A;  5DKN A;  1GJY A;  2WCL A;  1KK7 Z;  2PAS A;  4PDZ A;  3I5I B;  1PVA A;  1QX7 A;  4MSP A;  2I2R E;  1SPY A;  2LAN A;  1IKU A;  2EHB A;  1CDL A;  1SL7 A;  1YVH A;  3RZS A;  4ORC B;  2JXL A;  3C1V A;  2LC5 A;  4PE4 A;  5CPV A;  1DJG A;  5I2O A;  4MN0 A;  4TNC A;  2QEB A;  2H61 A;  1A03 A;  4U8D A;  1S36 A;  2Y1M A;  1Y6W A;  4FQT A;  1TN4 A;  2MJW B;  1QIW A;  1Q80 A;  2BE4 A;  3SJS A;  1JC2 A;  4GBA A;  4GGN A;  2KFG A;  2LMU A;  2BAP A;  3PN7 B;  4PAL A;  4YI9 A;  1H4B A;  1CDN A;  1C07 A;  1J7Q A;  2JNX A;  2BBN A;  1XA5 A;  1C3Z A;  1MUX A;  2CCM A;  2YGU A;  1TIZ A;  1B8L A;  1WDC C;  1DJW A;  3CGA A;  1F55 A;  1LVC D;  1A75 A;  1DJY A;  1SKT A;  1TCO B;  1W9Z A;  1PUL A;  4I5N B;  1T14 A;  1EG4 A;  3EKJ A;  5HKZ A;  3GOF A;  1OMR A;  2KFH A;  2M3W A;  1YUT A;  3IF7 A;  2KLE A;  1SK6 D;  1OE9 B;  2JZI A;  1MF8 B;  2PQL A;  1NX2 A;  1A29 A;  2ERB A;  1JFJ A;  4C0J A;  2OS8 C;  2AMI A;  3I5G B;  4YGA A;  1MWN A;  2KAY A;  1R2U A;  2VRG A;  4CID A;  1GGW A;  1LS8 A;  3B6X A;  1CMG A;  1YVL A;  1Y0V H;  2FCD A;  5FI2 A;  1ZFS A;  3B88 A;  1G4Y R;  1RK9 A;  2BE6 A;  3L47 A;  2BEC A;  4FQO A;  4BY5 A;  1M39 A;  2LHL A;  4PCW A;  2Y5I A;  4CFR A;  1NX3 A;  4E68 A;  1ZUZ A;  2LV7 A;  1B8C A;  2ZNE A;  1CFP A;  1KFU L;  1B1G A;  2KAX A;  1FI5 A;  5F6T A;  1UWO A;  4XYN A;  2KNE A;  2KI6 C;  1KFX S;  4JWQ A;  3TS5 B;  4BY4 A;  4JD9 A;  5G08 A;  5I8N A;  1K95 A;  1EJ3 A;  2WCK A;  1DMO A;  4NDC A;  3KHE A;  1KWO B;  2EC6 C;  1QVI Z;  2KGR A;  1UHK A;  2HQW A;  1B7T Y;  4QJ3 B;  2F3Y A;  2ZND A;  1SR6 B;  3FE8 A;  2LNK A;  5B8I B;  1RFJ A;  1SBJ A;  1TTX A;  2WOR A;  2EGD A;  2PYQ A;  4N5X A;  4MZJ A;  1F8H A;  3BQ3 A;  4N1G A;  4R1E A;  1FI6 A;  4IL1 A;  3FE6 A;  3OX6 A;  4N1F A;  2OTG C;  3NSO A;  3N7H A;  1C3Y A;  3JTD B;  3WHU B;  4GPL B;  1QVI Y;  3D77 A;  4DCK A;  2KI4 B;  3OX5 A;  1WRZ A;  1YUR A;  3O6B A;  3SG2 A;  1C7V A;  1DJH A;  3QME A;  2E6W A;  2A4J A;  2L5Y A;  3QRX A;  3LLE A;  3M0W A;  2WCF A;  4OZD A;  1TNW A;  2JRF A;  5HLO A;  1IRJ A;  1QLS A;  2Q91 A;  3E3R A;  5I2Q A;  1IIO A;  1NYA A;  1Z2C B;  3A8R A;  1J7O A;  1NCY A;  2HQ8 A;  1CKK A;  1B47 A;  2QPT A;  3FE9 A;  2QEV A;  3R1V A;  1CLB A;  2LVV A;  1OMV A;  2FCE A;  2PVB A;  3NXA A;  2LP2 A;  1KCY A;  1N2D A;  3S0A A;  5CSI A;  1A4P A;  2O5G A;  3K1E A;  1DVI A;  