1QVIZ

Crystal structure of scallop myosin s1 in the pre-power stroke state to 2.6 angstrom resolution: flexibility and function in the head
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Crystal structure of scallop Myosin s1 in the pre-power stroke state to 2.6 a resolution: flexibility and function in the head.
pubmed doi rcsb
molecule tags Contractile protein
total genus 48
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviZ01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviZ02
3CZTX 2PALA 2OTGB 2O5GA 2LP3A 4AQJA 4OR9B 2LUXA 2WCEA 2BE6A 3FIAA 1FW4A 1FI6A 2NLNA 4GGNA 3PSRA 1SYMA 2LUCA 5PALA 1OZOA 1EG3A 2K7OA 4A4BA 3DVMA 2ZFDA 2L4HA 4PHJA 2FJUB 4MEWA 1K90D 4GBAA 1QLKA 1FI5A 1NX2A 4IL1A 1G4YR 4C0KA 1SR6B 2NXQA 5HKZA 1M39A 3NSIA 4XJKB 2SASA 3BOWA 4GAOA 1UURA 3O6BA 4YGBB 3WHUB 2L50A 1S36A 1DJHA 5CSIA 1S5GY 5AERA 1NX3A 3SG4A 1C07A 1NCZA 3PALA 4YI8A 4OKHA 2E6WA 3I5GB 1JWDA 4MN0A 2I94A 3DVEA 2EC6B 1SL9A 4OV2A 4A4CA 1DF0A 1MF8B 1CMGA 1QXPA 4YGCB 4ETOA 1K8UA 1OMDA 1LINA 2KHNA 3F45A 1OSAA 4NQGA 4GGFC 3BOWB 1UHJA 4JPZB 3OHMB 4YGEB 1OE9B 1QIWA 2P6BB 3CWGA 2IS9A 1B8LA 1YRTB 1BT6A 1LA3A 3TDIA 3ZWHA 2EHBA 3EK8A 2I18A 2JPTA 1BR4B 2PSRA 5DKQA 3RLZA 1SCVA 4QJ5B 1KSMA 1NP8A 2M9GA 1NWDA 1DF0B 4PE1A 3CS1A 2CCMA 2LVJA 2Q4UA 2LP2A 4I5KA 1EH2A 1M31A 1K96A 3TS5C 4I5LB 3PN7C 2KI6C 2QPTA 4MZKA 1YUTA 1C7WA 1B1GA 1DJYA 5F6TA 3BUOB 3M0WA 4M2PA 3BUXB 2JTZA 3CLNA 4NDDA 1MUXA 3EKHA 1XYDA 1YUSA 3LCPC 2F3YA 1YX8A 5D69A 3VRQA 2HQ8A 1WRZA 3DVJA 5HLVA 2KFHA 2LVVA 3SG2A 3SJSA 3LLEA 2LCPA 3BUWB 1IJ5A 2BCAA 4YGDB 2JXCA 4R1EA 1UHNA 2KGBC 1CDPA 3DF0A 3TUYB 1YTZC 1WY9A 4MVFA 1SL7A 3SIBA 4ORAB 1S1EA 5B8IB 3I5FB 3CTNA 4NDBA 2OPOA 2OTGC 1CDMA 1J1EA 2JNXA 4I5JA 3RM1A 1F55A 2JT8A 3PM8A 2LE9B 3LK0A 1IG5A 1QATA 3NSOA 3TDZA 1F4OA 2K61A 1TNXA 1XFZO 3DF0B 4DIRA 2KFFA 5G08A 1SR6C 1S6JA 1XFXO 2GV5A 5FYXA 1AUIB 3FWBA 2MA2A 4M2OA 1DGUA 1BMOA 3I5HC 3PFVA 1SMGA 1QTXA 2CTNA 1WDCB 2JC2A 1RFJA 3O4YA 2NCOA 2OS8C 1SL8A 1UHHA 4WQ3A 1A2XA 1BR1B 3I5GC 1B4CA 2F2OA 2BCXA 2EC6C 3JTDB 1E8AA 1YX7A 4MSPA 1KWOB 1AVSA 1KFUS 1B9AA 1MQ1A 3AAKA 1IQ5A 1F54A 2NZ0A 2WCBA 5IBWA 2JZIA 1AJ4A 2KQYA 1KFUL 3SG3A 1CB1A 5GQQC 4F0ZB 3SG6A 2KFGA 2Y1MA 5I8NA 4YGAA 1QV1A 2KOTA 3E3RA 2HF5A 1QVIY 3VRPA 5KU1A 1BOCA 4XYNA 5BPJA 2KBMA 1UHIA 1TRFA 4DUQA 3OX5A 1BLQA 4PHMA 2V53A 1CTRA 2KAVA 1IRJA 2PMYA 3BXKA 5AFPA 2M7NA 2KDHA 4CIDA 1QS7A 1SW8A 3GK2A 1J7QA 2LLTA 5CPVA 2M1KB 4HRHA 2ZNDA 2L5XB 3I5HB 3BYAA 1DMOA 2GGZA 5HKYA 2JXLA 2FCEA 1AP4A 1S6IA 2LLUA 2OS8B 4AQIA 1J1DA 1OMRA 1DJIA 1DJZA 3WXAA 1UP5A 1TOPA 2WNDA 2KYFA 2MLEC 3VGOA 4DS7A 1QLSA 1XFUO 1YURA 2K2FA 3BUNB 1D1OA 2AAOA 1U5IA 3H4SE 1KQMB 3GK4X 1SRAA 1NSHA 3NSKA 3EK7A 3EVUA 4P5OE 5D7FA 5JOLA 4QJ3B 2HQWA 2BBNA 1JF0A 1JFKA 1MWNA 2TN4A 5JJGA 1ZMZA 5CSJA 4PE0A 2MLFC 1Y6WA 1Y1UA 2LMUA 1K9KA 3TUYC 1TIZA 4MRYA 1KK7Z 1A03A 4PDZA 1R6PA 1CFFA 1LKJA 1A29A 3SG7A 1UHKA 2M7LA 1HQVA 3I5FC 1J7RA 4BY4A 4OVNF 1U5IB 1EJ3A 3KO0A 1XVJA 1OQPA 2JWWA 3CR4X 1UUSA 3VRRA 1CFDA 1PULA 3CGAA 4JWQA 1QASA 1Y1AA 1K2HA 2M97A 5AANA 2KYCA 3TZ1A 4WRIA 3WHTB 1CFPA 1FPWA 3EKJA 1RROA 2LM5A 4GFTA 2LNKA 2ZRTA 1M63B 1DGVA 1EL4A 2E30A 1NX0A 1DVIA 1QX2A 2H61A 2M29A 2M8UA 2KI4B 4L9MA 1Q80A 1B8RA 1XFYO 1CLMA 4D1EA 1J7PA 3A4UB 5TNCA 3TDUA 1IH0A 2PVBA 2L51A 2JU0A 1CFCA 1IJ6A 1WDCC 3KEVA 2F2PA 2K8MB 1EXRA 2WORA 3AKAA 4TNCA 1KK8B 4FTGA 1RTP1 1WLMA 3VRNA 4DRWA 2COLB 5KSZA 3JTDC 2JOJA 3PATA 1KWOC 4N1GA 1CDNA 1A75A 1DJWA 1V1FA 2M3WA 4OCIA 4CFRA 1K93D 1NCXA 2M1UA 4UPGA 1BODA 1S5GZ 2I2RE 1B8CA 2BCBA 2LV7A 2Q91A 1AJ5A 5AXIA 1QX7A 3CR5X 4HREE 1RECA 1ALVA 3LL8B 3KF9A 2KGRA 4YBHB 1LVCD 4Q04A 5KTYA 2KNEA 1J55A 3MSEB 1NX1A 1CM1A 1N65A 3D10A 1ZFSA 1YVHA 1BJFA 1EG4A 3ZNIA 1A75B 1KSOA 1UWOA 1Y0VH 1XFWO 2LHIA 2WC8A 3KHEA 4ORBB 1K94A 2JRFA 3JVTC 1RJVA 4M2QA 2F33A 4E68A 1ALWA 2BKHB 2MHHA 2Y5IA 2ISDA 1QV0A 4ZCUA 5CSNA 3IQQA 5HLOA 4BY5A 4GUKA 1MHOA 1ZOTB 3BQ3A 1SBJA 1TN4A 4U8DA 4C0LA 1KQMC 2AUCA 3NSLA 2HPSA 2LANA 1G33A 2SCPA 2CBLA 1JF2A 5ER5A 1SCMB 1N2DA 4HSZA 1WLZA 1KFXS 1TCOB 1AHRA 1CKKA 4GNKB 1XK4A 1FF1A 2KBIA 4I5NB 2KI6D 1KFXL 2QACA 5I2QA 2G2BA 2K0JA 1MXEA 2PRUA 4HRGA 2K7DA 1PSRA 2WOSA 1CMFA 3O2PA 1QIVA 3IQOA 1PALA 3K21A 3EK4A 1NPQA 1PRWA 4QJ4B 1N0YA 5ER4X 4PCWA 2LVKA 3JVTB 2JTTA 3HCMA 2F3ZA 2L4IA 3QRXA 4C0JA 1ODBA 1JC2A 1YR5A 2NCPA 1LXFC 1SK6D 3EVRA 3HX4A 2MRDA 2KI4C 4MLWA 1QJTA 1L2OB 3PLFB 1W7JB 2B1UA 3VROA 1CLLA 1F70A 1SPYA 3IF7A 3CR2A 3DVKA 1KQVA 1CM4A 2DOQA 1F8HA 3SG5A 4YI9A 2I7AA 3DD4A 3I5IB 1X02A 3AKBA 1YVLA 4JQ0D 2ZRSA 2O60A 1KK8C 1GQMA 2H2KA 4CFQA 3FS7A 1OOJA 2G9BA 2FOTA 2AMIA 3D0YA 1OZSA 2H61C 2L0PA 2BL0C 1M46A 2FCDA 1MR8A 1JUOA 4MZJA 1PVAA 1IWQA 1TCFA 1DJGA 1OMVA 1B7TY 1JFJA 2LLSA 5HKWA 1LA0A 5I2LA 2F8PA 4DCKA 2JT3A 2Y4QA 3O78A 4P2YB 2LC5A 2JQ6A 1NUBA 4FQOA 2PASA 2L2EA 3BUMB 1B47A 1GJYA 3EVVA 1SKTA 4CLNA 3D0YB 1VRKA 1GGZA 5AEQA 4PHNA 2VRGA 2BBMA 4GPLB 2ZKMX 1V1GA 1QVIZ 1HT9A 1CDLA 2BE4A 4GGFA 3NXAA 2M49B 2ZN8A 1JSAA 2KAYA 4MZLA 4WQ2A 4PE4A 1W7IB 1YRUB 1IQ3A 4AOMA 1F71A 3C1VA 1TNWA 1Y1XA 2BECA 5J3XA 1S3PA 4ZCVA 2K2AA 3SIAA 1M45A 2RGIA 2Y1NA 3KPXA 1H8BA 4PE7A 1CLBA 3GK1A 1IKUA 2BL0B 2ZN9A 4MRXA 1TTXA 2D8NA 1ZACA 1BG1A 1SCMC 3OB2B 4N1FA 2M0RA 1DJXA 2MJWB 1BF5A 2LMTA 1TNPA 2JNFA 2KQ6A 4N5XA 1WRKA 1SY9A 4CPVA 2LVIA 1BU3A 1FBVA 2KSPA 4PHKA 2WCFA 3A8RA 1XA5A 1F4QA 1PSBA 1AK8A 2CT9A 2HETA 3OP0A 5DKNA 2KAXA 3OX6A 1K9PA 1L7ZA 1XO5A 1MXLC 3FWCA 4ICBA 1H4BA 3OB1B 5K89A 1G8IA 4PALA 5DKRA 1YUUA 1J7OA 1L2OC 1TNQA 3TS5B 2LAPA 1XK4C 3PN7B 2K7BA 3AAJA 1ZUZA 1B7TZ 1K9UA 2JULA 2CXJA 2LHLA 1C7VA 1PVBA 3GOFA 1DTLA 1R2UA 4ORCB 2MBXA 4MBEA 1KK7Y 3I5IC 1K95A 2L98A 4USLA 2ZNEA 2LMVA 1A4PA 1NCYA 1NIWA 5I2OA 1NYAA 1GGWA 1DT7B 4YRUA 3LK1A 1JBAA 1RK9A 1PK0D 1SNLA 4NDCA 2CNPA 2JT0A 2K7CA 3WNXB 1IGVA 2R2IA 1S6CA 1KCYA 3ICBA 1S26D 2GGMA 1CNPA 1RWYA 2A4JA 2EGDA 2MAZA 4XJKA 5CSFA 5HYDA 1QX5B 1XFVO 1WRLA 2BKIB
