1QJTA

Solution structure of the apo eh1 domain of mouse epidermal growth factor receptor substrate 15, eps15
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
LSLTQLSSGNPVYEKYYRQVEAGNTGRVLALDAAAFLKKSGLPDLILGKIWDLADTDGKGVLSKQEFFVALRLVACAQNGLEVSLSSLSLAVPPPRFHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR SUBSTRATE SUBSTRATE 15, EPS
publication title The Eh1 Domain of Eps15 is Structurally Classified as a Member of the S100 Subclass of EF-Hand Containing Proteins
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1999-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qjtA00
1XFXO 1GGWA 1YX7A 2M9GA 1MR8A 1D1OA 4A4CA 2ZFDA 1SR6B 3FS7A 2F2OA 4BY5A 2Y1NA 4GGNA 2L98A 1SW8A 2AAOA 2MBXA 1SMGA 4MN0A 1DJXA 1CDMA 1X02A 1RROA 2ZN8A 4P5OE 1DJYA 2WOSA 1NUBA 1LKJA 1AJ5A 2JULA 3CR4X 1TNWA 4MSPA 2KGRA 1KK7Z 3I5HB 4MZJA 1JC2A 4C0JA 1YRUB 4I5KA 2M49B 2WORA 1SL9A 1UHHA 1ALVA 2KHNA 5DKNA 4CLNA 1WDCB 3CGAA 1BLQA 1E8AA 2K7CA 1YX8A 2R2IA 1SKTA 4GGFC 2KFFA 1S36A 1EG4A 2M7LA 3KHEA 2LLUA 3DVKA 2G9BA 3TDZA 5I2LA 1CNPA 1F54A 4ZCVA 4E68A 3LK1A 4CPVA 4PDZA 2JC2A 2HETA 5J3XA 3OB1B 1JF0A 3CZTX 4WRIA 3QRXA 4AQIA 1KFUL 3I5GB 4A4BA 1BG1A 4P2YB 2OS8B 4M2PA 1KK8B 1Y1AA 1KQMC 1AK8A 1F70A 2JNFA 1KWOB 1Y1XA 2B1UA 2L4HA 4NDBA 1AHRA 2F33A 1EXRA 1TNQA 1OOJA 2Q4UA 1NWDA 1S26D 2K2FA 2TN4A 1MXEA 1GGZA 1OMRA 3C1VA 2JZIA 4NDCA 3SG5A 1F71A 2MAZA 5I2OA 1B8CA 1QVIY 2MLFC 4PHJA 5DKQA 4YGCB 3DVEA 3MSEB 3O6BA 3M0WA 3O78A 2RGIA 2CXJA 1AJ4A 4I5NB 2NZ0A 3JVTB 1G33A 1QX7A 5HYDA 2H61A 1SRAA 3CR5X 2EHBA 1F4QA 3OP0A 2LANA 2LLSA 1UWOA 2L51A 4MEWA 1KSMA 1RECA 3EK4A 2WC8A 3A4UB 2KI4C 3KPXA 3SJSA 1UHJA 3OB2B 1YUSA 1RJVA 1SK6D 4XYNA 2JOJA 1LINA 1BR1B 1EG3A 2FCDA 1NPQA 3SG3A 1TN4A 1UHNA 4IL1A 3D0YA 1DJWA 2E6WA 2ZN9A 2BBMA 1AVSA 2CNPA 4MLWA 1UUSA 1YUUA 4OCIA 3KO0A 4QJ5B 1BU3A 2OTGB 2WCFA 2Y4QA 2EC6B 2JXLA 1B1GA 1TNXA 2DOQA 4PHNA 2LLTA 2KDHA 1IJ5A 1V1GA 3GK2A 2BCAA 1RK9A 3BUNB 4YGDB 1JSAA 1YRTB 3DVMA 2L2EA 5PALA 1K9PA 2JQ6A 3GOFA 4F0ZB 1UP5A 2LHLA 2KOTA 1DJZA 1ZOTB 2BKHB 2LVIA 1UHKA 4UPGA 2BE4A 2JWWA 1SBJA 3D10A 2LUCA 4JWQA 4I5LB 3IF7A 4GAOA 2M1KB 1FI6A 1SNLA 2JTTA 2OPOA 1K9UA 1TIZA 1DF0A 1XFUO 1K90D 1QVIZ 3FWBA 4USLA 3VRPA 5I8NA 2I94A 4DRWA 3I5IC 1CDLA 1CFCA 1JBAA 3TDIA 3FIAA 2CBLA 2K61A 4ORAB 1B8LA 1Q80A 1WLZA 2H2KA 1LA3A 1QTXA 5HKYA 3O4YA 1DTLA 3LL8B 3TUYC 4PE4A 1KSOA 2JU0A 3OX5A 1QIVA 2LE9B 2Y1MA 1F8HA 4R1EA 4TNCA 5TNCA 2KYCA 1A29A 2WNDA 1IJ6A 1L7ZA 4OVNF 5AEQA 5FYXA 2QPTA 1K94A 1N65A 1RFJA 1H4BA 1HQVA 5JOLA 2KAXA 5HKZA 1DJIA 4XJKA 1W7JB 3ZWHA 1B7TY 4YRUA 2LCPA 1QATA 1SL8A 1LXFC 2I2RE 2Q91A 1G4YR 4GGFA 5CPVA 1DF0B 2L50A 4MZLA 1K93D 2F8PA 1A03A 1IKUA 1XFWO 3ICBA 1R2UA 1NCYA 4M2QA 2K8MB 1XK4C 3CWGA 1A2XA 3EVRA 1N0YA 4CFQA 3GK1A 4N1GA 1K9KA 1WY9A 2M29A 1XO5A 2KNEA 4FQOA 1TNPA 1M63B 2HF5A 1QV0A 2O5GA 1J1EA 1QXPA 5CSJA 1BOCA 2ISDA 1OMVA 1V1FA 2PALA 3PFVA 1JFKA 1BF5A 1FI5A 1PK0D 2KFGA 3PN7C 1C7VA 2AMIA 2KBMA 2BE6A 5B8IB 1CLBA 1J55A 5BPJA 3PLFB 2JPTA 4I5JA 1K8UA 2NCPA 4XJKB 3TS5C 2JT8A 1YR5A 3FWCA 3DF0B 3SG2A 2SASA 1CB1A 2E30A 2JT0A 3ZNIA 1B9AA 2PASA 1KFUS 3BUOB 2NXQA 5JJGA 3EKJA 1J7PA 2KAYA 4HSZA 3AKAA 3BUWB 3HCMA 3BUMB 2KI6D 3WXAA 2BCXA 3K21A 3VRQA 1KQMB 1IH0A 1YVHA 1B7TZ 1BMOA 4WQ3A 3TZ1A 2LHIA 1NYAA 1R6PA 2F3ZA 2O60A 4MZKA 1M31A 1EL4A 1A4PA 5CSNA 5AFPA 3A8RA 1VRKA 2HPSA 3WNXB 2PVBA 3SG4A 2LVJA 1MQ1A 2V53A 2CCMA 4AQJA 2JRFA 1QV1A 3EVUA 2P6BB 2SCPA 1CFPA 1W7IB 1KFXL 2CTNA 1IQ5A 2BL0C 2PSRA 1L2OC 1C07A 3BXKA 4MBEA 3VRNA 1J7OA 4BY4A 3LCPC 1BR4B 1SCMC 1UHIA 3NSLA 1MXLC 1DT7B 4JPZB 2EGDA 2H61C 3JTDC 2JXCA 2K7BA 4ORBB 2KI4B 1AP4A 1B47A 1GQMA 2AUCA 2GGZA 3PATA 3BYAA 1CDPA 1KCYA 1QLSA 2MJWB 2MLEC 1KQVA 4ETOA 4PE1A 4QJ3B 2WCEA 1SCVA 1M39A 1ODBA 5HKWA 3NXAA 2FOTA 3DD4A 3PM8A 5D69A 1L2OB 1QLKA 2KSPA 4L9MA 1OMDA 1EJ3A 1S6IA 4N1FA 1F4OA 1WRKA 5F6TA 1FBVA 4GBAA 2L5XB 5CSIA 3CTNA 4PHMA 1J1DA 2ZRSA 3JTDB 2LC5A 1CM4A 1DGUA 3SG7A 1SR6C 2KQ6A 2LAPA 4MRYA 4PHKA 1FF1A 1PVBA 1S6JA 1H8BA 3AAKA 3IQQA 4FTGA 5KTYA 1B8RA 4NDDA 4YI9A 2GV5A 1WLMA 2GGMA 1OE9B 1CFDA 2M8UA 2LM5A 2HQWA 3I5HC 1DJGA 1YTZC 3NSKA 3EVVA 2K7DA 2BKIB 2HQ8A 3I5IB 3KF9A 4CIDA 1XFVO 3EK7A 3OHMB 1CMFA 1WDCC 2BECA 1G8IA 4D1EA 1BT6A 4ORCB 4YGBB 1XK4A 2NCOA 3DF0A 3GK4X 3TUYB 5G08A 1OQPA 4U8DA 1CFFA 1QJTA 3F45A 5D7FA 1IQ3A 1HT9A 1QIWA 1QX5B 1S6CA 1M45A 2JT3A 4YI8A 1SYMA 1N2DA 1A75A 4MVFA 2LMVA 1YUTA 1BJFA 4OKHA 2VRGA 2KQYA 1SL7A 1NX1A 1XVJA 4PE7A 1FW4A 1B4CA 2BCBA 4GUKA 1XYDA 1K96A 1U5IB 1S3PA 2PMYA 3CLNA 3I5GC 3WHTB 2OS8C 2QACA 3CR2A 1RTP1 1S1EA 4AOMA 5AERA 4QJ4B 1KK8C 1K2HA 4C0LA 3HX4A 2MHHA 3RLZA 1KWOC 4DUQA 1BODA 4CFRA 4M2OA 1WRZA 5HLVA 4ZCUA 4OR9B 3SIAA 1CKKA 2LNKA 1IG5A 2L4IA 3SIBA 4YGAA 2LVKA 1XFZO 2MRDA 3KEVA 2M1UA 4PALA 2K7OA 2ZKMX 1LVCD 3H4SE 1QS7A 1UURA 3E3RA 2JTZA 1CMGA 1PRWA 1RWYA 1IRJA 1S5GY 4DS7A 3O2PA 1NX0A 2LP2A 3BOWA 4GNKB 5AANA 2M0RA 1IWQA 1A75B 1WRLA 3AKBA 3PN7B 5GQQC 3JVTC 1IGVA 3DVJA 2K0JA 1OZSA 1Y6WA 1MHOA 3RM1A 3TS5B 2F3YA 5ER4X 3EK8A 1J7RA 5ER5A 1J7QA 4GFTA 3EKHA 3IQOA 1DVIA 1PULA 2ZRTA 2K2AA 2LMTA 1JUOA 2BBNA 2COLB 3NSIA 3TDUA 2KFHA 1XA5A 2M3WA 1OSAA 2I7AA 1XFYO 2ZNDA 4YGEB 1MWNA 1TRFA 3VGOA 1QASA 5K89A 1CTRA 2ZNEA 2KAVA 2JNXA 3AAJA 2M7NA 4Q04A 1CDNA 1GJYA 1NCZA 1SPYA 4HREE 1JF2A 4YBHB 1TCOB 2KBIA 2OTGC 2IS9A 4HRGA 4ICBA 1OZOA 1ALWA 2EC6C 1K95A 2F2PA 1NCXA 1NX3A 4DCKA 5HLOA 3BUXB 3BOWB 1PVAA 1MF8B 2FJUB 1NSHA 4HRHA 3WHUB 1PSBA 1EH2A 1NX2A 1QX2A 2LVVA 4N5XA 1CLMA 4GPLB 4PE0A 3VROA 1ZACA 1KFXS 1LA0A 1PSRA 2Y5IA 2M97A 3I5FC 1KK7Y 1ZMZA 2KYFA 3LK0A 1DGVA 5DKRA 4JQ0D 1NIWA 2BL0B 1ZUZA 5KU1A 1M46A 1S5GZ 2NLNA 3NSOA 1CM1A 1C7WA 4DIRA 2G2BA 3LLEA 5IBWA 2LP3A 3CS1A 3SG6A 1JFJA 1SCMB 1Y0VH 1CLLA 1NP8A 3PSRA 2KGBC 1DMOA 2I18A 1Y1UA 2LV7A 1F55A 1FPWA 1AUIB 2A4JA 2LMUA 2L0PA 5AXIA 1TTXA 3OX6A 1TOPA 1TCFA 2KI6C 1U5IA 3BQ3A 3I5FB 4MRXA 1DJHA 1PALA 1ZFSA 2D8NA 4WQ2A 5KSZA 1SY9A 2LUXA 2FCEA 2WCBA 4NQGA 1JWDA 1YURA 5I2QA 4C0KA 2MA2A 2PRUA 3D0YB 5CSFA 1MUXA 1YVLA 2CT9A 3PALA 4PCWA 4OV2A 3VRRA