5IBW A;  2SCP A;  4GAO A;  1BF5 A;  1NCZ A;  3BJH A;  1A75 B;  1OQP A;  3DVM A;  3O78 A;  1OMD A;  3TZ1 A;  4MLW A;  1JSA A;  3H4S E;  2F2O A;  2GGZ A;  3D73 A;  2LUC A;  5AER A;  3DF0 A;  3OGN A;  5HKY A;  1F54 A;  3DZT A;  3BXK A;  5AXI A;  3SIA A;  1CNP A;  4AQI A;  4JQ0 D;  1XFV O;  2L2E A;  1DJX A;  1HQV A;  3BUN B;  1QV1 A;  2FJU B;  2MHH A;  4MZK A;  4NQG A;  1MHO A;  2LMV A;  1JBA A;  3FIA A;  1IH0 A;  1L2O C;  2FOT A;  2HPS A;  3TUY C;  3D76 A;  1YUU A;  1M31 A;  2I7A A;  3K21 A;  1BLQ A;  2BL0 B;  1EH2 A;  1SMG A;  1ALW A;  3I5I C;  4YBH B;  1KQM C;  3SG6 A;  1BU3 A;  1R6P A;  1BT6 A;  1DT7 B;  4XJK A;  2SAS A;  1BOD A;  1ZMZ A;  4ETO A;  1KK8 B;  2GGM A;  2M7N A;  3HCM A;  5DKR A;  1S6J A;  1RRO A;  3NSL A;  1PSB A;  1QJT A;  1DTL A;  3SG7 A;  1K96 A;  2PRU A;  1XFR A;  2FJY A;  1ALV A;  1YUS A;  2GTE A;  2JXC A;  3CYZ A;  5FYX A;  1DJI A;  4D1E A;  3PFV A;  1K9P A;  2BCX A;  3I5H C;  5CSN A;  2RGI A;  5D69 A;  3BUW B;  2WND A;  1DGV A;  3AKB A;  1WRK A;  1LKJ A;  1TOP A;  3PN7 C;  3VRN A;  1QV0 A;  1S6C A;  1K8U A;  3KEV A;  1DEK A;  1BR4 B;  4A4C A;  1SY9 A;  3EG5 B;  1DEL A;  2CTN A;  2JUL A;  3NSK A;  2M7L A;  3TDU A;  3BOW B;  3UO9 A;  1K9U A;  3EVU A;  2L98 A;  1F70 A;  4IJ7 A;  2LLT A;  3OP0 A;  1LIN A;  2KLD A;  2JT0 A;  2L51 A;  3CAB A;  2CNP A;  3BFA A;  4PHM A;  5I94 A;  1XK4 C;  2JTT A;  1B9A A;  2LLS A;  3I5G C;  3ZWH A;  2K7B A;  3OHM B;  3FWB A;  3EKH A;  1QWV A;  3D74 A;  1PAL A;  3BUO B;  1TUZ A;  4YGC B;  3VRO A;  4F7F A;  2V53 A;  5KU1 A;  1W7I B;  1WY9 A;  1UHI A;  1YX7 A;  1IJ5 A;  5GQQ C;  1QLK A;  4PHN A;  1CLL A;  1KFU S;  1OOJ A;  2M0R A;  4GGF C;  4MVF A;  1BG1 A;  2L5X B;  1S26 D;  4I5J A;  4I5L B;  1NUB A;  2I94 A;  1L7Z A;  2CT9 A;  4KYN A;  5HLV A;  1FW4 A;  3FWC A;  1F4O A;  2JT3 A;  4OR9 B;  1IWQ A;  1SL8 A;  3LCP C;  3PAL A;  2CBL A;  5D3O A;  1B7T Z;  2MA2 A;  3TS5 C;  2G2B A;  3MSE B;  1UUS A;  1Y1X A;  1SNL A;  1G33 A;  1PSR A;  1MXL C;  1WDC B;  2KHN A;  2L2C A;  2M1K B;  2WC5 A;  3EVR A;  4DRW A;  2F3Z A;  5HYD A;  1KWO C;  3O2P A;  1SYM A;  3DF0 B;  2K0J A;  1AVS A;  2M1U A;  3BFB A;  1CMF A;  3RLZ A;  4ORB B;  1XVJ A;  1NIW A;  1J1D A;  3JVT C;  2M97 A;  2M8U A;  4INX A;  1AHR A;  1JFK A;  1GGZ A;  1WRL A;  1S3P A;  2IS9 A;  3CTN A;  4WQ3 A;  2KSP A;  5FI6 A;  1OZO A;  4I5K A;  5K89 