chains in the Genus database with same CATH superfamily
3CZTX 2PALA 2OTGB 2O5GA 5EL2A 2LP3A 4AQJA 4OR9B 2LUXA 2WCEA 2BE6A 3FIAA 1FW4A 1FI6A 2NLNA 4GGNA 3PSRA 1SYMA 2LUCA 5PALA 1OZOA 2P71A 1EG3A 2K7OA 4A4BA 3DVMA 2ZFDA 2L4HA 4PHJA 2FJUB 4MEWA 5FI6A 1K90D 4GBAA 1QLKA 3S0EA 1FI5A 1NX2A 4IL1A 1G4YR 4C0KA 1SR6B 2NXQA 5HKZA 1M39A 3NSIA 4XJKB 1OW4A 2SASA 3BOWA 4GAOA 1UURA 3O6BA 4YGBB 3WHUB 2L50A 1S36A 1DJHA 5CSIA 1S5GY 5AERA 1NX3A 3SG4A 1C07A 1NCZA 3PALA 4YI8A 2WC5A 4OKHA 2E6WA 3I5GB 1JWDA 4MN0A 2WCKA 2I94A 3DVEA 2EC6B 1SL9A 4OV2A 4A4CA 3SS5A 1DF0A 3V2LA 1MF8B 1CMGA 1QXPA 4YGCB 1LS8A 4ETOA 1K8UA 1OMDA 1LINA 2KHNA 3F45A 1OSAA 4NQGA 3D73A 4GGFC 1Z2CB 1UHJA 3BOWB 4JPZB 3OHMB 4YGEB 3UNWA 1OE9B 1QIWA 2P6BB 3CWGA 2IS9A 1B8LA 1YRTB 1BT6A 1LA3A 3TDIA 3ZWHA 3PJIA 2EHBA 3BFAA 3EK8A 2I18A 2JPTA 3R72A 1BR4B 2PSRA 5DKQA 3RLZA 1SCVA 3R1OA 4QJ5B 1KSMA 1NP8A 2M9GA 1NWDA 1DF0B 4PE1A 3CS1A 2CCMA 2LVJA 2Q4UA 5DICA 2LP2A 3DZTA 4I5KA 1EH2A 1C3ZA 3DXLA 1M31A 3R1PA 1K96A 3TS5C 2L5YA 4I5LB 3PN7C 2KI6C 2QPTA 4MZKA 3UO9A 1YUTA 1C7WA 1B1GA 1DJYA 5F6TA 3CDNA 3BUOB 3M0WA 4M2PA 3BUXB 2JTZA 1W9ZA 3CLNA 4NDDA 1MUXA 3EKHA 1XYDA 1YUSA 3LCPC 2F3YA 1YX8A 1TUJA 5D69A 1OOHA 3D74A 3VRQA 2HQ8A 1WRZA 3DVJA 5HLVA 2KFHA 2LVVA 3SG2A 3SJSA 3LLEA 2LCPA 3BUWB 1IJ5A 2BCAA 4YGDB 2JXCA 4R1EA 3S0AA 1UHNA 2KGBC 3DYEA 1CDPA 3DF0A 3TUYB 1YTZC 1WY9A 2KLEA 4MVFA 1SL7A 3SIBA 4ORAB 1S1EA 5B8IB 3I5FB 4JD9A 3CTNA 4NDBA 2OPOA 2QEOA 2OTGC 1CDMA 2H8VA 1J1EA 2JNXA 4I5JA 3RM1A 1F55A 2JT8A 3K1EA 3PM8A 2LE9B 3FE8A 3LK0A 1IG5A 1QATA 3NSOA 3TDZA 1F4OA 2BAPA 2K61A 1TNXA 1XFZO 3DF0B 4DIRA 2KFFA 5G08A 1SR6C 1S6JA 1XFXO 2GV5A 5FYXA 1AUIB 3FWBA 2MA2A 4M2OA 1DGUA 1BMOA 3I5HC 3PFVA 1SMGA 1IIOA 1QTXA 2CTNA 1WDCB 2JC2A 1RFJA 3O4YA 2NCOA 2OS8C 1SL8A 1UHHA 4WQ3A 1A2XA 1BR1B 3I5GC 2PQLA 1B4CA 2F2OA 3B88A 2BCXA 2EC6C 3JTDB 1E8AA 1YX7A 4MSPA 1KWOB 1AVSA 1KFUS 1B9AA 1MQ1A 3AAKA 1IQ5A 1F54A 2NZ0A 2WCBA 5IBWA 2JZIA 1AJ4A 2KQYA 1KFUL 3SG3A 1CB1A 5GQQC 4F0ZB 3SG6A 2KFGA 2Y1MA 4F7FA 4YGAA 5I8NA 2QEBA 3RZSA 1QV1A 2KOTA 3E3RA 2HF5A 1QVIY 3VRPA 5KU1A 1BOCA 2WCJA 4XYNA 5BPJA 3D75A 1QWVA 2KBMA 1UHIA 1TRFA 4DUQA 3OX5A 1BLQA 4PHMA 2V53A 1CTRA 2QEHA 2KAVA 1IRJA 2PMYA 3BXKA 3CZ2A 5AFPA 2M7NA 2KDHA 4CIDA 1QS7A 1SW8A 3GK2A 1J7QA 2LLTA 5CPVA 2M1KB 1XFRA 2ZNDA 2L5XB 4HRHA 3I5HB 3BYAA 3BJHA 2GGZA 5HKYA 2JXLA 2FCEA 1AP4A 1DMOA 1S6IA 2LLUA 2OS8B 4AQIA 1J1DA 1OMRA 1DJIA 1DJZA 3WXAA 1UP5A 1TOPA 2WNDA 2KYFA 2MLEC 3VGOA 4DS7A 1QLSA 1XFUO 1YURA 2K2FA 2K60A 3B7AA 3BUNB 4FQTA 2AAOA 1U5IA 3H4SE 1D1OA 1DEKA 1KQMB 3GK4X 1SRAA 1NSHA 3B6XA 3NSKA 3D77A 3BFHA 3EK7A 3Q8IA 3EVUA 4P5OE 5D7FA 5JOLA 4QJ3B 2HQWA 2BBNA 1A03A 1JF0A 1JFKA 1MWNA 2TN4A 5JJGA 1ZMZA 5CSJA 4KYNA 3CYZA 4PE0A 2MLFC 1Y6WA 1Y1UA 2LMUA 1K9KA 3TUYC 1TIZA 2KLDA 1KK7Z 1TUZA 3DY9A 4IJ7A 4MRYA 4PDZA 2YGUA 1R6PA 1CFFA 1LKJA 2ERBA 1A29A 3SG7A 1UHKA 2M7LA 1HQVA 3I5FC 1J7RA 1DELA 4BY4A 4OVNF 1U5IB 1EJ3A 3KO0A 1XVJA 1OQPA 2JWWA 3CR4X 1UUSA 3VRRA 1CFDA 1PULA 3CGAA 2FJYA 3D76A 3FE6A 1QASA 3CABA 1Y1AA 4JWQA 1K2HA 2M97A 5AANA 2KYCA 3TZ1A 1TWOA 4WRIA 3WHTB 1CFPA 1FPWA 3EKJA 1RROA 2LM5A 4GFTA 2LNKA 2ZRTA 1M63B 1DGVA 1EL4A 2E30A 1NX0A 1DVIA 1QX2A 2H61A 2M29A 2M8UA 2KI4B 4L9MA 2WCLA 1Q80A 1B8RA 1XFYO 1CLMA 4D1EA 3S0FA 1J7PA 3A4UB 5TNCA 3TDUA 1IH0A 2PVBA 2L51A 3NHTA 2JU0A 3R1VA 1IJ6A 1WDCC 1CFCA 3NHIA 3VB1A 3KEVA 2F2PA 2K8MB 1EXRA 2WORA 3AKAA 4TNCA 1KK8B 4FTGA 1RTP1 1WLMA 3VRNA 4DRWA 2COLB 5KSZA 3JTDC 2QDIA 2JOJA 3PATA 1KWOC 4N1GA 1CDNA 1A75A 2WC6A 3N7HA 1DJWA 3S0BA 1V1FA 2M3WA 4OCIA 4CFRA 1K93D 1NCXA 2M1UA 4UPGA 1BODA 1S5GZ 2I2RE 1B8CA 2BCBA 2LV7A 2Q91A 1AJ5A 5AXIA 1QX7A 2QEVA 3CR5X 4HREE 3L47A 1RECA 1ALVA 3LL8B 3KF9A 2KGRA 4YBHB 1LVCD 4Q04A 5KTYA 2KNEA 1DC1A 1J55A 1Z4HA 3MSEB 1NX1A 1CM1A 1N65A 3D10A 1ZFSA 1YVHA 1BJFA 1EG4A 3ZNIA 1A75B 1KSOA 1UWOA 1Y0VH 1XFWO 2LHIA 2WC8A 3KHEA 4ORBB 1K94A 2JRFA 3JVTC 1RJVA 4M2QA 2F33A 4E68A 1ALWA 2BKHB 3L4AA 2MHHA 3D78A 2Y5IA 2ISDA 1QV0A 4ZCUA 5CSNA 3IQQA 5HLOA 4BY5A 4GUKA 1MHOA 1ZOTB 3BQ3A 2PYQA 1SBJA 1TN4A 4OZDA 4U8DA 1KQMC 3SS3A 2AUCA 4C0LA 3NSLA 2HPSA 2LANA 1G33A 2SCPA 2CBLA 1JF2A 5ER5A 1SCMB 1N2DA 1OOFA 1WLZA 3QMEA 1KFXS 1TCOB 4HSZA 1AHRA 1CKKA 4GNKB 1XK4A 1FF1A 2KBIA 4I5NB 5FI2A 2KI6D 1KFXL 2QACA 5I2QA 2G2BA 2K0JA 1MXEA 2PRUA 3FE9A 2K7DA 1PSRA 4HRGA 2WOSA 1CMFA 3O2PA 1QIVA 3IQOA 1PALA 3K21A 3EK4A 3S0DA 1NPQA 1PRWA 2WCHA 4QJ4B 1N0YA 5ER4X 4PCWA 2LVKA 2WCMA 2JTTA 3HCMA 3JVTB 2F3ZA 2L4IA 3QRXA 4C0JA 1ODBA 1JC2A 1YR5A 2NCPA 1LXFC 1SK6D 3SS4A 3EVRA 3HX4A 2MRDA 2KI4C 4MLWA 1QJTA 1L2OB 3PLFB 1W7JB 1OOIX 4JKTA 2B1UA 3VROA 1CLLA 1F70A 1SPYA 3IF7A 3CR2A 3DVKA 1KQVA 1CM4A 2DOQA 1F8HA 2JPOA 3SG5A 4YI9A 2I7AA 3DD4A 3I5IB 1X02A 3AKBA 1YVLA 4JQ0D 2ZRSA 2O60A 3S0GA 1KK8C 1GQMA 2H2KA 4CFQA 3FS7A 1OOJA 2G9BA 2FOTA 2AMIA 2KPHA 2L2CA 3D0YA 1OZSA 2H61C 2L0PA 2BL0C 1M46A 2GTEA 2FCDA 1MR8A 1JUOA 4MZJA 1PVAA 1IWQA 1TCFA 1DJGA 1OMVA 1B7TY 1JFJA 