chains in the Genus database with same CATH superfamily
1XFXO 1GGWA 1YX7A 2M9GA 1MR8A 1D1OA 4A4CA 2ZFDA 1SR6B 3FS7A 2F2OA 4BY5A 2Y1NA 4GGNA 2L98A 1SW8A 2AAOA 2MBXA 1SMGA 4MN0A 1DJXA 1CDMA 1X02A 1RROA 2ZN8A 4P5OE 1DJYA 2WOSA 1NUBA 1LKJA 1AJ5A 2JULA 2L2CA 1TNWA 2WCHA 3CR4X 3NHTA 2KGRA 1KK7Z 1DEKA 3I5HB 4MZJA 1JC2A 4C0JA 1YRUB 4I5KA 2M49B 2WORA 1IIOA 1SL9A 2QEBA 1UHHA 1ALVA 2KHNA 5DKNA 4CLNA 1WDCB 3CGAA 1BLQA 1E8AA 5FI7A 2K7CA 1YX8A 4JKTA 3D78A 2R2IA 1SKTA 4GGFC 2KFFA 1S36A 1EG4A 2M7LA 3KHEA 2LLUA 3DVKA 2G9BA 3TDZA 5I2LA 1CNPA 1F54A 2BAPA 4ZCVA 3PM2A 4E68A 3LK1A 2KLEA 4CPVA 4PDZA 2JC2A 2HETA 5J3XA 3OB1B 1JF0A 3CZTX 4WRIA 3QRXA 3QMEA 4AQIA 1KFUL 1W9ZA 2K60A 3I5GB 4A4BA 1BG1A 1OOFA 2OS8B 4P2YB 3S0AA 1DC1A 4M2PA 1KK8B 1Y1AA 3D74A 1KQMC 1AK8A 1F70A 2JNFA 1KWOB 1Y1XA 2B1UA 2L4HA 3S0FA 4NDBA 1AHRA 2F33A 1EXRA 4FQTA 1TNQA 1OOJA 1DQEA 2Q4UA 1NWDA 2H8VA 1S26D 2K2FA 2TN4A 3CABA 1MXEA 1GGZA 1OMRA 3C1VA 2JZIA 4NDCA 3SG5A 3OGNA 1F71A 2MAZA 5I2OA 1B8CA 1QVIY 2MLFC 4PHJA 5DKQA 4YGCB 3DVEA 3MSEB 3O6BA 3M0WA 3O78A 5D3OA 2RGIA 2CXJA 1AJ4A 2QEVA 4I5NB 2NZ0A 3JVTB 1G33A 1QX7A 4MSPA 1XFRA 5HYDA 2H61A 1SRAA 3CR5X 2EHBA 1F4QA 3OP0A 2LANA 2LLSA 1UWOA 2L51A 4MEWA 1KSMA 1RECA 3EK4A 2WC8A 3K1EA 3R72A 3A4UB 2KI4C 2PYQA 2QEOA 3KPXA 3SJSA 1UHJA 3OB2B 1YUSA 1RJVA 1SK6D 4XYNA 5HL1A 2JOJA 1LINA 1OOHA 1BR1B 1EG3A 2FCDA 3BJHA 1NPQA 2WCMA 3SG3A 1TN4A 1UHNA 4IL1A 2KLDA 3D0YA 1DJWA 2E6WA 2ZN9A 2WCLA 2BBMA 1AVSA 2CNPA 4MLWA 1UUSA 1YUUA 4OCIA 3KO0A 4QJ5B 1BU3A 2OTGB 2GTEA 2WCFA 2Y4QA 2EC6B 2JXLA 1B1GA 1TNXA 2DOQA 4PHNA 2LLTA 2KDHA 1IJ5A 1V1GA 3GK2A 2BCAA 1RK9A 3BUNB 4YGDB 1JSAA 1YRTB 3DVMA 2L2EA 5PALA 1K9PA 2JQ6A 3GOFA 4F0ZB 1UP5A 4F7FA 2LHLA 2KOTA 1DJZA 1ZOTB 2BKHB 3BFBA 2LVIA 1UHKA 4UPGA 2BE4A 2JWWA 1SBJA 4PT1A 3D10A 2LUCA 4JWQA 5FI2A 4I5LB 3DXLA 3IF7A 2M1KB 4GAOA 1SNLA 2JTTA 2OPOA 1FI6A 5EL2A 1K9UA 1TIZA 1DF0A 1XFUO 1K90D 1QVIZ 3FWBA 4USLA 3R1VA 3DYEA 3VRPA 5I8NA 2I94A 4DRWA 3I5IC 1CDLA 1CFCA 1JBAA 3TDIA 3FIAA 2CBLA 2K61A 4ORAB 2QDIA 4INWA 1B8LA 1Q80A 1WLZA 2H2KA 1LA3A 1QTXA 5HKYA 3SS4A 3O4YA 1DTLA 3LL8B 3TUYC 4PE4A 1KSOA 2JU0A 3OX5A 1QIVA 2LE9B 2Y1MA 1F8HA 4R1EA 4TNCA 3SS3A 5TNCA 2KYCA 1A29A 2WNDA 3FE9A 1IJ6A 1L7ZA 4OVNF 5AEQA 5FYXA 3CDNA 2QPTA 3V2LA 1K94A 1N65A 1RFJA 1H4BA 1HQVA 5JOLA 2KAXA 5HKZA 1DJIA 2JPOA 4XJKA 1W7JB 3S0DA 3ZWHA 1B7TY 4YRUA 2LCPA 1QATA 1SL8A 1LXFC 2I2RE 2Q91A 1G4YR 4GGFA 3CZ0A 5CPVA 1DF0B 2L50A 4MZLA 1K93D 2F8PA 1A03A 1TUZA 1XFWO 3ICBA 4IJ7A 1IKUA 2ERBA 1DELA 1R2UA 1NCYA 4M2QA 2K8MB 1XK4C 3CWGA 1A2XA 3EVRA 1N0YA 3OBVA 3GK1A 4N1GA 4CFQA 3CZ1A 1K9KA 1WY9A 2M29A 1XO5A 2KNEA 4FQOA 1TNPA 1M63B 2HF5A 1QV0A 2O5GA 1J1EA 3O4XA 1QXPA 5CSJA 1BOCA 2ISDA 1OMVA 1LS8A 1V1FA 1Z4HA 1JFKA 2PALA 3PFVA 1SSEB 1BF5A 1FI5A 1PK0D 2KFGA 3PN7C 1C7VA 3UO9A 2AMIA 2KBMA 2BE6A 5B8IB 1CLBA 1J55A 3B6XA 5BPJA 3IVTA 3PLFB 2JPTA 4I5JA 1K8UA 2NCPA 4XJKB 3TS5C 2JT8A 1YR5A 3FWCA 2L5YA 3DF0B 3SG2A 2SASA 1CB1A 2E30A 2JT0A 3ZNIA 3NGVA 3UNWA 1B9AA 2PASA 1KFUS 3BUOB 2WC5A 3VB1A 2NXQA 5JJGA 3EKJA 1J7PA 2KAYA 5I94A 4HSZA 4OZDA 3AKAA 3BUWB 3HCMA 3L4LA 3BUMB 2KI6D 3WXAA 2BCXA 3K21A 1QWVA 3VRQA 1KQMB 3FE6A 1IH0A 1YVHA 1B7TZ 1BMOA 4WQ3A 3TZ1A 2LHIA 1NYAA 1R6PA 2F3ZA 2O60A 3D73A 1M31A 4MZKA 1EL4A 1A4PA 5CSNA 5AFPA 3A8RA 1VRKA 2HPSA 3WNXB 2PVBA 3SG4A 2LVJA 1MQ1A 2YGUA 2V53A 2CCMA 4AQJA 2JRFA 1QV1A 2WC6A 3EVUA 2P6BB 2SCPA 1CFPA 1W7IB 1KFXL 2CTNA 2WCJA 1IQ5A 2BL0C 2PSRA 1L2OC 1C07A 3BXKA 4MBEA 3VRNA 1J7OA 4BY4A 3LCPC 5DICA 1BR4B 1SCMC 1UHIA 3NSLA 1MXLC 2FJYA 1DT7B 4JPZB 2EGDA 2H61C 3JTDC 2JXCA 2K7BA 4ORBB 2KI4B 1AP4A 1B47A 1GQMA 2AUCA 2GGZA 3PATA 3BYAA 1CDPA 1KCYA 1QLSA 2MJWB 2MLEC 3DZTA 1KQVA 4ETOA 4PE1A 4QJ3B 2WCEA 1SCVA 1M39A 1ODBA 5HKWA 3NXAA 2FOTA 1OW4A 3DD4A 3PM8A 5D69A 1L2OB 1QLKA 2KSPA 4L9MA 1OMDA 1EJ3A 1S6IA 4N1FA 1F4OA 1WRKA 5F6TA 1FBVA 3R1PA 3DY9A 4GBAA 4JD9A 2L5XB 5CSIA 3CTNA 4PHMA 3PJIA 3Q8IA 1J1DA 2ZRSA 3JTDB 2LC5A 1CM4A 1DGUA 1P28A 3B88A 1SR6C 2KQ6A 2LAPA 4MRYA 4PHKA 3SG7A 1PVBA 1S6JA 1FF1A 1H8BA 3AAKA 3IQQA 4FTGA 5KTYA 1B8RA 1T14A 4NDDA 4YI9A 2GV5A 1WLMA 2GGMA 1OE9B 1CFDA 2M8UA 2LM5A 2PQLA 2HQWA 3I5HC 3SS5A 1DJGA 1YTZC 5FI6A 3NSKA 3EVVA 2K7DA 2BKIB 2HQ8A 3I5IB 3KF9A 3L47A 4CIDA 2BNXA 1XFVO 3RZSA 3EK7A 2WCKA 3OHMB 1CMFA 1WDCC 2BECA 1G8IA 4D1EA 1BT6A 4ORCB 4YGBB 1XK4A 2NCOA 3DF0A 3GK4X 3B7AA 5G08A 3TUYB 1OQPA 2QEHA 4U8DA 3S0EA 1QJTA 1TUJA 3F45A 1CFFA 3B87A 5D7FA 1IQ3A 1HT9A 1QIWA 1QX5B 1S6CA 1M45A 2JT3A 4YI8A 3D75A 1SYMA 1N2DA 1A75A 4MVFA 2LMVA 1YUTA 1BJFA 4OKHA 2VRGA 2KQYA 2P70A 1SL7A 1NX1A 1XVJA 4PE7A 1FW4A 1B4CA 2BCBA 4GUKA 1XYDA 1K96A 1U5IB 1S3PA 2KPHA 2PMYA 3CLNA 3I5GC 3WHTB 2OS8C 2QACA 3CR2A 1RTP1 3CZ2A 1S1EA 4AOMA 5AERA 4QJ4B 1KK8C 1K2HA 4C0LA 3HX4A 2MHHA 3RLZA 1KWOC 4DUQA 1BODA 4CFRA 4M2OA 1WRZA 5HLVA 4ZCUA 4OR9B 3SIAA 1CKKA 2LNKA 1IG5A 2L4IA 3SIBA 4YGAA 2LVKA 1XFZO 