2HQWA

Crystal structure of ca2+/calmodulin bound to nmda receptor nr1c1 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
138
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title The NMDA Receptor NR1 C1 Region Bound to Calmodulin: Structural Insights into Functional Differences between Homologous Domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 47
structure length 138
sequence length 144
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hqwA00
2FCEA 1OMVA 1K9UA 2M7NA 1U5IB 2JWWA 1CNPA 1D1OA 2CCMA 1UUSA 2KFHA 1RWYA 2MJWB 3CR2A 2SASA 4PHJA 4UPGA 1QASA 1Y1XA 1YR5A 4M2QA 1K2HA 1K9PA 1MXLC 1FPWA 1YRTB 2CT9A 2HPSA 3GK2A 1SCVA 3JVTC 2BCAA 2MLFC 4PE0A 3BUNB 4F0ZB 1N65A 5HKWA 1AJ4A 1DJGA 3EVRA 1XFUO 1CTRA 3TZ1A 4MBEA 1QX5B 1EG3A 5DKQA 1YX7A 2LM5A 1S6CA 1Q80A 3NSKA 4YGDB 1TCOB 2KYFA 2JT3A 4DIRA 1IQ3A 1BR4B 1BT6A 1CFFA 1AHRA 2M0RA 4GPLB 1A2XA 1RFJA 3AAJA 2KAXA 2KFFA 3IQOA 1BU3A 1NSHA 1MR8A 2K7OA 2L51A 3O78A 4CFQA 2CNPA 2Y5IA 2EC6C 2HETA 1R2UA 1EH2A 1KK7Z 1S6IA 4DS7A 3M0WA 5ER4X 5AANA 3BUOB 4QJ4B 3SG2A 4JPZB 2LLSA 4QJ5B 3RM1A 3CS1A 3TS5B 1J1DA 1ZUZA 4GNKB 2SCPA 3GOFA 1KFUS 1G8IA 1UWOA 3WHUB 1CMGA 2LP2A 3TS5C 5AXIA 1FI5A 3O6BA 3TDIA 2M1KB 2BKHB 2F2PA 2L4IA 3PALA 1IWQA 4AOMA 3O4YA 4USLA 1YTZC 2MA2A 3PFVA 1YUUA 1KK8B 1TNXA 1N0YA 2VRGA 5AFPA 2WOSA 1S6JA 3VRQA 1K90D 1KK8C 2G9BA 1DJXA 1B7TY 4JWQA 5KSZA 1N2DA 2KBMA 3TDZA 2BBNA 1OZOA 1B9AA 1MUXA 3NSLA 5TNCA 1SMGA 2L98A 4PHNA 1J55A 2JU0A 1FF1A 2PASA 1JBAA 2M97A 2Q91A 1GJYA 1BG1A 1AUIB 1XFVO 3BYAA 4NDDA 3LL8B 4PHMA 1WRLA 2P6BB 2LMTA 1B4CA 2GGMA 5F6TA 1RTP1 1A75B 3EK7A 1BR1B 5CSIA 1JC2A 1LA0A 3A4UB 3OB2B 2JC2A 5JJGA 2HQ8A 1UHIA 1QTXA 3ZNIA 5J3XA 3EK8A 3D10A 2ZKMX 5DKRA 1SL9A 1EXRA 1C7WA 1OZSA 2FJUB 3KEVA 1F54A 2M1UA 1ODBA 1WLMA 1YVLA 1S26D 1NPQA 2COLB 3I5HB 5HLVA 3SJSA 2G2BA 1CFPA 1BLQA 1SCMB 1E8AA 2QACA 2DOQA 1QLSA 2BECA 1SCMC 1TNQA 1M31A 1QS7A 3FWCA 3PN7C 3SG3A 5KTYA 1J7QA 4QJ3B 2KSPA 2L5XB 2K7DA 1QLKA 1R6PA 1W7IB 3BOWA 3RLZA 1OQPA 1Y0VH 2KOTA 3EKHA 2ISDA 1B8CA 1HT9A 1SNLA 1GQMA 1XVJA 1KCYA 2LV7A 4MRXA 4PDZA 1X02A 5GQQC 1VRKA 1DF0A 4A4BA 1QV0A 1XA5A 1DMOA 1C7VA 1TN4A 1M45A 1WRZA 2E30A 2TN4A 3CZTX 2PRUA 4XJKA 1S36A 4MZJA 3K21A 4YRUA 2LMUA 1BJFA 3DVJA 2M8UA 2WNDA 3TUYB 4MVFA 1QIVA 1OE9B 1JFKA 3OP0A 5JOLA 1UP5A 1FI6A 3VRRA 2ZRSA 1V1GA 3EVUA 2MAZA 4R1EA 3F45A 3GK4X 3NSOA 1M46A 3O2PA 3I5IB 1SL8A 2LNKA 2LVJA 1NWDA 4CIDA 1BOCA 1LA3A 4ZCUA 3D0YB 1SK6D 2Q4UA 3I5IC 3TDUA 2JPTA 3OX5A 4WQ3A 1KWOB 1ZOTB 2JULA 3LCPC 4NDBA 4OKHA 2M49B 4L9MA 1Y6WA 2F33A 4HRGA 4GGNA 1TTXA 3FWBA 3SG4A 4YGBB 1DJIA 2WCFA 1IKUA 1CLMA 2KHNA 2F8PA 3OX6A 1TIZA 1MF8B 1QX7A 3SG6A 2ZNDA 2LCPA 1JF2A 2CTNA 1TCFA 3NSIA 1ALWA 4HRHA 1IH0A 1J7PA 5HYDA 4FTGA 1S5GY 1SKTA 3EK4A 1JUOA 2R2IA 2JTTA 1CM1A 2NCOA 5HLOA 2NXQA 5KU1A 1F71A 3FS7A 4IL1A 1DJHA 1PSRA 4JQ0D 2NLNA 5CSNA 3BQ3A 2LE9B 2LUXA 1TRFA 1WDCB 3CLNA 1BMOA 1YUTA 4GFTA 1WDCC 1F8HA 5CPVA 2LLTA 2K7CA 1XK4C 1PSBA 4DUQA 2JXLA 2LVKA 1SL7A 1SYMA 4PCWA 1JWDA 1QIWA 1FBVA 4NQGA 1AVSA 1XFXO 4ICBA 1YX8A 3SG7A 5CSJA 3LK1A 3A8RA 2KQ6A 3I5FB 3NXAA 1NCXA 1AP4A 2H61A 4PE1A 2LHIA 1DJZA 2B1UA 2OPOA 3H4SE 4OR9B 2LANA 2GGZA 1W7JB 4GUKA 1DVIA 2PVBA 3AKBA 2LC5A 2KDHA 1XYDA 3QRXA 3ICBA 4N1GA 4I5JA 2LUCA 3BUXB 1IRJA 1WLZA 5G08A 2KAYA 5HKZA 2ZN9A 1LKJA 5I2QA 3VRPA 1B8RA 2JZIA 1YUSA 2H2KA 1TOPA 1V1FA 2HQWA 3ZWHA 1YRUB 1B1GA 2L50A 3EKJA 1BODA 5HKYA 1CDNA 3DF0A 1GGWA 1A03A 1H4BA 1JF0A 2F3YA 1Y1AA 1AK8A 1CLBA 2CBLA 2WC8A 1OOJA 4ORAB 1WY9A 3I5HC 2K0JA 1F55A 1YURA 2K8MB 1NX0A 1PVBA 1U5IA 4YGEB 1CFDA 1XFWO 2FCDA 1DTLA 2JT0A 3DVKA 5K89A 4MZLA 2LP3A 4AQJA 2KI6D 1IGVA 1IJ6A 2I7AA 1NX1A 2LAPA 1KK7Y 1KQMB 1NP8A 1UHHA 2KFGA 1FW4A 2ZNEA 3GK1A 3VGOA 2OTGB 2PMYA 4DRWA 2JQ6A 2ZFDA 1PALA 2MHHA 3BXKA 1QV1A 1K95A 1QJTA 2OS8B 5AERA 1QVIY 2F2OA 2ZRTA 1J1EA 4C0JA 2AMIA 1XFYO 2OS8C 1NIWA 1L7ZA 1NX3A 2BE6A 1J7OA 2M9GA 2M3WA 2RGIA 4M2PA 3WXAA 2K2FA 1OMRA 4C0LA 1L2OB 1NCZA 2KBIA 2WCBA 4MSPA 5DKNA 4E68A 2EGDA 3TUYC 2K7BA 1L2OC 4MZKA 2M7LA 1ZFSA 3BUWB 2MBXA 4PE7A 2GV5A 4PHKA 1S3PA 4D1EA 3DD4A 2E6WA 3CWGA 3SIBA 1B7TZ 2BCBA 2JRFA 1ZMZA 1SRAA 1YVHA 2KQYA 5PALA 4N1FA 1QATA 3SIAA 2LMVA 1MXEA 2EHBA 2K61A 1B8LA 2BKIB 2I94A 1TNWA 4NDCA 1KWOC 1WRKA 1PRWA 1QX2A 4N5XA 4OV2A 3VROA 2KNEA 3LLEA 1NX2A 1J7RA 4BY4A 3SG5A 4ETOA 3DVMA 2MRDA 2FOTA 4ZCVA 3LK0A 2A4JA 3JVTB 2KGRA 1LXFC 3CTNA 2AUCA 2MLEC 2V53A 3BOWB 2LHLA 1RROA 3I5GB 5IBWA 4GGFC 4ORBB 3DVEA 1KFXL 2LVIA 1MHOA 3I5GC 5AEQA 3KPXA 2CXJA 2L4HA 1EL4A 1MWNA 1NCYA 1DF0B 2JTZA 4PE4A 5I2OA 3HX4A 4P2YB 4BY5A 3CR5X 2I18A 3OHMB 4OCIA 1OSAA 4FQOA 5ER5A 1BF5A 1K93D 5I2LA 5BPJA 1KFXS 4CLNA 1A75A 4XJKB 1LINA 