1SYMA

3-d solution structure of reduced apo-s100b from rat, nmr, 20 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100B
publication title Solution structure of rat apo-S100B(beta beta) as determined by NMR spectroscopy.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding protein
total genus 21
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1symA00
4I5KA 1MUXA 1CM1A 1TN4A 2LLSA 3CWGA 4MZKA 5PALA 2BKHB 1LKJA 2KDHA 1IH0A 5I2QA 4CFQA 3VRRA 3I5HB 3ZWHA 2ZNEA 5B8IB 1NX0A 1JC2A 3E3RA 4CPVA 1NX2A 2AUCA 3I5IB 5CSJA 1D1OA 3SJSA 3GK2A 2MAZA 3OX5A 5HLOA 1M63B 2MJWB 1KSOA 1KFXL 2JPTA 3AKBA 1G4YR 2NCOA 1Y1UA 3FWCA 1F4OA 1R6PA 2FOTA 1SBJA 2JT0A 3SG5A 1LXFC 1OMRA 2LE9B 4OR9B 1XA5A 3DVKA 2I7AA 2JWWA 4P2YB 1YVHA 1BR4B 2F2PA 1QXPA 1U5IA 2L5XB 1AUIB 2LC5A 1H8BA 1PVBA 1WLMA 5D69A 4MLWA 5IBWA 1L2OC 1RK9A 1NCZA 1DT7B 4CLNA 3EK8A 2L4HA 1Y1AA 2KQYA 5D7FA 1WDCC 2I94A 1S6CA 5AEQA 1K8UA 4ORAB 1HQVA 1TOPA 2OS8C 3SIBA 4DS7A 4AOMA 1UHNA 2D8NA 2JULA 4PHJA 3OB2B 1BR1B 2LNKA 4MVFA 3NSKA 2G9BA 4NDCA 2F33A 1KWOB 3LK0A 3WHTB 1BF5A 1NCXA 4QJ3B 4I5JA 4R1EA 2NZ0A 3TDUA 1A03A 1S26D 1B7TZ 2NCPA 2LAPA 1CNPA 1GGWA 1EJ3A 3JVTC 4XJKB 1S5GZ 3DF0A 2LHLA 1EG4A 4ICBA 2M8UA 3I5GC 2ZKMX 3D10A 1YURA 1YVLA 1Y6WA 2KSPA 4FTGA 4ZCUA 3NSIA 1M39A 1KSMA 1J1DA 1KQMB 1BU3A 1FW4A 2PASA 2BBMA 1DVIA 3ZNIA 4JQ0D 2JOJA 4MN0A 1B47A 1J55A 1TTXA 1SL7A 1NCYA 5AERA 1XFZO 2LLUA 2B1UA 2KGBC 3NSLA 1YUSA 2BL0C 1JF2A 4ORBB 1F55A 1W7IB 2Y1NA 2COLB 1CMGA 3BUXB 1K9KA 1QASA 3PSRA 4FQOA 1JF0A 5G08A 1RJVA 3SG7A 1F70A 1IQ3A 3QRXA 1UHJA 4ZCVA 2H2KA 3ICBA 2ZRTA 3D0YA 4GGFC 3O78A 3NXAA 1WRLA 3LCPC 1XVJA 3EKJA 1R2UA 1DF0B 1SRAA 2PALA 3NSOA 4PDZA 1C7VA 1SNLA 3O2PA 1J1EA 2FCEA 2L98A 4MBEA 2MA2A 3BUMB 2ZN8A 1OSAA 1LA3A 1B4CA 1WDCB 2JT8A 3KHEA 1FPWA 1K9PA 2OS8B 2Q91A 2RGIA 2Y1MA 1CLMA 2LHIA 1KFUS 1QLKA 2OTGC 4DCKA 2IS9A 4BY5A 3GK4X 2M3WA 4N1FA 1B8CA 4BY4A 2SCPA 1AP4A 2MLFC 2O60A 3SG3A 4F0ZB 2BCAA 2CT9A 4C0JA 3CTNA 1IJ6A 1AJ4A 1TRFA 2GGMA 1YRTB 1RECA 4GGNA 3JVTB 1RWYA 3TS5B 4A4BA 3I5GB 3HX4A 4PE1A 3SG6A 1QX5B 4MZLA 2K7BA 5HKWA 1K94A 1KFXS 1MQ1A 2KI6C 1N65A 4HRHA 4A4CA 4WRIA 1RFJA 5BPJA 4HSZA 5HLVA 3OB1B 2HQ8A 1BT6A 1EG3A 1B7TY 4I5NB 4MZJA 2KFGA 1SR6C 2WORA 2FJUB 5AXIA 1QX2A 1XK4A 4P5OE 1S6JA 5GQQC 3CGAA 1JFKA 3SG4A 1YUTA 2BL0B 2BE6A 4UPGA 1KCYA 3JTDC 1RTP1 1QS7A 2L0PA 1TNXA 1W7JB 1VRKA 3IQOA 3OP0A 2P6BB 2G2BA 5DKQA 4PHNA 2LANA 1TCFA 2LM5A 1BJFA 4I5LB 2CBLA 2LLTA 1YRUB 1JWDA 1MHOA 1MXLC 1TIZA 1J7QA 1F8HA 2KAXA 4HREE 1K90D 2KYCA 1TNWA 2PRUA 4N5XA 1YTZC 1QLSA 1QJTA 1SPYA 2GV5A 2K61A 2MLEC 2AAOA 3VROA 1UURA 1K93D 1CLLA 1PK0D 1CFDA 1DGUA 1JBAA 2F2OA 2M97A 1DMOA 2LUCA 2KI6D 4YGAA 2WCBA 2E6WA 2M1KB 1WLZA 1SW8A 1CKKA 3BQ3A 2A4JA 3H4SE 3LL8B 4M2OA 1OMVA 1BOCA 1BMOA 4DUQA 1YX7A 2K0JA 1ZOTB 4GGFA 1WRKA 2OTGB 2NXQA 2KNEA 3EK7A 3PALA 1IGVA 1NUBA 2L4IA 3TS5C 1OZSA 3KPXA 2M29A 2QACA 2JNFA 1NSHA 3F45A 3BUOB 2WNDA 4YBHB 3VGOA 1ZUZA 1AVSA 2F3ZA 2KFHA 4OCIA 4YGEB 3AAKA 1PSBA 1QATA 1K96A 3LLEA 1M46A 3TUYC 1X02A 3PATA 4NQGA 1K2HA 5F6TA 2PSRA 2KFFA 1OOJA 2KAYA 3RLZA 4XJKA 1GQMA 5I2LA 4QJ4B 1DJYA 1IG5A 2SASA 3MSEB 1TNQA 4U8DA 2CXJA 1QVIY 2HPSA 1SR6B 4D1EA 1DJIA 2M0RA 1WRZA 3PLFB 1CFFA 5ER5A 1GGZA 1XYDA 4PHMA 1G8IA 2I18A 2JU0A 1S1EA 2LMVA 2H61A 3JTDB 1CFCA 1DJXA 3CR4X 1QV0A 1ZFSA 3IQQA 1KQVA 2JRFA 1PRWA 1S3PA 1KK8C 2KOTA 2WCEA 2M7LA 1BG1A 3DVEA 1YX8A 4M2PA 1UWOA 3A4UB 1IJ5A 2LMUA 2QPTA 2LVVA 1Q80A 1UHIA 5DKNA 1CM4A 1DTLA 3AAJA 1OMDA 1PULA 3CR2A 1BODA 1NWDA 1CB1A 3AKAA 4GNKB 1C7WA 1EXRA 2JXCA 4L9MA 1SL9A 1FF1A 4NDBA 2L50A 1DF0A 2JC2A 2ZRSA 4DIRA 2F8PA 2JT3A 1V1GA 2I2RE 2HF5A 1SL8A 1SYMA 2CCMA 2WCFA 1CLBA 4MEWA 4IL1A 1JFJA 1K9UA 3PN7B 2Y5IA 4GFTA 1IRJA 4E68A 1MF8B 3CR5X 2NLNA 1A2XA 1B9AA 2AMIA 4JPZB 3RM1A 1E8AA 1NPQA 1QV1A 2TN4A 3GOFA 1A29A 2LVJA 4GUKA 4GAOA 1AK8A 3DD4A 4PE4A 4PCWA 2ZNDA 5KSZA 1J7OA 1Y0VH 3OHMB 3TUYB 1SCMC 2ZN9A 1DJGA 4QJ5B 2LVKA 1S5GY 1ZMZA 1A4PA 1XFVO 5CPVA 5ER4X 1NX3A 2KGRA 2BKIB 2EC6C 1EH2A 1K95A 4XYNA 1OZOA 2VRGA 2M49B 1Y1XA 2JQ6A 4YI9A 1DJHA 2PMYA 1MR8A 4MSPA 2KBIA 3O4YA 1DJWA 1MWNA 2GGZA 4AQIA 5CSFA 1MXEA 1M31A 1U5IB 3BYAA 1AJ5A 3DVMA 1H4BA 1SMGA 1LVCD 1OE9B 4N1GA 5HKYA 5I2OA 2ISDA 3VRNA 1F4QA 2JTZA 1CDNA 2R2IA 1JSAA 1CTRA 2L51A 3GK1A 1CDMA 1KK8B 4GPLB 2E30A 3EVRA 1OQPA 5AFPA 4PHKA 5DKRA 1SY9A 2HQWA 2K7CA 2MHHA 3SIAA 4AQJA 2L2EA 1IKUA 3WXAA 1TCOB 2CTNA 1FI6A 1XFUO 2V53A 1SKTA 3SG2A 2O5GA 4NDDA 1NYAA 4PALA 4ETOA 3TDZA 1EL4A 2WC8A 3EKHA 4YGDB 4HRGA 1C07A 1JUOA 2KI4C 4TNCA 1G33A 1N2DA 3PN7C 2Q4UA 1XFWO 4OVNF 2PVBA 3DF0B 3TZ1A 2LUXA 3FIAA 1YR5A 1PSRA 1XFYO 1NIWA 3CLNA 3EVUA 1SK6D 2K2AA 5KU1A 1HT9A 1KK7Z 1L7ZA 5JOLA 1S6IA 1BLQA 1S36A 1UHHA 2KQ6A 3M0WA 4C0KA 2K2FA 4WQ3A 4CIDA 1NP8A 1UUSA 1IWQA 1FBVA 2FCDA 2M9GA 2KHNA 1LINA 1NX1A 3LK1A 1CDLA 4ORCB 1GJYA 1XK4C 2EGDA 3BUNB 1FI5A 2K7DA 2MRDA 1LA0A 1ALVA 2OPOA 2BCXA 1SCMB 2BECA 1M45A 2JNXA 1ALWA 3EK4A 3O6BA 5CSNA 1F71A 2JTTA 2LVIA 4C0LA 1QTXA 3I5HC 5HYDA 2EC6B 1DGVA 2EHBA 1UHKA 1QX7A 2F3YA 3I5FB 1PVAA 3D0YB 3I5IC 5JJGA 2CNPA 3EVVA 3VRPA 4CFRA 1XFXO 3TDIA 4PE7A 1QIVA 5J3XA 3HCMA 5KTYA 4M2QA 2ZFDA 4OKHA 4YI8A 4YGCB 2K8MB 4YRUA 3VRQA 3BXKA 1B8LA 3BOWB 5K89A 2BE4A 4WQ2A 2Y4QA 1WY9A 1TNPA 3KF9A 4OV2A 1RROA 1J7RA 1ZACA 3WHUB 1B8RA 2DOQA 3C1VA 4PE0A 3OX6A 3WNXB 5CSIA 3PFVA 1IQ5A 4GBAA 1XO5A 1CFPA 2LP3A 2MBXA 1ODBA 2HETA 3BUWB 1CMFA 1A75B 1N0YA 2M1UA 3A8RA 1L2OB 2KI4B 2BBNA 2LV7A 3BOWA 1YUUA 1KWOC 4DRWA 1J7PA 2KBMA 3PM8A 4MRYA 3CZTX 2JZIA 3FS7A 3CS1A 2K7OA 2LP2A 1PALA 1CDPA 1B1GA 1AHRA 2LCPA 5I8NA 1V1FA 5HKZA 2KAVA 4USLA 1DJZA 3IF7A 3KO0A 4Q04A 5AANA 4JWQA 4YGBB 5FYXA 1KFUL 3FWBA 5TNCA 1A75A 1UP5A 3KEVA 1SCVA 1F54A 1QIWA 1QVIZ 2KYFA 2WOSA 3DVJA 3I5FC 1KK7Y 4MRXA 2H61C 2M7NA 1KQMC 2JXLA 2LMTA 2BCBA 3K21A