A;  1H8B A;  3BYA A;  4WRI A;  3CLN A;  1P28 A;  2M29 A;  3JTD C;  4HRE E;  1WLM A;  1F71 A;  1KSM A;  1DJZ A;  2KYF A;  5HKW A;  5KTY A;  4GNK B;  4XJK B;  1SL9 A;  3PAT A;  3CDN A;  1ZAC A;  3IVT A;  3SG5 A;  4C0L A;  1OW4 A;  1UHH A;  1N0Y A;  1S5G Y;  1AJ4 A;  2O60 A;  3B86 A;  3B87 A;  5D7F A;  2WC8 A;  3A4U B;  1JWD A;  1TNQ A;  5J3X A;  4C0K A;  3EVV A;  1DGU A;  1DQE A;  1QIV A;  2JPT A;  2Y4Q A;  3DY9 A;  1AJ5 A;  3GK2 A;  3OB1 B;  4DIR A;  4CFQ A;  1NX0 A;  3UNW A;  2LMT A;  1KFX L;  5FI7 A;  2LVK A;  3FS7 A;  1J1E A;  1QX2 A;  1CM4 A;  4Q04 A;  1TNX A;  1CFF A;  3DYE A;  2B1U A;  2COL B;  3CS1 A;  2LCP A;  3F45 A;  1RJV A;  3R72 A;  2KQ6 A;  2KBI A;  1UHJ A;  3DVK A;  2JTZ A;  1GQM A;  1AK8 A;  2KI6 D;  2KQY A;  1MR8 A;  3SS4 A;  5ER5 A;  1FF1 A;  2OTG B;  1BOC A;  1BMO A;  1TWO A;  3DXL A;  2QEO A;  4WQ2 A;  2F33 A;  2DOQ A;  3I5F C;  3NGV A;  2P71 A;  1XK4 A;  4ZCU A;  5TNC A;  2AAO A;  1X02 A;  1SCM C;  2JPO A;  1WLZ A;  1PRW A;  2LP3 A;  1AUI B;  2ZFD A;  2ZN8 A;  3CR2 A;  2LAP A;  1OOF A;  1XFY O;  3L4L A;  2BKI B;  3NHT A;  5DKQ A;  1K90 D;  1YR5 A;  5KSZ A;  1BJF A;  1K93 D;  4YGE B;  2BL0 C;  3R1O A;  1TNP A;  4GGF A;  4MRY A;  1UUR A;  2WCB A;  1D1O A;  5HL1 A;  1XFZ O;  3BUX B;  1M63 B;  2HET A;  4GUK A;  3V2L A;  2LLU A;  3PM2 A;  2OPO A;  4OKH A;  1SW8 A;  3S0E A;  3SIB A;  1AP4 A;  2KBM A;  2QEH A;  3D10 A;  1YRU B;  5ER4 X;  1UHN A;  2K61 A;  2LM5 A;  4HSZ A;  3S0F A;  2L4H A;  3PSR A;  2NXQ A;  2JT8 A;  2Y1N A;  1YX8 A;  2ZKM X;  5CSF A;  2WCH A;  2KAV A;  3VB1 A;  5AFP A;  1TRF A;  2AUC A;  3WXA A;  3AAJ A;  2CXJ A;  4PHK A;  3AAK A;  2LUX A;  2MAZ A;  1M46 A;  2H2K A;  2PMY A;  3BUM B;  3LK0 A;  2ZRT A;  1L2O B;  4ORA B;  3IQO A;  2F8P A;  5EL2 A;  3TUY B;  2I18 A;  3B7A A;  2MRD A;  2L0P A;  1REC A;  3CR4 X;  3HX4 A;  4MEW A;  2G9B A;  2BKH B;  1KQM B;  3EK8 A;  3SS3 A;  2WC6 A;  1U5I A;  1SRA A;  1EG3 A;  1IG5 A;  4JPZ B;  2P6B B;  1B8R A;  1LA0 A;  2WCE A;  2JOJ A;  4NDD A;  1JUO A;  5CSJ A;  2L50 A;  1CTR A;  1IQ3 A;  1NSH A;  1YRT B;  1OSA A;  2K2A A;  2TN4 A;  4USL A;  1CFC A;  2LVJ A;  3I5H B;  3Q8I A;  1C7W A;  1XYD A;  4ICB A;  4JKT A;  1PK0 D;  3SS5 A;  1DC1 A;  1KK7 Y;  1NCX A;  3O4Y A;  4P5O E;  4GFT A;  1IJ6 A;  1MQ1 A;  1TUJ A;  1VRK A;  2K60 A;  1SCV A;  2KPH A;  3PLF B;  1UP5 A;  2D8N A;  