1CMFA 1TNPA 2KI6C 1NYAA 1K8UA 2LVVA 1QXPA 4YGAA 3WHTB 1CKKA 1CDMA 1XFZO 4HSZA 3AKAA 2EC6B 4TNCA 1KQVA 5B8IB 1G4YR 1KFUL 4AQIA 1CB1A 5CSFA 1KSOA 4ORCB 2HF5A 3VRNA 2WCEA 2Y1NA 4YI8A 2IS9A 3OB1B 1JSAA 3CGAA 4A4CA 3IQQA 2O5GA 5D69A 3PSRA 1A4PA 2BL0B 1EG4A 1B47A 1DT7B 2O60A 1QVIZ 3I5FC 2BL0C 2NZ0A 1F4QA 1SR6B 1CFCA 2Y4QA 2L0PA 4WRIA 2LLUA 1SR6C 3HCMA 5D7FA 1UURA 4CFRA 2KYCA 1A29A 1DGVA 1LVCD 1PULA 3KO0A 1GGZA 1CM4A 3WNXB 1EJ3A 3JTDB 1IQ5A 1PK0D 4U8DA 3JTDC 4PALA 2AAOA 4MEWA 1SW8A 4XYNA 4YBHB 4GBAA 1ZACA 4YGCB 4MLWA 1JFJA 2KI4B 2JNXA 1MQ1A 2I2RE 2KAVA 1M63B 4WQ2A 4HREE 4P5OE 2KI4C 1DJWA 1SPYA 3MSEB 1RJVA 2QPTA 1Y1UA 4MN0A 4MRYA 2BE4A 4I5NB 1CLLA 2JOJA 2M29A 1SBJA 1CDPA 3D0YA 3KHEA 4Q04A 1RECA 3E3RA 3FIAA 3IF7A 1UHNA 2JXCA 1RK9A 1DGUA 1S1EA 4I5LB 1OMDA 1KQMC 2NCPA 1S5GZ 1M39A 2OTGC 2Y1MA 1KSMA 2F3ZA 4CPVA 1G33A 3PN7B 4I5KA 1PVAA 2BBMA 4YI9A 3EVVA 5I8NA 3KF9A 2JNFA 1IG5A 4GGFA 2PSRA 2H61C 1AJ5A 4C0KA 1IJ5A 2JT8A 1SY9A 1F70A 1K96A 1K9KA 2L2EA 3C1VA 1UHJA 1XO5A 3BUMB 1C07A 2KGBC 1DJYA 1NUBA 3PM8A 4OVNF 1H8BA 1HQVA 1F4OA 2D8NA 2WORA 1ALVA 3PATA 1UHKA 2K2AA 1CDLA 3AAKA 2ZN8A 4M2OA 5FYXA 3DF0B 4DCKA 3CR4X 4GAOA 1K94A 3PLFB 2PALA 1XK4A 2BCXA
chains in the Genus database with same CATH superfamily
2FCEA 1OMVA 1K9UA 2M7NA 1U5IB 2JWWA 1CNPA 3SS3A 2CCMA 1D1OA 1UUSA 2KFHA 1RWYA 2MJWB 3CR2A 2SASA 1DEKA 4PHJA 4UPGA 1QASA 1Y1XA 1YR5A 4M2QA 1K2HA 1K9PA 1MXLC 1FPWA 1YRTB 2CT9A 2HPSA 3GK2A 1SCVA 3JVTC 2BCAA 2MLFC 4PE0A 3BUNB 1OOGA 5DICA 4F0ZB 1N65A 5HKWA 1AJ4A 1DJGA 3B6XA 3EVRA 1XFUO 1CTRA 1TUJA 3PLFB 3TZ1A 2L5YA 1QX5B 4MBEA 1EG3A 5DKQA 1YX7A 2KLEA 2LM5A 1S6CA 3S0EA 1Q80A 3NSKA 3CZ1A 4YGDB 1TCOB 1Z2CB 4JD9A 2KYFA 3BFAA 2JT3A 4DIRA 1IQ3A 1BR4B 1BT6A 1CFFA 1AHRA 2M0RA 4GPLB 1A2XA 1RFJA 3AAJA 2KAXA 2KFFA 3R1PA 3IQOA 1BU3A 1NSHA 1MR8A 2K7OA 2L51A 3O78A 4CFQA 2CNPA 2Y5IA 2EC6C 2HETA 2QDIA 3CZ2A 1R2UA 1EH2A 1KK7Z 1S6IA 4DS7A 3M0WA 5ER4X 5AANA 3BUOB 4QJ4B 3SG2A 4JPZB 2LLSA 4QJ5B 3RM1A 3CS1A 3TS5B 1J1DA 1ZUZA 4GNKB 2SCPA 3GOFA 1KFUS 1G8IA 1UWOA 3L47A 3WHUB 1CMGA 2LP2A 3TS5C 5AXIA 1FI5A 3O6BA 3TDIA 2M1KB 2BKHB 2F2PA 2L4IA 3PALA 1IWQA 4AOMA 3O4YA 4USLA 3NGVA 1YTZC 2MA2A 3PFVA 1P28A 1YUUA 1KK8B 1TNXA 1N0YA 2VRGA 5AFPA 2WOSA 1S6JA 3VRQA 5HL1A 1K90D 1KK8C 2G9BA 1DJXA 2QEBA 1B7TY 4JWQA 5KSZA 1N2DA 2KBMA 3IVTA 2BBNA 3PM2A 3TDZA 1OZOA 1B9AA 3S0DA 1MUXA 3NSLA 3BJHA 1SMGA 5TNCA 2L98A 4PHNA 1J55A 2JU0A 1FF1A 2PASA 1JBAA 2M97A 2Q91A 1GJYA 1BG1A 1AUIB 1XFVO 3BYAA 4NDDA 3LL8B 4PHMA 1WRLA 2P6BB 2LMTA 1B4CA 2GGMA 5F6TA 1RTP1 1A75B 3EK7A 3R1OA 1BR1B 5CSIA 1JC2A 1LA0A 3A4UB 3OB2B 2JC2A 5JJGA 2HQ8A 1UHIA 1QTXA 3ZNIA 5J3XA 3EK8A 3D10A 2ZKMX 5DKRA 1SL9A 1EXRA 1C7WA 1OZSA 2FJUB 3KEVA 1F54A 3DZTA 2M1UA 1ODBA 1WLMA 1YVLA 1S26D 1NPQA 2COLB 3I5HB 5HLVA 3SJSA 2G2BA 1CFPA 1BLQA 1SCMB 1E8AA 2QACA 2DOQA 1QLSA 2BECA 1SCMC 1TNQA 1M31A 1QS7A 3CABA 3FWCA 3PN7C 3SG3A 5KTYA 1J7QA 4QJ3B 2KSPA 2L5XB 3Q8IA 2K7DA 1QLKA 3R72A 1R6PA 1W7IB 3BOWA 3RLZA 2KLDA 2P71A 1OQPA 1Y0VH 2KOTA 3CYZA 3EKHA 1B8CA 1HT9A 1SNLA 5FI2A 2ISDA 1IIOA 1GQMA 1XVJA 2QEVA 1KCYA 2LV7A 4MRXA 1OOHA 4PDZA 1X02A 5GQQC 1VRKA 1DF0A 4A4BA 1QV0A 1XA5A 1DMOA 4JKTA 1C7VA 1TN4A 1M45A 1WRZA 2E30A 2JPOA 2TN4A 1TWOA 3CZTX 5D3OA 2PRUA 1XFRA 4XJKA 1DQEA 1S36A 4MZJA 2P70A 3K21A 4YRUA 2LMUA 1BJFA 3DVJA 2M8UA 2WNDA 3TUYB 4MVFA 1QIVA 1OE9B 1JFKA 3OP0A 5JOLA 3D77A 1UP5A 1FI6A 3QMEA 3VRRA 3D73A 2ZRSA 1V1GA 3EVUA 3L4AA 2MAZA 4R1EA 3F45A 3GK4X 1OW4A 3NSOA 1M46A 3O2PA 3I5IB 1SL8A 2LNKA 2LVJA 1NWDA 4CIDA 1BOCA 1LA3A 4ZCUA 3D0YB 1SK6D 2Q4UA 3I5IC 3TDUA 2JPTA 3OX5A 4WQ3A 1KWOB 1ZOTB 2JULA 3LCPC 4NDBA 4OKHA 1SSEB 2M49B 4L9MA 1Y6WA 2F33A 4HRGA 4GGNA 1TTXA 3FWBA 3SG4A 4YGBB 1DJIA 2WCFA 1IKUA 1CLMA 2KHNA 2F8PA 3OX6A 3D74A 3SS4A 1TIZA 1MF8B 1QX7A 3SG6A 2ZNDA 2LCPA 1JF2A 2CTNA 1TCFA 3NSIA 1ALWA 4HRHA 1IH0A 1Z4HA 1J7PA 5HYDA 4FTGA 1S5GY 1SKTA 3EK4A 1JUOA 2R2IA 2JTTA 1CM1A 2NCOA 5HLOA 2BAPA 2NXQA 5KU1A 1F71A 3FS7A 3DY9A 4IL1A 1DJHA 1PSRA 4JQ0D 2NLNA 5CSNA 3BQ3A 3EG5B 2LE9B 2LUXA 1TRFA 1WDCB 3CLNA 3DYEA 1BMOA 1YUTA 2PQLA 1WDCC 4GFTA 1F8HA 5CPVA 1QWVA 2LLTA 2K7CA 1XK4C 1PSBA 4DUQA 2JXLA 2LVKA 2KPHA 3S0AA 1SL7A 1SYMA 4PCWA 1JWDA 1QIWA 4INXA 1FBVA 4NQGA 2WCKA 1AVSA 1XFXO 4ICBA 1YX8A 3SG7A 5CSJA 3LK1A 3A8RA 2KQ6A 3I5FB 3NXAA 1NCXA 1AP4A 2H61A 4PE1A 2LHIA 4IJ7A 1DJZA 2B1UA 2OPOA 3H4SE 4OR9B 2LANA 3B86A 2GGZA 1W7JB 4GUKA 1DVIA 2PVBA 3AKBA 2LC5A 2KDHA 3B87A 4F7FA 1XYDA 3QRXA 3ICBA 4N1GA 4I5JA 2LUCA 3BUXB 1IRJA 1WLZA 5G08A 2KAYA 3CDNA 5HKZA 2ZN9A 1LKJA 5I2QA 3VRPA 1B8RA 2JZIA 1YUSA 2H2KA 1TOPA 1V1FA 4PT1A 2HQWA 3ZWHA 1YRUB 2PYQA 2ERBA 2L50A 3EKJA 2WCMA 1B1GA 1BODA 5HKYA 1CDNA 3DF0A 1GGWA 