2LLSA 5HKWA 1LA0A 5I2LA 2F8PA 4DCKA 3L4LA 2JT3A 2Y4QA 3O78A 4P2YB 2LC5A 1GM0A 2JQ6A 1NUBA 4FQOA 2PASA 2L2EA 3BUMB 1B47A 1GJYA 3EVVA 1SKTA 4CLNA 3D0YB 1VRKA 1GGZA 5AEQA 4PHNA 2VRGA 2BBMA 4GPLB 2ZKMX 1V1GA 1QVIZ 1HT9A 1CDLA 2BE4A 4GGFA 3NXAA 2M49B 2ZN8A 1JSAA 2KAYA 4MZLA 3BFBA 3B86A 4PE4A 1W7IB 4WQ2A 1YRUB 1IQ3A 4AOMA 1OOGA 1F71A 3C1VA 1TNWA 1Y1XA 2BECA 5J3XA 1S3PA 4ZCVA 2K2AA 3SIAA 1M45A 2RGIA 2Y1NA 3KPXA 3PM2A 3CZ1A 1H8BA 4PE7A 1CLBA 3GK1A 1IKUA 2BL0B 2ZN9A 4MRXA 1TTXA 2D8NA 1ZACA 3B87A 1BG1A 1SCMC 3OB2B 4N1FA 1SSEB 4INWA 2M0RA 3NGVA 1DJXA 2MJWB 1BF5A 2LMTA 1TNPA 2JNFA 2KQ6A 3O4XA 1P28A 4N5XA 3CZ0A 1WRKA 1T14A 1SY9A 4CPVA 2LVIA 5D3OA 1BU3A 1FBVA 2KSPA 4PHKA 2WCFA 3A8RA 1XA5A 2P70A 1F4QA 1PSBA 1AK8A 2CT9A 2HETA 3OP0A 5DKNA 2KAXA 3OX6A 1K9PA 5FI7A 1L7ZA 1XO5A 1MXLC 3FWCA 4ICBA 1H4BA 3OB1B 5K89A 1G8IA 4PALA 5DKRA 1YUUA 1J7OA 1L2OC 1TNQA 3TS5B 2LAPA 1XK4C 3PN7B 2K7BA 3AAJA 1ZUZA 4PT1A 1B7TZ 1K9UA 2JULA 5HL1A 2CXJA 2LHLA 5I94A 1PVBA 3GOFA 1C7VA 1DTLA 1R2UA 3OBVA 4ORCB 2MBXA 4MBEA 1KK7Y 3I5IC 1K95A 2L98A 4USLA 2ZNEA 2LMVA 1A4PA 1NCYA 1C3YA 1NIWA 5I2OA 1NYAA 1GGWA 1DT7B 3OGNA 1DQEA 4YRUA 1ORGA 4INXA 3LK1A 1JBAA 1RK9A 1PK0D 1SNLA 2BNXA 4NDCA 2CNPA 2JT0A 2K7CA 3WNXB 3IVTA 1IGVA 2R2IA 1S6CA 1KCYA 3ICBA 1S26D 2GGMA 1CNPA 1RWYA 2A4JA 2EGDA 2MAZA 4XJKA 5CSFA 3EG5B 5HYDA 1QX5B 1XFVO 1WRLA 2BKIB
chains in the Genus database with same CATH topology
3CZTX 2PALA 2OTGB 2O5GA 2LP3A 4AQJA 4OR9B 2LUXA 2WCEA 2BE6A 3FIAA 1FW4A 1FI6A 2NLNA 4GGNA 3PSRA 1SYMA 2LUCA 5PALA 1OZOA 1EG3A 2K7OA 4A4BA 3DVMA 2ZFDA 2L4HA 4PHJA 2FJUB 4MEWA 1K90D 4GBAA 1QLKA 1FI5A 1NX2A 4IL1A 1G4YR 4C0KA 1SR6B 2NXQA 5HKZA 1M39A 3NSIA 4XJKB 2SASA 3BOWA 4GAOA 1UURA 3O6BA 4YGBB 3WHUB 2L50A 1S36A 1DJHA 5CSIA 1S5GY 5AERA 1NX3A 3SG4A 1C07A 1NCZA 3PALA 4YI8A 4OKHA 2E6WA 3I5GB 1JWDA 4MN0A 2I94A 3DVEA 2EC6B 1SL9A 4OV2A 4A4CA 1DF0A 1MF8B 1CMGA 1QXPA 4YGCB 4ETOA 1K8UA 1OMDA 1LINA 2KHNA 3F45A 1OSAA 4NQGA 4GGFC 3BOWB 1UHJA 4JPZB 3OHMB 4YGEB 1OE9B 1QIWA 2P6BB 3CWGA 2IS9A 1B8LA 1YRTB 1BT6A 1LA3A 3TDIA 3ZWHA 2EHBA 3EK8A 2I18A 2JPTA 1BR4B 2PSRA 5DKQA 3RLZA 1SCVA 4QJ5B 1KSMA 1NP8A 2M9GA 1NWDA 1DF0B 4PE1A 3CS1A 2CCMA 2LVJA 2Q4UA 2LP2A 4I5KA 1EH2A 1M31A 1K96A 3TS5C 4I5LB 3PN7C 2KI6C 2QPTA 4MZKA 1YUTA 1C7WA 1B1GA 1DJYA 5F6TA 3BUOB 3M0WA 4M2PA 3BUXB 2JTZA 3CLNA 4NDDA 1MUXA 3EKHA 1XYDA 1YUSA 3LCPC 2F3YA 1YX8A 5D69A 3VRQA 2HQ8A 1WRZA 3DVJA 5HLVA 2KFHA 2LVVA 3SG2A 3SJSA 3LLEA 2LCPA 3BUWB 1IJ5A 2BCAA 4YGDB 2JXCA 4R1EA 1UHNA 2KGBC 1CDPA 3DF0A 3TUYB 1YTZC 1WY9A 4MVFA 1SL7A 3SIBA 4ORAB 1S1EA 5B8IB 3I5FB 3CTNA 4NDBA 2OPOA 2OTGC 1CDMA 1J1EA 2JNXA 4I5JA 3RM1A 1F55A 2JT8A 3PM8A 2LE9B 3LK0A 1IG5A 1QATA 3NSOA 3TDZA 1F4OA 2K61A 1TNXA 1XFZO 3DF0B 4DIRA 2KFFA 5G08A 1SR6C 1S6JA 1XFXO 2GV5A 5FYXA 1AUIB 3FWBA 2MA2A 4M2OA 1DGUA 1BMOA 3I5HC 3PFVA 1SMGA 1QTXA 2CTNA 1WDCB 2JC2A 1RFJA 3O4YA 2NCOA 2OS8C 1SL8A 1UHHA 4WQ3A 1A2XA 1BR1B 3I5GC 1B4CA 2F2OA 2BCXA 2EC6C 3JTDB 1E8AA 1YX7A 4MSPA 1KWOB 1AVSA 1KFUS 1B9AA 1MQ1A 3AAKA 1IQ5A 1F54A 2NZ0A 2WCBA 5IBWA 2JZIA 1AJ4A 2KQYA 1KFUL 3SG3A 1CB1A 5GQQC 4F0ZB 3SG6A 2KFGA 2Y1MA 5I8NA 4YGAA 1QV1A 2KOTA 3E3RA 2HF5A 1QVIY 3VRPA 5KU1A 1BOCA 4XYNA 5BPJA 2KBMA 1UHIA 1TRFA 4DUQA 3OX5A 1BLQA 4PHMA 2V53A 1CTRA 2KAVA 1IRJA 2PMYA 3BXKA 5AFPA 2M7NA 2KDHA 4CIDA 1QS7A 1SW8A 3GK2A 1J7QA 2LLTA 5CPVA 2M1KB 4HRHA 2ZNDA 2L5XB 3I5HB 3BYAA 1DMOA 2GGZA 5HKYA 2JXLA 2FCEA 1AP4A 1S6IA 2LLUA 2OS8B 4AQIA 1J1DA 1OMRA 1DJIA 1DJZA 3WXAA 1UP5A 1TOPA 2WNDA 2KYFA 2MLEC 3VGOA 4DS7A 1QLSA 1XFUO 1YURA 2K2FA 3BUNB 1D1OA 2AAOA 1U5IA 3H4SE 1KQMB 3GK4X 1SRAA 1NSHA 3NSKA 3EK7A 3EVUA 4P5OE 5D7FA 5JOLA 4QJ3B 2HQWA 2BBNA 1JF0A 1JFKA 1MWNA 2TN4A 5JJGA 1ZMZA 5CSJA 4PE0A 2MLFC 1Y6WA 1Y1UA 2LMUA 1K9KA 3TUYC 1TIZA 4MRYA 1KK7Z 1A03A 4PDZA 1R6PA 1CFFA 1LKJA 1A29A 3SG7A 1UHKA 2M7LA 1HQVA 3I5FC 1J7RA 4BY4A 4OVNF 1U5IB 1EJ3A 3KO0A 1XVJA 1OQPA 2JWWA 3CR4X 1UUSA 3VRRA 1CFDA 1PULA 3CGAA 4JWQA 1QASA 1Y1AA 1K2HA 2M97A 5AANA 2KYCA 3TZ1A 4WRIA 3WHTB 1CFPA 1FPWA 3EKJA 1RROA 2LM5A 4GFTA 2LNKA 2ZRTA 1M63B 1DGVA 1EL4A 2E30A 1NX0A 1DVIA 1QX2A 2H61A 2M29A 2M8UA 2KI4B 4L9MA 1Q80A 1B8RA 1XFYO 1CLMA 4D1EA 1J7PA 3A4UB 5TNCA 3TDUA 1IH0A 2PVBA 2L51A 2JU0A 1CFCA 1IJ6A 1WDCC 3KEVA 2F2PA 2K8MB 1EXRA 2WORA 3AKAA 4TNCA 1KK8B 4FTGA 1RTP1 1WLMA 3VRNA 4DRWA 2COLB 5KSZA 3JTDC 2JOJA 3PATA 1KWOC 4N1GA 1CDNA 1A75A 1DJWA 1V1FA 2M3WA 4OCIA 4CFRA 1K93D 1NCXA 2M1UA 4UPGA 1BODA 1S5GZ 2I2RE 1B8CA 2BCBA 2LV7A 2Q91A 1AJ5A 5AXIA 1QX7A 3CR5X 4HREE 1RECA 1ALVA 3LL8B 3KF9A 2KGRA 4YBHB 1LVCD 4Q04A 5KTYA 2KNEA 1J55A 3MSEB 1NX1A 1CM1A 1N65A 3D10A 1ZFSA 1YVHA 1BJFA 1EG4A 3ZNIA 1A75B 1KSOA 1UWOA 1Y0VH 1XFWO 2LHIA 2WC8A 3KHEA 4ORBB 1K94A 2JRFA 3JVTC 1RJVA 4M2QA 2F33A 4E68A 1ALWA 2BKHB 2MHHA 2Y5IA 2ISDA 1QV0A 4ZCUA 5CSNA 3IQQA 5HLOA 4BY5A 4GUKA 1MHOA 1ZOTB 3BQ3A 1SBJA 1TN4A 4U8DA 4C0LA 1KQMC 2AUCA 3NSLA 2HPSA 2LANA 1G33A 2SCPA 2CBLA 1JF2A 5ER5A 1SCMB 1N2DA 4HSZA 1WLZA 1KFXS 1TCOB 1AHRA 1CKKA 4GNKB 1XK4A 1FF1A 2KBIA 4I5NB 2KI6D 1KFXL 2QACA 5I2QA 2G2BA 2K0JA 1MXEA 2PRUA 4HRGA 2K7DA 1PSRA 2WOSA 1CMFA 3O2PA 1QIVA 3IQOA 1PALA 3K21A 3EK4A 1NPQA 1PRWA 4QJ4B 1N0YA 5ER4X 4PCWA 2LVKA 3JVTB 2JTTA 3HCMA 2F3ZA 2L4IA 3QRXA 4C0JA 1ODBA 1JC2A 1YR5A 2NCPA 1LXFC 1SK6D 3EVRA 3HX4A 2MRDA 2KI4C 4MLWA 1QJTA 1L2OB 3PLFB 1W7JB 2B1UA 3VROA 1CLLA 1F70A 1SPYA 3IF7A 3CR2A 3DVKA 1KQVA 1CM4A 2DOQA 1F8HA 3SG5A 4YI9A 2I7AA 3DD4A 3I5IB 1X02A 