2H8V A;  2LE9 B;  2QDI A;  3D78 A;  4L9M A;  4M2Q A;  4QJ4 B;  4PHJ A;  4HRH A;  4F0Z B;  2M9G A;  1F4Q A;  5DIC A;  1FPW A;  1J7R A;  3D0Y A;  1V1G A;  1XFW O;  1EXR A;  2KDH A;  1NX1 A;  3NHI A;  2QAC A;  1JF0 A;  1CDM A;  1S1E A;  4CLN A;  2MLF C;  1CFD A;  1DF0 A;  2WCJ A;  2WCM A;  3S0D A;  1SR6 C;  3TDI A;  2LVI A;  2K7O A;  2KYC A;  2NCP A;  3LL8 B;  3VRQ A;  4A4B A;  1TCF A;  3BFH A;  1S5G Z;  3KO0 A;  3KF9 A;  4PE7 A;  2OS8 B;  3EK4 A;  1S6I A;  1A2X A;  3L4A A;  2ISD A;  3AKA A;  2BCB A;  4P2Y B;  2L4I A;  1N65 A;  1OOH A;  4ZCV A;  1ORG A;  2JU0 A;  3CZ0 A;  2KI4 C;  2NZ0 A;  3VGO A;  3PJI A;  1K9K A;  1OOI X;  1B4C A;  2KGB C;  5JOL A;  3WNX B;  4HRG A;  1OOG A;  1Y1A A;  1HT9 A;  3CWG A;  4DS7 A;  2BBM A;  4YI8 A;  3TDZ A;  2KOT A;  4NDB A;  1IQ5 A;  5AAN A;  2H61 C;  3WHT B;  2K8M B;  1K94 A;  1LA3 A;  1JF2 A;  2HF5 A;  3CZT X;  3CZ1 A;  3DVJ A;  2EC6 B;  4PT1 A;  1J55 A;  4CPV A;  3JVT B;  2NCO A;  3LK1 A;  3O4X A;  2E30 A;  2JQ6 A;  4OV2 A;  1CDP A;  2PAL A;  4PE1 A;  1RWY A;  3BOW A;  2M49 B;  2K2F A;  1G8I A;  1KQV A;  1V1F A;  3NSI A;  2Q4U A;  3CZ2 A;  4AQJ A;  1QAS A;  4M2O A;  3RM1 A;  5JJG A;  1EL4 A;  1U5I B;  1ZOT B;  3OB2 B;  4DUQ A;  4YRU A;  3GK4 X;  5BPJ A;  4INW A;  1RTP 1;  2ZN9 A;  2K7C A;  1OZS A;  1IGV A; 
#chains in the Genus database with same CATH homology
 3FE8 A;  3S0G A;  3S0B A;  3FE6 A;  5EL2 A;  3B7A A;  3D75 A;  1C3Y A;  3N7H A;  3D77 A;  2L2C A;  2WC5 A;  2WC6 A;  3QME A;  3BFB A;  3R1P A;  4OZD A;  2P70 A;  3Q8I A;  4INX A;  3FE9 A;  2QEV A;  3R1V A;  1GM0 A;  1TUJ A;  2KPH A;  1P28 A;  3S0A A;  3K1E A;  2H8V A;  2QDI A;  3D78 A;  3BJH A;  5DIC A;  3CDN A;  2WCL A;  1OW4 A;  3B86 A;  3B87 A;  3D73 A;  3NHI A;  3OGN A;  3DZT A;  3RZS A;  1DQE A;  2WCJ A;  2WCM A;  3S0D A;  3DY9 A;  3BFH A;  2QEB A;  4FQT A;  3DYE A;  3L4A A;  3D76 A;  3R72 A;  1OOH A;  1C3Z A;  1ORG A;  3CZ0 A;  3PJI A;  1OOI X;  1T14 A;  1OOG A;  1TWO A;  3DXL A;  2QEO A;  1XFR A;  2FJY A;  3CYZ A;  2GTE A;  3NGV A;  2P71 A;  2PQL A;  2ERB A;  2JPO A;  3L4L A;  1OOF A;  3NHT A;  3CZ1 A;  4PT1 A;  1LS8 A;  3B6X A;  3R1O A;  3B88 A;  3L47 A;  3V2L A;  3CZ2 A;  3S0E A;  2QEH A;  3CAB A;  3BFA A;  4JD9 A;  3S0F A;  4INW A;  2WCK A;  1QWV A;  3D74 A;  4F7F A;  2WCH A;  3VB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...