1A03A 1H4BA 1JF0A 2F3YA 1Y1AA 1AK8A 1CLBA 2CBLA 2WC8A 1OOJA 4ORAB 1WY9A 1LS8A 2K0JA 3I5HC 1F55A 1YURA 2K8MB 1NX0A 1PVBA 1U5IA 4YGEB 1CFDA 1XFWO 2FCDA 1DTLA 2JT0A 3N7HA 3DVKA 5K89A 4MZLA 2LP3A 4AQJA 2KI6D 1IGVA 1IJ6A 3B7AA 2I7AA 1NX1A 2LAPA 1KK7Y 1KQMB 1NP8A 1UHHA 2KFGA 1FW4A 2ZNEA 3GK1A 3OBVA 3VGOA 2OTGB 5I2OA 2PMYA 4DRWA 1DC1A 2JQ6A 2ZFDA 1PALA 2MHHA 3BXKA 1QV1A 1K95A 1QJTA 2OS8B 3V2LA 5AERA 1QVIY 2F2OA 2ZRTA 3B88A 1J1EA 4C0JA 2AMIA 1XFYO 2OS8C 1NIWA 1L7ZA 1NX3A 2BE6A 1J7OA 2M9GA 2M3WA 2RGIA 4M2PA 3WXAA 2K2FA 1OMRA 4C0LA 1L2OB 1NCZA 2KBIA 2WCBA 4MSPA 5DKNA 4E68A 2EGDA 3TUYC 2K7BA 1L2OC 2H8VA 4MZKA 5FI6A 2M7LA 1ZFSA 3BUWB 2MBXA 4PE7A 2GV5A 4PHKA 1S3PA 4D1EA 3DD4A 2E6WA 3CWGA 3SIBA 1B7TZ 2BCBA 1T14A 2JRFA 1ZMZA 1SRAA 1YVHA 2KQYA 3UO9A 3FE8A 5PALA 4N1FA 1QATA 1C3ZA 2WCJA 3SIAA 2LMVA 1MXEA 2EHBA 2K61A 1B8LA 2BKIB 2I94A 1TNWA 4NDCA 1KWOC 1WRKA 3NHTA 1PRWA 1QX2A 4N5XA 4OV2A 3VROA 1C3YA 2KNEA 3LLEA 1NX2A 1J7RA 4BY4A 4FQTA 3SG5A 3D78A 4ETOA 3DVMA 2MRDA 3K1EA 2FOTA 3FE9A 4ZCVA 1OOIX 3LK0A 2A4JA 3JVTB 2KGRA 1LXFC 3CTNA 2AUCA 2MLEC 2V53A 3BOWB 2LHLA 1RROA 3I5GB 2FJYA 5IBWA 4GGFC 3R1VA 4ORBB 3DVEA 1KFXL 2LVIA 1MHOA 3I5GC 5AEQA 3SS5A 3KPXA 2CXJA 2L4HA 5I94A 1EL4A 1MWNA 1NCYA 1DF0B 2JTZA 2L2CA 3BFHA 3CZ0A 3HX4A 3NHIA 4P2YB 4PE4A 5EL2A 4BY5A 3CR5X 2I18A 3OHMB 4OCIA 1OSAA 4FQOA 5ER5A 1BF5A 1K93D 5I2LA 5BPJA 1KFXS 4CLNA 1A75A 4XJKB 2BNXA 1LINA 1CMFA 1TNPA 2KI6C 1NYAA 1K8UA 2LVVA 1QXPA 4YGAA 3WHTB 1CKKA 1CDMA 1XFZO 4HSZA 3AKAA 2EC6B 2WCHA 4TNCA 1KQVA 5B8IB 1G4YR 1KFUL 4AQIA 1CB1A 5CSFA 1KSOA 4ORCB 2HF5A 3VRNA 2WCEA 2Y1NA 4YI8A 1GM0A 2IS9A 3OB1B 1JSAA 3CGAA 4A4CA 3IQQA 2O5GA 5D69A 3PSRA 1A4PA 2BL0B 1EG4A 1B47A 3VB1A 1DT7B 2O60A 1QVIZ 3I5FC 2BL0C 3D76A 2NZ0A 1F4QA 1SR6B 2YGUA 1CFCA 2Y4QA 2L0PA 4WRIA 4INWA 2LLUA 1SR6C 3HCMA 2WC6A 1UURA 5D7FA 4CFRA 1ORGA 2KYCA 3D75A 1A29A 1DGVA 1LVCD 1PULA 3KO0A 1GGZA 1CM4A 3S0FA 3WNXB 1EJ3A 3JTDB 1DELA 1IQ5A 1PK0D 2WC5A 4U8DA 3JTDC 4PALA 2AAOA 4MEWA 1SW8A 4XYNA 4YBHB 4GBAA 1ZACA 2K60A 4YGCB 3FE6A 4MLWA 1JFJA 3UNWA 3S0BA 2KI4B 2JNXA 1MQ1A 2I2RE 2KAVA 1M63B 4WQ2A 4HREE 4P5OE 2QEHA 2KI4C 1DJWA 1SPYA 3MSEB 1RJVA 2QPTA 1Y1UA 4KYNA 4MN0A 4MRYA 2BE4A 4I5NB 1CLLA 3L4LA 2JOJA 2M29A 1SBJA 1CDPA 3D0YA 3KHEA 4Q04A 1RECA 3E3RA 3FIAA 2QEOA 3IF7A 1UHNA 3DXLA 2JXCA 1RK9A 1DGUA 3S0GA 1S1EA 4I5LB 1OMDA 1KQMC 2NCPA 1S5GZ 1M39A 2OTGC 2Y1MA 3BFBA 1KSMA 2F3ZA 4OZDA 4CPVA 1G33A 3PN7B 5FI7A 4I5KA 1PVAA 1TUZA 2BBMA 4YI9A 3EVVA 5I8NA 3KF9A 2JNFA 1IG5A 4GGFA 2PSRA 2H61C 3PJIA 1AJ5A 4C0KA 1IJ5A 2JT8A 2GTEA 1SY9A 1F70A 1K96A 1K9KA 2L2EA 3C1VA 1UHJA 1XO5A 3BUMB 1C07A 2WCLA 2KGBC 1DJYA 1NUBA 3PM8A 4OVNF 1H8BA 3O4XA 1HQVA 1OOFA 3RZSA 1F4OA 2D8NA 2WORA 1ALVA 3PATA 1UHKA 2K2AA 1CDLA 3AAKA 2ZN8A 4M2OA 5FYXA 3DF0B 4DCKA 3CR4X 4GAOA 1K94A 1W9ZA 3OGNA 2PALA 1XK4A 2BCXA
chains in the Genus database with same CATH topology
2FCEA 1OMVA 1K9UA 2M7NA 1U5IB 2JWWA 1CNPA 1D1OA 2CCMA 1UUSA 2KFHA 1RWYA 2MJWB 3CR2A 2SASA 4PHJA 4UPGA 1QASA 1Y1XA 1YR5A 4M2QA 1K2HA 1K9PA 1MXLC 1FPWA 1YRTB 2CT9A 2HPSA 3GK2A 1SCVA 3JVTC 2BCAA 2MLFC 4PE0A 3BUNB 4F0ZB 1N65A 5HKWA 1AJ4A 1DJGA 3EVRA 1XFUO 1CTRA 3TZ1A 4MBEA 1QX5B 1EG3A 5DKQA 1YX7A 2LM5A 1S6CA 1Q80A 3NSKA 4YGDB 1TCOB 2KYFA 2JT3A 4DIRA 1IQ3A 1BR4B 1BT6A 1CFFA 1AHRA 2M0RA 4GPLB 1A2XA 1RFJA 3AAJA 2KAXA 2KFFA 3IQOA 1BU3A 1NSHA 1MR8A 2K7OA 2L51A 3O78A 4CFQA 2CNPA 2Y5IA 2EC6C 2HETA 1R2UA 1EH2A 1KK7Z 1S6IA 4DS7A 3M0WA 5ER4X 5AANA 3BUOB 4QJ4B 3SG2A 4JPZB 2LLSA 4QJ5B 3RM1A 3CS1A 3TS5B 1J1DA 1ZUZA 4GNKB 2SCPA 3GOFA 1KFUS 1G8IA 1UWOA 3WHUB 1CMGA 2LP2A 3TS5C 5AXIA 1FI5A 3O6BA 3TDIA 2M1KB 2BKHB 2F2PA 2L4IA 3PALA 1IWQA 4AOMA 3O4YA 4USLA 1YTZC 2MA2A 3PFVA 1YUUA 1KK8B 1TNXA 1N0YA 2VRGA 5AFPA 2WOSA 1S6JA 3VRQA 1K90D 1KK8C 2G9BA 1DJXA 1B7TY 4JWQA 5KSZA 1N2DA 2KBMA 3TDZA 2BBNA 1OZOA 1B9AA 1MUXA 3NSLA 5TNCA 1SMGA 2L98A 4PHNA 1J55A 2JU0A 1FF1A 2PASA 1JBAA 2M97A 2Q91A 1GJYA 1BG1A 1AUIB 1XFVO 3BYAA 4NDDA 3LL8B 4PHMA 1WRLA 2P6BB 2LMTA 1B4CA 2GGMA 5F6TA 1RTP1 1A75B 3EK7A 1BR1B 5CSIA 1JC2A 1LA0A 3A4UB 3OB2B 2JC2A 5JJGA 2HQ8A 1UHIA 1QTXA 3ZNIA 5J3XA 3EK8A 3D10A 2ZKMX 5DKRA 1SL9A 1EXRA 1C7WA 1OZSA 2FJUB 3KEVA 1F54A 2M1UA 1ODBA 1WLMA 1YVLA 1S26D 1NPQA 2COLB 3I5HB 5HLVA 3SJSA 2G2BA 1CFPA 1BLQA 1SCMB 1E8AA 2QACA 2DOQA 1QLSA 2BECA 1SCMC 1TNQA 1M31A 1QS7A 3FWCA 3PN7C 3SG3A 5KTYA 1J7QA 4QJ3B 2KSPA 2L5XB 2K7DA 1QLKA 1R6PA 1W7IB 3BOWA 3RLZA 1OQPA 1Y0VH 2KOTA 3EKHA 2ISDA 1B8CA 1HT9A 1SNLA 1GQMA 1XVJA 1KCYA 2LV7A 4MRXA 4PDZA 1X02A 5GQQC 1VRKA 1DF0A 4A4BA 1QV0A 1XA5A 1DMOA 1C7VA 1TN4A 1M45A 1WRZA 2E30A 2TN4A 3CZTX 2PRUA 4XJKA 1S36A 4MZJA 3K21A 4YRUA 2LMUA 1BJFA 3DVJA 2M8UA 