chains in the Genus database with same CATH superfamily
4I5KA 1MUXA 1CM1A 1TN4A 2LLSA 3CWGA 4MZKA 5PALA 2BKHB 1LKJA 1OOHA 2KDHA 3FE8A 1IH0A 3V2LA 5I2QA 4CFQA 3VRRA 3I5HB 3ZWHA 2ZNEA 5B8IB 1NX0A 1JC2A 3E3RA 4CPVA 1NX2A 2AUCA 3I5IB 5CSJA 1D1OA 3PM2A 3SJSA 3GK2A 2MAZA 3OX5A 5HLOA 1M63B 2MJWB 1KSOA 1KFXL 2JPTA 3AKBA 1G4YR 2WC5A 2NCOA 1IIOA 1Y1UA 3FWCA 1F4OA 1R6PA 2FOTA 1SBJA 2JT0A 3SG5A 1LXFC 1OOFA 1OMRA 2LE9B 4OR9B 1XA5A 3DVKA 2I7AA 2JWWA 3BFHA 4P2YB 3UNWA 1YVHA 1DELA 3L47A 1BR4B 2F2PA 3CYZA 4IJ7A 4OZDA 1QXPA 1U5IA 2L5XB 1AUIB 2LC5A 1H8BA 1PVBA 1WLMA 5D69A 4MLWA 4F7FA 5IBWA 1L2OC 1RK9A 1NCZA 3DZTA 1DT7B 4CLNA 3EK8A 2L4HA 1Y1AA 1ORGA 2KQYA 5D7FA 1WDCC 2I94A 1LS8A 1S6CA 1W9ZA 1K8UA 5AEQA 4ORAB 1HQVA 1TOPA 2OS8C 4PT1A 3SIBA 2BAPA 4AOMA 4DS7A 1UHNA 2D8NA 2JULA 4PHJA 3OB2B 1BR1B 2LNKA 4MVFA 3NSKA 3D77A 2G9BA 3S0AA 4NDCA 2F33A 1KWOB 3LK0A 3WHTB 1BF5A 3BFBA 1NCXA 4QJ3B 4I5JA 4R1EA 1T14A 2NZ0A 3TDUA 1S26D 1A03A 3FE9A 1B7TZ 2NCPA 2LAPA 1CNPA 1GGWA 1EJ3A 3JVTC 4XJKB 1S5GZ 3DF0A 2LHLA 1EG4A 4ICBA 2M8UA 3I5GC 3QMEA 2ZKMX 3D10A 1YURA 3IVTA 1YVLA 1Y6WA 2KSPA 4FTGA 4ZCUA 3NSIA 3SS3A 1M39A 1KSMA 1J1DA 1KQMB 1BU3A 1FW4A 2PASA 3L4LA 2BBMA 1DVIA 3ZNIA 4JQ0D 2JOJA 4MN0A 1B47A 1J55A 1TTXA 1SL7A 1NCYA 2PQLA 2P71A 5AERA 1XFZO 2LLUA 2B1UA 2KGBC 3NSLA 1YUSA 2BL0C 2PYQA 1JF2A 4ORBB 1F55A 1W7IB 2Y1NA 2COLB 1CMGA 3BUXB 1K9KA 1QASA 3PSRA 4FQOA 1JF0A 5G08A 1RJVA 3SG7A 1F70A 1IQ3A 3QRXA 1UHJA 4ZCVA 2H2KA 3ICBA 2ZRTA 3D0YA 4GGFC 3O78A 3NXAA 1WRLA 3LCPC 1XVJA 3EKJA 1R2UA 1DF0B 1SRAA 2PALA 3NSOA 4PDZA 1C7VA 2L2CA 1SNLA 3R1VA 3O2PA 1J1EA 2FCEA 2L98A 4MBEA 2MA2A 3BUMB 2ZN8A 1OSAA 1SSEB 1LA3A 3EG5B 1B4CA 1WDCB 2JT8A 3KHEA 1FPWA 1K9PA 2OS8B 2Q91A 2RGIA 2Y1MA 1CLMA 2LHIA 1KFUS 1QLKA 2OTGC 4DCKA 4INWA 2IS9A 4BY5A 1Z4HA 3GK4X 2M3WA 5FI7A 4N1FA 1B8CA 2WCMA 4BY4A 2SCPA 1AP4A 2MLFC 2O60A 3SG3A 4F0ZB 2BCAA 2CT9A 4C0JA 3CTNA 2JPOA 1IJ6A 1AJ4A 1TRFA 2GGMA 1YRTB 1RECA 4GGNA 3JVTB 1RWYA 3CDNA 3D78A 3TS5B 4A4BA 3I5GB 3CZ1A 3HX4A 3DYEA 4PE1A 5FI2A 3SG6A 1QX5B 4MZLA 2K7BA 5HKWA 1K94A 1KFXS 1MQ1A 2KI6C 1N65A 3DXLA 4HRHA 4A4CA 3RZSA 4WRIA 1XFRA 1RFJA 5BPJA 4HSZA 5HLVA 3OB1B 3S0GA 2HQ8A 1BT6A 1EG3A 1B7TY 4I5NB 4MZJA 2KFGA 3D76A 1SR6C 2WORA 1OW4A 2FJUB 5AXIA 1QX2A 1XK4A 4P5OE 1S6JA 5GQQC 3CGAA 1JFKA 3R1OA 3SG4A 1YUTA 2BL0B 2BE6A 4UPGA 1KCYA 3JTDC 1RTP1 1QS7A 2L0PA 1TNXA 1W7JB 1VRKA 3IQOA 3OP0A 2P6BB 2G2BA 5DKQA 4PHNA 2LANA 1TCFA 2LM5A 1BJFA 4I5LB 1DQEA 2CBLA 1YRUB 2LLTA 1JWDA 1MHOA 1MXLC 1TIZA 1J7QA 1F8HA 2KAXA 4HREE 1K90D 2KYCA 1TNWA 2PRUA 4N5XA 1YTZC 2QEOA 4KYNA 1QLSA 1QJTA 1SPYA 2GV5A 2K61A 2WCKA 2MLEC 2AAOA 3VROA 5DICA 1UURA 1K93D 1CLLA 1PK0D 1Z2CB 1CFDA 1DGUA 1JBAA 2F2OA 2M97A 1DMOA 2LUCA 2KI6D 4YGAA 2WCBA 1DEKA 2E6WA 2M1KB 1WLZA 1SW8A 1CKKA 3BQ3A 2A4JA 3H4SE 3LL8B 4M2OA 1OMVA 1BOCA 1BMOA 4DUQA 1YX7A 2K0JA 1ZOTB 4GGFA 1WRKA 2OTGB 2NXQA 2KNEA 3EK7A 3PALA 1IGVA 1NUBA 2L4IA 3CZ2A 2YGUA 3TS5C 1OZSA 3KPXA 2M29A 2QACA 3BJHA 2JNFA 1NSHA 3BFAA 3F45A 3BUOB 2WNDA 4YBHB 3VGOA 1ZUZA 1AVSA 2F3ZA 2KFHA 4OCIA 4YGEB 5EL2A 2KPHA 3AAKA 1PSBA 1QATA 1K96A 3LLEA 1M46A 3CZ0A 1X02A 3D73A 3PATA 4NQGA 3TUYC 1K2HA 3B6XA 5F6TA 2PSRA 2KFFA 1OOJA 2KAYA 3RLZA 2KLDA 4XJKA 1GQMA 5I2LA 4QJ4B 1DJYA 1IG5A 2SASA 3MSEB 3FE6A 5D3OA 1TNQA 1TUZA 4U8DA 2CXJA 1QVIY 2HPSA 1SR6B 4D1EA 1DJIA 2M0RA 1WRZA 3PLFB 1CFFA 5ER5A 1GGZA 1XYDA 4PHMA 1G8IA 2I18A 2JU0A 1S1EA 2GTEA 2LMVA 2H61A 3JTDB 1CFCA 1DJXA 3CR4X 1QV0A 1ZFSA 3IQQA 1KQVA 2JRFA 1PRWA 1S3PA 3B88A 1KK8C 2KOTA 2WCEA 2M7LA 1DC1A 3DVEA 1BG1A 1YX8A 4M2PA 1UWOA 3A4UB 1IJ5A 2LMUA 2QPTA 2LVVA 1Q80A 1UHIA 2L5YA 3Q8IA 5DKNA 3S0EA 1CM4A 1DTLA 3AAJA 1OMDA 1PULA 3CR2A 1BODA 1OOGA 2ERBA 1NWDA 1CB1A 3AKAA 4GNKB 1C7WA 1EXRA 2JXCA 4L9MA 1SL9A 1FF1A 4NDBA 2L50A 1DF0A 2JC2A 2ZRSA 4DIRA 1P28A 2F8PA 2JT3A 1V1GA 2I2RE 2HF5A 1SL8A 1SYMA 2CCMA 2P70A 2WCFA 4INXA 1CLBA 3PJIA 4MEWA 4IL1A 1JFJA 3B87A 1K9UA 1C3YA 3PN7B 2Y5IA 4GFTA 1IRJA 4E68A 1MF8B 3CR5X 2NLNA 1A2XA 2BNXA 1B9AA 2AMIA 3OGNA 4JPZB 2QEHA 3RM1A 1E8AA 1NPQA 1QV1A 1OOIX 2TN4A 3GOFA 1A29A 2LVJA 4GUKA 4GAOA 1AK8A 3DD4A 4PE4A 4PCWA 2ZNDA 5KSZA 1J7OA 1Y0VH 3OHMB 3TUYB 1SCMC 2ZN9A 1DJGA 4QJ5B 3R72A 2LVKA 1S5GY 1ZMZA 1A4PA 1XFVO 2K60A 2QEVA 3S0DA 5CPVA 5ER4X 1NX3A 2KGRA 2BKIB 2EC6C 4JD9A 1EH2A 1K95A 4XYNA 1OZOA 2VRGA 2M49B 1Y1XA 1TWOA 2JQ6A 4YI9A 1DJHA 2PMYA 1MR8A 4MSPA 2KBIA 3O4YA 1DJWA 1MWNA 2GGZA 3B7AA 4AQIA 2WCHA 3CABA 1MXEA 5CSFA 1M31A 1U5IB 3BYAA 1AJ5A 3DVMA 3S0BA 1TUJA 1H4BA 1SMGA 1LVCD 1OE9B 4N1GA 5HKYA 5I2OA 2ISDA 3VRNA 1F4QA 2JTZA 1CDNA 2R2IA 3O4XA 1JSAA 1CTRA 2L51A 3GK1A 1CDMA 1KK8B 4GPLB 2E30A 3EVRA 1OQPA 5FI6A 5AFPA 4PHKA 5DKRA 1SY9A 3D75A 2HQWA 3R1PA 2K7CA 2MHHA 3SIAA 4AQJA 2L2EA 1IKUA 3WXAA 1TCOB 2CTNA 1FI6A 1XFUO 2V53A 1SKTA 3SG2A 2O5GA 4NDDA 1NYAA 4PALA 4ETOA 3TDZA 2QDIA 1EL4A 2WC8A 3EKHA 4YGDB 4HRGA 1C07A 1JUOA 2KI4C 4TNCA 1G33A 1QWVA 1N2DA 3PN7C 2Q4UA 2WC6A 1XFWO 4OVNF 2PVBA 3DF0B 3TZ1A 2LUXA 3FIAA 1YR5A 1PSRA 1XFYO 1NIWA 3CLNA 3EVUA 1SK6D 2K2AA 5KU1A 1HT9A 1KK7Z 1L7ZA 5JOLA 1S6IA 