3AKBA 1YVLA 4JQ0D 2ZRSA 2O60A 1KK8C 1GQMA 2H2KA 4CFQA 3FS7A 1OOJA 2G9BA 2FOTA 2AMIA 3D0YA 1OZSA 2H61C 2L0PA 2BL0C 1M46A 2FCDA 1MR8A 1JUOA 4MZJA 1PVAA 1IWQA 1TCFA 1DJGA 1OMVA 1B7TY 1JFJA 2LLSA 5HKWA 1LA0A 5I2LA 2F8PA 4DCKA 2JT3A 2Y4QA 3O78A 4P2YB 2LC5A 2JQ6A 1NUBA 4FQOA 2PASA 2L2EA 3BUMB 1B47A 1GJYA 3EVVA 1SKTA 4CLNA 3D0YB 1VRKA 1GGZA 5AEQA 4PHNA 2VRGA 2BBMA 4GPLB 2ZKMX 1V1GA 1QVIZ 1HT9A 1CDLA 2BE4A 4GGFA 3NXAA 2M49B 2ZN8A 1JSAA 2KAYA 4MZLA 4WQ2A 4PE4A 1W7IB 1YRUB 1IQ3A 4AOMA 1F71A 3C1VA 1TNWA 1Y1XA 2BECA 5J3XA 1S3PA 4ZCVA 2K2AA 3SIAA 1M45A 2RGIA 2Y1NA 3KPXA 1H8BA 4PE7A 1CLBA 3GK1A 1IKUA 2BL0B 2ZN9A 4MRXA 1TTXA 2D8NA 1ZACA 1BG1A 1SCMC 3OB2B 4N1FA 2M0RA 1DJXA 2MJWB 1BF5A 2LMTA 1TNPA 2JNFA 2KQ6A 4N5XA 1WRKA 1SY9A 4CPVA 2LVIA 1BU3A 1FBVA 2KSPA 4PHKA 2WCFA 3A8RA 1XA5A 1F4QA 1PSBA 1AK8A 2CT9A 2HETA 3OP0A 5DKNA 2KAXA 3OX6A 1K9PA 1L7ZA 1XO5A 1MXLC 3FWCA 4ICBA 1H4BA 3OB1B 5K89A 1G8IA 4PALA 5DKRA 1YUUA 1J7OA 1L2OC 1TNQA 3TS5B 2LAPA 1XK4C 3PN7B 2K7BA 3AAJA 1ZUZA 1B7TZ 1K9UA 2JULA 2CXJA 2LHLA 1C7VA 1PVBA 3GOFA 1DTLA 1R2UA 4ORCB 2MBXA 4MBEA 1KK7Y 3I5IC 1K95A 2L98A 4USLA 2ZNEA 2LMVA 1A4PA 1NCYA 1NIWA 5I2OA 1NYAA 1GGWA 1DT7B 4YRUA 3LK1A 1JBAA 1RK9A 1PK0D 1SNLA 4NDCA 2CNPA 2JT0A 2K7CA 3WNXB 1IGVA 2R2IA 1S6CA 1KCYA 3ICBA 1S26D 2GGMA 1CNPA 1RWYA 2A4JA 2EGDA 2MAZA 4XJKA 5CSFA 5HYDA 1QX5B 1XFVO 1WRLA 2BKIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZT X;  2PAL A;  2OTG B;  2O5G A;  2LP3 A;  4AQJ A;  4OR9 B;  2LUX A;  2WCE A;  2BE6 A;  3FIA A;  1FW4 A;  1FI6 A;  2NLN A;  4GGN A;  3PSR A;  1SYM A;  2LUC A;  5PAL A;  1OZO A;  1EG3 A;  2K7O A;  4A4B A;  3DVM A;  2ZFD A;  2L4H A;  4PHJ A;  2FJU B;  4MEW A;  1K90 D;  4GBA A;  1QLK A;  1FI5 A;  1NX2 A;  4IL1 A;  1G4Y R;  4C0K A;  1SR6 B;  2NXQ A;  5HKZ A;  1M39 A;  3NSI A;  4XJK B;  2SAS A;  3BOW A;  4GAO A;  1UUR A;  3O6B A;  4YGB B;  3WHU B;  2L50 A;  1S36 A;  1DJH A;  5CSI A;  1S5G Y;  5AER A;  1NX3 A;  3SG4 A;  1C07 A;  1NCZ A;  3PAL A;  4YI8 A;  4OKH A;  2E6W A;  3I5G B;  1JWD A;  4MN0 A;  2I94 A;  3DVE A;  2EC6 B;  1SL9 A;  4OV2 A;  4A4C A;  1DF0 A;  1MF8 B;  1CMG A;  1QXP A;  4YGC B;  4ETO A;  1K8U A;  1OMD A;  1LIN A;  2KHN A;  3F45 A;  1OSA A;  4NQG A;  4GGF C;  3BOW B;  1UHJ A;  4JPZ B;  3OHM B;  4YGE B;  1OE9 B;  1QIW A;  2P6B B;  3CWG A;  2IS9 A;  1B8L A;  1YRT B;  1BT6 A;  1LA3 A;  3TDI A;  3ZWH A;  2EHB A;  3EK8 A;  2I18 A;  2JPT A;  1BR4 B;  2PSR A;  5DKQ A;  3RLZ A;  1SCV A;  4QJ5 B;  1KSM A;  1NP8 A;  2M9G A;  1NWD A;  1DF0 B;  4PE1 A;  3CS1 A;  2CCM A;  2LVJ A;  2Q4U A;  2LP2 A;  4I5K A;  1EH2 A;  1M31 A;  1K96 A;  3TS5 C;  4I5L B;  3PN7 C;  2KI6 C;  2QPT A;  4MZK A;  1YUT A;  1C7W A;  1B1G A;  1DJY A;  5F6T A;  3BUO B;  3M0W A;  4M2P A;  3BUX B;  2JTZ A;  3CLN A;  4NDD A;  1MUX A;  3EKH A;  1XYD A;  1YUS A;  3LCP C;  2F3Y A;  1YX8 A;  5D69 A;  3VRQ A;  2HQ8 A;  1WRZ A;  3DVJ A;  5HLV A;  2KFH A;  2LVV A;  3SG2 A;  3SJS A;  3LLE A;  2LCP A;  3BUW B;  1IJ5 A;  2BCA A;  4YGD B;  2JXC A;  4R1E A;  1UHN A;  2KGB C;  1CDP A;  3DF0 A;  3TUY B;  1YTZ C;  1WY9 A;  4MVF A;  1SL7 A;  3SIB A;  4ORA B;  1S1E A;  5B8I B;  3I5F B;  3CTN A;  4NDB A;  2OPO A;  2OTG C;  1CDM A;  1J1E A;  2JNX A;  4I5J A;  3RM1 A;  1F55 A;  2JT8 A;  3PM8 A;  2LE9 B;  3LK0 A;  1IG5 A;  1QAT A;  3NSO A;  3TDZ A;  1F4O A;  2K61 A;  1TNX A;  1XFZ O;  3DF0 B;  4DIR A;  2KFF A;  5G08 A;  1SR6 C;  1S6J A;  1XFX O;  2GV5 A;  5FYX A;  1AUI B;  3FWB A;  2MA2 A;  4M2O A;  1DGU A;  1BMO A;  3I5H C;  3PFV A;  1SMG A;  1QTX A;  2CTN A;  1WDC B;  2JC2 A;  1RFJ A;  3O4Y A;  2NCO A;  2OS8 C;  1SL8 A;  1UHH A;  4WQ3 A;  1A2X A;  1BR1 B;  3I5G C;  1B4C A;  2F2O A;  2BCX A;  2EC6 C;  3JTD B;  1E8A A;  1YX7 A;  4MSP A;  1KWO B;  1AVS A;  1KFU S;  1B9A A;  1MQ1 A;  3AAK A;  1IQ5 A;  1F54 A;  2NZ0 A;  2WCB A;  5IBW A;  2JZI A;  1AJ4 A;  2KQY A;  1KFU L;  3SG3 A;  1CB1 A;  5GQQ C;  4F0Z B;  3SG6 A;  2KFG A;  2Y1M A;  5I8N A;  4YGA A;  1QV1 A;  2KOT A;  3E3R A;  2HF5 A;  1QVI Y;  3VRP A;  5KU1 A;  1BOC A;  4XYN A;  5BPJ A;  2KBM A;  1UHI A;  1TRF A;  4DUQ A;  3OX5 A;  1BLQ A;  4PHM A;  2V53 A;  1CTR A;  2KAV A;  1IRJ A;  2PMY A;  3BXK A;  5AFP A;  2M7N A;  2KDH A;  4CID A;  1QS7 A;  1SW8 A;  3GK2 A;  1J7Q A;  2LLT A;  5CPV A;  2M1K B;  4HRH A;  2ZND A;  2L5X B;  3I5H B;  3BYA A;  1DMO A;  2GGZ A;  5HKY A;  2JXL A;  2FCE A;  1AP4 A;  1S6I A;  2LLU A;  2OS8 B;  4AQI A;  1J1D A;  1OMR A;  1DJI A;  1DJZ A;  3WXA A;  1UP5 A;  1TOP A;  2WND A;  2KYF A;  2MLE C;  3VGO A;  4DS7 A;  1QLS A;  1XFU O;  1YUR A;  2K2F A;  3BUN B;  1D1O A;  2AAO A;  1U5I A;  3H4S E;  1KQM B;  3GK4 X;  1SRA A;  1NSH A;  3NSK A;  3EK7 A;  3EVU A;  4P5O E;  5D7F A;  5JOL A;  4QJ3 B;  2HQW A;  2BBN A;  1JF0 A;  1JFK A;  1MWN A;  2TN4 A;  5JJG A;  1ZMZ A;  5CSJ A;  4PE0 A;  2MLF C;  1Y6W A;  1Y1U A;  2LMU A;  1K9K A;  3TUY C;  1TIZ A;  4MRY A;  1KK7 Z;  1A03 A;  4PDZ A;  1R6P A;  1CFF A;  1LKJ A;  1A29 A;  3SG7 A;  1UHK A;  2M7L A;  1HQV A;  3I5F C;  1J7R A;  4BY4 A;  4OVN F;  1U5I B;  1EJ3 A;  3KO0 A;  1XVJ A;  1OQP A;  2JWW A;  3CR4 X;  1UUS A;  3VRR A;  1CFD A;  1PUL A;  3CGA A;  4JWQ A;  1QAS A;  1Y1A A;  1K2H A;  2M97 A;  5AAN A;  2KYC A;  3TZ1 A;  4WRI A;  3WHT B;  1CFP A;  1FPW A;  3EKJ A;  1RRO A;  2LM5 A;  4GFT A;  2LNK A;  2ZRT A;  1M63 B;  1DGV A;  1EL4 A;  2E30 A;  1NX0 