2WNDA 3TUYB 4MVFA 1QIVA 1OE9B 1JFKA 3OP0A 5JOLA 1UP5A 1FI6A 3VRRA 2ZRSA 1V1GA 3EVUA 2MAZA 4R1EA 3F45A 3GK4X 3NSOA 1M46A 3O2PA 3I5IB 1SL8A 2LNKA 2LVJA 1NWDA 4CIDA 1BOCA 1LA3A 4ZCUA 3D0YB 1SK6D 2Q4UA 3I5IC 3TDUA 2JPTA 3OX5A 4WQ3A 1KWOB 1ZOTB 2JULA 3LCPC 4NDBA 4OKHA 2M49B 4L9MA 1Y6WA 2F33A 4HRGA 4GGNA 1TTXA 3FWBA 3SG4A 4YGBB 1DJIA 2WCFA 1IKUA 1CLMA 2KHNA 2F8PA 3OX6A 1TIZA 1MF8B 1QX7A 3SG6A 2ZNDA 2LCPA 1JF2A 2CTNA 1TCFA 3NSIA 1ALWA 4HRHA 1IH0A 1J7PA 5HYDA 4FTGA 1S5GY 1SKTA 3EK4A 1JUOA 2R2IA 2JTTA 1CM1A 2NCOA 5HLOA 2NXQA 5KU1A 1F71A 3FS7A 4IL1A 1DJHA 1PSRA 4JQ0D 2NLNA 5CSNA 3BQ3A 2LE9B 2LUXA 1TRFA 1WDCB 3CLNA 1BMOA 1YUTA 4GFTA 1WDCC 1F8HA 5CPVA 2LLTA 2K7CA 1XK4C 1PSBA 4DUQA 2JXLA 2LVKA 1SL7A 1SYMA 4PCWA 1JWDA 1QIWA 1FBVA 4NQGA 1AVSA 1XFXO 4ICBA 1YX8A 3SG7A 5CSJA 3LK1A 3A8RA 2KQ6A 3I5FB 3NXAA 1NCXA 1AP4A 2H61A 4PE1A 2LHIA 1DJZA 2B1UA 2OPOA 3H4SE 4OR9B 2LANA 2GGZA 1W7JB 4GUKA 1DVIA 2PVBA 3AKBA 2LC5A 2KDHA 1XYDA 3QRXA 3ICBA 4N1GA 4I5JA 2LUCA 3BUXB 1IRJA 1WLZA 5G08A 2KAYA 5HKZA 2ZN9A 1LKJA 5I2QA 3VRPA 1B8RA 2JZIA 1YUSA 2H2KA 1TOPA 1V1FA 2HQWA 3ZWHA 1YRUB 1B1GA 2L50A 3EKJA 1BODA 5HKYA 1CDNA 3DF0A 1GGWA 1A03A 1H4BA 1JF0A 2F3YA 1Y1AA 1AK8A 1CLBA 2CBLA 2WC8A 1OOJA 4ORAB 1WY9A 3I5HC 2K0JA 1F55A 1YURA 2K8MB 1NX0A 1PVBA 1U5IA 4YGEB 1CFDA 1XFWO 2FCDA 1DTLA 2JT0A 3DVKA 5K89A 4MZLA 2LP3A 4AQJA 2KI6D 1IGVA 1IJ6A 2I7AA 1NX1A 2LAPA 1KK7Y 1KQMB 1NP8A 1UHHA 2KFGA 1FW4A 2ZNEA 3GK1A 3VGOA 2OTGB 2PMYA 4DRWA 2JQ6A 2ZFDA 1PALA 2MHHA 3BXKA 1QV1A 1K95A 1QJTA 2OS8B 5AERA 1QVIY 2F2OA 2ZRTA 1J1EA 4C0JA 2AMIA 1XFYO 2OS8C 1NIWA 1L7ZA 1NX3A 2BE6A 1J7OA 2M9GA 2M3WA 2RGIA 4M2PA 3WXAA 2K2FA 1OMRA 4C0LA 1L2OB 1NCZA 2KBIA 2WCBA 4MSPA 5DKNA 4E68A 2EGDA 3TUYC 2K7BA 1L2OC 4MZKA 2M7LA 1ZFSA 3BUWB 2MBXA 4PE7A 2GV5A 4PHKA 1S3PA 4D1EA 3DD4A 2E6WA 3CWGA 3SIBA 1B7TZ 2BCBA 2JRFA 1ZMZA 1SRAA 1YVHA 2KQYA 5PALA 4N1FA 1QATA 3SIAA 2LMVA 1MXEA 2EHBA 2K61A 1B8LA 2BKIB 2I94A 1TNWA 4NDCA 1KWOC 1WRKA 1PRWA 1QX2A 4N5XA 4OV2A 3VROA 2KNEA 3LLEA 1NX2A 1J7RA 4BY4A 3SG5A 4ETOA 3DVMA 2MRDA 2FOTA 4ZCVA 3LK0A 2A4JA 3JVTB 2KGRA 1LXFC 3CTNA 2AUCA 2MLEC 2V53A 3BOWB 2LHLA 1RROA 3I5GB 5IBWA 4GGFC 4ORBB 3DVEA 1KFXL 2LVIA 1MHOA 3I5GC 5AEQA 3KPXA 2CXJA 2L4HA 1EL4A 1MWNA 1NCYA 1DF0B 2JTZA 4PE4A 5I2OA 3HX4A 4P2YB 4BY5A 3CR5X 2I18A 3OHMB 4OCIA 1OSAA 4FQOA 5ER5A 1BF5A 1K93D 5I2LA 5BPJA 1KFXS 4CLNA 1A75A 4XJKB 1LINA 1CMFA 1TNPA 2KI6C 1NYAA 1K8UA 2LVVA 1QXPA 4YGAA 3WHTB 1CKKA 1CDMA 1XFZO 4HSZA 3AKAA 2EC6B 4TNCA 1KQVA 5B8IB 1G4YR 1KFUL 4AQIA 1CB1A 5CSFA 1KSOA 4ORCB 2HF5A 3VRNA 2WCEA 2Y1NA 4YI8A 2IS9A 3OB1B 1JSAA 3CGAA 4A4CA 3IQQA 2O5GA 5D69A 3PSRA 1A4PA 2BL0B 1EG4A 1B47A 1DT7B 2O60A 1QVIZ 3I5FC 2BL0C 2NZ0A 1F4QA 1SR6B 1CFCA 2Y4QA 2L0PA 4WRIA 2LLUA 1SR6C 3HCMA 5D7FA 1UURA 4CFRA 2KYCA 1A29A 1DGVA 1LVCD 1PULA 3KO0A 1GGZA 1CM4A 3WNXB 1EJ3A 3JTDB 1IQ5A 1PK0D 4U8DA 3JTDC 4PALA 2AAOA 4MEWA 1SW8A 4XYNA 4YBHB 4GBAA 1ZACA 4YGCB 4MLWA 1JFJA 2KI4B 2JNXA 1MQ1A 2I2RE 2KAVA 1M63B 4WQ2A 4HREE 4P5OE 2KI4C 1DJWA 1SPYA 3MSEB 1RJVA 2QPTA 1Y1UA 4MN0A 4MRYA 2BE4A 4I5NB 1CLLA 2JOJA 2M29A 1SBJA 1CDPA 3D0YA 3KHEA 4Q04A 1RECA 3E3RA 3FIAA 3IF7A 1UHNA 2JXCA 1RK9A 1DGUA 1S1EA 4I5LB 1OMDA 1KQMC 2NCPA 1S5GZ 1M39A 2OTGC 2Y1MA 1KSMA 2F3ZA 4CPVA 1G33A 3PN7B 4I5KA 1PVAA 2BBMA 4YI9A 3EVVA 5I8NA 3KF9A 2JNFA 1IG5A 4GGFA 2PSRA 2H61C 1AJ5A 4C0KA 1IJ5A 2JT8A 1SY9A 1F70A 1K96A 1K9KA 2L2EA 3C1VA 1UHJA 1XO5A 3BUMB 1C07A 2KGBC 1DJYA 1NUBA 3PM8A 4OVNF 1H8BA 1HQVA 1F4OA 2D8NA 2WORA 1ALVA 3PATA 1UHKA 2K2AA 1CDLA 3AAKA 2ZN8A 4M2OA 5FYXA 3DF0B 4DCKA 3CR4X 4GAOA 1K94A 3PLFB 2PALA 1XK4A 2BCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCE A;  1OMV A;  1K9U A;  2M7N A;  1U5I B;  2JWW A;  1CNP A;  1D1O A;  2CCM A;  1UUS A;  2KFH A;  1RWY A;  2MJW B;  3CR2 A;  2SAS A;  4PHJ A;  4UPG A;  1QAS A;  1Y1X A;  1YR5 A;  4M2Q A;  1K2H A;  1K9P A;  1MXL C;  1FPW A;  1YRT B;  2CT9 A;  2HPS A;  3GK2 A;  1SCV A;  3JVT C;  2BCA A;  2MLF C;  4PE0 A;  3BUN B;  4F0Z B;  1N65 A;  5HKW A;  1AJ4 A;  1DJG A;  3EVR A;  1XFU O;  1CTR A;  3TZ1 A;  4MBE A;  1QX5 B;  1EG3 A;  5DKQ A;  1YX7 A;  2LM5 A;  1S6C A;  1Q80 A;  3NSK A;  4YGD B;  1TCO B;  2KYF A;  2JT3 A;  4DIR A;  1IQ3 A;  1BR4 B;  1BT6 A;  1CFF A;  1AHR A;  2M0R A;  4GPL B;  1A2X A;  1RFJ A;  3AAJ A;  2KAX A;  2KFF A;  3IQO A;  1BU3 A;  1NSH A;  1MR8 A;  2K7O A;  2L51 A;  3O78 A;  4CFQ A;  2CNP A;  2Y5I A;  2EC6 C;  2HET A;  1R2U A;  1EH2 A;  1KK7 Z;  1S6I A;  4DS7 A;  3M0W A;  5ER4 X;  5AAN A;  3BUO B;  4QJ4 B;  3SG2 A;  4JPZ B;  2LLS A;  4QJ5 B;  3RM1 A;  3CS1 A;  3TS5 B;  1J1D A;  1ZUZ A;  4GNK B;  2SCP A;  3GOF A;  1KFU S;  1G8I