3DY9A 1BLQA 1S36A 1UHHA 2KQ6A 3S0FA 3M0WA 4C0KA 5I94A 2K2FA 4WQ3A 4CIDA 1NP8A 1UUSA 1IWQA 1FBVA 2FCDA 2M9GA 3SS5A 2KHNA 1LINA 1NX1A 3LK1A 1CDLA 4ORCB 1GJYA 1XK4C 2EGDA 3BUNB 1FI5A 2K7DA 2MRDA 1LA0A 1ALVA 2OPOA 2BCXA 1SCMB 2BECA 1M45A 2JNXA 1ALWA 3EK4A 3O6BA 5CSNA 1F71A 3K1EA 2JTTA 4FQTA 2LVIA 4JKTA 3NHTA 4C0LA 1QTXA 3I5HC 5HYDA 2EC6B 1DGVA 2EHBA 1UHKA 1QX7A 2F3YA 3I5FB 1PVAA 3D0YB 3I5IC 5JJGA 2CNPA 3EVVA 3VRPA 4CFRA 1XFXO 3TDIA 3SS4A 4PE7A 1QIVA 5J3XA 3L4AA 1C3ZA 3HCMA 5KTYA 4M2QA 3NHIA 2ZFDA 4OKHA 4YI8A 4YGCB 2K8MB 4YRUA 2WCJA 2QEBA 3VRQA 3UO9A 3BXKA 1B8LA 3BOWB 5K89A 2BE4A 4WQ2A 2Y4QA 1WY9A 1TNPA 3KF9A 4OV2A 1RROA 1J7RA 1ZACA 3WHUB 1B8RA 2DOQA 3C1VA 4PE0A 3OX6A 3WNXB 5CSIA 3PFVA 1IQ5A 3N7HA 4GBAA 1XO5A 1CFPA 2LP3A 2FJYA 1ODBA 2HETA 3B86A 3BUWB 2MBXA 1CMFA 1A75B 1N0YA 2M1UA 3A8RA 1L2OB 2KI4B 2BBNA 2LV7A 3BOWA 3NGVA 1YUUA 1KWOC 4DRWA 1J7PA 5HL1A 2KBMA 3PM8A 2WCLA 4MRYA 3CZTX 2JZIA 3FS7A 3CS1A 2K7OA 2LP2A 1PALA 1CDPA 1B1GA 1AHRA 2LCPA 2H8VA 5I8NA 1V1FA 5HKZA 2KAVA 3D74A 4USLA 1DJZA 3IF7A 3KO0A 4Q04A 5AANA 4JWQA 4YGBB 5FYXA 3VB1A 1KFUL 1GM0A 3FWBA 5TNCA 1A75A 1UP5A 3KEVA 1SCVA 1F54A 3OBVA 1QIWA 1QVIZ 2KYFA 2WOSA 3DVJA 2KLEA 3I5FC 1KK7Y 4MRXA 2H61C 2M7NA 1KQMC 2JXLA 2LMTA 2BCBA 3K21A
chains in the Genus database with same CATH topology
4I5KA 1MUXA 1CM1A 1TN4A 2LLSA 3CWGA 4MZKA 5PALA 2BKHB 1LKJA 2KDHA 1IH0A 5I2QA 4CFQA 3VRRA 3I5HB 3ZWHA 2ZNEA 5B8IB 1NX0A 1JC2A 3E3RA 4CPVA 1NX2A 2AUCA 3I5IB 5CSJA 1D1OA 3SJSA 3GK2A 2MAZA 3OX5A 5HLOA 1M63B 2MJWB 1KSOA 1KFXL 2JPTA 3AKBA 1G4YR 2NCOA 1Y1UA 3FWCA 1F4OA 1R6PA 2FOTA 1SBJA 2JT0A 3SG5A 1LXFC 1OMRA 2LE9B 4OR9B 1XA5A 3DVKA 2I7AA 2JWWA 4P2YB 1YVHA 1BR4B 2F2PA 1QXPA 1U5IA 2L5XB 1AUIB 2LC5A 1H8BA 1PVBA 1WLMA 5D69A 4MLWA 5IBWA 1L2OC 1RK9A 1NCZA 1DT7B 4CLNA 3EK8A 2L4HA 1Y1AA 2KQYA 5D7FA 1WDCC 2I94A 1S6CA 5AEQA 1K8UA 4ORAB 1HQVA 1TOPA 2OS8C 3SIBA 4DS7A 4AOMA 1UHNA 2D8NA 2JULA 4PHJA 3OB2B 1BR1B 2LNKA 4MVFA 3NSKA 2G9BA 4NDCA 2F33A 1KWOB 3LK0A 3WHTB 1BF5A 1NCXA 4QJ3B 4I5JA 4R1EA 2NZ0A 3TDUA 1A03A 1S26D 1B7TZ 2NCPA 2LAPA 1CNPA 1GGWA 1EJ3A 3JVTC 4XJKB 1S5GZ 3DF0A 2LHLA 1EG4A 4ICBA 2M8UA 3I5GC 2ZKMX 3D10A 1YURA 1YVLA 1Y6WA 2KSPA 4FTGA 4ZCUA 3NSIA 1M39A 1KSMA 1J1DA 1KQMB 1BU3A 1FW4A 2PASA 2BBMA 1DVIA 3ZNIA 4JQ0D 2JOJA 4MN0A 1B47A 1J55A 1TTXA 1SL7A 1NCYA 5AERA 1XFZO 2LLUA 2B1UA 2KGBC 3NSLA 1YUSA 2BL0C 1JF2A 4ORBB 1F55A 1W7IB 2Y1NA 2COLB 1CMGA 3BUXB 1K9KA 1QASA 3PSRA 4FQOA 1JF0A 5G08A 1RJVA 3SG7A 1F70A 1IQ3A 3QRXA 1UHJA 4ZCVA 2H2KA 3ICBA 2ZRTA 3D0YA 4GGFC 3O78A 3NXAA 1WRLA 3LCPC 1XVJA 3EKJA 1R2UA 1DF0B 1SRAA 2PALA 3NSOA 4PDZA 1C7VA 1SNLA 3O2PA 1J1EA 2FCEA 2L98A 4MBEA 2MA2A 3BUMB 2ZN8A 1OSAA 1LA3A 1B4CA 1WDCB 2JT8A 3KHEA 1FPWA 1K9PA 2OS8B 2Q91A 2RGIA 2Y1MA 1CLMA 2LHIA 1KFUS 1QLKA 2OTGC 4DCKA 2IS9A 4BY5A 3GK4X 2M3WA 4N1FA 1B8CA 4BY4A 2SCPA 1AP4A 2MLFC 2O60A 3SG3A 4F0ZB 2BCAA 2CT9A 4C0JA 3CTNA 1IJ6A 1AJ4A 1TRFA 2GGMA 1YRTB 1RECA 4GGNA 3JVTB 1RWYA 3TS5B 4A4BA 3I5GB 3HX4A 4PE1A 3SG6A 1QX5B 4MZLA 2K7BA 5HKWA 1K94A 1KFXS 1MQ1A 2KI6C 1N65A 4HRHA 4A4CA 4WRIA 1RFJA 5BPJA 4HSZA 5HLVA 3OB1B 2HQ8A 1BT6A 1EG3A 1B7TY 4I5NB 4MZJA 2KFGA 1SR6C 2WORA 2FJUB 5AXIA 1QX2A 1XK4A 4P5OE 1S6JA 5GQQC 3CGAA 1JFKA 3SG4A 1YUTA 2BL0B 2BE6A 4UPGA 1KCYA 3JTDC 1RTP1 1QS7A 2L0PA 1TNXA 1W7JB 1VRKA 3IQOA 3OP0A 2P6BB 2G2BA 5DKQA 4PHNA 2LANA 1TCFA 2LM5A 1BJFA 4I5LB 2CBLA 2LLTA 1YRUB 1JWDA 1MHOA 1MXLC 1TIZA 1J7QA 1F8HA 2KAXA 4HREE 1K90D 2KYCA 1TNWA 2PRUA 4N5XA 1YTZC 1QLSA 1QJTA 1SPYA 2GV5A 2K61A 2MLEC 2AAOA 3VROA 1UURA 1K93D 1CLLA 1PK0D 1CFDA 1DGUA 1JBAA 2F2OA 2M97A 1DMOA 2LUCA 2KI6D 4YGAA 2WCBA 2E6WA 2M1KB 1WLZA 1SW8A 1CKKA 3BQ3A 2A4JA 3H4SE 3LL8B 4M2OA 1OMVA 1BOCA 1BMOA 4DUQA 1YX7A 2K0JA 1ZOTB 4GGFA 1WRKA 2OTGB 2NXQA 2KNEA 3EK7A 3PALA 1IGVA 1NUBA 2L4IA 3TS5C 1OZSA 3KPXA 2M29A 2QACA 2JNFA 1NSHA 3F45A 3BUOB 2WNDA 4YBHB 3VGOA 1ZUZA 1AVSA 2F3ZA 2KFHA 4OCIA 4YGEB 3AAKA 1PSBA 1QATA 1K96A 3LLEA 1M46A 3TUYC 1X02A 3PATA 4NQGA 1K2HA 5F6TA 2PSRA 2KFFA 1OOJA 2KAYA 3RLZA 4XJKA 1GQMA 5I2LA 4QJ4B 1DJYA 1IG5A 2SASA 3MSEB 1TNQA 4U8DA 2CXJA 1QVIY 2HPSA 1SR6B 4D1EA 1DJIA 2M0RA 1WRZA 3PLFB 1CFFA 5ER5A 1GGZA 1XYDA 4PHMA 1G8IA 2I18A 2JU0A 1S1EA 2LMVA 2H61A 3JTDB 1CFCA 1DJXA 3CR4X 1QV0A 1ZFSA 3IQQA 1KQVA 2JRFA 1PRWA 1S3PA 1KK8C 2KOTA 2WCEA 2M7LA 1BG1A 3DVEA 1YX8A 4M2PA 1UWOA 3A4UB 1IJ5A 2LMUA 2QPTA 2LVVA 1Q80A 1UHIA 5DKNA 1CM4A 1DTLA 3AAJA 1OMDA 1PULA 3CR2A 1BODA 1NWDA 1CB1A 3AKAA 4GNKB 1C7WA 1EXRA 2JXCA 4L9MA 1SL9A 1FF1A 4NDBA 2L50A 1DF0A 2JC2A 2ZRSA 4DIRA 2F8PA 2JT3A 1V1GA 2I2RE 2HF5A 1SL8A 1SYMA 2CCMA 2WCFA 1CLBA 4MEWA 4IL1A 1JFJA 1K9UA 3PN7B 2Y5IA 4GFTA 1IRJA 4E68A 1MF8B 3CR5X 2NLNA 1A2XA 1B9AA 2AMIA 4JPZB 3RM1A 1E8AA 1NPQA 1QV1A 2TN4A 3GOFA 1A29A 2LVJA 4GUKA 4GAOA 1AK8A 3DD4A 4PE4A 4PCWA 2ZNDA 5KSZA 1J7OA 1Y0VH 3OHMB 3TUYB 1SCMC 2ZN9A 1DJGA 4QJ5B 2LVKA 1S5GY 1ZMZA 1A4PA 1XFVO 5CPVA 5ER4X 1NX3A 2KGRA 2BKIB 2EC6C 1EH2A 1K95A 4XYNA 1OZOA 2VRGA 2M49B 1Y1XA 2JQ6A 4YI9A 1DJHA 2PMYA 1MR8A 4MSPA 2KBIA 3O4YA 1DJWA 1MWNA 2GGZA 4AQIA 5CSFA 1MXEA 1M31A 1U5IB 3BYAA 1AJ5A 3DVMA 1H4BA 1SMGA 1LVCD 1OE9B 4N1GA 5HKYA 5I2OA 2ISDA 3VRNA 1F4QA 2JTZA 1CDNA 2R2IA 1JSAA 1CTRA 2L51A 3GK1A 1CDMA 1KK8B 4GPLB 2E30A 3EVRA 1OQPA 5AFPA 4PHKA 5DKRA 1SY9A 2HQWA 2K7CA 2MHHA 3SIAA 4AQJA 2L2EA 1IKUA 3WXAA 1TCOB 2CTNA 1FI6A 1XFUO 2V53A 1SKTA 3SG2A 2O5GA 4NDDA 1NYAA 4PALA 4ETOA 3TDZA 1EL4A 2WC8A 3EKHA 