2MRDA 3KEVA 2M1UA 4PALA 2K7OA 2ZKMX 1LVCD 3H4SE 3N7HA 1QS7A 1UURA 3E3RA 3FE8A 2JTZA 1CMGA 1PRWA 1RWYA 1IRJA 1S5GY 4DS7A 3O2PA 1NX0A 2LP2A 3EG5B 3BOWA 4GNKB 5AANA 2M0RA 1IWQA 1A75B 1WRLA 3AKBA 3PN7B 5GQQC 3JVTC 3L4AA 1IGVA 3D76A 3DVJA 3R1OA 2K0JA 1OZSA 1Y6WA 1MHOA 3BFHA 3RM1A 3TS5B 2F3YA 5ER4X 3EK8A 1J7RA 2P71A 5ER5A 4GFTA 4INXA 3EKHA 3IQOA 1J7QA 1DVIA 1PULA 2ZRTA 2K2AA 2LMTA 1JUOA 2BBNA 2COLB 3NSIA 3TDUA 2KFHA 1XA5A 2M3WA 1OSAA 1ORGA 2I7AA 1XFYO 2ZNDA 3S0GA 4YGEB 1MWNA 1TRFA 3VGOA 1QASA 5K89A 3S0BA 1CTRA 2ZNEA 4KYNA 3D77A 2KAVA 2JNXA 3AAJA 2M7NA 4Q04A 1CDNA 1GJYA 1NCZA 1SPYA 4HREE 1JF2A 4YBHB 1TCOB 2KBIA 2OTGC 2IS9A 4HRGA 4ICBA 1OZOA 1ALWA 2EC6C 1K95A 2F2PA 1NCXA 1NX3A 4DCKA 5HLOA 3BUXB 3BOWB 1PVAA 1MF8B 2FJUB 1NSHA 4HRHA 3WHUB 1PSBA 1EH2A 1NX2A 1QX2A 2LVVA 4N5XA 1CLMA 1Z2CB 4GPLB 4PE0A 3VROA 1ZACA 1KFXS 1LA0A 1PSRA 2Y5IA 1C3ZA 2M97A 1KK7Y 1ZMZA 2KYFA 3I5FC 3LK0A 1DGVA 5DKRA 4JQ0D 1NIWA 2BL0B 1ZUZA 5KU1A 1M46A 1S5GZ 2NLNA 3NSOA 1CM1A 1C7WA 4DIRA 2G2BA 3LLEA 5IBWA 2LP3A 3CS1A 3SG6A 1JFJA 1SCMB 1Y0VH 1CLLA 3BFAA 1NP8A 3PSRA 2KGBC 1DMOA 2I18A 1Y1UA 2LV7A 1F55A 1FPWA 1AUIB 2A4JA 2LMUA 2L0PA 3NHIA 5AXIA 1TTXA 1TWOA 1TOPA 3OX6A 1TCFA 2KI6C 1U5IA 3BQ3A 3I5FB 4MRXA 1ZFSA 1DJHA 1PALA 3B86A 1OOGA 2D8NA 4WQ2A 5KSZA 1SY9A 2LUXA 1OOIX 2FCEA 2WCBA 4NQGA 1GM0A 1JWDA 1YURA 1C3YA 5I2QA 4C0KA 3CYZA 2MA2A 2PRUA 3D0YB 5CSFA 1MUXA 1YVLA 2CT9A 3PALA 4PCWA 4OV2A 3VRRA
chains in the Genus database with same CATH topology
1XFXO 1GGWA 1YX7A 2M9GA 1MR8A 1D1OA 4A4CA 2ZFDA 1SR6B 3FS7A 2F2OA 4BY5A 2Y1NA 4GGNA 2L98A 1SW8A 2AAOA 2MBXA 1SMGA 4MN0A 1DJXA 1CDMA 1X02A 1RROA 2ZN8A 4P5OE 1DJYA 2WOSA 1NUBA 1LKJA 1AJ5A 2JULA 3CR4X 1TNWA 4MSPA 2KGRA 1KK7Z 3I5HB 4MZJA 1JC2A 4C0JA 1YRUB 4I5KA 2M49B 2WORA 1SL9A 1UHHA 1ALVA 2KHNA 5DKNA 4CLNA 1WDCB 3CGAA 1BLQA 1E8AA 2K7CA 1YX8A 2R2IA 1SKTA 4GGFC 2KFFA 1S36A 1EG4A 2M7LA 3KHEA 2LLUA 3DVKA 2G9BA 3TDZA 5I2LA 1CNPA 1F54A 4ZCVA 4E68A 3LK1A 4CPVA 4PDZA 2JC2A 2HETA 5J3XA 3OB1B 1JF0A 3CZTX 4WRIA 3QRXA 4AQIA 1KFUL 3I5GB 4A4BA 1BG1A 4P2YB 2OS8B 4M2PA 1KK8B 1Y1AA 1KQMC 1AK8A 1F70A 2JNFA 1KWOB 1Y1XA 2B1UA 2L4HA 4NDBA 1AHRA 2F33A 1EXRA 1TNQA 1OOJA 2Q4UA 1NWDA 1S26D 2K2FA 2TN4A 1MXEA 1GGZA 1OMRA 3C1VA 2JZIA 4NDCA 3SG5A 1F71A 2MAZA 5I2OA 1B8CA 1QVIY 2MLFC 4PHJA 5DKQA 4YGCB 3DVEA 3MSEB 3O6BA 3M0WA 3O78A 2RGIA 2CXJA 1AJ4A 4I5NB 2NZ0A 3JVTB 1G33A 1QX7A 5HYDA 2H61A 1SRAA 3CR5X 2EHBA 1F4QA 3OP0A 2LANA 2LLSA 1UWOA 2L51A 4MEWA 1KSMA 1RECA 3EK4A 2WC8A 3A4UB 2KI4C 3KPXA 3SJSA 1UHJA 3OB2B 1YUSA 1RJVA 1SK6D 4XYNA 2JOJA 1LINA 1BR1B 1EG3A 2FCDA 1NPQA 3SG3A 1TN4A 1UHNA 4IL1A 3D0YA 1DJWA 2E6WA 2ZN9A 2BBMA 1AVSA 2CNPA 4MLWA 1UUSA 1YUUA 4OCIA 3KO0A 4QJ5B 1BU3A 2OTGB 2WCFA 2Y4QA 2EC6B 2JXLA 1B1GA 1TNXA 2DOQA 4PHNA 2LLTA 2KDHA 1IJ5A 1V1GA 3GK2A 2BCAA 1RK9A 3BUNB 4YGDB 1JSAA 1YRTB 3DVMA 2L2EA 5PALA 1K9PA 2JQ6A 3GOFA 4F0ZB 1UP5A 2LHLA 2KOTA 1DJZA 1ZOTB 2BKHB 2LVIA 1UHKA 4UPGA 2BE4A 2JWWA 1SBJA 3D10A 2LUCA 4JWQA 4I5LB 3IF7A 4GAOA 2M1KB 1FI6A 1SNLA 2JTTA 2OPOA 1K9UA 1TIZA 1DF0A 1XFUO 1K90D 1QVIZ 3FWBA 4USLA 3VRPA 5I8NA 2I94A 4DRWA 3I5IC 1CDLA 1CFCA 1JBAA 3TDIA 3FIAA 2CBLA 2K61A 4ORAB 1B8LA 1Q80A 1WLZA 2H2KA 1LA3A 1QTXA 5HKYA 3O4YA 1DTLA 3LL8B 3TUYC 4PE4A 1KSOA 2JU0A 3OX5A 1QIVA 2LE9B 2Y1MA 1F8HA 4R1EA 4TNCA 5TNCA 2KYCA 1A29A 2WNDA 1IJ6A 1L7ZA 4OVNF 5AEQA 5FYXA 2QPTA 1K94A 1N65A 1RFJA 1H4BA 1HQVA 5JOLA 2KAXA 5HKZA 1DJIA 4XJKA 1W7JB 3ZWHA 1B7TY 4YRUA 2LCPA 1QATA 1SL8A 1LXFC 2I2RE 2Q91A 1G4YR 4GGFA 5CPVA 1DF0B 2L50A 4MZLA 1K93D 2F8PA 1A03A 1IKUA 1XFWO 3ICBA 1R2UA 1NCYA 4M2QA 2K8MB 1XK4C 3CWGA 1A2XA 3EVRA 1N0YA 4CFQA 3GK1A 4N1GA 1K9KA 1WY9A 2M29A 1XO5A 2KNEA 4FQOA 1TNPA 1M63B 2HF5A 1QV0A 2O5GA 1J1EA 1QXPA 5CSJA 1BOCA 2ISDA 1OMVA 1V1FA 2PALA 3PFVA 1JFKA 1BF5A 1FI5A 1PK0D 2KFGA 3PN7C 1C7VA 2AMIA 2KBMA 2BE6A 5B8IB 1CLBA 1J55A 5BPJA 3PLFB 2JPTA 4I5JA 1K8UA 2NCPA 4XJKB 3TS5C 2JT8A 1YR5A 3FWCA 3DF0B 3SG2A 2SASA 1CB1A 2E30A 2JT0A 3ZNIA 1B9AA 2PASA 1KFUS 3BUOB 2NXQA 5JJGA 3EKJA 1J7PA 2KAYA 4HSZA 3AKAA 3BUWB 3HCMA 3BUMB 2KI6D 3WXAA 2BCXA 3K21A 3VRQA 1KQMB 1IH0A 1YVHA 1B7TZ 1BMOA 4WQ3A 3TZ1A 2LHIA 1NYAA 1R6PA 2F3ZA 2O60A 4MZKA 1M31A 1EL4A 1A4PA 5CSNA 5AFPA 3A8RA 1VRKA 2HPSA 3WNXB 2PVBA 3SG4A 2LVJA 1MQ1A 2V53A 2CCMA 4AQJA 2JRFA 1QV1A 3EVUA 2P6BB 2SCPA 1CFPA 1W7IB 1KFXL 2CTNA 1IQ5A 2BL0C 2PSRA 1L2OC 1C07A 3BXKA 4MBEA 3VRNA 1J7OA 4BY4A 3LCPC 1BR4B 1SCMC 1UHIA 3NSLA 1MXLC 1DT7B 4JPZB 2EGDA 2H61C 3JTDC 2JXCA 2K7BA 4ORBB 2KI4B 1AP4A 1B47A 1GQMA 2AUCA 2GGZA 3PATA 3BYAA 1CDPA 1KCYA 1QLSA 2MJWB 2MLEC 1KQVA 4ETOA 4PE1A 4QJ3B 2WCEA 1SCVA 1M39A 1ODBA 5HKWA 3NXAA 2FOTA 3DD4A 3PM8A 5D69A 1L2OB 1QLKA 2KSPA 4L9MA 1OMDA 1EJ3A 1S6IA 4N1FA 1F4OA 1WRKA 5F6TA 1FBVA 4GBAA 2L5XB 5CSIA 3CTNA 4PHMA 1J1DA 2ZRSA 3JTDB 2LC5A 1CM4A 1DGUA 3SG7A 1SR6C 2KQ6A 2LAPA 4MRYA 4PHKA 1FF1A 1PVBA 1S6JA 1H8BA 3AAKA 3IQQA 4FTGA 5KTYA 1B8RA 4NDDA 4YI9A 2GV5A 1WLMA 2GGMA 1OE9B 1CFDA 2M8UA 2LM5A 2HQWA 3I5HC 1DJGA 1YTZC 3NSKA 3EVVA 2K7DA 2BKIB 2HQ8A 3I5IB 3KF9A 4CIDA 1XFVO 3EK7A 3OHMB 1CMFA 1WDCC 2BECA 1G8IA 4D1EA 1BT6A 4ORCB 4YGBB 1XK4A 2NCOA 3DF0A 3GK4X 3TUYB 5G08A 1OQPA 4U8DA 1CFFA 1QJTA 3F45A 5D7FA 1IQ3A 1HT9A 1QIWA 1QX5B 1S6CA 1M45A 2JT3A 4YI8A 1SYMA 1N2DA 1A75A 4MVFA 2LMVA 1YUTA 1BJFA 4OKHA 2VRGA 2KQYA 1SL7A 1NX1A 1XVJA 4PE7A 1FW4A 1B4CA 2BCBA 4GUKA 1XYDA 1K96A 1U5IB 1S3PA 2PMYA 3CLNA 3I5GC 3WHTB 2OS8C 2QACA 3CR2A 1RTP1 1S1EA 4AOMA 5AERA 