A;  1UWO A;  3WHU B;  1CMG A;  2LP2 A;  3TS5 C;  5AXI A;  1FI5 A;  3O6B A;  3TDI A;  2M1K B;  2BKH B;  2F2P A;  2L4I A;  3PAL A;  1IWQ A;  4AOM A;  3O4Y A;  4USL A;  1YTZ C;  2MA2 A;  3PFV A;  1YUU A;  1KK8 B;  1TNX A;  1N0Y A;  2VRG A;  5AFP A;  2WOS A;  1S6J A;  3VRQ A;  1K90 D;  1KK8 C;  2G9B A;  1DJX A;  1B7T Y;  4JWQ A;  5KSZ A;  1N2D A;  2KBM A;  3TDZ A;  2BBN A;  1OZO A;  1B9A A;  1MUX A;  3NSL A;  5TNC A;  1SMG A;  2L98 A;  4PHN A;  1J55 A;  2JU0 A;  1FF1 A;  2PAS A;  1JBA A;  2M97 A;  2Q91 A;  1GJY A;  1BG1 A;  1AUI B;  1XFV O;  3BYA A;  4NDD A;  3LL8 B;  4PHM A;  1WRL A;  2P6B B;  2LMT A;  1B4C A;  2GGM A;  5F6T A;  1RTP 1;  1A75 B;  3EK7 A;  1BR1 B;  5CSI A;  1JC2 A;  1LA0 A;  3A4U B;  3OB2 B;  2JC2 A;  5JJG A;  2HQ8 A;  1UHI A;  1QTX A;  3ZNI A;  5J3X A;  3EK8 A;  3D10 A;  2ZKM X;  5DKR A;  1SL9 A;  1EXR A;  1C7W A;  1OZS A;  2FJU B;  3KEV A;  1F54 A;  2M1U A;  1ODB A;  1WLM A;  1YVL A;  1S26 D;  1NPQ A;  2COL B;  3I5H B;  5HLV A;  3SJS A;  2G2B A;  1CFP A;  1BLQ A;  1SCM B;  1E8A A;  2QAC A;  2DOQ A;  1QLS A;  2BEC A;  1SCM C;  1TNQ A;  1M31 A;  1QS7 A;  3FWC A;  3PN7 C;  3SG3 A;  5KTY A;  1J7Q A;  4QJ3 B;  2KSP A;  2L5X B;  2K7D A;  1QLK A;  1R6P A;  1W7I B;  3BOW A;  3RLZ A;  1OQP A;  1Y0V H;  2KOT A;  3EKH A;  2ISD A;  1B8C A;  1HT9 A;  1SNL A;  1GQM A;  1XVJ A;  1KCY A;  2LV7 A;  4MRX A;  4PDZ A;  1X02 A;  5GQQ C;  1VRK A;  1DF0 A;  4A4B A;  1QV0 A;  1XA5 A;  1DMO A;  1C7V A;  1TN4 A;  1M45 A;  1WRZ A;  2E30 A;  2TN4 A;  3CZT X;  2PRU A;  4XJK A;  1S36 A;  4MZJ A;  3K21 A;  4YRU A;  2LMU A;  1BJF A;  3DVJ A;  2M8U A;  2WND A;  3TUY B;  4MVF A;  1QIV A;  1OE9 B;  1JFK A;  3OP0 A;  5JOL A;  1UP5 A;  1FI6 A;  3VRR A;  2ZRS A;  1V1G A;  3EVU A;  2MAZ A;  4R1E A;  3F45 A;  3GK4 X;  3NSO A;  1M46 A;  3O2P A;  3I5I B;  1SL8 A;  2LNK A;  2LVJ A;  1NWD A;  4CID A;  1BOC A;  1LA3 A;  4ZCU A;  3D0Y B;  1SK6 D;  2Q4U A;  3I5I C;  3TDU A;  2JPT A;  3OX5 A;  4WQ3 A;  1KWO B;  1ZOT B;  2JUL A;  3LCP C;  4NDB A;  4OKH A;  2M49 B;  4L9M A;  1Y6W A;  2F33 A;  4HRG A;  4GGN A;  1TTX A;  3FWB A;  3SG4 A;  4YGB B;  1DJI A;  2WCF A;  1IKU A;  1CLM A;  2KHN A;  2F8P A;  3OX6 A;  1TIZ A;  1MF8 B;  1QX7 A;  3SG6 A;  2ZND A;  2LCP A;  1JF2 A;  2CTN A;  1TCF A;  3NSI A;  1ALW A;  4HRH A;  1IH0 A;  1J7P A;  5HYD A;  4FTG A;  1S5G Y;  1SKT A;  3EK4 A;  1JUO A;  2R2I A;  2JTT A;  1CM1 A;  2NCO A;  5HLO A;  2NXQ A;  5KU1 A;  1F71 A;  3FS7 A;  4IL1 A;  1DJH A;  1PSR A;  4JQ0 D;  2NLN A;  5CSN A;  3BQ3 A;  2LE9 B;  2LUX A;  1TRF A;  1WDC B;  3CLN A;  1BMO A;  1YUT A;  4GFT A;  1WDC C;  1F8H A;  5CPV A;  2LLT A;  2K7C A;  1XK4 C;  1PSB A;  4DUQ A;  2JXL A;  2LVK A;  1SL7 A;  1SYM A;  4PCW A;  1JWD A;  1QIW A;  1FBV A;  4NQG A;  1AVS A;  1XFX O;  4ICB A;  1YX8 A;  3SG7 A;  5CSJ A;  3LK1 A;  3A8R A;  2KQ6 A;  3I5F B;  3NXA A;  1NCX A;  1AP4 A;  2H61 A;  4PE1 A;  2LHI A;  1DJZ A;  2B1U A;  2OPO A;  3H4S E;  4OR9 B;  2LAN A;  2GGZ A;  1W7J B;  4GUK A;  1DVI A;  2PVB A;  3AKB A;  2LC5 A;  2KDH A;  1XYD A;  3QRX A;  3ICB A;  4N1G A;  4I5J A;  2LUC A;  3BUX B;  1IRJ A;  1WLZ A;  5G08 A;  2KAY A;  5HKZ A;  2ZN9 A;  1LKJ A;  5I2Q A;  3VRP A;  1B8R A;  2JZI A;  1YUS A;  2H2K A;  1TOP A;  1V1F A;  2HQW A;  3ZWH A;  1YRU B;  1B1G A;  2L50 A;  3EKJ A;  1BOD A;  5HKY A;  1CDN A;  3DF0 A;  1GGW A;  1A03 A;  1H4B A;  1JF0 A;  2F3Y A;  1Y1A A;  1AK8 A;  1CLB A;  2CBL A;  2WC8 A;  1OOJ A;  4ORA B;  1WY9 A;  3I5H C;  2K0J A;  1F55 A;  1YUR A;  2K8M B;  1NX0 A;  1PVB A;  1U5I A;  4YGE B;  1CFD A;  1XFW O;  2FCD A;  1DTL A;  2JT0 A;  3DVK A;  5K89 A;  4MZL A;  2LP3 A;  4AQJ A;  2KI6 D;  1IGV A;  1IJ6 A;  2I7A A;  1NX1 A;  2LAP A;  1KK7 Y;  1KQM B;  1NP8 A;  1UHH A;  2KFG A;  1FW4 A;  2ZNE A;  3GK1 A;  3VGO A;  2OTG B;  2PMY A;  4DRW A;  2JQ6 A;  2ZFD A;  1PAL A;  2MHH A;  3BXK A;  1QV1 A;  1K95 A;  1QJT A;  2OS8 B;  5AER A;  1QVI Y;  2F2O A;  2ZRT A;  1J1E A;  4C0J A;  2AMI A;  1XFY O;  2OS8 C;  1NIW A;  1L7Z A;  1NX3 A;  2BE6 A;  1J7O A;  2M9G A;  2M3W A;  2RGI A;  4M2P A;  3WXA A;  2K2F A;  1OMR A;  4C0L A;  1L2O B;  1NCZ A;  2KBI A;  2WCB A;  4MSP A;  5DKN A;  4E68 A;  2EGD A;  3TUY C;  2K7B A;  1L2O C;  4MZK A;  2M7L A;  1ZFS A;  3BUW B;  2MBX A;  4PE7 A;  2GV5 A;  4PHK A;  1S3P A;  4D1E A;  3DD4 A;  2E6W A;  3CWG A;  3SIB A;  1B7T Z;  2BCB A;  2JRF A;  1ZMZ A;  1SRA A;  1YVH A;  2KQY A;  5PAL A;  4N1F A;  1QAT A;  3SIA A;  2LMV A;  1MXE A;  2EHB A;  2K61 A;  1B8L A;  2BKI B;  2I94 A;  1TNW A;  4NDC A;  1KWO C;  1WRK A;  1PRW A;  1QX2 A;  4N5X A;  4OV2 A;  3VRO A;  2KNE A;  