4YGDB 4HRGA 1C07A 1JUOA 2KI4C 4TNCA 1G33A 1N2DA 3PN7C 2Q4UA 1XFWO 4OVNF 2PVBA 3DF0B 3TZ1A 2LUXA 3FIAA 1YR5A 1PSRA 1XFYO 1NIWA 3CLNA 3EVUA 1SK6D 2K2AA 5KU1A 1HT9A 1KK7Z 1L7ZA 5JOLA 1S6IA 1BLQA 1S36A 1UHHA 2KQ6A 3M0WA 4C0KA 2K2FA 4WQ3A 4CIDA 1NP8A 1UUSA 1IWQA 1FBVA 2FCDA 2M9GA 2KHNA 1LINA 1NX1A 3LK1A 1CDLA 4ORCB 1GJYA 1XK4C 2EGDA 3BUNB 1FI5A 2K7DA 2MRDA 1LA0A 1ALVA 2OPOA 2BCXA 1SCMB 2BECA 1M45A 2JNXA 1ALWA 3EK4A 3O6BA 5CSNA 1F71A 2JTTA 2LVIA 4C0LA 1QTXA 3I5HC 5HYDA 2EC6B 1DGVA 2EHBA 1UHKA 1QX7A 2F3YA 3I5FB 1PVAA 3D0YB 3I5IC 5JJGA 2CNPA 3EVVA 3VRPA 4CFRA 1XFXO 3TDIA 4PE7A 1QIVA 5J3XA 3HCMA 5KTYA 4M2QA 2ZFDA 4OKHA 4YI8A 4YGCB 2K8MB 4YRUA 3VRQA 3BXKA 1B8LA 3BOWB 5K89A 2BE4A 4WQ2A 2Y4QA 1WY9A 1TNPA 3KF9A 4OV2A 1RROA 1J7RA 1ZACA 3WHUB 1B8RA 2DOQA 3C1VA 4PE0A 3OX6A 3WNXB 5CSIA 3PFVA 1IQ5A 4GBAA 1XO5A 1CFPA 2LP3A 2MBXA 1ODBA 2HETA 3BUWB 1CMFA 1A75B 1N0YA 2M1UA 3A8RA 1L2OB 2KI4B 2BBNA 2LV7A 3BOWA 1YUUA 1KWOC 4DRWA 1J7PA 2KBMA 3PM8A 4MRYA 3CZTX 2JZIA 3FS7A 3CS1A 2K7OA 2LP2A 1PALA 1CDPA 1B1GA 1AHRA 2LCPA 5I8NA 1V1FA 5HKZA 2KAVA 4USLA 1DJZA 3IF7A 3KO0A 4Q04A 5AANA 4JWQA 4YGBB 5FYXA 1KFUL 3FWBA 5TNCA 1A75A 1UP5A 3KEVA 1SCVA 1F54A 1QIWA 1QVIZ 2KYFA 2WOSA 3DVJA 3I5FC 1KK7Y 4MRXA 2H61C 2M7NA 1KQMC 2JXLA 2LMTA 2BCBA 3K21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5K A;  1MUX A;  1CM1 A;  1TN4 A;  2LLS A;  3CWG A;  4MZK A;  5PAL A;  2BKH B;  1LKJ A;  2KDH A;  1IH0 A;  5I2Q A;  4CFQ A;  3VRR A;  3I5H B;  3ZWH A;  2ZNE A;  5B8I B;  1NX0 A;  1JC2 A;  3E3R A;  4CPV A;  1NX2 A;  2AUC A;  3I5I B;  5CSJ A;  1D1O A;  3SJS A;  3GK2 A;  2MAZ A;  3OX5 A;  5HLO A;  1M63 B;  2MJW B;  1KSO A;  1KFX L;  2JPT A;  3AKB A;  1G4Y R;  2NCO A;  1Y1U A;  3FWC A;  1F4O A;  1R6P A;  2FOT A;  1SBJ A;  2JT0 A;  3SG5 A;  1LXF C;  1OMR A;  2LE9 B;  4OR9 B;  1XA5 A;  3DVK A;  2I7A A;  2JWW A;  4P2Y B;  1YVH A;  1BR4 B;  2F2P A;  1QXP A;  1U5I A;  2L5X B;  1AUI B;  2LC5 A;  1H8B A;  1PVB A;  1WLM A;  5D69 A;  4MLW A;  5IBW A;  1L2O C;  1RK9 A;  1NCZ A;  1DT7 B;  4CLN A;  3EK8 A;  2L4H A;  1Y1A A;  2KQY A;  5D7F A;  1WDC C;  2I94 A;  1S6C A;  5AEQ A;  1K8U A;  4ORA B;  1HQV A;  1TOP A;  2OS8 C;  3SIB A;  4DS7 A;  4AOM A;  1UHN A;  2D8N A;  2JUL A;  4PHJ A;  3OB2 B;  1BR1 B;  2LNK A;  4MVF A;  3NSK A;  2G9B A;  4NDC A;  2F33 A;  1KWO B;  3LK0 A;  3WHT B;  1BF5 A;  1NCX A;  4QJ3 B;  4I5J A;  4R1E A;  2NZ0 A;  3TDU A;  1A03 A;  1S26 D;  1B7T Z;  2NCP A;  2LAP A;  1CNP A;  1GGW A;  1EJ3 A;  3JVT C;  4XJK B;  1S5G Z;  3DF0 A;  2LHL A;  1EG4 A;  4ICB A;  2M8U A;  3I5G C;  2ZKM X;  3D10 A;  1YUR A;  1YVL A;  1Y6W A;  2KSP A;  4FTG A;  4ZCU A;  3NSI A;  1M39 A;  1KSM A;  1J1D A;  1KQM B;  1BU3 A;  1FW4 A;  2PAS A;  2BBM A;  1DVI A;  3ZNI A;  4JQ0 D;  2JOJ A;  4MN0 A;  1B47 A;  1J55 A;  1TTX A;  1SL7 A;  1NCY A;  5AER A;  1XFZ O;  2LLU A;  2B1U A;  2KGB C;  3NSL A;  1YUS A;  2BL0 C;  1JF2 A;  4ORB B;  1F55 A;  1W7I B;  2Y1N A;  2COL B;  1CMG A;  3BUX B;  1K9K A;  1QAS A;  3PSR A;  4FQO A;  1JF0 A;  5G08 A;  1RJV A;  3SG7 A;  1F70 A;  1IQ3 A;  3QRX A;  1UHJ A;  4ZCV A;  2H2K A;  3ICB A;  2ZRT A;  3D0Y A;  4GGF C;  3O78 A;  3NXA A;  1WRL A;  3LCP C;  1XVJ A;  3EKJ A;  1R2U A;  1DF0 B;  1SRA A;  2PAL A;  3NSO A;  4PDZ A;  1C7V A;  1SNL A;  3O2P A;  1J1E A;  2FCE A;  2L98 A;  4MBE A;  2MA2 A;  3BUM B;  2ZN8 A;  1OSA A;  1LA3 A;  1B4C A;  1WDC B;  2JT8 A;  3KHE A;  1FPW A;  1K9P A;  2OS8 B;  2Q91 A;  2RGI A;  2Y1M A;  1CLM A;  2LHI A;  1KFU S;  1QLK A;  2OTG C;  4DCK A;  2IS9 A;  4BY5 A;  3GK4 X;  2M3W A;  4N1F A;  1B8C A;  4BY4 A;  2SCP A;  1AP4 A;  2MLF C;  2O60 A;  3SG3 A;  4F0Z B;  2BCA A;  2CT9 A;  4C0J A;  3CTN A;  1IJ6 A;  1AJ4 A;  1TRF A;  2GGM A;  1YRT B;  1REC A;  4GGN A;  3JVT B;  1RWY A;  3TS5 B;  4A4B A;  3I5G B;  3HX4 A;  4PE1 A;  3SG6 A;  1QX5 B;  4MZL A;  2K7B A;  5HKW A;  1K94 A;  1KFX S;  1MQ1 A;  2KI6 C;  1N65 A;  4HRH A;  4A4C A;  4WRI A;  1RFJ A;  5BPJ A;  4HSZ A;  5HLV A;  3OB1 B;  2HQ8 A;  1BT6 A;  1EG3 A;  1B7T Y;  4I5N B;  4MZJ A;  2KFG A;  1SR6 C;  2WOR A;  2FJU B;  5AXI A;  1QX2 A;  1XK4 A;  4P5O E;  1S6J A;  5GQQ C;  3CGA A;  1JFK A;  3SG4 A;  1YUT A;  2BL0 B;  2BE6 A;  4UPG A;  1KCY A;  3JTD C;  1RTP 1;  1QS7 A;  2L0P A;  1TNX A;  1W7J B;  1VRK A;  3IQO A;  3OP0 A;  2P6B B;  2G2B A;  5DKQ A;  4PHN A;  2LAN A;  1TCF A;  2LM5 A;  1BJF A;  4I5L B;  2CBL A;  2LLT A;  1YRU B;  1JWD A;  1MHO A;  1MXL C;  1TIZ A;  1J7Q A;  1F8H A;  2KAX A;  4HRE E;  1K90 D;  2KYC A;  1TNW A;  2PRU A;  4N5X A;  1YTZ C;  1QLS A;  1QJT A;  1SPY A;  2GV5 A;  2K61 A;  2MLE C;  2AAO A;  3VRO A;  1UUR A;  1K93 D;  1CLL A;  1PK0 D;  1CFD A;  1DGU A;  1JBA A;  2F2O A;  2M97 A;  1DMO A;  2LUC A;  2KI6 D;  4YGA A;  2WCB A;  2E6W A;  2M1K B;  1WLZ A;  1SW8 A;  1CKK A;  3BQ3 A;  2A4J A;  3H4S E;  3LL8 B;  4M2O A;  1OMV A;  1BOC A;  1BMO A;  4DUQ A;  1YX7 A;  2K0J A;  1ZOT B;  4GGF A;  1WRK A;  2OTG B;  2NXQ A;  2KNE A;  3EK7 A;  3PAL A;  1IGV A;  1NUB A;  2L4I A;  3TS5 C;  1OZS A;  3KPX A;  2M29 A;  2QAC A;  2JNF A;  1NSH A;  3F45 A;  3BUO B;  2WND A;  4YBH B;  3VGO A;  1ZUZ A;  1AVS A;  2F3Z A;  2KFH A;  4OCI A;  4YGE B;  3AAK A;  1PSB A;  1QAT A;  1K96 A;  3LLE A;  1M46 A;  3TUY C;  1X02 A;  3PAT A;  4NQG A;  1K2H A;  5F6T A;  2PSR A;  2KFF A;  1OOJ A;  2KAY A;  3RLZ A;  4XJK A;  