4QJ4B 1KK8C 1K2HA 4C0LA 3HX4A 2MHHA 3RLZA 1KWOC 4DUQA 1BODA 4CFRA 4M2OA 1WRZA 5HLVA 4ZCUA 4OR9B 3SIAA 1CKKA 2LNKA 1IG5A 2L4IA 3SIBA 4YGAA 2LVKA 1XFZO 2MRDA 3KEVA 2M1UA 4PALA 2K7OA 2ZKMX 1LVCD 3H4SE 1QS7A 1UURA 3E3RA 2JTZA 1CMGA 1PRWA 1RWYA 1IRJA 1S5GY 4DS7A 3O2PA 1NX0A 2LP2A 3BOWA 4GNKB 5AANA 2M0RA 1IWQA 1A75B 1WRLA 3AKBA 3PN7B 5GQQC 3JVTC 1IGVA 3DVJA 2K0JA 1OZSA 1Y6WA 1MHOA 3RM1A 3TS5B 2F3YA 5ER4X 3EK8A 1J7RA 5ER5A 1J7QA 4GFTA 3EKHA 3IQOA 1DVIA 1PULA 2ZRTA 2K2AA 2LMTA 1JUOA 2BBNA 2COLB 3NSIA 3TDUA 2KFHA 1XA5A 2M3WA 1OSAA 2I7AA 1XFYO 2ZNDA 4YGEB 1MWNA 1TRFA 3VGOA 1QASA 5K89A 1CTRA 2ZNEA 2KAVA 2JNXA 3AAJA 2M7NA 4Q04A 1CDNA 1GJYA 1NCZA 1SPYA 4HREE 1JF2A 4YBHB 1TCOB 2KBIA 2OTGC 2IS9A 4HRGA 4ICBA 1OZOA 1ALWA 2EC6C 1K95A 2F2PA 1NCXA 1NX3A 4DCKA 5HLOA 3BUXB 3BOWB 1PVAA 1MF8B 2FJUB 1NSHA 4HRHA 3WHUB 1PSBA 1EH2A 1NX2A 1QX2A 2LVVA 4N5XA 1CLMA 4GPLB 4PE0A 3VROA 1ZACA 1KFXS 1LA0A 1PSRA 2Y5IA 2M97A 3I5FC 1KK7Y 1ZMZA 2KYFA 3LK0A 1DGVA 5DKRA 4JQ0D 1NIWA 2BL0B 1ZUZA 5KU1A 1M46A 1S5GZ 2NLNA 3NSOA 1CM1A 1C7WA 4DIRA 2G2BA 3LLEA 5IBWA 2LP3A 3CS1A 3SG6A 1JFJA 1SCMB 1Y0VH 1CLLA 1NP8A 3PSRA 2KGBC 1DMOA 2I18A 1Y1UA 2LV7A 1F55A 1FPWA 1AUIB 2A4JA 2LMUA 2L0PA 5AXIA 1TTXA 3OX6A 1TOPA 1TCFA 2KI6C 1U5IA 3BQ3A 3I5FB 4MRXA 1DJHA 1PALA 1ZFSA 2D8NA 4WQ2A 5KSZA 1SY9A 2LUXA 2FCEA 2WCBA 4NQGA 1JWDA 1YURA 5I2QA 4C0KA 2MA2A 2PRUA 3D0YB 5CSFA 1MUXA 1YVLA 2CT9A 3PALA 4PCWA 4OV2A 3VRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFX O;  1GGW A;  1YX7 A;  2M9G A;  1MR8 A;  1D1O A;  4A4C A;  2ZFD A;  1SR6 B;  3FS7 A;  2F2O A;  4BY5 A;  2Y1N A;  4GGN A;  2L98 A;  1SW8 A;  2AAO A;  2MBX A;  1SMG A;  4MN0 A;  1DJX A;  1CDM A;  1X02 A;  1RRO A;  2ZN8 A;  4P5O E;  1DJY A;  2WOS A;  1NUB A;  1LKJ A;  1AJ5 A;  2JUL A;  3CR4 X;  1TNW A;  4MSP A;  2KGR A;  1KK7 Z;  3I5H B;  4MZJ A;  1JC2 A;  4C0J A;  1YRU B;  4I5K A;  2M49 B;  2WOR A;  1SL9 A;  1UHH A;  1ALV A;  2KHN A;  5DKN A;  4CLN A;  1WDC B;  3CGA A;  1BLQ A;  1E8A A;  2K7C A;  1YX8 A;  2R2I A;  1SKT A;  4GGF C;  2KFF A;  1S36 A;  1EG4 A;  2M7L A;  3KHE A;  2LLU A;  3DVK A;  2G9B A;  3TDZ A;  5I2L A;  1CNP A;  1F54 A;  4ZCV A;  4E68 A;  3LK1 A;  4CPV A;  4PDZ A;  2JC2 A;  2HET A;  5J3X A;  3OB1 B;  1JF0 A;  3CZT X;  4WRI A;  3QRX A;  4AQI A;  1KFU L;  3I5G B;  4A4B A;  1BG1 A;  4P2Y B;  2OS8 B;  4M2P A;  1KK8 B;  1Y1A A;  1KQM C;  1AK8 A;  1F70 A;  2JNF A;  1KWO B;  1Y1X A;  2B1U A;  2L4H A;  4NDB A;  1AHR A;  2F33 A;  1EXR A;  1TNQ A;  1OOJ A;  2Q4U A;  1NWD A;  1S26 D;  2K2F A;  2TN4 A;  1MXE A;  1GGZ A;  1OMR A;  3C1V A;  2JZI A;  4NDC A;  3SG5 A;  1F71 A;  2MAZ A;  5I2O A;  1B8C A;  1QVI Y;  2MLF C;  4PHJ A;  5DKQ A;  4YGC B;  3DVE A;  3MSE B;  3O6B A;  3M0W A;  3O78 A;  2RGI A;  2CXJ A;  1AJ4 A;  4I5N B;  2NZ0 A;  3JVT B;  1G33 A;  1QX7 A;  5HYD A;  2H61 A;  1SRA A;  3CR5 X;  2EHB A;  1F4Q A;  3OP0 A;  2LAN A;  2LLS A;  1UWO A;  2L51 A;  4MEW A;  1KSM A;  1REC A;  3EK4 A;  2WC8 A;  3A4U B;  2KI4 C;  3KPX A;  3SJS A;  1UHJ A;  3OB2 B;  1YUS A;  1RJV A;  1SK6 D;  4XYN A;  2JOJ A;  1LIN A;  1BR1 B;  1EG3 A;  2FCD A;  1NPQ A;  3SG3 A;  1TN4 A;  1UHN A;  4IL1 A;  3D0Y A;  1DJW A;  2E6W A;  2ZN9 A;  2BBM A;  1AVS A;  2CNP A;  4MLW A;  1UUS A;  1YUU A;  4OCI A;  3KO0 A;  4QJ5 B;  1BU3 A;  2OTG B;  2WCF A;  2Y4Q A;  2EC6 B;  2JXL A;  1B1G A;  1TNX A;  2DOQ A;  4PHN A;  2LLT A;  2KDH A;  1IJ5 A;  1V1G A;  3GK2 A;  2BCA A;  1RK9 A;  3BUN B;  4YGD B;  1JSA A;  1YRT B;  3DVM A;  2L2E A;  5PAL A;  1K9P A;  2JQ6 A;  3GOF A;  4F0Z B;  1UP5 A;  2LHL A;  2KOT A;  1DJZ A;  1ZOT B;  2BKH B;  2LVI A;  1UHK A;  4UPG A;  2BE4 A;  2JWW A;  1SBJ A;  3D10 A;  2LUC A;  4JWQ A;  4I5L B;  3IF7 A;  4GAO A;  2M1K B;  1FI6 A;  1SNL A;  2JTT A;  2OPO A;  1K9U A;  1TIZ A;  1DF0 A;  1XFU O;  1K90 D;  1QVI Z;  3FWB A;  4USL A;  3VRP A;  5I8N A;  2I94 A;  4DRW A;  3I5I C;  1CDL A;  1CFC A;  1JBA A;  3TDI A;  3FIA A;  2CBL A;  2K61 A;  4ORA B;  1B8L A;  1Q80 A;  1WLZ A;  2H2K A;  1LA3 A;  1QTX A;  5HKY A;  3O4Y A;  1DTL A;  3LL8 B;  3TUY C;  4PE4 A;  1KSO A;  2JU0 A;  3OX5 A;  1QIV A;  2LE9 B;  2Y1M A;  1F8H A;  4R1E A;  4TNC A;  5TNC A;  2KYC A;  1A29 A;  2WND A;  1IJ6 A;  1L7Z A;  4OVN F;  5AEQ A;  5FYX A;  2QPT A;  1K94 A;  1N65 A;  1RFJ A;  1H4B A;  1HQV A;  5JOL A;  2KAX A;  5HKZ A;  1DJI A;  4XJK A;  1W7J B;  3ZWH A;  1B7T Y;  4YRU A;  2LCP A;  1QAT A;  1SL8 A;  1LXF C;  2I2R E;  2Q91 A;  1G4Y R;  4GGF A;  5CPV A;  1DF0 B;  2L50 A;  4MZL A;  1K93 D;  2F8P A;  1A03 A;  1IKU A;  1XFW O;  3ICB A;  1R2U A;  1NCY A;  4M2Q A;  2K8M B;  1XK4 C;  3CWG A;  1A2X A;  3EVR A;  1N0Y A;  4CFQ A;  3GK1 A;  4N1G A;  1K9K A;  1WY9 A;  2M29 A;  1XO5 A;  2KNE A;  4FQO A;  1TNP A;  1M63 B;  2HF5 A;  1QV0 A;  2O5G A;  1J1E A;  1QXP A;  5CSJ A;  1BOC A;  2ISD A;  1OMV A;  1V1F A;  2PAL A;  3PFV A;  1JFK A;  1BF5 A;  1FI5 A;  1PK0 D;  2KFG A;  3PN7 C;  1C7V A;  2AMI A;  2KBM A;  2BE6 A;  5B8I B;  1CLB A;  1J55 A;  5BPJ A;  3PLF B;  2JPT A;  4I5J A;  1K8U A;  2NCP A;  4XJK B;  3TS5 C;  2JT8 A;  1YR5 A;  3FWC A;  3DF0 B;  3SG2 A;  2SAS A;  1CB1 A;  2E30 A;  2JT0 A;  3ZNI A;  1B9A A;  2PAS A;  1KFU S;  3BUO B;  2NXQ A;  5JJG A;  3EKJ A;  1J7P A;  2KAY A;  4HSZ A;  3AKA A;  3BUW B;  3HCM A;  3BUM B;  2KI6 D;  3WXA A;  2BCX A;  3K21 A;  3VRQ A;  1KQM B;  1IH0 A;  1YVH A;  1B7T Z;  1BMO A;  4WQ3 