3LLE A;  1NX2 A;  1J7R A;  4BY4 A;  3SG5 A;  4ETO A;  3DVM A;  2MRD A;  2FOT A;  4ZCV A;  3LK0 A;  2A4J A;  3JVT B;  2KGR A;  1LXF C;  3CTN A;  2AUC A;  2MLE C;  2V53 A;  3BOW B;  2LHL A;  1RRO A;  3I5G B;  5IBW A;  4GGF C;  4ORB B;  3DVE A;  1KFX L;  2LVI A;  1MHO A;  3I5G C;  5AEQ A;  3KPX A;  2CXJ A;  2L4H A;  1EL4 A;  1MWN A;  1NCY A;  1DF0 B;  2JTZ A;  4PE4 A;  5I2O A;  3HX4 A;  4P2Y B;  4BY5 A;  3CR5 X;  2I18 A;  3OHM B;  4OCI A;  1OSA A;  4FQO A;  5ER5 A;  1BF5 A;  1K93 D;  5I2L A;  5BPJ A;  1KFX S;  4CLN A;  1A75 A;  4XJK B;  1LIN A;  1CMF A;  1TNP A;  2KI6 C;  1NYA A;  1K8U A;  2LVV A;  1QXP A;  4YGA A;  3WHT B;  1CKK A;  1CDM A;  1XFZ O;  4HSZ A;  3AKA A;  2EC6 B;  4TNC A;  1KQV A;  5B8I B;  1G4Y R;  1KFU L;  4AQI A;  1CB1 A;  5CSF A;  1KSO A;  4ORC B;  2HF5 A;  3VRN A;  2WCE A;  2Y1N A;  4YI8 A;  2IS9 A;  3OB1 B;  1JSA A;  3CGA A;  4A4C A;  3IQQ A;  2O5G A;  5D69 A;  3PSR A;  1A4P A;  2BL0 B;  1EG4 A;  1B47 A;  1DT7 B;  2O60 A;  1QVI Z;  3I5F C;  2BL0 C;  2NZ0 A;  1F4Q A;  1SR6 B;  1CFC A;  2Y4Q A;  2L0P A;  4WRI A;  2LLU A;  1SR6 C;  3HCM A;  5D7F A;  1UUR A;  4CFR A;  2KYC A;  1A29 A;  1DGV A;  1LVC D;  1PUL A;  3KO0 A;  1GGZ A;  1CM4 A;  3WNX B;  1EJ3 A;  3JTD B;  1IQ5 A;  1PK0 D;  4U8D A;  3JTD C;  4PAL A;  2AAO A;  4MEW A;  1SW8 A;  4XYN A;  4YBH B;  4GBA A;  1ZAC A;  4YGC B;  4MLW A;  1JFJ A;  2KI4 B;  2JNX A;  1MQ1 A;  2I2R E;  2KAV A;  1M63 B;  4WQ2 A;  4HRE E;  4P5O E;  2KI4 C;  1DJW A;  1SPY A;  3MSE B;  1RJV A;  2QPT A;  1Y1U A;  4MN0 A;  4MRY A;  2BE4 A;  4I5N B;  1CLL A;  2JOJ A;  2M29 A;  1SBJ A;  1CDP A;  3D0Y A;  3KHE A;  4Q04 A;  1REC A;  3E3R A;  3FIA A;  3IF7 A;  1UHN A;  2JXC A;  1RK9 A;  1DGU A;  1S1E A;  4I5L B;  1OMD A;  1KQM C;  2NCP A;  1S5G Z;  1M39 A;  2OTG C;  2Y1M A;  1KSM A;  2F3Z A;  4CPV A;  1G33 A;  3PN7 B;  4I5K A;  1PVA A;  2BBM A;  4YI9 A;  3EVV A;  5I8N A;  3KF9 A;  2JNF A;  1IG5 A;  4GGF A;  2PSR A;  2H61 C;  1AJ5 A;  4C0K A;  1IJ5 A;  2JT8 A;  1SY9 A;  1F70 A;  1K96 A;  1K9K A;  2L2E A;  3C1V A;  1UHJ A;  1XO5 A;  3BUM B;  1C07 A;  2KGB C;  1DJY A;  1NUB A;  3PM8 A;  4OVN F;  1H8B A;  1HQV A;  1F4O A;  2D8N A;  2WOR A;  1ALV A;  3PAT A;  1UHK A;  2K2A A;  1CDL A;  3AAK A;  2ZN8 A;  4M2O A;  5FYX A;  3DF0 B;  4DCK A;  3CR4 X;  4GAO A;  1K94 A;  3PLF B;  2PAL A;  1XK4 A;  2BCX A; 
#chains in the Genus database with same CATH topology
 2FCE A;  1OMV A;  1K9U A;  2M7N A;  1U5I B;  2JWW A;  1CNP A;  3SS3 A;  2CCM A;  1D1O A;  1UUS A;  2KFH A;  1RWY A;  2MJW B;  3CR2 A;  2SAS A;  1DEK A;  4PHJ A;  4UPG A;  1QAS A;  1Y1X A;  1YR5 A;  4M2Q A;  1K2H A;  1K9P A;  1MXL C;  1FPW A;  1YRT B;  2CT9 A;  2HPS A;  3GK2 A;  1SCV A;  3JVT C;  2BCA A;  2MLF C;  4PE0 A;  3BUN B;  1OOG A;  5DIC A;  4F0Z B;  1N65 A;  5HKW A;  1AJ4 A;  1DJG A;  3B6X A;  3EVR A;  1XFU O;  1CTR A;  1TUJ A;  3PLF B;  3TZ1 A;  2L5Y A;  1QX5 B;  4MBE A;  1EG3 A;  5DKQ A;  1YX7 A;  2KLE A;  2LM5 A;  1S6C A;  3S0E A;  1Q80 A;  3NSK A;  3CZ1 A;  4YGD B;  1TCO B;  1Z2C B;  4JD9 A;  2KYF A;  3BFA A;  2JT3 A;  4DIR A;  1IQ3 A;  1BR4 B;  1BT6 A;  1CFF A;  1AHR A;  2M0R A;  4GPL B;  1A2X A;  1RFJ A;  3AAJ A;  2KAX A;  2KFF A;  3R1P A;  3IQO A;  1BU3 A;  1NSH A;  1MR8 A;  2K7O A;  2L51 A;  3O78 A;  4CFQ A;  2CNP A;  2Y5I A;  2EC6 C;  2HET A;  2QDI A;  3CZ2 A;  1R2U A;  1EH2 A;  1KK7 Z;  1S6I A;  4DS7 A;  3M0W A;  5ER4 X;  5AAN A;  3BUO B;  4QJ4 B;  3SG2 A;  4JPZ B;  2LLS A;  4QJ5 B;  3RM1 A;  3CS1 A;  3TS5 B;  1J1D A;  1ZUZ A;  4GNK B;  2SCP A;  3GOF A;  1KFU S;  1G8I A;  1UWO A;  3L47 A;  3WHU B;  1CMG A;  2LP2 A;  3TS5 C;  5AXI A;  1FI5 A;  3O6B A;  3TDI A;  2M1K B;  2BKH B;  2F2P A;  2L4I A;  3PAL A;  1IWQ A;  4AOM A;  3O4Y A;  4USL A;  3NGV A;  1YTZ C;  2MA2 A;  3PFV A;  1P28 A;  1YUU A;  1KK8 B;  1TNX A;  1N0Y A;  2VRG A;  5AFP A;  2WOS A;  1S6J A;  3VRQ A;  5HL1 A;  1K90 D;  1KK8 C;  2G9B A;  1DJX A;  2QEB A;  1B7T Y;  4JWQ A;  5KSZ A;  1N2D A;  2KBM A;  3IVT A;  2BBN A;  3PM2 A;  3TDZ A;  1OZO A;  1B9A A;  3S0D A;  1MUX A;  3NSL A;  3BJH A;  1SMG A;  5TNC A;  2L98 A;  4PHN A;  1J55 A;  2JU0 A;  1FF1 A;  2PAS A;  1JBA A;  2M97 A;  2Q91 A;  1GJY A;  1BG1 A;  1AUI B;  1XFV O;  3BYA A;  4NDD A;  3LL8 B;  4PHM A;  1WRL A;  2P6B B;  2LMT A;  1B4C A;  2GGM A;  5F6T A;  1RTP 1;  1A75 B;  3EK7 A;  3R1O A;  1BR1 B;  5CSI A;  1JC2 A;  1LA0 A;  3A4U B;  3OB2 B;  2JC2 A;  5JJG A;  2HQ8 A;  1UHI A;  1QTX A;  3ZNI A;  5J3X A;  3EK8 A;  3D10 A;  2ZKM X;  5DKR A;  1SL9 A;  1EXR A;  1C7W A;  1OZS A;  2FJU B;  3KEV A;  1F54 A;  3DZT A;  2M1U A;  1ODB A;  