1GQM A;  5I2L A;  4QJ4 B;  1DJY A;  1IG5 A;  2SAS A;  3MSE B;  1TNQ A;  4U8D A;  2CXJ A;  1QVI Y;  2HPS A;  1SR6 B;  4D1E A;  1DJI A;  2M0R A;  1WRZ A;  3PLF B;  1CFF A;  5ER5 A;  1GGZ A;  1XYD A;  4PHM A;  1G8I A;  2I18 A;  2JU0 A;  1S1E A;  2LMV A;  2H61 A;  3JTD B;  1CFC A;  1DJX A;  3CR4 X;  1QV0 A;  1ZFS A;  3IQQ A;  1KQV A;  2JRF A;  1PRW A;  1S3P A;  1KK8 C;  2KOT A;  2WCE A;  2M7L A;  1BG1 A;  3DVE A;  1YX8 A;  4M2P A;  1UWO A;  3A4U B;  1IJ5 A;  2LMU A;  2QPT A;  2LVV A;  1Q80 A;  1UHI A;  5DKN A;  1CM4 A;  1DTL A;  3AAJ A;  1OMD A;  1PUL A;  3CR2 A;  1BOD A;  1NWD A;  1CB1 A;  3AKA A;  4GNK B;  1C7W A;  1EXR A;  2JXC A;  4L9M A;  1SL9 A;  1FF1 A;  4NDB A;  2L50 A;  1DF0 A;  2JC2 A;  2ZRS A;  4DIR A;  2F8P A;  2JT3 A;  1V1G A;  2I2R E;  2HF5 A;  1SL8 A;  1SYM A;  2CCM A;  2WCF A;  1CLB A;  4MEW A;  4IL1 A;  1JFJ A;  1K9U A;  3PN7 B;  2Y5I A;  4GFT A;  1IRJ A;  4E68 A;  1MF8 B;  3CR5 X;  2NLN A;  1A2X A;  1B9A A;  2AMI A;  4JPZ B;  3RM1 A;  1E8A A;  1NPQ A;  1QV1 A;  2TN4 A;  3GOF A;  1A29 A;  2LVJ A;  4GUK A;  4GAO A;  1AK8 A;  3DD4 A;  4PE4 A;  4PCW A;  2ZND A;  5KSZ A;  1J7O A;  1Y0V H;  3OHM B;  3TUY B;  1SCM C;  2ZN9 A;  1DJG A;  4QJ5 B;  2LVK A;  1S5G Y;  1ZMZ A;  1A4P A;  1XFV O;  5CPV A;  5ER4 X;  1NX3 A;  2KGR A;  2BKI B;  2EC6 C;  1EH2 A;  1K95 A;  4XYN A;  1OZO A;  2VRG A;  2M49 B;  1Y1X A;  2JQ6 A;  4YI9 A;  1DJH A;  2PMY A;  1MR8 A;  4MSP A;  2KBI A;  3O4Y A;  1DJW A;  1MWN A;  2GGZ A;  4AQI A;  5CSF A;  1MXE A;  1M31 A;  1U5I B;  3BYA A;  1AJ5 A;  3DVM A;  1H4B A;  1SMG A;  1LVC D;  1OE9 B;  4N1G A;  5HKY A;  5I2O A;  2ISD A;  3VRN A;  1F4Q A;  2JTZ A;  1CDN A;  2R2I A;  1JSA A;  1CTR A;  2L51 A;  3GK1 A;  1CDM A;  1KK8 B;  4GPL B;  2E30 A;  3EVR A;  1OQP A;  5AFP A;  4PHK A;  5DKR A;  1SY9 A;  2HQW A;  2K7C A;  2MHH A;  3SIA A;  4AQJ A;  2L2E A;  1IKU A;  3WXA A;  1TCO B;  2CTN A;  1FI6 A;  1XFU O;  2V53 A;  1SKT A;  3SG2 A;  2O5G A;  4NDD A;  1NYA A;  4PAL A;  4ETO A;  3TDZ A;  1EL4 A;  2WC8 A;  3EKH A;  4YGD B;  4HRG A;  1C07 A;  1JUO A;  2KI4 C;  4TNC A;  1G33 A;  1N2D A;  3PN7 C;  2Q4U A;  1XFW O;  4OVN F;  2PVB A;  3DF0 B;  3TZ1 A;  2LUX A;  3FIA A;  1YR5 A;  1PSR A;  1XFY O;  1NIW A;  3CLN A;  3EVU A;  1SK6 D;  2K2A A;  5KU1 A;  1HT9 A;  1KK7 Z;  1L7Z A;  5JOL A;  1S6I A;  1BLQ A;  1S36 A;  1UHH A;  2KQ6 A;  3M0W A;  4C0K A;  2K2F A;  4WQ3 A;  4CID A;  1NP8 A;  1UUS A;  1IWQ A;  1FBV A;  2FCD A;  2M9G A;  2KHN A;  1LIN A;  1NX1 A;  3LK1 A;  1CDL A;  4ORC B;  1GJY A;  1XK4 C;  2EGD A;  3BUN B;  1FI5 A;  2K7D A;  2MRD A;  1LA0 A;  1ALV A;  2OPO A;  2BCX A;  1SCM B;  2BEC A;  1M45 A;  2JNX A;  1ALW A;  3EK4 A;  3O6B A;  5CSN A;  1F71 A;  2JTT A;  2LVI A;  4C0L A;  1QTX A;  3I5H C;  5HYD A;  2EC6 B;  1DGV A;  2EHB A;  1UHK A;  1QX7 A;  2F3Y A;  3I5F B;  1PVA A;  3D0Y B;  3I5I C;  5JJG A;  2CNP A;  3EVV A;  3VRP A;  4CFR A;  1XFX O;  3TDI A;  4PE7 A;  1QIV A;  5J3X A;  3HCM A;  5KTY A;  4M2Q A;  2ZFD A;  4OKH A;  4YI8 A;  4YGC B;  2K8M B;  4YRU A;  3VRQ A;  3BXK A;  1B8L A;  3BOW B;  5K89 A;  2BE4 A;  4WQ2 A;  2Y4Q A;  1WY9 A;  1TNP A;  3KF9 A;  4OV2 A;  1RRO A;  1J7R A;  1ZAC A;  3WHU B;  1B8R A;  2DOQ A;  3C1V A;  4PE0 A;  3OX6 A;  3WNX B;  5CSI A;  3PFV A;  1IQ5 A;  4GBA A;  1XO5 A;  1CFP A;  2LP3 A;  2MBX A;  1ODB A;  2HET A;  3BUW B;  1CMF A;  1A75 B;  1N0Y A;  2M1U A;  3A8R A;  1L2O B;  2KI4 B;  2BBN A;  2LV7 A;  3BOW A;  1YUU A;  1KWO C;  4DRW A;  1J7P A;  2KBM A;  3PM8 A;  4MRY A;  3CZT X;  2JZI A;  3FS7 A;  3CS1 A;  2K7O A;  2LP2 A;  1PAL A;  1CDP A;  1B1G A;  1AHR A;  2LCP A;  5I8N A;  1V1F A;  5HKZ A;  2KAV A;  4USL A;  1DJZ A;  3IF7 A;  3KO0 A;  4Q04 A;  5AAN A;  4JWQ A;  4YGB B;  5FYX A;  1KFU L;  3FWB A;  5TNC A;  1A75 A;  1UP5 A;  3KEV A;  1SCV A;  1F54 A;  1QIW A;  1QVI Z;  2KYF A;  2WOS A;  3DVJ A;  3I5F C;  1KK7 Y;  4MRX A;  2H61 C;  2M7N A;  1KQM C;  2JXL A;  2LMT A;  2BCB A;  3K21 A; 
#chains in the Genus database with same CATH topology
 4I5K A;  1MUX A;  1CM1 A;  1TN4 A;  2LLS A;  3CWG A;  4MZK A;  5PAL A;  2BKH B;  1LKJ A;  1OOH A;  2KDH A;  3FE8 A;  1IH0 A;  3V2L A;  5I2Q A;  4CFQ A;  3VRR A;  3I5H B;  3ZWH A;  2ZNE A;  5B8I B;  1NX0 A;  1JC2 A;  3E3R A;  4CPV A;  1NX2 A;  2AUC A;  3I5I B;  5CSJ A;  1D1O A;  3PM2 A;  3SJS A;  3GK2 A;  2MAZ A;  3OX5 A;  5HLO A;  1M63 B;  2MJW B;  1KSO A;  1KFX L;  2JPT A;  3AKB A;  1G4Y R;  2WC5 A;  2NCO A;  1IIO A;  1Y1U A;  3FWC A;  1F4O A;  1R6P A;  2FOT A;  1SBJ A;  2JT0 A;  3SG5 A;  1LXF C;  1OOF A;  1OMR A;  2LE9 B;  4OR9 B;  1XA5 A;  3DVK A;  2I7A A;  2JWW A;  3BFH A;  4P2Y B;  3UNW A;  1YVH A;  1DEL A;  3L47 A;  1BR4 B;  2F2P A;  3CYZ A;  4IJ7 A;  4OZD A;  1QXP A;  1U5I A;  2L5X B;  1AUI B;  2LC5 A;  1H8B A;  1PVB A;  1WLM A;  5D69 A;  4MLW A;  4F7F A;  5IBW A;  1L2O C;  1RK9 A;  1NCZ A;  3DZT A;  1DT7 B;  4CLN A;  3EK8 A;  2L4H A;  1Y1A A;  1ORG A;  2KQY A;  5D7F A;  1WDC C;  2I94 A;  1LS8 A;  1S6C A;  1W9Z A;  1K8U A;  5AEQ A;  4ORA B;  1HQV A;  1TOP A;  2OS8 C;  4PT1 A;  3SIB A;  2BAP A;  4AOM A;  4DS7 A;  1UHN A;  2D8N A;  2JUL A;  4PHJ A;  3OB2 B;  1BR1 B;  2LNK A;  4MVF A;  3NSK A;  3D77 A;  2G9B A;  3S0A A;  4NDC A;  2F33 A;  1KWO B;  3LK0 A;  3WHT B;  1BF5 A;  3BFB A;  1NCX A;  4QJ3 B;  4I5J A;  4R1E A;  1T14 A;  2NZ0 A;  3TDU