A;  1DVI A;  1QX2 A;  2H61 A;  2M29 A;  2M8U A;  2KI4 B;  4L9M A;  1Q80 A;  1B8R A;  1XFY O;  1CLM A;  4D1E A;  1J7P A;  3A4U B;  5TNC A;  3TDU A;  1IH0 A;  2PVB A;  2L51 A;  2JU0 A;  1CFC A;  1IJ6 A;  1WDC C;  3KEV A;  2F2P A;  2K8M B;  1EXR A;  2WOR A;  3AKA A;  4TNC A;  1KK8 B;  4FTG A;  1RTP 1;  1WLM A;  3VRN A;  4DRW A;  2COL B;  5KSZ A;  3JTD C;  2JOJ A;  3PAT A;  1KWO C;  4N1G A;  1CDN A;  1A75 A;  1DJW A;  1V1F A;  2M3W A;  4OCI A;  4CFR A;  1K93 D;  1NCX A;  2M1U A;  4UPG A;  1BOD A;  1S5G Z;  2I2R E;  1B8C A;  2BCB A;  2LV7 A;  2Q91 A;  1AJ5 A;  5AXI A;  1QX7 A;  3CR5 X;  4HRE E;  1REC A;  1ALV A;  3LL8 B;  3KF9 A;  2KGR A;  4YBH B;  1LVC D;  4Q04 A;  5KTY A;  2KNE A;  1J55 A;  3MSE B;  1NX1 A;  1CM1 A;  1N65 A;  3D10 A;  1ZFS A;  1YVH A;  1BJF A;  1EG4 A;  3ZNI A;  1A75 B;  1KSO A;  1UWO A;  1Y0V H;  1XFW O;  2LHI A;  2WC8 A;  3KHE A;  4ORB B;  1K94 A;  2JRF A;  3JVT C;  1RJV A;  4M2Q A;  2F33 A;  4E68 A;  1ALW A;  2BKH B;  2MHH A;  2Y5I A;  2ISD A;  1QV0 A;  4ZCU A;  5CSN A;  3IQQ A;  5HLO A;  4BY5 A;  4GUK A;  1MHO A;  1ZOT B;  3BQ3 A;  1SBJ A;  1TN4 A;  4U8D A;  4C0L A;  1KQM C;  2AUC A;  3NSL A;  2HPS A;  2LAN A;  1G33 A;  2SCP A;  2CBL A;  1JF2 A;  5ER5 A;  1SCM B;  1N2D A;  4HSZ A;  1WLZ A;  1KFX S;  1TCO B;  1AHR A;  1CKK A;  4GNK B;  1XK4 A;  1FF1 A;  2KBI A;  4I5N B;  2KI6 D;  1KFX L;  2QAC A;  5I2Q A;  2G2B A;  2K0J A;  1MXE A;  2PRU A;  4HRG A;  2K7D A;  1PSR A;  2WOS A;  1CMF A;  3O2P A;  1QIV A;  3IQO A;  1PAL A;  3K21 A;  3EK4 A;  1NPQ A;  1PRW A;  4QJ4 B;  1N0Y A;  5ER4 X;  4PCW A;  2LVK A;  3JVT B;  2JTT A;  3HCM A;  2F3Z A;  2L4I A;  3QRX A;  4C0J A;  1ODB A;  1JC2 A;  1YR5 A;  2NCP A;  1LXF C;  1SK6 D;  3EVR A;  3HX4 A;  2MRD A;  2KI4 C;  4MLW A;  1QJT A;  1L2O B;  3PLF B;  1W7J B;  2B1U A;  3VRO A;  1CLL A;  1F70 A;  1SPY A;  3IF7 A;  3CR2 A;  3DVK A;  1KQV A;  1CM4 A;  2DOQ A;  1F8H A;  3SG5 A;  4YI9 A;  2I7A A;  3DD4 A;  3I5I B;  1X02 A;  3AKB A;  1YVL A;  4JQ0 D;  2ZRS A;  2O60 A;  1KK8 C;  1GQM A;  2H2K A;  4CFQ A;  3FS7 A;  1OOJ A;  2G9B A;  2FOT A;  2AMI A;  3D0Y A;  1OZS A;  2H61 C;  2L0P A;  2BL0 C;  1M46 A;  2FCD A;  1MR8 A;  1JUO A;  4MZJ A;  1PVA A;  1IWQ A;  1TCF A;  1DJG A;  1OMV A;  1B7T Y;  1JFJ A;  2LLS A;  5HKW A;  1LA0 A;  5I2L A;  2F8P A;  4DCK A;  2JT3 A;  2Y4Q A;  3O78 A;  4P2Y B;  2LC5 A;  2JQ6 A;  1NUB A;  4FQO A;  2PAS A;  2L2E A;  3BUM B;  1B47 A;  1GJY A;  3EVV A;  1SKT A;  4CLN A;  3D0Y B;  1VRK A;  1GGZ A;  5AEQ A;  4PHN A;  2VRG A;  2BBM A;  4GPL B;  2ZKM X;  1V1G A;  1QVI Z;  1HT9 A;  1CDL A;  2BE4 A;  4GGF A;  3NXA A;  2M49 B;  2ZN8 A;  1JSA A;  2KAY A;  4MZL A;  4WQ2 A;  4PE4 A;  1W7I B;  1YRU B;  1IQ3 A;  4AOM A;  1F71 A;  3C1V A;  1TNW A;  1Y1X A;  2BEC A;  5J3X A;  1S3P A;  4ZCV A;  2K2A A;  3SIA A;  1M45 A;  2RGI A;  2Y1N A;  3KPX A;  1H8B A;  4PE7 A;  1CLB A;  3GK1 A;  1IKU A;  2BL0 B;  2ZN9 A;  4MRX A;  1TTX A;  2D8N A;  1ZAC A;  1BG1 A;  1SCM C;  3OB2 B;  4N1F A;  2M0R A;  1DJX A;  2MJW B;  1BF5 A;  2LMT A;  1TNP A;  2JNF A;  2KQ6 A;  4N5X A;  1WRK A;  1SY9 A;  4CPV A;  2LVI A;  1BU3 A;  1FBV A;  2KSP A;  4PHK A;  2WCF A;  3A8R A;  1XA5 A;  1F4Q A;  1PSB A;  1AK8 A;  2CT9 A;  2HET A;  3OP0 A;  5DKN A;  2KAX A;  3OX6 A;  1K9P A;  1L7Z A;  1XO5 A;  1MXL C;  3FWC A;  4ICB A;  1H4B A;  3OB1 B;  5K89 A;  1G8I A;  4PAL A;  5DKR A;  1YUU A;  1J7O A;  1L2O C;  1TNQ A;  3TS5 B;  2LAP A;  1XK4 C;  3PN7 B;  2K7B A;  3AAJ A;  1ZUZ A;  1B7T Z;  1K9U A;  2JUL A;  2CXJ A;  2LHL A;  1C7V A;  1PVB A;  3GOF A;  1DTL A;  1R2U A;  4ORC B;  2MBX A;  4MBE A;  1KK7 Y;  3I5I C;  1K95 A;  2L98 A;  4USL A;  2ZNE A;  2LMV A;  1A4P A;  1NCY A;  1NIW A;  5I2O A;  1NYA A;  1GGW A;  1DT7 B;  4YRU A;  3LK1 A;  1JBA A;  1RK9 A;  1PK0 D;  1SNL A;  4NDC A;  2CNP A;  2JT0 A;  2K7C A;  3WNX B;  1IGV A;  2R2I A;  1S6C A;  1KCY A;  3ICB A;  1S26 D;  2GGM A;  1CNP A;  1RWY A;  2A4J A;  2EGD A;  2MAZ A;  4XJK A;  5CSF A;  5HYD A;  1QX5 B;  1XFV O;  1WRL A;  2BKI B; 
#chains in the Genus database with same CATH topology
 3CZT X;  2PAL A;  2OTG B;  2O5G A;  5EL2 A;  2LP3 A;  4AQJ A;  4OR9 B;  2LUX A;  2WCE A;  2BE6 A;  3FIA A;  1FW4 A;  1FI6 A;  2NLN A;  4GGN A;  3PSR A;  1SYM A;  2LUC A;  5PAL A;  1OZO A;  2P71 A;  1EG3 A;  2K7O A;  4A4B A;  3DVM A;  2ZFD A;  2L4H A;  4PHJ A;  2FJU B;  4MEW A;  5FI6 A;  1K90 D;  4GBA A;  1QLK A;  3S0E A;  1FI5 A;  1NX2 A;  4IL1 A;  1G4Y R;  4C0K A;  1SR6 B;  2NXQ A;  5HKZ A;  1M39 A;  3NSI A;  4XJK B;  1OW4 A;  2SAS A;  3BOW A;  4GAO A;  1UUR A;  3O6B A;  4YGB B;  3WHU B;  2L50 A;  1S36 A;  1DJH A;  5CSI A;  1S5G Y;  5AER A;  1NX3 A;  3SG4 A;  1C07 A;  1NCZ A;  3PAL A;  4YI8 A;  2WC5 A;  4OKH A;  2E6W A;  3I5G B;  1JWD A;  4MN0 A;  2WCK A;  2I94 A;  3DVE A;  2EC6 B;  1SL9 A;  4OV2 A;  4A4C A;  3SS5 A;  1DF0 A;  3V2L A;  1MF8 B;  1CMG A;  1QXP A;  4YGC B;  1LS8 A;  4ETO A;  1K8U A;  1OMD A;  1LIN A;  2KHN A;  3F45 A;  1OSA A;  4NQG A;  3D73 A;  4GGF C;  1Z2C B;  1UHJ A;  3BOW B;  4JPZ B;  3OHM B;  4YGE B;  3UNW A;  1OE9 B;  1QIW A;  2P6B B;  3CWG A;  2IS9 A;  1B8L A;  1YRT B;  1BT6 A;  1LA3 A;  3TDI A;  3ZWH A;  3PJI A;  2EHB A;  3BFA A;  3EK8 A;  2I18 A;  2JPT A;  3R72 A;  1BR4 B;  2PSR A;  5DKQ A;  3RLZ A;  1SCV A;  3R1O A;  4QJ5 B;  1KSM A;  1NP8 A;  2M9G A;  1NWD A;  1DF0 B;  