1WLM A;  1YVL A;  1S26 D;  1NPQ A;  2COL B;  3I5H B;  5HLV A;  3SJS A;  2G2B A;  1CFP A;  1BLQ A;  1SCM B;  1E8A A;  2QAC A;  2DOQ A;  1QLS A;  2BEC A;  1SCM C;  1TNQ A;  1M31 A;  1QS7 A;  3CAB A;  3FWC A;  3PN7 C;  3SG3 A;  5KTY A;  1J7Q A;  4QJ3 B;  2KSP A;  2L5X B;  3Q8I A;  2K7D A;  1QLK A;  3R72 A;  1R6P A;  1W7I B;  3BOW A;  3RLZ A;  2KLD A;  2P71 A;  1OQP A;  1Y0V H;  2KOT A;  3CYZ A;  3EKH A;  1B8C A;  1HT9 A;  1SNL A;  5FI2 A;  2ISD A;  1IIO A;  1GQM A;  1XVJ A;  2QEV A;  1KCY A;  2LV7 A;  4MRX A;  1OOH A;  4PDZ A;  1X02 A;  5GQQ C;  1VRK A;  1DF0 A;  4A4B A;  1QV0 A;  1XA5 A;  1DMO A;  4JKT A;  1C7V A;  1TN4 A;  1M45 A;  1WRZ A;  2E30 A;  2JPO A;  2TN4 A;  1TWO A;  3CZT X;  5D3O A;  2PRU A;  1XFR A;  4XJK A;  1DQE A;  1S36 A;  4MZJ A;  2P70 A;  3K21 A;  4YRU A;  2LMU A;  1BJF A;  3DVJ A;  2M8U A;  2WND A;  3TUY B;  4MVF A;  1QIV A;  1OE9 B;  1JFK A;  3OP0 A;  5JOL A;  3D77 A;  1UP5 A;  1FI6 A;  3QME A;  3VRR A;  3D73 A;  2ZRS A;  1V1G A;  3EVU A;  3L4A A;  2MAZ A;  4R1E A;  3F45 A;  3GK4 X;  1OW4 A;  3NSO A;  1M46 A;  3O2P A;  3I5I B;  1SL8 A;  2LNK A;  2LVJ A;  1NWD A;  4CID A;  1BOC A;  1LA3 A;  4ZCU A;  3D0Y B;  1SK6 D;  2Q4U A;  3I5I C;  3TDU A;  2JPT A;  3OX5 A;  4WQ3 A;  1KWO B;  1ZOT B;  2JUL A;  3LCP C;  4NDB A;  4OKH A;  1SSE B;  2M49 B;  4L9M A;  1Y6W A;  2F33 A;  4HRG A;  4GGN A;  1TTX A;  3FWB A;  3SG4 A;  4YGB B;  1DJI A;  2WCF A;  1IKU A;  1CLM A;  2KHN A;  2F8P A;  3OX6 A;  3D74 A;  3SS4 A;  1TIZ A;  1MF8 B;  1QX7 A;  3SG6 A;  2ZND A;  2LCP A;  1JF2 A;  2CTN A;  1TCF A;  3NSI A;  1ALW A;  4HRH A;  1IH0 A;  1Z4H A;  1J7P A;  5HYD A;  4FTG A;  1S5G Y;  1SKT A;  3EK4 A;  1JUO A;  2R2I A;  2JTT A;  1CM1 A;  2NCO A;  5HLO A;  2BAP A;  2NXQ A;  5KU1 A;  1F71 A;  3FS7 A;  3DY9 A;  4IL1 A;  1DJH A;  1PSR A;  4JQ0 D;  2NLN A;  5CSN A;  3BQ3 A;  3EG5 B;  2LE9 B;  2LUX A;  1TRF A;  1WDC B;  3CLN A;  3DYE A;  1BMO A;  1YUT A;  2PQL A;  1WDC C;  4GFT A;  1F8H A;  5CPV A;  1QWV A;  2LLT A;  2K7C A;  1XK4 C;  1PSB A;  4DUQ A;  2JXL A;  2LVK A;  2KPH A;  3S0A A;  1SL7 A;  1SYM A;  4PCW A;  1JWD A;  1QIW A;  4INX A;  1FBV A;  4NQG A;  2WCK A;  1AVS A;  1XFX O;  4ICB A;  1YX8 A;  3SG7 A;  5CSJ A;  3LK1 A;  3A8R A;  2KQ6 A;  3I5F B;  3NXA A;  1NCX A;  1AP4 A;  2H61 A;  4PE1 A;  2LHI A;  4IJ7 A;  1DJZ A;  2B1U A;  2OPO A;  3H4S E;  4OR9 B;  2LAN A;  3B86 A;  2GGZ A;  1W7J B;  4GUK A;  1DVI A;  2PVB A;  3AKB A;  2LC5 A;  2KDH A;  3B87 A;  4F7F A;  1XYD A;  3QRX A;  3ICB A;  4N1G A;  4I5J A;  2LUC A;  3BUX B;  1IRJ A;  1WLZ A;  5G08 A;  2KAY A;  3CDN A;  5HKZ A;  2ZN9 A;  1LKJ A;  5I2Q A;  3VRP A;  1B8R A;  2JZI A;  1YUS A;  2H2K A;  1TOP A;  1V1F A;  4PT1 A;  2HQW A;  3ZWH A;  1YRU B;  2PYQ A;  2ERB A;  2L50 A;  3EKJ A;  2WCM A;  1B1G A;  1BOD A;  5HKY A;  1CDN A;  3DF0 A;  1GGW A;  1A03 A;  1H4B A;  1JF0 A;  2F3Y A;  1Y1A A;  1AK8 A;  1CLB A;  2CBL A;  2WC8 A;  1OOJ A;  4ORA B;  1WY9 A;  1LS8 A;  2K0J A;  3I5H C;  1F55 A;  1YUR A;  2K8M B;  1NX0 A;  1PVB A;  1U5I A;  4YGE B;  1CFD A;  1XFW O;  2FCD A;  1DTL A;  2JT0 A;  3N7H A;  3DVK A;  5K89 A;  4MZL A;  2LP3 A;  4AQJ A;  2KI6 D;  1IGV A;  1IJ6 A;  3B7A A;  2I7A A;  1NX1 A;  2LAP A;  1KK7 Y;  1KQM B;  1NP8 A;  1UHH A;  2KFG A;  1FW4 A;  2ZNE A;  3GK1 A;  3OBV A;  3VGO A;  2OTG B;  5I2O A;  2PMY A;  4DRW A;  1DC1 A;  2JQ6 A;  2ZFD A;  1PAL A;  2MHH A;  3BXK A;  1QV1 A;  1K95 A;  1QJT A;  2OS8 B;  3V2L A;  5AER A;  1QVI Y;  2F2O A;  2ZRT A;  3B88 A;  1J1E A;  4C0J A;  2AMI A;  1XFY O;  2OS8 C;  1NIW A;  1L7Z A;  1NX3 A;  2BE6 A;  1J7O A;  2M9G A;  2M3W A;  2RGI A;  4M2P A;  3WXA A;  2K2F A;  1OMR A;  4C0L A;  1L2O B;  1NCZ A;  2KBI A;  2WCB A;  4MSP A;  5DKN A;  4E68 A;  2EGD A;  3TUY C;  2K7B A;  1L2O C;  2H8V A;  4MZK A;  5FI6 A;  2M7L A;  1ZFS A;  3BUW B;  2MBX A;  4PE7 A;  2GV5 A;  4PHK A;  1S3P A;  4D1E A;  3DD4 A;  2E6W A;  3CWG A;  3SIB A;  1B7T Z;  2BCB A;  1T14 A;  2JRF A;  1ZMZ A;  1SRA A;  1YVH A;  2KQY A;  3UO9 A;  3FE8 A;  5PAL A;  4N1F A;  1QAT A;  1C3Z A;  2WCJ A;  3SIA A;  2LMV A;  1MXE A;  2EHB A;  2K61 A;  1B8L A;  2BKI B;  2I94 A;  1TNW A;  4NDC A;  1KWO C;  1WRK A;  3NHT A;  1PRW A;  1QX2 A;  4N5X A;  4OV2 A;  3VRO A;  1C3Y A;  2KNE A;  3LLE A;  1NX2 A;  1J7R A;  4BY4 A;  4FQT A;  3SG5 A;  3D78 A;  4ETO A;  3DVM A;  2MRD A;  3K1E A;  2FOT A;  3FE9 A;  4ZCV A;  1OOI X;  3LK0 A;  2A4J A;  3JVT B;  2KGR A;  1LXF C;  3CTN A;  2AUC A;  2MLE C;  2V53 A;  3BOW B;  2LHL A;  1RRO A;  3I5G B;  2FJY A;  5IBW A;  4GGF C;  3R1V A;  4ORB B;  3DVE A;  1KFX L;  2LVI A;  1MHO A;  3I5G