A;  1S26 D;  1A03 A;  3FE9 A;  1B7T Z;  2NCP A;  2LAP A;  1CNP A;  1GGW A;  1EJ3 A;  3JVT C;  4XJK B;  1S5G Z;  3DF0 A;  2LHL A;  1EG4 A;  4ICB A;  2M8U A;  3I5G C;  3QME A;  2ZKM X;  3D10 A;  1YUR A;  3IVT A;  1YVL A;  1Y6W A;  2KSP A;  4FTG A;  4ZCU A;  3NSI A;  3SS3 A;  1M39 A;  1KSM A;  1J1D A;  1KQM B;  1BU3 A;  1FW4 A;  2PAS A;  3L4L A;  2BBM A;  1DVI A;  3ZNI A;  4JQ0 D;  2JOJ A;  4MN0 A;  1B47 A;  1J55 A;  1TTX A;  1SL7 A;  1NCY A;  2PQL A;  2P71 A;  5AER A;  1XFZ O;  2LLU A;  2B1U A;  2KGB C;  3NSL A;  1YUS A;  2BL0 C;  2PYQ A;  1JF2 A;  4ORB B;  1F55 A;  1W7I B;  2Y1N A;  2COL B;  1CMG A;  3BUX B;  1K9K A;  1QAS A;  3PSR A;  4FQO A;  1JF0 A;  5G08 A;  1RJV A;  3SG7 A;  1F70 A;  1IQ3 A;  3QRX A;  1UHJ A;  4ZCV A;  2H2K A;  3ICB A;  2ZRT A;  3D0Y A;  4GGF C;  3O78 A;  3NXA A;  1WRL A;  3LCP C;  1XVJ A;  3EKJ A;  1R2U A;  1DF0 B;  1SRA A;  2PAL A;  3NSO A;  4PDZ A;  1C7V A;  2L2C A;  1SNL A;  3R1V A;  3O2P A;  1J1E A;  2FCE A;  2L98 A;  4MBE A;  2MA2 A;  3BUM B;  2ZN8 A;  1OSA A;  1SSE B;  1LA3 A;  3EG5 B;  1B4C A;  1WDC B;  2JT8 A;  3KHE A;  1FPW A;  1K9P A;  2OS8 B;  2Q91 A;  2RGI A;  2Y1M A;  1CLM A;  2LHI A;  1KFU S;  1QLK A;  2OTG C;  4DCK A;  4INW A;  2IS9 A;  4BY5 A;  1Z4H A;  3GK4 X;  2M3W A;  5FI7 A;  4N1F A;  1B8C A;  2WCM A;  4BY4 A;  2SCP A;  1AP4 A;  2MLF C;  2O60 A;  3SG3 A;  4F0Z B;  2BCA A;  2CT9 A;  4C0J A;  3CTN A;  2JPO A;  1IJ6 A;  1AJ4 A;  1TRF A;  2GGM A;  1YRT B;  1REC A;  4GGN A;  3JVT B;  1RWY A;  3CDN A;  3D78 A;  3TS5 B;  4A4B A;  3I5G B;  3CZ1 A;  3HX4 A;  3DYE A;  4PE1 A;  5FI2 A;  3SG6 A;  1QX5 B;  4MZL A;  2K7B A;  5HKW A;  1K94 A;  1KFX S;  1MQ1 A;  2KI6 C;  1N65 A;  3DXL A;  4HRH A;  4A4C A;  3RZS A;  4WRI A;  1XFR A;  1RFJ A;  5BPJ A;  4HSZ A;  5HLV A;  3OB1 B;  3S0G A;  2HQ8 A;  1BT6 A;  1EG3 A;  1B7T Y;  4I5N B;  4MZJ A;  2KFG A;  3D76 A;  1SR6 C;  2WOR A;  1OW4 A;  2FJU B;  5AXI A;  1QX2 A;  1XK4 A;  4P5O E;  1S6J A;  5GQQ C;  3CGA A;  1JFK A;  3R1O A;  3SG4 A;  1YUT A;  2BL0 B;  2BE6 A;  4UPG A;  1KCY A;  3JTD C;  1RTP 1;  1QS7 A;  2L0P A;  1TNX A;  1W7J B;  1VRK A;  3IQO A;  3OP0 A;  2P6B B;  2G2B A;  5DKQ A;  4PHN A;  2LAN A;  1TCF A;  2LM5 A;  1BJF A;  4I5L B;  1DQE A;  2CBL A;  1YRU B;  2LLT A;  1JWD A;  1MHO A;  1MXL C;  1TIZ A;  1J7Q A;  1F8H A;  2KAX A;  4HRE E;  1K90 D;  2KYC A;  1TNW A;  2PRU A;  4N5X A;  1YTZ C;  2QEO A;  4KYN A;  1QLS A;  1QJT A;  1SPY A;  2GV5 A;  2K61 A;  2WCK A;  2MLE C;  2AAO A;  3VRO A;  5DIC A;  1UUR A;  1K93 D;  1CLL A;  1PK0 D;  1Z2C B;  1CFD A;  1DGU A;  1JBA A;  2F2O A;  2M97 A;  1DMO A;  2LUC A;  2KI6 D;  4YGA A;  2WCB A;  1DEK A;  2E6W A;  2M1K B;  1WLZ A;  1SW8 A;  1CKK A;  3BQ3 A;  2A4J A;  3H4S E;  3LL8 B;  4M2O A;  1OMV A;  1BOC A;  1BMO A;  4DUQ A;  1YX7 A;  2K0J A;  1ZOT B;  4GGF A;  1WRK A;  2OTG B;  2NXQ A;  2KNE A;  3EK7 A;  3PAL A;  1IGV A;  1NUB A;  2L4I A;  3CZ2 A;  2YGU A;  3TS5 C;  1OZS A;  3KPX A;  2M29 A;  2QAC A;  3BJH A;  2JNF A;  1NSH A;  3BFA A;  3F45 A;  3BUO B;  2WND A;  4YBH B;  3VGO A;  1ZUZ A;  1AVS A;  2F3Z A;  2KFH A;  4OCI A;  4YGE B;  5EL2 A;  2KPH A;  3AAK A;  1PSB A;  1QAT A;  1K96 A;  3LLE A;  1M46 A;  3CZ0 A;  1X02 A;  3D73 A;  3PAT A;  4NQG A;  3TUY C;  1K2H A;  3B6X A;  5F6T A;  2PSR A;  2KFF A;  1OOJ A;  2KAY A;  3RLZ A;  2KLD A;  4XJK A;  1GQM A;  5I2L A;  4QJ4 B;  1DJY A;  1IG5 A;  2SAS A;  3MSE B;  3FE6 A;  5D3O A;  1TNQ A;  1TUZ A;  4U8D A;  2CXJ A;  1QVI Y;  2HPS A;  1SR6 B;  4D1E A;  1DJI A;  2M0R A;  1WRZ A;  3PLF B;  1CFF A;  5ER5 A;  1GGZ A;  1XYD A;  4PHM A;  1G8I A;  2I18 A;  2JU0 A;  1S1E A;  2GTE A;  2LMV A;  2H61 A;  3JTD B;  1CFC A;  1DJX A;  3CR4 X;  1QV0 A;  1ZFS A;  3IQQ A;  1KQV A;  2JRF A;  1PRW A;  1S3P A;  3B88 A;  1KK8 C;  2KOT A;  2WCE A;  2M7L A;  1DC1 A;  3DVE A;  1BG1 A;  1YX8 A;  4M2P A;  1UWO A;  3A4U B;  1IJ5 A;  2LMU A;  2QPT A;  2LVV A;  1Q80 A;  1UHI A;  2L5Y A;  3Q8I A;  5DKN A;  3S0E A;  1CM4 A;  1DTL A;  3AAJ A;  1OMD A;  1PUL A;  3CR2 A;  1BOD A;  1OOG A;  2ERB A;  1NWD A;  1CB1 A;  3AKA A;  4GNK B;  1C7W A;  1EXR A;  2JXC A;  4L9M A;  1SL9 A;  1FF1 A;  4NDB A;  2L50 A;  1DF0 A;  2JC2 A;  2ZRS A;  4DIR A;  1P28 A;  2F8P A;  2JT3 A;  1V1G A;  2I2R E;  2HF5 A;  1SL8 A;  1SYM A;  2CCM A;  2P70 A;  2WCF A;  4INX A;  1CLB A;  3PJI A;  4MEW A;  4IL1 A;  1JFJ A;  3B87 A;  1K9U A;  1C3Y A;  3PN7 B;  2Y5I A;  4GFT A;  1IRJ A;  4E68 A;  1MF8 B;  3CR5 X;  2NLN A;  1A2X A;  2BNX A;  1B9A A;  2AMI A;  3OGN A;  4JPZ B;  2QEH A;  3RM1 A;  1E8A A;  1NPQ A;  1QV1 A;  1OOI X;  2TN4 A;  3GOF A;  1A29 A;  2LVJ A;  4GUK A;  4GAO A;  1AK8 A;  3DD4 A;  4PE4 A;  4PCW A;  2ZND A;  5KSZ A;  1J7O A;  1Y0V H;  3OHM B;  3TUY B;  1SCM C;  2ZN9 A;  1DJG A;  4QJ5 B;  3R72 A;  2LVK A;  1S5G Y;  1ZMZ A;  1A4P A;  1XFV O;  2K60 A;  2QEV A;  3S0D A;  5CPV A;  5ER4 X;  1NX3 A;  2KGR A;  2BKI B;  2EC6 C;  4JD9 A;  1EH2 A;  1K95 A;  4XYN A;  1OZO A;  2VRG A;  2M49 B;  1Y1X A;  1TWO A;  2JQ6 A;  4YI9 A;  1DJH A;  2PMY A;  1MR8 A;  4MSP A;  2KBI A;  3O4Y A;  1DJW A;  1MWN A;  2GGZ A;  3B7A A;  4AQI A;  2WCH A;  3CAB A;  1MXE A;  5CSF A;  1M31 A;  1U5I B;  3BYA A;  1AJ5 A;  3DVM A;  3S0B A;  1TUJ A;  1H4B A;  1SMG A;  1LVC D;  1OE9 B;  4N1G A;  5HKY A;  5I2O A;  2ISD A;  3VRN A;  1F4Q A;  2JTZ A;  1CDN A;  2R2I