A;  3TZ1 A;  2LHI A;  1NYA A;  1R6P A;  2F3Z A;  2O60 A;  4MZK A;  1M31 A;  1EL4 A;  1A4P A;  5CSN A;  5AFP A;  3A8R A;  1VRK A;  2HPS A;  3WNX B;  2PVB A;  3SG4 A;  2LVJ A;  1MQ1 A;  2V53 A;  2CCM A;  4AQJ A;  2JRF A;  1QV1 A;  3EVU A;  2P6B B;  2SCP A;  1CFP A;  1W7I B;  1KFX L;  2CTN A;  1IQ5 A;  2BL0 C;  2PSR A;  1L2O C;  1C07 A;  3BXK A;  4MBE A;  3VRN A;  1J7O A;  4BY4 A;  3LCP C;  1BR4 B;  1SCM C;  1UHI A;  3NSL A;  1MXL C;  1DT7 B;  4JPZ B;  2EGD A;  2H61 C;  3JTD C;  2JXC A;  2K7B A;  4ORB B;  2KI4 B;  1AP4 A;  1B47 A;  1GQM A;  2AUC A;  2GGZ A;  3PAT A;  3BYA A;  1CDP A;  1KCY A;  1QLS A;  2MJW B;  2MLE C;  1KQV A;  4ETO A;  4PE1 A;  4QJ3 B;  2WCE A;  1SCV A;  1M39 A;  1ODB A;  5HKW A;  3NXA A;  2FOT A;  3DD4 A;  3PM8 A;  5D69 A;  1L2O B;  1QLK A;  2KSP A;  4L9M A;  1OMD A;  1EJ3 A;  1S6I A;  4N1F A;  1F4O A;  1WRK A;  5F6T A;  1FBV A;  4GBA A;  2L5X B;  5CSI A;  3CTN A;  4PHM A;  1J1D A;  2ZRS A;  3JTD B;  2LC5 A;  1CM4 A;  1DGU A;  3SG7 A;  1SR6 C;  2KQ6 A;  2LAP A;  4MRY A;  4PHK A;  1FF1 A;  1PVB A;  1S6J A;  1H8B A;  3AAK A;  3IQQ A;  4FTG A;  5KTY A;  1B8R A;  4NDD A;  4YI9 A;  2GV5 A;  1WLM A;  2GGM A;  1OE9 B;  1CFD A;  2M8U A;  2LM5 A;  2HQW A;  3I5H C;  1DJG A;  1YTZ C;  3NSK A;  3EVV A;  2K7D A;  2BKI B;  2HQ8 A;  3I5I B;  3KF9 A;  4CID A;  1XFV O;  3EK7 A;  3OHM B;  1CMF A;  1WDC C;  2BEC A;  1G8I A;  4D1E A;  1BT6 A;  4ORC B;  4YGB B;  1XK4 A;  2NCO A;  3DF0 A;  3GK4 X;  3TUY B;  5G08 A;  1OQP A;  4U8D A;  1CFF A;  1QJT A;  3F45 A;  5D7F A;  1IQ3 A;  1HT9 A;  1QIW A;  1QX5 B;  1S6C A;  1M45 A;  2JT3 A;  4YI8 A;  1SYM A;  1N2D A;  1A75 A;  4MVF A;  2LMV A;  1YUT A;  1BJF A;  4OKH A;  2VRG A;  2KQY A;  1SL7 A;  1NX1 A;  1XVJ A;  4PE7 A;  1FW4 A;  1B4C A;  2BCB A;  4GUK A;  1XYD A;  1K96 A;  1U5I B;  1S3P A;  2PMY A;  3CLN A;  3I5G C;  3WHT B;  2OS8 C;  2QAC A;  3CR2 A;  1RTP 1;  1S1E A;  4AOM A;  5AER A;  4QJ4 B;  1KK8 C;  1K2H A;  4C0L A;  3HX4 A;  2MHH A;  3RLZ A;  1KWO C;  4DUQ A;  1BOD A;  4CFR A;  4M2O A;  1WRZ A;  5HLV A;  4ZCU A;  4OR9 B;  3SIA A;  1CKK A;  2LNK A;  1IG5 A;  2L4I A;  3SIB A;  4YGA A;  2LVK A;  1XFZ O;  2MRD A;  3KEV A;  2M1U A;  4PAL A;  2K7O A;  2ZKM X;  1LVC D;  3H4S E;  1QS7 A;  1UUR A;  3E3R A;  2JTZ A;  1CMG A;  1PRW A;  1RWY A;  1IRJ A;  1S5G Y;  4DS7 A;  3O2P A;  1NX0 A;  2LP2 A;  3BOW A;  4GNK B;  5AAN A;  2M0R A;  1IWQ A;  1A75 B;  1WRL A;  3AKB A;  3PN7 B;  5GQQ C;  3JVT C;  1IGV A;  3DVJ A;  2K0J A;  1OZS A;  1Y6W A;  1MHO A;  3RM1 A;  3TS5 B;  2F3Y A;  5ER4 X;  3EK8 A;  1J7R A;  5ER5 A;  1J7Q A;  4GFT A;  3EKH A;  3IQO A;  1DVI A;  1PUL A;  2ZRT A;  2K2A A;  2LMT A;  1JUO A;  2BBN A;  2COL B;  3NSI A;  3TDU A;  2KFH A;  1XA5 A;  2M3W A;  1OSA A;  2I7A A;  1XFY O;  2ZND A;  4YGE B;  1MWN A;  1TRF A;  3VGO A;  1QAS A;  5K89 A;  1CTR A;  2ZNE A;  2KAV A;  2JNX A;  3AAJ A;  2M7N A;  4Q04 A;  1CDN A;  1GJY A;  1NCZ A;  1SPY A;  4HRE E;  1JF2 A;  4YBH B;  1TCO B;  2KBI A;  2OTG C;  2IS9 A;  4HRG A;  4ICB A;  1OZO A;  1ALW A;  2EC6 C;  1K95 A;  2F2P A;  1NCX A;  1NX3 A;  4DCK A;  5HLO A;  3BUX B;  3BOW B;  1PVA A;  1MF8 B;  2FJU B;  1NSH A;  4HRH A;  3WHU B;  1PSB A;  1EH2 A;  1NX2 A;  1QX2 A;  2LVV A;  4N5X A;  1CLM A;  4GPL B;  4PE0 A;  3VRO A;  1ZAC A;  1KFX S;  1LA0 A;  1PSR A;  2Y5I A;  2M97 A;  3I5F C;  1KK7 Y;  1ZMZ A;  2KYF A;  3LK0 A;  1DGV A;  5DKR A;  4JQ0 D;  1NIW A;  2BL0 B;  1ZUZ A;  5KU1 A;  1M46 A;  1S5G Z;  2NLN A;  3NSO A;  1CM1 A;  1C7W A;  4DIR A;  2G2B A;  3LLE A;  5IBW A;  2LP3 A;  3CS1 A;  3SG6 A;  1JFJ A;  1SCM B;  1Y0V H;  1CLL A;  1NP8 A;  3PSR A;  2KGB C;  1DMO A;  2I18 A;  1Y1U A;  2LV7 A;  1F55 A;  1FPW A;  1AUI B;  2A4J A;  2LMU A;  2L0P A;  5AXI A;  1TTX A;  3OX6 A;  1TOP A;  1TCF A;  2KI6 C;  1U5I A;  3BQ3 A;  3I5F B;  4MRX A;  1DJH A;  1PAL A;  1ZFS A;  2D8N A;  4WQ2 A;  5KSZ A;  1SY9 A;  2LUX A;  2FCE A;  2WCB A;  4NQG A;  1JWD A;  1YUR A;  5I2Q A;  4C0K A;  2MA2 A;  2PRU A;  3D0Y B;  5CSF A;  1MUX A;  1YVL A;  2CT9 A;  3PAL A;  4PCW A;  4OV2 A;  3VRR A; 
#chains in the Genus database with same CATH topology
 1XFX O;  1GGW A;  1YX7 A;  2M9G A;  1MR8 A;  1D1O A;  4A4C A;  2ZFD A;  1SR6 B;  3FS7 A;  2F2O A;  4BY5 A;  2Y1N A;  4GGN A;  2L98 A;  1SW8 A;  2AAO A;  2MBX A;  1SMG A;  4MN0 A;  1DJX A;  1CDM A;  1X02 A;  1RRO A;  2ZN8 A;  4P5O E;  1DJY A;  2WOS A;  1NUB A;  1LKJ A;  1AJ5 A;  2JUL A;  2L2C A;  1TNW A;  2WCH A;  3CR4 X;  3NHT A;  2KGR A;  1KK7 Z;  1DEK A;  3I5H B;  4MZJ A;  1JC2 A;  4C0J A;  1YRU B;  4I5K A;  2M49 B;  2WOR A;  1IIO A;  1SL9 A;  2QEB A;  1UHH A;  1ALV A;  2KHN A;  5DKN A;  4CLN A;  1WDC B;  3CGA A;  1BLQ A;  1E8A A;  5FI7 A;  2K7C A;  1YX8 A;  4JKT A;  3D78 A;  2R2I A;  1SKT A;  4GGF C;  2KFF A;  1S36 A;  1EG4 A;  2M7L A;  3KHE A;  2LLU A;  3DVK A;  2G9B A;  3TDZ A;  5I2L A;  1CNP A;  1F54 A;  2BAP A;  4ZCV A;  3PM2 A;  4E68 A;  3LK1 A;  2KLE A;  4CPV A;  4PDZ A;  2JC2 A;  2HET A;  5J3X A;  3OB1 B;  1JF0 A;  3CZT X;  4WRI A;  3QRX A;  3QME A;  4AQI A;  1KFU L;  1W9Z A;  2K60 A;  3I5G B;  4A4B A;  1BG1 A;  1OOF A;  2OS8 B;  4P2Y B;  3S0A A;  1DC1 A;  4M2P A;  1KK8 B;  1Y1A A;  3D74 A;  1KQM C;  1AK8 A;  1F70 A;  2JNF A;  1KWO B;  1Y1X A;  2B1U A;  2L4H A;  3S0F A;  4NDB A;  1AHR A;  2F33 A;  1EXR A;  4FQT A;  1TNQ A;  1OOJ A;  1DQE A;  2Q4U A;  