4PE1 A;  3CS1 A;  2CCM A;  2LVJ A;  2Q4U A;  5DIC A;  2LP2 A;  3DZT A;  4I5K A;  1EH2 A;  1C3Z A;  3DXL A;  1M31 A;  3R1P A;  1K96 A;  3TS5 C;  2L5Y A;  4I5L B;  3PN7 C;  2KI6 C;  2QPT A;  4MZK A;  3UO9 A;  1YUT A;  1C7W A;  1B1G A;  1DJY A;  5F6T A;  3CDN A;  3BUO B;  3M0W A;  4M2P A;  3BUX B;  2JTZ A;  1W9Z A;  3CLN A;  4NDD A;  1MUX A;  3EKH A;  1XYD A;  1YUS A;  3LCP C;  2F3Y A;  1YX8 A;  1TUJ A;  5D69 A;  1OOH A;  3D74 A;  3VRQ A;  2HQ8 A;  1WRZ A;  3DVJ A;  5HLV A;  2KFH A;  2LVV A;  3SG2 A;  3SJS A;  3LLE A;  2LCP A;  3BUW B;  1IJ5 A;  2BCA A;  4YGD B;  2JXC A;  4R1E A;  3S0A A;  1UHN A;  2KGB C;  3DYE A;  1CDP A;  3DF0 A;  3TUY B;  1YTZ C;  1WY9 A;  2KLE A;  4MVF A;  1SL7 A;  3SIB A;  4ORA B;  1S1E A;  5B8I B;  3I5F B;  4JD9 A;  3CTN A;  4NDB A;  2OPO A;  2QEO A;  2OTG C;  1CDM A;  2H8V A;  1J1E A;  2JNX A;  4I5J A;  3RM1 A;  1F55 A;  2JT8 A;  3K1E A;  3PM8 A;  2LE9 B;  3FE8 A;  3LK0 A;  1IG5 A;  1QAT A;  3NSO A;  3TDZ A;  1F4O A;  2BAP A;  2K61 A;  1TNX A;  1XFZ O;  3DF0 B;  4DIR A;  2KFF A;  5G08 A;  1SR6 C;  1S6J A;  1XFX O;  2GV5 A;  5FYX A;  1AUI B;  3FWB A;  2MA2 A;  4M2O A;  1DGU A;  1BMO A;  3I5H C;  3PFV A;  1SMG A;  1IIO A;  1QTX A;  2CTN A;  1WDC B;  2JC2 A;  1RFJ A;  3O4Y A;  2NCO A;  2OS8 C;  1SL8 A;  1UHH A;  4WQ3 A;  1A2X A;  1BR1 B;  3I5G C;  2PQL A;  1B4C A;  2F2O A;  3B88 A;  2BCX A;  2EC6 C;  3JTD B;  1E8A A;  1YX7 A;  4MSP A;  1KWO B;  1AVS A;  1KFU S;  1B9A A;  1MQ1 A;  3AAK A;  1IQ5 A;  1F54 A;  2NZ0 A;  2WCB A;  5IBW A;  2JZI A;  1AJ4 A;  2KQY A;  1KFU L;  3SG3 A;  1CB1 A;  5GQQ C;  4F0Z B;  3SG6 A;  2KFG A;  2Y1M A;  4F7F A;  4YGA A;  5I8N A;  2QEB A;  3RZS A;  1QV1 A;  2KOT A;  3E3R A;  2HF5 A;  1QVI Y;  3VRP A;  5KU1 A;  1BOC A;  2WCJ A;  4XYN A;  5BPJ A;  3D75 A;  1QWV A;  2KBM A;  1UHI A;  1TRF A;  4DUQ A;  3OX5 A;  1BLQ A;  4PHM A;  2V53 A;  1CTR A;  2QEH A;  2KAV A;  1IRJ A;  2PMY A;  3BXK A;  3CZ2 A;  5AFP A;  2M7N A;  2KDH A;  4CID A;  1QS7 A;  1SW8 A;  3GK2 A;  1J7Q A;  2LLT A;  5CPV A;  2M1K B;  1XFR A;  2ZND A;  2L5X B;  4HRH A;  3I5H B;  3BYA A;  3BJH A;  2GGZ A;  5HKY A;  2JXL A;  2FCE A;  1AP4 A;  1DMO A;  1S6I A;  2LLU A;  2OS8 B;  4AQI A;  1J1D A;  1OMR A;  1DJI A;  1DJZ A;  3WXA A;  1UP5 A;  1TOP A;  2WND A;  2KYF A;  2MLE C;  3VGO A;  4DS7 A;  1QLS A;  1XFU O;  1YUR A;  2K2F A;  2K60 A;  3B7A A;  3BUN B;  4FQT A;  2AAO A;  1U5I A;  3H4S E;  1D1O A;  1DEK A;  1KQM B;  3GK4 X;  1SRA A;  1NSH A;  3B6X A;  3NSK A;  3D77 A;  3BFH A;  3EK7 A;  3Q8I A;  3EVU A;  4P5O E;  5D7F A;  5JOL A;  4QJ3 B;  2HQW A;  2BBN A;  1A03 A;  1JF0 A;  1JFK A;  1MWN A;  2TN4 A;  5JJG A;  1ZMZ A;  5CSJ A;  4KYN A;  3CYZ A;  4PE0 A;  2MLF C;  1Y6W A;  1Y1U A;  2LMU A;  1K9K A;  3TUY C;  1TIZ A;  2KLD A;  1KK7 Z;  1TUZ A;  3DY9 A;  4IJ7 A;  4MRY A;  4PDZ A;  2YGU A;  1R6P A;  1CFF A;  1LKJ A;  2ERB A;  1A29 A;  3SG7 A;  1UHK A;  2M7L A;  1HQV A;  3I5F C;  1J7R A;  1DEL A;  4BY4 A;  4OVN F;  1U5I B;  1EJ3 A;  3KO0 A;  1XVJ A;  1OQP A;  2JWW A;  3CR4 X;  1UUS A;  3VRR A;  1CFD A;  1PUL A;  3CGA A;  2FJY A;  3D76 A;  3FE6 A;  1QAS A;  3CAB A;  1Y1A A;  4JWQ A;  1K2H A;  2M97 A;  5AAN A;  2KYC A;  3TZ1 A;  1TWO A;  4WRI A;  3WHT B;  1CFP A;  1FPW A;  3EKJ A;  1RRO A;  2LM5 A;  4GFT A;  2LNK A;  2ZRT A;  1M63 B;  1DGV A;  1EL4 A;  2E30 A;  1NX0 A;  1DVI A;  1QX2 A;  2H61 A;  2M29 A;  2M8U A;  2KI4 B;  4L9M A;  2WCL A;  1Q80 A;  1B8R A;  1XFY O;  1CLM A;  4D1E A;  3S0F A;  1J7P A;  3A4U B;  5TNC A;  3TDU A;  1IH0 A;  2PVB A;  2L51 A;  3NHT A;  2JU0 A;  3R1V A;  1IJ6 A;  1WDC C;  1CFC A;  3NHI A;  3VB1 A;  3KEV A;  2F2P A;  2K8M B;  1EXR A;  2WOR A;  3AKA A;  4TNC A;  1KK8 B;  4FTG A;  1RTP 1;  1WLM A;  3VRN A;  4DRW A;  2COL B;  5KSZ A;  3JTD C;  2QDI A;  2JOJ A;  3PAT A;  1KWO C;  4N1G A;  1CDN A;  1A75 A;  2WC6 A;  3N7H A;  1DJW A;  3S0B A;  1V1F A;  2M3W A;  4OCI A;  4CFR A;  1K93 D;  1NCX A;  2M1U A;  4UPG A;  1BOD A;  1S5G Z;  2I2R E;  1B8C A;  2BCB A;  2LV7 A;  2Q91 A;  1AJ5 A;  5AXI A;  1QX7 A;  2QEV A;  3CR5 X;  4HRE E;  3L47 A;  1REC A;  1ALV A;  3LL8 B;  3KF9 A;  2KGR A;  4YBH B;  1LVC D;  4Q04 A;  5KTY A;  2KNE A;  1DC1 A;  1J55 A;  1Z4H A;  3MSE B;  1NX1 A;  1CM1 A;  1N65 A;  3D10 A;  1ZFS A;  1YVH A;  1BJF A;  1EG4 A;  3ZNI A;  1A75 B;  1KSO A;  1UWO A;  1Y0V H;  1XFW O;  2LHI A;  2WC8 A;  3KHE A;  4ORB B;  1K94 A;  2JRF A;  3JVT C;  1RJV A;  4M2Q A;  2F33 A;  4E68 A;  1ALW A;  2BKH B;  3L4A A;  2MHH A;  3D78 A;  2Y5I A;  2ISD A;  1QV0 A;  4ZCU A;  5CSN A;  3IQQ A;  5HLO A;  4BY5 A;  4GUK A;  1MHO A;  1ZOT B;  3BQ3 A;  2PYQ A;  1SBJ A;  1TN4 A;  4OZD A;  4U8D A;  1KQM C;  3SS3 A;  2AUC A;  4C0L A;  3NSL A;  2HPS A;  2LAN A;  1G33 A;  2SCP A;  2CBL A;  1JF2 A;  5ER5 A;  1SCM B;  1N2D A;  1OOF A;  1WLZ A;  3QME A;  1KFX S;  1TCO B;  4HSZ A;  1AHR A;  1CKK A;  4GNK B;  1XK4 A;  1FF1 A;  2KBI A;  4I5N B;  5FI2 A;  2KI6 D;  1KFX L;  2QAC A;  5I2Q A;  2G2B A;  2K0J A;  1MXE A;  2PRU A;  3FE9 A;  2K7D A;  1PSR A;  4HRG A;  2WOS A;  1CMF A;  3O2P A;  1QIV A;  3IQO A;  1PAL A;  3K21 A;  3EK4 A;  3S0D A;  1NPQ A;  1PRW A;  2WCH A;  4QJ4 B;  1N0Y A;  5ER4 X;  4PCW A;  2LVK A;  2WCM A;  2JTT A;  3HCM A;  3JVT B;  2F3Z A;  2L4I A;  3QRX A;  4C0J A;  1ODB A;  1JC2 A;  1YR5 A;  2NCP A;  1LXF C;  1SK6 D;  3SS4 A;  3EVR A;  3HX4 