A;  3O4X A;  1JSA A;  1CTR A;  2L51 A;  3GK1 A;  1CDM A;  1KK8 B;  4GPL B;  2E30 A;  3EVR A;  1OQP A;  5FI6 A;  5AFP A;  4PHK A;  5DKR A;  1SY9 A;  3D75 A;  2HQW A;  3R1P A;  2K7C A;  2MHH A;  3SIA A;  4AQJ A;  2L2E A;  1IKU A;  3WXA A;  1TCO B;  2CTN A;  1FI6 A;  1XFU O;  2V53 A;  1SKT A;  3SG2 A;  2O5G A;  4NDD A;  1NYA A;  4PAL A;  4ETO A;  3TDZ A;  2QDI A;  1EL4 A;  2WC8 A;  3EKH A;  4YGD B;  4HRG A;  1C07 A;  1JUO A;  2KI4 C;  4TNC A;  1G33 A;  1QWV A;  1N2D A;  3PN7 C;  2Q4U A;  2WC6 A;  1XFW O;  4OVN F;  2PVB A;  3DF0 B;  3TZ1 A;  2LUX A;  3FIA A;  1YR5 A;  1PSR A;  1XFY O;  1NIW A;  3CLN A;  3EVU A;  1SK6 D;  2K2A A;  5KU1 A;  1HT9 A;  1KK7 Z;  1L7Z A;  5JOL A;  1S6I A;  3DY9 A;  1BLQ A;  1S36 A;  1UHH A;  2KQ6 A;  3S0F A;  3M0W A;  4C0K A;  5I94 A;  2K2F A;  4WQ3 A;  4CID A;  1NP8 A;  1UUS A;  1IWQ A;  1FBV A;  2FCD A;  2M9G A;  3SS5 A;  2KHN A;  1LIN A;  1NX1 A;  3LK1 A;  1CDL A;  4ORC B;  1GJY A;  1XK4 C;  2EGD A;  3BUN B;  1FI5 A;  2K7D A;  2MRD A;  1LA0 A;  1ALV A;  2OPO A;  2BCX A;  1SCM B;  2BEC A;  1M45 A;  2JNX A;  1ALW A;  3EK4 A;  3O6B A;  5CSN A;  1F71 A;  3K1E A;  2JTT A;  4FQT A;  2LVI A;  4JKT A;  3NHT A;  4C0L A;  1QTX A;  3I5H C;  5HYD A;  2EC6 B;  1DGV A;  2EHB A;  1UHK A;  1QX7 A;  2F3Y A;  3I5F B;  1PVA A;  3D0Y B;  3I5I C;  5JJG A;  2CNP A;  3EVV A;  3VRP A;  4CFR A;  1XFX O;  3TDI A;  3SS4 A;  4PE7 A;  1QIV A;  5J3X A;  3L4A A;  1C3Z A;  3HCM A;  5KTY A;  4M2Q A;  3NHI A;  2ZFD A;  4OKH A;  4YI8 A;  4YGC B;  2K8M B;  4YRU A;  2WCJ A;  2QEB A;  3VRQ A;  3UO9 A;  3BXK A;  1B8L A;  3BOW B;  5K89 A;  2BE4 A;  4WQ2 A;  2Y4Q A;  1WY9 A;  1TNP A;  3KF9 A;  4OV2 A;  1RRO A;  1J7R A;  1ZAC A;  3WHU B;  1B8R A;  2DOQ A;  3C1V A;  4PE0 A;  3OX6 A;  3WNX B;  5CSI A;  3PFV A;  1IQ5 A;  3N7H A;  4GBA A;  1XO5 A;  1CFP A;  2LP3 A;  2FJY A;  1ODB A;  2HET A;  3B86 A;  3BUW B;  2MBX A;  1CMF A;  1A75 B;  1N0Y A;  2M1U A;  3A8R A;  1L2O B;  2KI4 B;  2BBN A;  2LV7 A;  3BOW A;  3NGV A;  1YUU A;  1KWO C;  4DRW A;  1J7P A;  5HL1 A;  2KBM A;  3PM8 A;  2WCL A;  4MRY A;  3CZT X;  2JZI A;  3FS7 A;  3CS1 A;  2K7O A;  2LP2 A;  1PAL A;  1CDP A;  1B1G A;  1AHR A;  2LCP A;  2H8V A;  5I8N A;  1V1F A;  5HKZ A;  2KAV A;  3D74 A;  4USL A;  1DJZ A;  3IF7 A;  3KO0 A;  4Q04 A;  5AAN A;  4JWQ A;  4YGB B;  5FYX A;  3VB1 A;  1KFU L;  1GM0 A;  3FWB A;  5TNC A;  1A75 A;  1UP5 A;  3KEV A;  1SCV A;  1F54 A;  3OBV A;  1QIW A;  1QVI Z;  2KYF A;  2WOS A;  3DVJ A;  2KLE A;  3I5F C;  1KK7 Y;  4MRX A;  2H61 C;  2M7N A;  1KQM C;  2JXL A;  2LMT A;  2BCB A;  3K21 A; 
#chains in the Genus database with same CATH homology
 4I5K A;  1MUX A;  1CM1 A;  1TN4 A;  2LLS A;  3CWG A;  4MZK A;  5PAL A;  2BKH B;  1LKJ A;  2KDH A;  1IH0 A;  5I2Q A;  4CFQ A;  3VRR A;  3I5H B;  3ZWH A;  2ZNE A;  5B8I B;  1NX0 A;  1JC2 A;  3E3R A;  4CPV A;  1NX2 A;  2AUC A;  3I5I B;  5CSJ A;  1D1O A;  3SJS A;  3GK2 A;  2MAZ A;  3OX5 A;  5HLO A;  1M63 B;  2MJW B;  1KSO A;  1KFX L;  2JPT A;  3AKB A;  1G4Y R;  2NCO A;  1Y1U A;  3FWC A;  1F4O A;  1R6P A;  2FOT A;  1SBJ A;  2JT0 A;  3SG5 A;  1LXF C;  1OMR A;  2LE9 B;  4OR9 B;  1XA5 A;  3DVK A;  2I7A A;  2JWW A;  4P2Y B;  1YVH A;  1BR4 B;  2F2P A;  1QXP A;  1U5I A;  2L5X B;  1AUI B;  2LC5 A;  1H8B A;  1PVB A;  1WLM A;  5D69 A;  4MLW A;  5IBW A;  1L2O C;  1RK9 A;  1NCZ A;  1DT7 B;  4CLN A;  3EK8 A;  2L4H A;  1Y1A A;  2KQY A;  5D7F A;  1WDC C;  2I94 A;  1S6C A;  5AEQ A;  1K8U A;  4ORA B;  1HQV A;  1TOP A;  2OS8 C;  3SIB A;  4DS7 A;  4AOM A;  1UHN A;  2D8N A;  2JUL A;  4PHJ A;  3OB2 B;  1BR1 B;  2LNK A;  4MVF A;  3NSK A;  2G9B A;  4NDC A;  2F33 A;  1KWO B;  3LK0 A;  3WHT B;  1BF5 A;  1NCX A;  4QJ3 B;  4I5J A;  4R1E A;  2NZ0 A;  3TDU A;  1A03 A;  1S26 D;  1B7T Z;  2NCP A;  2LAP A;  1CNP A;  1GGW A;  1EJ3 A;  3JVT C;  4XJK B;  1S5G Z;  3DF0 A;  2LHL A;  1EG4 A;  4ICB A;  2M8U A;  3I5G C;  2ZKM X;  3D10 A;  1YUR A;  1YVL A;  1Y6W A;  2KSP A;  4FTG A;  4ZCU A;  3NSI A;  1M39 A;  1KSM A;  1J1D A;  1KQM B;  1BU3 A;  1FW4 A;  2PAS A;  2BBM A;  1DVI A;  3ZNI A;  4JQ0 D;  2JOJ A;  4MN0 A;  1B47 A;  1J55 A;  1TTX A;  1SL7 A;  1NCY A;  5AER A;  1XFZ O;  2LLU A;  2B1U A;  2KGB C;  3NSL A;  1YUS A;  2BL0 C;  1JF2 A;  4ORB B;  1F55 A;  1W7I B;  2Y1N A;  2COL B;  1CMG A;  3BUX B;  1K9K A;  1QAS A;  3PSR A;  4FQO A;  1JF0 A;  5G08 A;  1RJV A;  3SG7 A;  1F70 A;  1IQ3 A;  3QRX A;  1UHJ A;  4ZCV A;  2H2K A;  3ICB A;  2ZRT A;  3D0Y A;  4GGF C;  3O78 A;  3NXA A;  1WRL A;  3LCP C;  1XVJ A;  3EKJ A;  1R2U A;  1DF0 B;  1SRA A;  2PAL A;  3NSO A;  4PDZ A;  1C7V A;  1SNL A;  3O2P A;  1J1E A;  2FCE A;  2L98 A;  4MBE A;  2MA2 A;  3BUM B;  2ZN8 A;  1OSA A;  1LA3 A;  1B4C A;  1WDC B;  2JT8 A;  3KHE A;  1FPW A;  1K9P A;  2OS8 B;  2Q91 A;  2RGI A;  2Y1M A;  1CLM A;  2LHI A;  1KFU S;  1QLK A;  2OTG C;  4DCK A;  2IS9 A;  4BY5 A;  3GK4 X;  2M3W A;  4N1F A;  1B8C A;  4BY4 A;  2SCP A;  1AP4 A;  2MLF C;  2O60 A;  3SG3 A;  4F0Z B;  2BCA A;  2CT9 A;  4C0J A;  3CTN A;  1IJ6 A;  1AJ4 A;  1TRF A;  2GGM A;  1YRT B;  1REC A;  4GGN A;  3JVT B;  1RWY A;  3TS5 B;  4A4B A;  3I5G B;  3HX4 A;  4PE1 A;  3SG6 A;  1QX5 B;  4MZL A;  2K7B A;  5HKW A;  1K94 A;  1KFX S;  1MQ1 A;  2KI6 C;  1N65 A;  4HRH A;  4A4C A;  4WRI A;  1RFJ A;  5BPJ A;  4HSZ A;  5HLV A;  3OB1 B;  2HQ8 A;  1BT6 A;  1EG3 A;  