1NWD A;  2H8V A;  1S26 D;  2K2F A;  2TN4 A;  3CAB A;  1MXE A;  1GGZ A;  1OMR A;  3C1V A;  2JZI A;  4NDC A;  3SG5 A;  3OGN A;  1F71 A;  2MAZ A;  5I2O A;  1B8C A;  1QVI Y;  2MLF C;  4PHJ A;  5DKQ A;  4YGC B;  3DVE A;  3MSE B;  3O6B A;  3M0W A;  3O78 A;  5D3O A;  2RGI A;  2CXJ A;  1AJ4 A;  2QEV A;  4I5N B;  2NZ0 A;  3JVT B;  1G33 A;  1QX7 A;  4MSP A;  1XFR A;  5HYD A;  2H61 A;  1SRA A;  3CR5 X;  2EHB A;  1F4Q A;  3OP0 A;  2LAN A;  2LLS A;  1UWO A;  2L51 A;  4MEW A;  1KSM A;  1REC A;  3EK4 A;  2WC8 A;  3K1E A;  3R72 A;  3A4U B;  2KI4 C;  2PYQ A;  2QEO A;  3KPX A;  3SJS A;  1UHJ A;  3OB2 B;  1YUS A;  1RJV A;  1SK6 D;  4XYN A;  5HL1 A;  2JOJ A;  1LIN A;  1OOH A;  1BR1 B;  1EG3 A;  2FCD A;  3BJH A;  1NPQ A;  2WCM A;  3SG3 A;  1TN4 A;  1UHN A;  4IL1 A;  2KLD A;  3D0Y A;  1DJW A;  2E6W A;  2ZN9 A;  2WCL A;  2BBM A;  1AVS A;  2CNP A;  4MLW A;  1UUS A;  1YUU A;  4OCI A;  3KO0 A;  4QJ5 B;  1BU3 A;  2OTG B;  2GTE A;  2WCF A;  2Y4Q A;  2EC6 B;  2JXL A;  1B1G A;  1TNX A;  2DOQ A;  4PHN A;  2LLT A;  2KDH A;  1IJ5 A;  1V1G A;  3GK2 A;  2BCA A;  1RK9 A;  3BUN B;  4YGD B;  1JSA A;  1YRT B;  3DVM A;  2L2E A;  5PAL A;  1K9P A;  2JQ6 A;  3GOF A;  4F0Z B;  1UP5 A;  4F7F A;  2LHL A;  2KOT A;  1DJZ A;  1ZOT B;  2BKH B;  3BFB A;  2LVI A;  1UHK A;  4UPG A;  2BE4 A;  2JWW A;  1SBJ A;  4PT1 A;  3D10 A;  2LUC A;  4JWQ A;  5FI2 A;  4I5L B;  3DXL A;  3IF7 A;  2M1K B;  4GAO A;  1SNL A;  2JTT A;  2OPO A;  1FI6 A;  5EL2 A;  1K9U A;  1TIZ A;  1DF0 A;  1XFU O;  1K90 D;  1QVI Z;  3FWB A;  4USL A;  3R1V A;  3DYE A;  3VRP A;  5I8N A;  2I94 A;  4DRW A;  3I5I C;  1CDL A;  1CFC A;  1JBA A;  3TDI A;  3FIA A;  2CBL A;  2K61 A;  4ORA B;  2QDI A;  4INW A;  1B8L A;  1Q80 A;  1WLZ A;  2H2K A;  1LA3 A;  1QTX A;  5HKY A;  3SS4 A;  3O4Y A;  1DTL A;  3LL8 B;  3TUY C;  4PE4 A;  1KSO A;  2JU0 A;  3OX5 A;  1QIV A;  2LE9 B;  2Y1M A;  1F8H A;  4R1E A;  4TNC A;  3SS3 A;  5TNC A;  2KYC A;  1A29 A;  2WND A;  3FE9 A;  1IJ6 A;  1L7Z A;  4OVN F;  5AEQ A;  5FYX A;  3CDN A;  2QPT A;  3V2L A;  1K94 A;  1N65 A;  1RFJ A;  1H4B A;  1HQV A;  5JOL A;  2KAX A;  5HKZ A;  1DJI A;  2JPO A;  4XJK A;  1W7J B;  3S0D A;  3ZWH A;  1B7T Y;  4YRU A;  2LCP A;  1QAT A;  1SL8 A;  1LXF C;  2I2R E;  2Q91 A;  1G4Y R;  4GGF A;  3CZ0 A;  5CPV A;  1DF0 B;  2L50 A;  4MZL A;  1K93 D;  2F8P A;  1A03 A;  1TUZ A;  1XFW O;  3ICB A;  4IJ7 A;  1IKU A;  2ERB A;  1DEL A;  1R2U A;  1NCY A;  4M2Q A;  2K8M B;  1XK4 C;  3CWG A;  1A2X A;  3EVR A;  1N0Y A;  3OBV A;  3GK1 A;  4N1G A;  4CFQ A;  3CZ1 A;  1K9K A;  1WY9 A;  2M29 A;  1XO5 A;  2KNE A;  4FQO A;  1TNP A;  1M63 B;  2HF5 A;  1QV0 A;  2O5G A;  1J1E A;  3O4X A;  1QXP A;  5CSJ A;  1BOC A;  2ISD A;  1OMV A;  1LS8 A;  1V1F A;  1Z4H A;  1JFK A;  2PAL A;  3PFV A;  1SSE B;  1BF5 A;  1FI5 A;  1PK0 D;  2KFG A;  3PN7 C;  1C7V A;  3UO9 A;  2AMI A;  2KBM A;  2BE6 A;  5B8I B;  1CLB A;  1J55 A;  3B6X A;  5BPJ A;  3IVT A;  3PLF B;  2JPT A;  4I5J A;  1K8U A;  2NCP A;  4XJK B;  3TS5 C;  2JT8 A;  1YR5 A;  3FWC A;  2L5Y A;  3DF0 B;  3SG2 A;  2SAS A;  1CB1 A;  2E30 A;  2JT0 A;  3ZNI A;  3NGV A;  3UNW A;  1B9A A;  2PAS A;  1KFU S;  3BUO B;  2WC5 A;  3VB1 A;  2NXQ A;  5JJG A;  3EKJ A;  1J7P A;  2KAY A;  5I94 A;  4HSZ A;  4OZD A;  3AKA A;  3BUW B;  3HCM A;  3L4L A;  3BUM B;  2KI6 D;  3WXA A;  2BCX A;  3K21 A;  1QWV A;  3VRQ A;  1KQM B;  3FE6 A;  1IH0 A;  1YVH A;  1B7T Z;  1BMO A;  4WQ3 A;  3TZ1 A;  2LHI A;  1NYA A;  1R6P A;  2F3Z A;  2O60 A;  3D73 A;  1M31 A;  4MZK A;  1EL4 A;  1A4P A;  5CSN A;  5AFP A;  3A8R A;  1VRK A;  2HPS A;  3WNX B;  2PVB A;  3SG4 A;  2LVJ A;  1MQ1 A;  2YGU A;  2V53 A;  2CCM A;  4AQJ A;  2JRF A;  1QV1 A;  2WC6 A;  3EVU A;  2P6B B;  2SCP A;  1CFP A;  1W7I B;  1KFX L;  2CTN A;  2WCJ A;  1IQ5 A;  2BL0 C;  2PSR A;  1L2O C;  1C07 A;  3BXK A;  4MBE A;  3VRN A;  1J7O A;  4BY4 A;  3LCP C;  5DIC A;  1BR4 B;  1SCM C;  1UHI A;  3NSL A;  1MXL C;  2FJY A;  1DT7 B;  4JPZ B;  2EGD A;  2H61 C;  3JTD C;  2JXC A;  2K7B A;  4ORB B;  2KI4 B;  1AP4 A;  1B47 A;  1GQM A;  2AUC A;  2GGZ A;  3PAT A;  3BYA A;  1CDP A;  1KCY A;  1QLS A;  2MJW B;  2MLE C;  3DZT A;  1KQV A;  4ETO A;  4PE1 A;  4QJ3 B;  2WCE A;  1SCV A;  1M39 A;  1ODB A;  5HKW A;  3NXA A;  2FOT A;  1OW4 A;  3DD4 A;  3PM8 A;  5D69 A;  1L2O B;  1QLK A;  2KSP A;  4L9M A;  1OMD A;  1EJ3 A;  1S6I A;  4N1F A;  1F4O A;  1WRK A;  5F6T A;  1FBV A;  3R1P A;  3DY9 A;  4GBA A;  4JD9 A;  2L5X B;  5CSI A;  3CTN A;  4PHM A;  3PJI A;  3Q8I A;  1J1D A;  2ZRS A;  3JTD B;  2LC5 A;  1CM4 A;  1DGU A;  1P28 A;  3B88 A;  1SR6 C;  2KQ6 A;  2LAP A;  4MRY A;  4PHK A;  3SG7 A;  1PVB A;  1S6J A;  1FF1 A;  1H8B A;  3AAK A;  3IQQ A;  4FTG A;  5KTY A;  1B8R A;  1T14 A;  4NDD A;  4YI9 A;  2GV5 A;  1WLM A;  2GGM A;  1OE9 B;  1CFD A;  2M8U A;  2LM5 A;  2PQL A;  2HQW A;  3I5H C;  3SS5 A;  1DJG A;  1YTZ C;  5FI6 A;  3NSK A;  3EVV A;  2K7D A;  2BKI B;  2HQ8 A;  3I5I B;  3KF9 A;  3L47 A;  4CID A;  2BNX A;  1XFV O;  3RZS A;  3EK7 A;  2WCK A;  3OHM B;  1CMF A;  1WDC C;  2BEC A;  1G8I A;  4D1E A;  1BT6 A;  4ORC B;  4YGB B;  1XK4 A;  2NCO A;  3DF0 A;  3GK4 X;  3B7A A;  5G08 A;  3TUY B;  1OQP A;  2QEH A;  4U8D A;  3S0E A;  1QJT A;  1TUJ A;  3F45 A;  1CFF A;  3B87 A;  5D7F A;  1IQ3 A;  1HT9 A;  1QIW A;  1QX5 B;  1S6C A;  1M45 A;  2JT3 A;  4YI8 A;  3D75 A;  1SYM A;  1N2D A;  1A75 A;  4MVF A;  2LMV A;  1YUT A;  