A;  2MRD A;  2KI4 C;  4MLW A;  1QJT A;  1L2O B;  3PLF B;  1W7J B;  1OOI X;  4JKT A;  2B1U A;  3VRO A;  1CLL A;  1F70 A;  1SPY A;  3IF7 A;  3CR2 A;  3DVK A;  1KQV A;  1CM4 A;  2DOQ A;  1F8H A;  2JPO A;  3SG5 A;  4YI9 A;  2I7A A;  3DD4 A;  3I5I B;  1X02 A;  3AKB A;  1YVL A;  4JQ0 D;  2ZRS A;  2O60 A;  3S0G A;  1KK8 C;  1GQM A;  2H2K A;  4CFQ A;  3FS7 A;  1OOJ A;  2G9B A;  2FOT A;  2AMI A;  2KPH A;  2L2C A;  3D0Y A;  1OZS A;  2H61 C;  2L0P A;  2BL0 C;  1M46 A;  2GTE A;  2FCD A;  1MR8 A;  1JUO A;  4MZJ A;  1PVA A;  1IWQ A;  1TCF A;  1DJG A;  1OMV A;  1B7T Y;  1JFJ A;  2LLS A;  5HKW A;  1LA0 A;  5I2L A;  2F8P A;  4DCK A;  3L4L A;  2JT3 A;  2Y4Q A;  3O78 A;  4P2Y B;  2LC5 A;  1GM0 A;  2JQ6 A;  1NUB A;  4FQO A;  2PAS A;  2L2E A;  3BUM B;  1B47 A;  1GJY A;  3EVV A;  1SKT A;  4CLN A;  3D0Y B;  1VRK A;  1GGZ A;  5AEQ A;  4PHN A;  2VRG A;  2BBM A;  4GPL B;  2ZKM X;  1V1G A;  1QVI Z;  1HT9 A;  1CDL A;  2BE4 A;  4GGF A;  3NXA A;  2M49 B;  2ZN8 A;  1JSA A;  2KAY A;  4MZL A;  3BFB A;  3B86 A;  4PE4 A;  1W7I B;  4WQ2 A;  1YRU B;  1IQ3 A;  4AOM A;  1OOG A;  1F71 A;  3C1V A;  1TNW A;  1Y1X A;  2BEC A;  5J3X A;  1S3P A;  4ZCV A;  2K2A A;  3SIA A;  1M45 A;  2RGI A;  2Y1N A;  3KPX A;  3PM2 A;  3CZ1 A;  1H8B A;  4PE7 A;  1CLB A;  3GK1 A;  1IKU A;  2BL0 B;  2ZN9 A;  4MRX A;  1TTX A;  2D8N A;  1ZAC A;  3B87 A;  1BG1 A;  1SCM C;  3OB2 B;  4N1F A;  1SSE B;  4INW A;  2M0R A;  3NGV A;  1DJX A;  2MJW B;  1BF5 A;  2LMT A;  1TNP A;  2JNF A;  2KQ6 A;  3O4X A;  1P28 A;  4N5X A;  3CZ0 A;  1WRK A;  1T14 A;  1SY9 A;  4CPV A;  2LVI A;  5D3O A;  1BU3 A;  1FBV A;  2KSP A;  4PHK A;  2WCF A;  3A8R A;  1XA5 A;  2P70 A;  1F4Q A;  1PSB A;  1AK8 A;  2CT9 A;  2HET A;  3OP0 A;  5DKN A;  2KAX A;  3OX6 A;  1K9P A;  5FI7 A;  1L7Z A;  1XO5 A;  1MXL C;  3FWC A;  4ICB A;  1H4B A;  3OB1 B;  5K89 A;  1G8I A;  4PAL A;  5DKR A;  1YUU A;  1J7O A;  1L2O C;  1TNQ A;  3TS5 B;  2LAP A;  1XK4 C;  3PN7 B;  2K7B A;  3AAJ A;  1ZUZ A;  4PT1 A;  1B7T Z;  1K9U A;  2JUL A;  5HL1 A;  2CXJ A;  2LHL A;  5I94 A;  1PVB A;  3GOF A;  1C7V A;  1DTL A;  1R2U A;  3OBV A;  4ORC B;  2MBX A;  4MBE A;  1KK7 Y;  3I5I C;  1K95 A;  2L98 A;  4USL A;  2ZNE A;  2LMV A;  1A4P A;  1NCY A;  1C3Y A;  1NIW A;  5I2O A;  1NYA A;  1GGW A;  1DT7 B;  3OGN A;  1DQE A;  4YRU A;  1ORG A;  4INX A;  3LK1 A;  1JBA A;  1RK9 A;  1PK0 D;  1SNL A;  2BNX A;  4NDC A;  2CNP A;  2JT0 A;  2K7C A;  3WNX B;  3IVT A;  1IGV A;  2R2I A;  1S6C A;  1KCY A;  3ICB A;  1S26 D;  2GGM A;  1CNP A;  1RWY A;  2A4J A;  2EGD A;  2MAZ A;  4XJK A;  5CSF A;  3EG5 B;  5HYD A;  1QX5 B;  1XFV O;  1WRL A;  2BKI B; 
#chains in the Genus database with same CATH homology
 3CZT X;  2PAL A;  2OTG B;  2O5G A;  2LP3 A;  4AQJ A;  4OR9 B;  2LUX A;  2WCE A;  2BE6 A;  3FIA A;  1FW4 A;  1FI6 A;  2NLN A;  4GGN A;  3PSR A;  1SYM A;  2LUC A;  5PAL A;  1OZO A;  1EG3 A;  2K7O A;  4A4B A;  3DVM A;  2ZFD A;  2L4H A;  4PHJ A;  2FJU B;  4MEW A;  1K90 D;  4GBA A;  1QLK A;  1FI5 A;  1NX2 A;  4IL1 A;  1G4Y R;  4C0K A;  1SR6 B;  2NXQ A;  5HKZ A;  1M39 A;  3NSI A;  4XJK B;  2SAS A;  3BOW A;  4GAO A;  1UUR A;  3O6B A;  4YGB B;  3WHU B;  2L50 A;  1S36 A;  1DJH A;  5CSI A;  1S5G Y;  5AER A;  1NX3 A;  3SG4 A;  1C07 A;  1NCZ A;  3PAL A;  4YI8 A;  4OKH A;  2E6W A;  3I5G B;  1JWD A;  4MN0 A;  2I94 A;  3DVE A;  2EC6 B;  1SL9 A;  4OV2 A;  4A4C A;  1DF0 A;  1MF8 B;  1CMG A;  1QXP A;  4YGC B;  4ETO A;  1K8U A;  1OMD A;  1LIN A;  2KHN A;  3F45 A;  1OSA A;  4NQG A;  4GGF C;  3BOW B;  1UHJ A;  4JPZ B;  3OHM B;  4YGE B;  1OE9 B;  1QIW A;  2P6B B;  3CWG A;  2IS9 A;  1B8L A;  1YRT B;  1BT6 A;  1LA3 A;  3TDI A;  3ZWH A;  2EHB A;  3EK8 A;  2I18 A;  2JPT A;  1BR4 B;  2PSR A;  5DKQ A;  3RLZ A;  1SCV A;  4QJ5 B;  1KSM A;  1NP8 A;  2M9G A;  1NWD A;  1DF0 B;  4PE1 A;  3CS1 A;  2CCM A;  2LVJ A;  2Q4U A;  2LP2 A;  4I5K A;  1EH2 A;  1M31 A;  1K96 A;  3TS5 C;  4I5L B;  3PN7 C;  2KI6 C;  2QPT A;  4MZK A;  1YUT A;  1C7W A;  1B1G A;  1DJY A;  5F6T A;  3BUO B;  3M0W A;  4M2P A;  3BUX B;  2JTZ A;  3CLN A;  4NDD A;  1MUX A;  3EKH A;  1XYD A;  1YUS A;  3LCP C;  2F3Y A;  1YX8 A;  5D69 A;  3VRQ A;  2HQ8 A;  1WRZ A;  3DVJ A;  5HLV A;  2KFH A;  2LVV A;  3SG2 A;  3SJS A;  3LLE A;  2LCP A;  3BUW B;  1IJ5 A;  2BCA A;  4YGD B;  2JXC A;  4R1E A;  1UHN A;  2KGB C;  1CDP A;  3DF0 A;  3TUY B;  1YTZ C;  1WY9 A;  4MVF A;  1SL7 A;  3SIB A;  4ORA B;  1S1E A;  5B8I B;  3I5F B;  3CTN A;  4NDB A;  2OPO A;  2OTG C;  1CDM A;  1J1E A;  2JNX A;  4I5J A;  3RM1 A;  1F55 A;  2JT8 A;  3PM8 A;  2LE9 B;  3LK0 A;  1IG5 A;  1QAT A;  3NSO A;  3TDZ A;  1F4O A;  2K61 A;  1TNX A;  1XFZ O;  3DF0 B;  4DIR A;  2KFF A;  5G08 A;  1SR6 C;  1S6J A;  1XFX O;  2GV5 A;  5FYX A;  1AUI B;  3FWB A;  2MA2 A;  4M2O A;  1DGU A;  1BMO A;  3I5H C;  3PFV A;  1SMG A;  1QTX A;  2CTN A;  1WDC B;  2JC2 A;  1RFJ A;  3O4Y A;  2NCO A;  2OS8 C;  1SL8 A;  1UHH A;  4WQ3 A;  1A2X A;  1BR1 B;  3I5G C;  1B4C A;  2F2O A;  2BCX A;  2EC6 C;  3JTD B;  1E8A A;  1YX7 A;  4MSP A;  1KWO B;  1AVS A;  1KFU S;  1B9A A;  1MQ1 A;  3AAK A;  1IQ5 A;  1F54 A;  2NZ0 A;  2WCB A;  5IBW A;  2JZI A;  1AJ4 A;  2KQY A;  1KFU L;  3SG3 A;  1CB1 A;  5GQQ C;  4F0Z B;  3SG6 A;  2KFG A;  2Y1M A;  5I8N A;  4YGA A;  1QV1 A;  2KOT A;  3E3R A;  2HF5 A;  1QVI Y;  3VRP A;  5KU1 A;  1BOC A;  4XYN A;  5BPJ A;  2KBM A;  1UHI A;  1TRF A;  