1B7T Y;  4I5N B;  4MZJ A;  2KFG A;  1SR6 C;  2WOR A;  2FJU B;  5AXI A;  1QX2 A;  1XK4 A;  4P5O E;  1S6J A;  5GQQ C;  3CGA A;  1JFK A;  3SG4 A;  1YUT A;  2BL0 B;  2BE6 A;  4UPG A;  1KCY A;  3JTD C;  1RTP 1;  1QS7 A;  2L0P A;  1TNX A;  1W7J B;  1VRK A;  3IQO A;  3OP0 A;  2P6B B;  2G2B A;  5DKQ A;  4PHN A;  2LAN A;  1TCF A;  2LM5 A;  1BJF A;  4I5L B;  2CBL A;  2LLT A;  1YRU B;  1JWD A;  1MHO A;  1MXL C;  1TIZ A;  1J7Q A;  1F8H A;  2KAX A;  4HRE E;  1K90 D;  2KYC A;  1TNW A;  2PRU A;  4N5X A;  1YTZ C;  1QLS A;  1QJT A;  1SPY A;  2GV5 A;  2K61 A;  2MLE C;  2AAO A;  3VRO A;  1UUR A;  1K93 D;  1CLL A;  1PK0 D;  1CFD A;  1DGU A;  1JBA A;  2F2O A;  2M97 A;  1DMO A;  2LUC A;  2KI6 D;  4YGA A;  2WCB A;  2E6W A;  2M1K B;  1WLZ A;  1SW8 A;  1CKK A;  3BQ3 A;  2A4J A;  3H4S E;  3LL8 B;  4M2O A;  1OMV A;  1BOC A;  1BMO A;  4DUQ A;  1YX7 A;  2K0J A;  1ZOT B;  4GGF A;  1WRK A;  2OTG B;  2NXQ A;  2KNE A;  3EK7 A;  3PAL A;  1IGV A;  1NUB A;  2L4I A;  3TS5 C;  1OZS A;  3KPX A;  2M29 A;  2QAC A;  2JNF A;  1NSH A;  3F45 A;  3BUO B;  2WND A;  4YBH B;  3VGO A;  1ZUZ A;  1AVS A;  2F3Z A;  2KFH A;  4OCI A;  4YGE B;  3AAK A;  1PSB A;  1QAT A;  1K96 A;  3LLE A;  1M46 A;  3TUY C;  1X02 A;  3PAT A;  4NQG A;  1K2H A;  5F6T A;  2PSR A;  2KFF A;  1OOJ A;  2KAY A;  3RLZ A;  4XJK A;  1GQM A;  5I2L A;  4QJ4 B;  1DJY A;  1IG5 A;  2SAS A;  3MSE B;  1TNQ A;  4U8D A;  2CXJ A;  1QVI Y;  2HPS A;  1SR6 B;  4D1E A;  1DJI A;  2M0R A;  1WRZ A;  3PLF B;  1CFF A;  5ER5 A;  1GGZ A;  1XYD A;  4PHM A;  1G8I A;  2I18 A;  2JU0 A;  1S1E A;  2LMV A;  2H61 A;  3JTD B;  1CFC A;  1DJX A;  3CR4 X;  1QV0 A;  1ZFS A;  3IQQ A;  1KQV A;  2JRF A;  1PRW A;  1S3P A;  1KK8 C;  2KOT A;  2WCE A;  2M7L A;  1BG1 A;  3DVE A;  1YX8 A;  4M2P A;  1UWO A;  3A4U B;  1IJ5 A;  2LMU A;  2QPT A;  2LVV A;  1Q80 A;  1UHI A;  5DKN A;  1CM4 A;  1DTL A;  3AAJ A;  1OMD A;  1PUL A;  3CR2 A;  1BOD A;  1NWD A;  1CB1 A;  3AKA A;  4GNK B;  1C7W A;  1EXR A;  2JXC A;  4L9M A;  1SL9 A;  1FF1 A;  4NDB A;  2L50 A;  1DF0 A;  2JC2 A;  2ZRS A;  4DIR A;  2F8P A;  2JT3 A;  1V1G A;  2I2R E;  2HF5 A;  1SL8 A;  1SYM A;  2CCM A;  2WCF A;  1CLB A;  4MEW A;  4IL1 A;  1JFJ A;  1K9U A;  3PN7 B;  2Y5I A;  4GFT A;  1IRJ A;  4E68 A;  1MF8 B;  3CR5 X;  2NLN A;  1A2X A;  1B9A A;  2AMI A;  4JPZ B;  3RM1 A;  1E8A A;  1NPQ A;  1QV1 A;  2TN4 A;  3GOF A;  1A29 A;  2LVJ A;  4GUK A;  4GAO A;  1AK8 A;  3DD4 A;  4PE4 A;  4PCW A;  2ZND A;  5KSZ A;  1J7O A;  1Y0V H;  3OHM B;  3TUY B;  1SCM C;  2ZN9 A;  1DJG A;  4QJ5 B;  2LVK A;  1S5G Y;  1ZMZ A;  1A4P A;  1XFV O;  5CPV A;  5ER4 X;  1NX3 A;  2KGR A;  2BKI B;  2EC6 C;  1EH2 A;  1K95 A;  4XYN A;  1OZO A;  2VRG A;  2M49 B;  1Y1X A;  2JQ6 A;  4YI9 A;  1DJH A;  2PMY A;  1MR8 A;  4MSP A;  2KBI A;  3O4Y A;  1DJW A;  1MWN A;  2GGZ A;  4AQI A;  5CSF A;  1MXE A;  1M31 A;  1U5I B;  3BYA A;  1AJ5 A;  3DVM A;  1H4B A;  1SMG A;  1LVC D;  1OE9 B;  4N1G A;  5HKY A;  5I2O A;  2ISD A;  3VRN A;  1F4Q A;  2JTZ A;  1CDN A;  2R2I A;  1JSA A;  1CTR A;  2L51 A;  3GK1 A;  1CDM A;  1KK8 B;  4GPL B;  2E30 A;  3EVR A;  1OQP A;  5AFP A;  4PHK A;  5DKR A;  1SY9 A;  2HQW A;  2K7C A;  2MHH A;  3SIA A;  4AQJ A;  2L2E A;  1IKU A;  3WXA A;  1TCO B;  2CTN A;  1FI6 A;  1XFU O;  2V53 A;  1SKT A;  3SG2 A;  2O5G A;  4NDD A;  1NYA A;  4PAL A;  4ETO A;  3TDZ A;  1EL4 A;  2WC8 A;  3EKH A;  4YGD B;  4HRG A;  1C07 A;  1JUO A;  2KI4 C;  4TNC A;  1G33 A;  1N2D A;  3PN7 C;  2Q4U A;  1XFW O;  4OVN F;  2PVB A;  3DF0 B;  3TZ1 A;  2LUX A;  3FIA A;  1YR5 A;  1PSR A;  1XFY O;  1NIW A;  3CLN A;  3EVU A;  1SK6 D;  2K2A A;  5KU1 A;  1HT9 A;  1KK7 Z;  1L7Z A;  5JOL A;  1S6I A;  1BLQ A;  1S36 A;  1UHH A;  2KQ6 A;  3M0W A;  4C0K A;  2K2F A;  4WQ3 A;  4CID A;  1NP8 A;  1UUS A;  1IWQ A;  1FBV A;  2FCD A;  2M9G A;  2KHN A;  1LIN A;  1NX1 A;  3LK1 A;  1CDL A;  4ORC B;  1GJY A;  1XK4 C;  2EGD A;  3BUN B;  1FI5 A;  2K7D A;  2MRD A;  1LA0 A;  1ALV A;  2OPO A;  2BCX A;  1SCM B;  2BEC A;  1M45 A;  2JNX A;  1ALW A;  3EK4 A;  3O6B A;  5CSN A;  1F71 A;  2JTT A;  2LVI A;  4C0L A;  1QTX A;  3I5H C;  5HYD A;  2EC6 B;  1DGV A;  2EHB A;  1UHK A;  1QX7 A;  2F3Y A;  3I5F B;  1PVA A;  3D0Y B;  3I5I C;  5JJG A;  2CNP A;  3EVV A;  3VRP A;  4CFR A;  1XFX O;  3TDI A;  4PE7 A;  1QIV A;  5J3X A;  3HCM A;  5KTY A;  4M2Q A;  2ZFD A;  4OKH A;  4YI8 A;  4YGC B;  2K8M B;  4YRU A;  3VRQ A;  3BXK A;  1B8L A;  3BOW B;  5K89 A;  2BE4 A;  4WQ2 A;  2Y4Q A;  1WY9 A;  1TNP A;  3KF9 A;  4OV2 A;  1RRO A;  1J7R A;  1ZAC A;  3WHU B;  1B8R A;  2DOQ A;  3C1V A;  4PE0 A;  3OX6 A;  3WNX B;  5CSI A;  3PFV A;  1IQ5 A;  4GBA A;  1XO5 A;  1CFP A;  2LP3 A;  2MBX A;  1ODB A;  2HET A;  3BUW B;  1CMF A;  1A75 B;  1N0Y A;  2M1U A;  3A8R A;  1L2O B;  2KI4 B;  2BBN A;  2LV7 A;  3BOW A;  1YUU A;  1KWO C;  4DRW A;  1J7P A;  2KBM A;  3PM8 A;  4MRY A;  3CZT X;  2JZI A;  3FS7 A;  3CS1 A;  2K7O A;  2LP2 A;  1PAL A;  1CDP A;  1B1G A;  1AHR A;  2LCP A;  5I8N A;  1V1F A;  5HKZ A;  2KAV A;  4USL A;  1DJZ A;  3IF7 A;  3KO0 A;  4Q04 A;  5AAN A;  4JWQ A;  4YGB B;  5FYX A;  1KFU L;  3FWB A;  5TNC A;  1A75 A;  1UP5 A;  3KEV A;  1SCV A;  1F54 A;  1QIW A;  1QVI Z;  2KYF A;  2WOS A;  3DVJ A;  3I5F C;  1KK7 Y;  4MRX A;  2H61 C;  2M7N A;  1KQM C;  2JXL A;  2LMT A;  2BCB A;  3K21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...