1BJF A;  4OKH A;  2VRG A;  2KQY A;  2P70 A;  1SL7 A;  1NX1 A;  1XVJ A;  4PE7 A;  1FW4 A;  1B4C A;  2BCB A;  4GUK A;  1XYD A;  1K96 A;  1U5I B;  1S3P A;  2KPH A;  2PMY A;  3CLN A;  3I5G C;  3WHT B;  2OS8 C;  2QAC A;  3CR2 A;  1RTP 1;  3CZ2 A;  1S1E A;  4AOM A;  5AER A;  4QJ4 B;  1KK8 C;  1K2H A;  4C0L A;  3HX4 A;  2MHH A;  3RLZ A;  1KWO C;  4DUQ A;  1BOD A;  4CFR A;  4M2O A;  1WRZ A;  5HLV A;  4ZCU A;  4OR9 B;  3SIA A;  1CKK A;  2LNK A;  1IG5 A;  2L4I A;  3SIB A;  4YGA A;  2LVK A;  1XFZ O;  2MRD A;  3KEV A;  2M1U A;  4PAL A;  2K7O A;  2ZKM X;  1LVC D;  3H4S E;  3N7H A;  1QS7 A;  1UUR A;  3E3R A;  3FE8 A;  2JTZ A;  1CMG A;  1PRW A;  1RWY A;  1IRJ A;  1S5G Y;  4DS7 A;  3O2P A;  1NX0 A;  2LP2 A;  3EG5 B;  3BOW A;  4GNK B;  5AAN A;  2M0R A;  1IWQ A;  1A75 B;  1WRL A;  3AKB A;  3PN7 B;  5GQQ C;  3JVT C;  3L4A A;  1IGV A;  3D76 A;  3DVJ A;  3R1O A;  2K0J A;  1OZS A;  1Y6W A;  1MHO A;  3BFH A;  3RM1 A;  3TS5 B;  2F3Y A;  5ER4 X;  3EK8 A;  1J7R A;  2P71 A;  5ER5 A;  4GFT A;  4INX A;  3EKH A;  3IQO A;  1J7Q A;  1DVI A;  1PUL A;  2ZRT A;  2K2A A;  2LMT A;  1JUO A;  2BBN A;  2COL B;  3NSI A;  3TDU A;  2KFH A;  1XA5 A;  2M3W A;  1OSA A;  1ORG A;  2I7A A;  1XFY O;  2ZND A;  3S0G A;  4YGE B;  1MWN A;  1TRF A;  3VGO A;  1QAS A;  5K89 A;  3S0B A;  1CTR A;  2ZNE A;  4KYN A;  3D77 A;  2KAV A;  2JNX A;  3AAJ A;  2M7N A;  4Q04 A;  1CDN A;  1GJY A;  1NCZ A;  1SPY A;  4HRE E;  1JF2 A;  4YBH B;  1TCO B;  2KBI A;  2OTG C;  2IS9 A;  4HRG A;  4ICB A;  1OZO A;  1ALW A;  2EC6 C;  1K95 A;  2F2P A;  1NCX A;  1NX3 A;  4DCK A;  5HLO A;  3BUX B;  3BOW B;  1PVA A;  1MF8 B;  2FJU B;  1NSH A;  4HRH A;  3WHU B;  1PSB A;  1EH2 A;  1NX2 A;  1QX2 A;  2LVV A;  4N5X A;  1CLM A;  1Z2C B;  4GPL B;  4PE0 A;  3VRO A;  1ZAC A;  1KFX S;  1LA0 A;  1PSR A;  2Y5I A;  1C3Z A;  2M97 A;  1KK7 Y;  1ZMZ A;  2KYF A;  3I5F C;  3LK0 A;  1DGV A;  5DKR A;  4JQ0 D;  1NIW A;  2BL0 B;  1ZUZ A;  5KU1 A;  1M46 A;  1S5G Z;  2NLN A;  3NSO A;  1CM1 A;  1C7W A;  4DIR A;  2G2B A;  3LLE A;  5IBW A;  2LP3 A;  3CS1 A;  3SG6 A;  1JFJ A;  1SCM B;  1Y0V H;  1CLL A;  3BFA A;  1NP8 A;  3PSR A;  2KGB C;  1DMO A;  2I18 A;  1Y1U A;  2LV7 A;  1F55 A;  1FPW A;  1AUI B;  2A4J A;  2LMU A;  2L0P A;  3NHI A;  5AXI A;  1TTX A;  1TWO A;  1TOP A;  3OX6 A;  1TCF A;  2KI6 C;  1U5I A;  3BQ3 A;  3I5F B;  4MRX A;  1ZFS A;  1DJH A;  1PAL A;  3B86 A;  1OOG A;  2D8N A;  4WQ2 A;  5KSZ A;  1SY9 A;  2LUX A;  1OOI X;  2FCE A;  2WCB A;  4NQG A;  1GM0 A;  1JWD A;  1YUR A;  1C3Y A;  5I2Q A;  4C0K A;  3CYZ A;  2MA2 A;  2PRU A;  3D0Y B;  5CSF A;  1MUX A;  1YVL A;  2CT9 A;  3PAL A;  4PCW A;  4OV2 A;  3VRR A; 
#chains in the Genus database with same CATH homology
 1XFX O;  1GGW A;  1YX7 A;  2M9G A;  1MR8 A;  1D1O A;  4A4C A;  2ZFD A;  1SR6 B;  3FS7 A;  2F2O A;  4BY5 A;  2Y1N A;  4GGN A;  2L98 A;  1SW8 A;  2AAO A;  2MBX A;  1SMG A;  4MN0 A;  1DJX A;  1CDM A;  1X02 A;  1RRO A;  2ZN8 A;  4P5O E;  1DJY A;  2WOS A;  1NUB A;  1LKJ A;  1AJ5 A;  2JUL A;  3CR4 X;  1TNW A;  4MSP A;  2KGR A;  1KK7 Z;  3I5H B;  4MZJ A;  1JC2 A;  4C0J A;  1YRU B;  4I5K A;  2M49 B;  2WOR A;  1SL9 A;  1UHH A;  1ALV A;  2KHN A;  5DKN A;  4CLN A;  1WDC B;  3CGA A;  1BLQ A;  1E8A A;  2K7C A;  1YX8 A;  2R2I A;  1SKT A;  4GGF C;  2KFF A;  1S36 A;  1EG4 A;  2M7L A;  3KHE A;  2LLU A;  3DVK A;  2G9B A;  3TDZ A;  5I2L A;  1CNP A;  1F54 A;  4ZCV A;  4E68 A;  3LK1 A;  4CPV A;  4PDZ A;  2JC2 A;  2HET A;  5J3X A;  3OB1 B;  1JF0 A;  3CZT X;  4WRI A;  3QRX A;  4AQI A;  1KFU L;  3I5G B;  4A4B A;  1BG1 A;  4P2Y B;  2OS8 B;  4M2P A;  1KK8 B;  1Y1A A;  1KQM C;  1AK8 A;  1F70 A;  2JNF A;  1KWO B;  1Y1X A;  2B1U A;  2L4H A;  4NDB A;  1AHR A;  2F33 A;  1EXR A;  1TNQ A;  1OOJ A;  2Q4U A;  1NWD A;  1S26 D;  2K2F A;  2TN4 A;  1MXE A;  1GGZ A;  1OMR A;  3C1V A;  2JZI A;  4NDC A;  3SG5 A;  1F71 A;  2MAZ A;  5I2O A;  1B8C A;  1QVI Y;  2MLF C;  4PHJ A;  5DKQ A;  4YGC B;  3DVE A;  3MSE B;  3O6B A;  3M0W A;  3O78 A;  2RGI A;  2CXJ A;  1AJ4 A;  4I5N B;  2NZ0 A;  3JVT B;  1G33 A;  1QX7 A;  5HYD A;  2H61 A;  1SRA A;  3CR5 X;  2EHB A;  1F4Q A;  3OP0 A;  2LAN A;  2LLS A;  1UWO A;  2L51 A;  4MEW A;  1KSM A;  1REC A;  3EK4 A;  2WC8 A;  3A4U B;  2KI4 C;  3KPX A;  3SJS A;  1UHJ A;  3OB2 B;  1YUS A;  1RJV A;  1SK6 D;  4XYN A;  2JOJ A;  1LIN A;  1BR1 B;  1EG3 A;  2FCD A;  1NPQ A;  3SG3 A;  1TN4 A;  1UHN A;  4IL1 A;  3D0Y A;  1DJW A;  2E6W A;  2ZN9 A;  2BBM A;  1AVS A;  2CNP A;  4MLW A;  1UUS A;  1YUU A;  4OCI A;  3KO0 A;  4QJ5 B;  1BU3 A;  2OTG B;  2WCF A;  2Y4Q A;  2EC6 B;  2JXL A;  1B1G A;  1TNX A;  2DOQ A;  4PHN A;  2LLT A;  2KDH A;  1IJ5 A;  1V1G A;  3GK2 A;  2BCA A;  1RK9 A;  3BUN B;  4YGD B;  1JSA A;  1YRT B;  3DVM A;  2L2E A;  5PAL A;  1K9P A;  2JQ6 A;  3GOF A;  4F0Z B;  1UP5 A;  2LHL A;  2KOT A;  1DJZ A;  1ZOT B;  2BKH B;  2LVI A;  1UHK A;  4UPG A;  2BE4 A;  2JWW A;  1SBJ A;  3D10 A;  2LUC A;  4JWQ A;  4I5L B;  3IF7 A;  4GAO A;  2M1K B;  1FI6 A;  1SNL A;  2JTT A;  2OPO A;  1K9U A;  1TIZ A;  1DF0 A;  1XFU O;  1K90 D;  1QVI Z;  3FWB A;  4USL A;  3VRP A;  5I8N A;  2I94 A;  4DRW A;  3I5I C;  1CDL A;  1CFC A;  1JBA A;  3TDI A;  3FIA A;  2CBL A;  2K61 A;  4ORA B;  1B8L A;  1Q80 A;  1WLZ A;  2H2K A;  1LA3 A;  1QTX A;  5HKY A;  3O4Y A;  1DTL A;  3LL8 B;  3TUY C;  4PE4 A;  1KSO A;  2JU0 A;  3OX5 A;  1QIV A;  2LE9 B;  2Y1M A;  1F8H