4DUQ A;  3OX5 A;  1BLQ A;  4PHM A;  2V53 A;  1CTR A;  2KAV A;  1IRJ A;  2PMY A;  3BXK A;  5AFP A;  2M7N A;  2KDH A;  4CID A;  1QS7 A;  1SW8 A;  3GK2 A;  1J7Q A;  2LLT A;  5CPV A;  2M1K B;  4HRH A;  2ZND A;  2L5X B;  3I5H B;  3BYA A;  1DMO A;  2GGZ A;  5HKY A;  2JXL A;  2FCE A;  1AP4 A;  1S6I A;  2LLU A;  2OS8 B;  4AQI A;  1J1D A;  1OMR A;  1DJI A;  1DJZ A;  3WXA A;  1UP5 A;  1TOP A;  2WND A;  2KYF A;  2MLE C;  3VGO A;  4DS7 A;  1QLS A;  1XFU O;  1YUR A;  2K2F A;  3BUN B;  1D1O A;  2AAO A;  1U5I A;  3H4S E;  1KQM B;  3GK4 X;  1SRA A;  1NSH A;  3NSK A;  3EK7 A;  3EVU A;  4P5O E;  5D7F A;  5JOL A;  4QJ3 B;  2HQW A;  2BBN A;  1JF0 A;  1JFK A;  1MWN A;  2TN4 A;  5JJG A;  1ZMZ A;  5CSJ A;  4PE0 A;  2MLF C;  1Y6W A;  1Y1U A;  2LMU A;  1K9K A;  3TUY C;  1TIZ A;  4MRY A;  1KK7 Z;  1A03 A;  4PDZ A;  1R6P A;  1CFF A;  1LKJ A;  1A29 A;  3SG7 A;  1UHK A;  2M7L A;  1HQV A;  3I5F C;  1J7R A;  4BY4 A;  4OVN F;  1U5I B;  1EJ3 A;  3KO0 A;  1XVJ A;  1OQP A;  2JWW A;  3CR4 X;  1UUS A;  3VRR A;  1CFD A;  1PUL A;  3CGA A;  4JWQ A;  1QAS A;  1Y1A A;  1K2H A;  2M97 A;  5AAN A;  2KYC A;  3TZ1 A;  4WRI A;  3WHT B;  1CFP A;  1FPW A;  3EKJ A;  1RRO A;  2LM5 A;  4GFT A;  2LNK A;  2ZRT A;  1M63 B;  1DGV A;  1EL4 A;  2E30 A;  1NX0 A;  1DVI A;  1QX2 A;  2H61 A;  2M29 A;  2M8U A;  2KI4 B;  4L9M A;  1Q80 A;  1B8R A;  1XFY O;  1CLM A;  4D1E A;  1J7P A;  3A4U B;  5TNC A;  3TDU A;  1IH0 A;  2PVB A;  2L51 A;  2JU0 A;  1CFC A;  1IJ6 A;  1WDC C;  3KEV A;  2F2P A;  2K8M B;  1EXR A;  2WOR A;  3AKA A;  4TNC A;  1KK8 B;  4FTG A;  1RTP 1;  1WLM A;  3VRN A;  4DRW A;  2COL B;  5KSZ A;  3JTD C;  2JOJ A;  3PAT A;  1KWO C;  4N1G A;  1CDN A;  1A75 A;  1DJW A;  1V1F A;  2M3W A;  4OCI A;  4CFR A;  1K93 D;  1NCX A;  2M1U A;  4UPG A;  1BOD A;  1S5G Z;  2I2R E;  1B8C A;  2BCB A;  2LV7 A;  2Q91 A;  1AJ5 A;  5AXI A;  1QX7 A;  3CR5 X;  4HRE E;  1REC A;  1ALV A;  3LL8 B;  3KF9 A;  2KGR A;  4YBH B;  1LVC D;  4Q04 A;  5KTY A;  2KNE A;  1J55 A;  3MSE B;  1NX1 A;  1CM1 A;  1N65 A;  3D10 A;  1ZFS A;  1YVH A;  1BJF A;  1EG4 A;  3ZNI A;  1A75 B;  1KSO A;  1UWO A;  1Y0V H;  1XFW O;  2LHI A;  2WC8 A;  3KHE A;  4ORB B;  1K94 A;  2JRF A;  3JVT C;  1RJV A;  4M2Q A;  2F33 A;  4E68 A;  1ALW A;  2BKH B;  2MHH A;  2Y5I A;  2ISD A;  1QV0 A;  4ZCU A;  5CSN A;  3IQQ A;  5HLO A;  4BY5 A;  4GUK A;  1MHO A;  1ZOT B;  3BQ3 A;  1SBJ A;  1TN4 A;  4U8D A;  4C0L A;  1KQM C;  2AUC A;  3NSL A;  2HPS A;  2LAN A;  1G33 A;  2SCP A;  2CBL A;  1JF2 A;  5ER5 A;  1SCM B;  1N2D A;  4HSZ A;  1WLZ A;  1KFX S;  1TCO B;  1AHR A;  1CKK A;  4GNK B;  1XK4 A;  1FF1 A;  2KBI A;  4I5N B;  2KI6 D;  1KFX L;  2QAC A;  5I2Q A;  2G2B A;  2K0J A;  1MXE A;  2PRU A;  4HRG A;  2K7D A;  1PSR A;  2WOS A;  1CMF A;  3O2P A;  1QIV A;  3IQO A;  1PAL A;  3K21 A;  3EK4 A;  1NPQ A;  1PRW A;  4QJ4 B;  1N0Y A;  5ER4 X;  4PCW A;  2LVK A;  3JVT B;  2JTT A;  3HCM A;  2F3Z A;  2L4I A;  3QRX A;  4C0J A;  1ODB A;  1JC2 A;  1YR5 A;  2NCP A;  1LXF C;  1SK6 D;  3EVR A;  3HX4 A;  2MRD A;  2KI4 C;  4MLW A;  1QJT A;  1L2O B;  3PLF B;  1W7J B;  2B1U A;  3VRO A;  1CLL A;  1F70 A;  1SPY A;  3IF7 A;  3CR2 A;  3DVK A;  1KQV A;  1CM4 A;  2DOQ A;  1F8H A;  3SG5 A;  4YI9 A;  2I7A A;  3DD4 A;  3I5I B;  1X02 A;  3AKB A;  1YVL A;  4JQ0 D;  2ZRS A;  2O60 A;  1KK8 C;  1GQM A;  2H2K A;  4CFQ A;  3FS7 A;  1OOJ A;  2G9B A;  2FOT A;  2AMI A;  3D0Y A;  1OZS A;  2H61 C;  2L0P A;  2BL0 C;  1M46 A;  2FCD A;  1MR8 A;  1JUO A;  4MZJ A;  1PVA A;  1IWQ A;  1TCF A;  1DJG A;  1OMV A;  1B7T Y;  1JFJ A;  2LLS A;  5HKW A;  1LA0 A;  5I2L A;  2F8P A;  4DCK A;  2JT3 A;  2Y4Q A;  3O78 A;  4P2Y B;  2LC5 A;  2JQ6 A;  1NUB A;  4FQO A;  2PAS A;  2L2E A;  3BUM B;  1B47 A;  1GJY A;  3EVV A;  1SKT A;  4CLN A;  3D0Y B;  1VRK A;  1GGZ A;  5AEQ A;  4PHN A;  2VRG A;  2BBM A;  4GPL B;  2ZKM X;  1V1G A;  1QVI Z;  1HT9 A;  1CDL A;  2BE4 A;  4GGF A;  3NXA A;  2M49 B;  2ZN8 A;  1JSA A;  2KAY A;  4MZL A;  4WQ2 A;  4PE4 A;  1W7I B;  1YRU B;  1IQ3 A;  4AOM A;  1F71 A;  3C1V A;  1TNW A;  1Y1X A;  2BEC A;  5J3X A;  1S3P A;  4ZCV A;  2K2A A;  3SIA A;  1M45 A;  2RGI A;  2Y1N A;  3KPX A;  1H8B A;  4PE7 A;  1CLB A;  3GK1 A;  1IKU A;  2BL0 B;  2ZN9 A;  4MRX A;  1TTX A;  2D8N A;  1ZAC A;  1BG1 A;  1SCM C;  3OB2 B;  4N1F A;  2M0R A;  1DJX A;  2MJW B;  1BF5 A;  2LMT A;  1TNP A;  2JNF A;  2KQ6 A;  4N5X A;  1WRK A;  1SY9 A;  4CPV A;  2LVI A;  1BU3 A;  1FBV A;  2KSP A;  4PHK A;  2WCF A;  3A8R A;  1XA5 A;  1F4Q A;  1PSB A;  1AK8 A;  2CT9 A;  2HET A;  3OP0 A;  5DKN A;  2KAX A;  3OX6 A;  1K9P A;  1L7Z A;  1XO5 A;  1MXL C;  3FWC A;  4ICB A;  1H4B A;  3OB1 B;  5K89 A;  1G8I A;  4PAL A;  5DKR A;  1YUU A;  1J7O A;  1L2O C;  1TNQ A;  3TS5 B;  2LAP A;  1XK4 C;  3PN7 B;  2K7B A;  3AAJ A;  1ZUZ A;  1B7T Z;  1K9U A;  2JUL A;  2CXJ A;  2LHL A;  1C7V A;  1PVB A;  3GOF A;  1DTL A;  1R2U A;  4ORC B;  2MBX A;  4MBE A;  1KK7 Y;  3I5I C;  1K95 A;  2L98 A;  4USL A;  2ZNE A;  2LMV A;  1A4P A;  1NCY A;  1NIW A;  5I2O A;  1NYA A;  1GGW A;  1DT7 B;  4YRU A;  3LK1 A;  1JBA A;  1RK9 A;  1PK0 D;  1SNL A;  4NDC A;  2CNP A;  2JT0 A;  2K7C A;  3WNX B;  1IGV A;  2R2I A;  1S6C A;  1KCY A;  3ICB A;  1S26 D;  2GGM A;  1CNP A;  1RWY A;  2A4J A;  2EGD A;  2MAZ A;  4XJK A;  5CSF A;  5HYD A;  1QX5 B;  1XFV O;  1WRL A;  2BKI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...