A;  4R1E A;  4TNC A;  5TNC A;  2KYC A;  1A29 A;  2WND A;  1IJ6 A;  1L7Z A;  4OVN F;  5AEQ A;  5FYX A;  2QPT A;  1K94 A;  1N65 A;  1RFJ A;  1H4B A;  1HQV A;  5JOL A;  2KAX A;  5HKZ A;  1DJI A;  4XJK A;  1W7J B;  3ZWH A;  1B7T Y;  4YRU A;  2LCP A;  1QAT A;  1SL8 A;  1LXF C;  2I2R E;  2Q91 A;  1G4Y R;  4GGF A;  5CPV A;  1DF0 B;  2L50 A;  4MZL A;  1K93 D;  2F8P A;  1A03 A;  1IKU A;  1XFW O;  3ICB A;  1R2U A;  1NCY A;  4M2Q A;  2K8M B;  1XK4 C;  3CWG A;  1A2X A;  3EVR A;  1N0Y A;  4CFQ A;  3GK1 A;  4N1G A;  1K9K A;  1WY9 A;  2M29 A;  1XO5 A;  2KNE A;  4FQO A;  1TNP A;  1M63 B;  2HF5 A;  1QV0 A;  2O5G A;  1J1E A;  1QXP A;  5CSJ A;  1BOC A;  2ISD A;  1OMV A;  1V1F A;  2PAL A;  3PFV A;  1JFK A;  1BF5 A;  1FI5 A;  1PK0 D;  2KFG A;  3PN7 C;  1C7V A;  2AMI A;  2KBM A;  2BE6 A;  5B8I B;  1CLB A;  1J55 A;  5BPJ A;  3PLF B;  2JPT A;  4I5J A;  1K8U A;  2NCP A;  4XJK B;  3TS5 C;  2JT8 A;  1YR5 A;  3FWC A;  3DF0 B;  3SG2 A;  2SAS A;  1CB1 A;  2E30 A;  2JT0 A;  3ZNI A;  1B9A A;  2PAS A;  1KFU S;  3BUO B;  2NXQ A;  5JJG A;  3EKJ A;  1J7P A;  2KAY A;  4HSZ A;  3AKA A;  3BUW B;  3HCM A;  3BUM B;  2KI6 D;  3WXA A;  2BCX A;  3K21 A;  3VRQ A;  1KQM B;  1IH0 A;  1YVH A;  1B7T Z;  1BMO A;  4WQ3 A;  3TZ1 A;  2LHI A;  1NYA A;  1R6P A;  2F3Z A;  2O60 A;  4MZK A;  1M31 A;  1EL4 A;  1A4P A;  5CSN A;  5AFP A;  3A8R A;  1VRK A;  2HPS A;  3WNX B;  2PVB A;  3SG4 A;  2LVJ A;  1MQ1 A;  2V53 A;  2CCM A;  4AQJ A;  2JRF A;  1QV1 A;  3EVU A;  2P6B B;  2SCP A;  1CFP A;  1W7I B;  1KFX L;  2CTN A;  1IQ5 A;  2BL0 C;  2PSR A;  1L2O C;  1C07 A;  3BXK A;  4MBE A;  3VRN A;  1J7O A;  4BY4 A;  3LCP C;  1BR4 B;  1SCM C;  1UHI A;  3NSL A;  1MXL C;  1DT7 B;  4JPZ B;  2EGD A;  2H61 C;  3JTD C;  2JXC A;  2K7B A;  4ORB B;  2KI4 B;  1AP4 A;  1B47 A;  1GQM A;  2AUC A;  2GGZ A;  3PAT A;  3BYA A;  1CDP A;  1KCY A;  1QLS A;  2MJW B;  2MLE C;  1KQV A;  4ETO A;  4PE1 A;  4QJ3 B;  2WCE A;  1SCV A;  1M39 A;  1ODB A;  5HKW A;  3NXA A;  2FOT A;  3DD4 A;  3PM8 A;  5D69 A;  1L2O B;  1QLK A;  2KSP A;  4L9M A;  1OMD A;  1EJ3 A;  1S6I A;  4N1F A;  1F4O A;  1WRK A;  5F6T A;  1FBV A;  4GBA A;  2L5X B;  5CSI A;  3CTN A;  4PHM A;  1J1D A;  2ZRS A;  3JTD B;  2LC5 A;  1CM4 A;  1DGU A;  3SG7 A;  1SR6 C;  2KQ6 A;  2LAP A;  4MRY A;  4PHK A;  1FF1 A;  1PVB A;  1S6J A;  1H8B A;  3AAK A;  3IQQ A;  4FTG A;  5KTY A;  1B8R A;  4NDD A;  4YI9 A;  2GV5 A;  1WLM A;  2GGM A;  1OE9 B;  1CFD A;  2M8U A;  2LM5 A;  2HQW A;  3I5H C;  1DJG A;  1YTZ C;  3NSK A;  3EVV A;  2K7D A;  2BKI B;  2HQ8 A;  3I5I B;  3KF9 A;  4CID A;  1XFV O;  3EK7 A;  3OHM B;  1CMF A;  1WDC C;  2BEC A;  1G8I A;  4D1E A;  1BT6 A;  4ORC B;  4YGB B;  1XK4 A;  2NCO A;  3DF0 A;  3GK4 X;  3TUY B;  5G08 A;  1OQP A;  4U8D A;  1CFF A;  1QJT A;  3F45 A;  5D7F A;  1IQ3 A;  1HT9 A;  1QIW A;  1QX5 B;  1S6C A;  1M45 A;  2JT3 A;  4YI8 A;  1SYM A;  1N2D A;  1A75 A;  4MVF A;  2LMV A;  1YUT A;  1BJF A;  4OKH A;  2VRG A;  2KQY A;  1SL7 A;  1NX1 A;  1XVJ A;  4PE7 A;  1FW4 A;  1B4C A;  2BCB A;  4GUK A;  1XYD A;  1K96 A;  1U5I B;  1S3P A;  2PMY A;  3CLN A;  3I5G C;  3WHT B;  2OS8 C;  2QAC A;  3CR2 A;  1RTP 1;  1S1E A;  4AOM A;  5AER A;  4QJ4 B;  1KK8 C;  1K2H A;  4C0L A;  3HX4 A;  2MHH A;  3RLZ A;  1KWO C;  4DUQ A;  1BOD A;  4CFR A;  4M2O A;  1WRZ A;  5HLV A;  4ZCU A;  4OR9 B;  3SIA A;  1CKK A;  2LNK A;  1IG5 A;  2L4I A;  3SIB A;  4YGA A;  2LVK A;  1XFZ O;  2MRD A;  3KEV A;  2M1U A;  4PAL A;  2K7O A;  2ZKM X;  1LVC D;  3H4S E;  1QS7 A;  1UUR A;  3E3R A;  2JTZ A;  1CMG A;  1PRW A;  1RWY A;  1IRJ A;  1S5G Y;  4DS7 A;  3O2P A;  1NX0 A;  2LP2 A;  3BOW A;  4GNK B;  5AAN A;  2M0R A;  1IWQ A;  1A75 B;  1WRL A;  3AKB A;  3PN7 B;  5GQQ C;  3JVT C;  1IGV A;  3DVJ A;  2K0J A;  1OZS A;  1Y6W A;  1MHO A;  3RM1 A;  3TS5 B;  2F3Y A;  5ER4 X;  3EK8 A;  1J7R A;  5ER5 A;  1J7Q A;  4GFT A;  3EKH A;  3IQO A;  1DVI A;  1PUL A;  2ZRT A;  2K2A A;  2LMT A;  1JUO A;  2BBN A;  2COL B;  3NSI A;  3TDU A;  2KFH A;  1XA5 A;  2M3W A;  1OSA A;  2I7A A;  1XFY O;  2ZND A;  4YGE B;  1MWN A;  1TRF A;  3VGO A;  1QAS A;  5K89 A;  1CTR A;  2ZNE A;  2KAV A;  2JNX A;  3AAJ A;  2M7N A;  4Q04 A;  1CDN A;  1GJY A;  1NCZ A;  1SPY A;  4HRE E;  1JF2 A;  4YBH B;  1TCO B;  2KBI A;  2OTG C;  2IS9 A;  4HRG A;  4ICB A;  1OZO A;  1ALW A;  2EC6 C;  1K95 A;  2F2P A;  1NCX A;  1NX3 A;  4DCK A;  5HLO A;  3BUX B;  3BOW B;  1PVA A;  1MF8 B;  2FJU B;  1NSH A;  4HRH A;  3WHU B;  1PSB A;  1EH2 A;  1NX2 A;  1QX2 A;  2LVV A;  4N5X A;  1CLM A;  4GPL B;  4PE0 A;  3VRO A;  1ZAC A;  1KFX S;  1LA0 A;  1PSR A;  2Y5I A;  2M97 A;  3I5F C;  1KK7 Y;  1ZMZ A;  2KYF A;  3LK0 A;  1DGV A;  5DKR A;  4JQ0 D;  1NIW A;  2BL0 B;  1ZUZ A;  5KU1 A;  1M46 A;  1S5G Z;  2NLN A;  3NSO A;  1CM1 A;  1C7W A;  4DIR A;  2G2B A;  3LLE A;  5IBW A;  2LP3 A;  3CS1 A;  3SG6 A;  1JFJ A;  1SCM B;  1Y0V H;  1CLL A;  1NP8 A;  3PSR A;  2KGB C;  1DMO A;  2I18 A;  1Y1U A;  2LV7 A;  1F55 A;  1FPW A;  1AUI B;  2A4J A;  2LMU A;  2L0P A;  5AXI A;  1TTX A;  3OX6 A;  1TOP A;  1TCF A;  2KI6 C;  1U5I A;  3BQ3 A;  3I5F B;  4MRX A;  1DJH A;  1PAL A;  1ZFS A;  2D8N A;  4WQ2 A;  5KSZ A;  1SY9 A;  2LUX A;  2FCE A;  2WCB A;  4NQG A;  1JWD A;  1YUR A;  5I2Q A;  4C0K A;  2MA2 A;  2PRU A;  3D0Y B;  5CSF A;  1MUX A;  1YVL A;  2CT9 A;  3PAL A;  4PCW A;  4OV2 A;  3VRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...