C;  5AEQ A;  3SS5 A;  3KPX A;  2CXJ A;  2L4H A;  5I94 A;  1EL4 A;  1MWN A;  1NCY A;  1DF0 B;  2JTZ A;  2L2C A;  3BFH A;  3CZ0 A;  3HX4 A;  3NHI A;  4P2Y B;  4PE4 A;  5EL2 A;  4BY5 A;  3CR5 X;  2I18 A;  3OHM B;  4OCI A;  1OSA A;  4FQO A;  5ER5 A;  1BF5 A;  1K93 D;  5I2L A;  5BPJ A;  1KFX S;  4CLN A;  1A75 A;  4XJK B;  2BNX A;  1LIN A;  1CMF A;  1TNP A;  2KI6 C;  1NYA A;  1K8U A;  2LVV A;  1QXP A;  4YGA A;  3WHT B;  1CKK A;  1CDM A;  1XFZ O;  4HSZ A;  3AKA A;  2EC6 B;  2WCH A;  4TNC A;  1KQV A;  5B8I B;  1G4Y R;  1KFU L;  4AQI A;  1CB1 A;  5CSF A;  1KSO A;  4ORC B;  2HF5 A;  3VRN A;  2WCE A;  2Y1N A;  4YI8 A;  1GM0 A;  2IS9 A;  3OB1 B;  1JSA A;  3CGA A;  4A4C A;  3IQQ A;  2O5G A;  5D69 A;  3PSR A;  1A4P A;  2BL0 B;  1EG4 A;  1B47 A;  3VB1 A;  1DT7 B;  2O60 A;  1QVI Z;  3I5F C;  2BL0 C;  3D76 A;  2NZ0 A;  1F4Q A;  1SR6 B;  2YGU A;  1CFC A;  2Y4Q A;  2L0P A;  4WRI A;  4INW A;  2LLU A;  1SR6 C;  3HCM A;  2WC6 A;  1UUR A;  5D7F A;  4CFR A;  1ORG A;  2KYC A;  3D75 A;  1A29 A;  1DGV A;  1LVC D;  1PUL A;  3KO0 A;  1GGZ A;  1CM4 A;  3S0F A;  3WNX B;  1EJ3 A;  3JTD B;  1DEL A;  1IQ5 A;  1PK0 D;  2WC5 A;  4U8D A;  3JTD C;  4PAL A;  2AAO A;  4MEW A;  1SW8 A;  4XYN A;  4YBH B;  4GBA A;  1ZAC A;  2K60 A;  4YGC B;  3FE6 A;  4MLW A;  1JFJ A;  3UNW A;  3S0B A;  2KI4 B;  2JNX A;  1MQ1 A;  2I2R E;  2KAV A;  1M63 B;  4WQ2 A;  4HRE E;  4P5O E;  2QEH A;  2KI4 C;  1DJW A;  1SPY A;  3MSE B;  1RJV A;  2QPT A;  1Y1U A;  4KYN A;  4MN0 A;  4MRY A;  2BE4 A;  4I5N B;  1CLL A;  3L4L A;  2JOJ A;  2M29 A;  1SBJ A;  1CDP A;  3D0Y A;  3KHE A;  4Q04 A;  1REC A;  3E3R A;  3FIA A;  2QEO A;  3IF7 A;  1UHN A;  3DXL A;  2JXC A;  1RK9 A;  1DGU A;  3S0G A;  1S1E A;  4I5L B;  1OMD A;  1KQM C;  2NCP A;  1S5G Z;  1M39 A;  2OTG C;  2Y1M A;  3BFB A;  1KSM A;  2F3Z A;  4OZD A;  4CPV A;  1G33 A;  3PN7 B;  5FI7 A;  4I5K A;  1PVA A;  1TUZ A;  2BBM A;  4YI9 A;  3EVV A;  5I8N A;  3KF9 A;  2JNF A;  1IG5 A;  4GGF A;  2PSR A;  2H61 C;  3PJI A;  1AJ5 A;  4C0K A;  1IJ5 A;  2JT8 A;  2GTE A;  1SY9 A;  1F70 A;  1K96 A;  1K9K A;  2L2E A;  3C1V A;  1UHJ A;  1XO5 A;  3BUM B;  1C07 A;  2WCL A;  2KGB C;  1DJY A;  1NUB A;  3PM8 A;  4OVN F;  1H8B A;  3O4X A;  1HQV A;  1OOF A;  3RZS A;  1F4O A;  2D8N A;  2WOR A;  1ALV A;  3PAT A;  1UHK A;  2K2A A;  1CDL A;  3AAK A;  2ZN8 A;  4M2O A;  5FYX A;  3DF0 B;  4DCK A;  3CR4 X;  4GAO A;  1K94 A;  1W9Z A;  3OGN A;  2PAL A;  1XK4 A;  2BCX A; 
#chains in the Genus database with same CATH homology
 2FCE A;  1OMV A;  1K9U A;  2M7N A;  1U5I B;  2JWW A;  1CNP A;  1D1O A;  2CCM A;  1UUS A;  2KFH A;  1RWY A;  2MJW B;  3CR2 A;  2SAS A;  4PHJ A;  4UPG A;  1QAS A;  1Y1X A;  1YR5 A;  4M2Q A;  1K2H A;  1K9P A;  1MXL C;  1FPW A;  1YRT B;  2CT9 A;  2HPS A;  3GK2 A;  1SCV A;  3JVT C;  2BCA A;  2MLF C;  4PE0 A;  3BUN B;  4F0Z B;  1N65 A;  5HKW A;  1AJ4 A;  1DJG A;  3EVR A;  1XFU O;  1CTR A;  3TZ1 A;  4MBE A;  1QX5 B;  1EG3 A;  5DKQ A;  1YX7 A;  2LM5 A;  1S6C A;  1Q80 A;  3NSK A;  4YGD B;  1TCO B;  2KYF A;  2JT3 A;  4DIR A;  1IQ3 A;  1BR4 B;  1BT6 A;  1CFF A;  1AHR A;  2M0R A;  4GPL B;  1A2X A;  1RFJ A;  3AAJ A;  2KAX A;  2KFF A;  3IQO A;  1BU3 A;  1NSH A;  1MR8 A;  2K7O A;  2L51 A;  3O78 A;  4CFQ A;  2CNP A;  2Y5I A;  2EC6 C;  2HET A;  1R2U A;  1EH2 A;  1KK7 Z;  1S6I A;  4DS7 A;  3M0W A;  5ER4 X;  5AAN A;  3BUO B;  4QJ4 B;  3SG2 A;  4JPZ B;  2LLS A;  4QJ5 B;  3RM1 A;  3CS1 A;  3TS5 B;  1J1D A;  1ZUZ A;  4GNK B;  2SCP A;  3GOF A;  1KFU S;  1G8I A;  1UWO A;  3WHU B;  1CMG A;  2LP2 A;  3TS5 C;  5AXI A;  1FI5 A;  3O6B A;  3TDI A;  2M1K B;  2BKH B;  2F2P A;  2L4I A;  3PAL A;  1IWQ A;  4AOM A;  3O4Y A;  4USL A;  1YTZ C;  2MA2 A;  3PFV A;  1YUU A;  1KK8 B;  1TNX A;  1N0Y A;  2VRG A;  5AFP A;  2WOS A;  1S6J A;  3VRQ A;  1K90 D;  1KK8 C;  2G9B A;  1DJX A;  1B7T Y;  4JWQ A;  5KSZ A;  1N2D A;  2KBM A;  3TDZ A;  2BBN A;  1OZO A;  1B9A A;  1MUX A;  3NSL A;  5TNC A;  1SMG A;  2L98 A;  4PHN A;  1J55 A;  2JU0 A;  1FF1 A;  2PAS A;  1JBA A;  2M97 A;  2Q91 A;  1GJY A;  1BG1 A;  1AUI B;  1XFV O;  3BYA A;  4NDD A;  3LL8 B;  4PHM A;  1WRL A;  2P6B B;  2LMT A;  1B4C A;  2GGM A;  5F6T A;  1RTP 1;  1A75 B;  3EK7 A;  1BR1 B;  5CSI A;  1JC2 A;  1LA0 A;  3A4U B;  3OB2 B;  2JC2 A;  5JJG A;  2HQ8 A;  1UHI A;  1QTX A;  3ZNI A;  5J3X A;  3EK8 A;  3D10 A;  2ZKM X;  5DKR A;  1SL9 A;  1EXR A;  1C7W A;  1OZS A;  2FJU B;  3KEV A;  1F54 A;  2M1U A;  1ODB A;  1WLM A;  1YVL A;  1S26 D;  1NPQ A;  2COL B;  3I5H B;  5HLV A;  3SJS A;  2G2B A;  1CFP A;  1BLQ A;  1SCM B;  1E8A A;  2QAC A;  2DOQ A;  1QLS A;  2BEC A;  1SCM C;  1TNQ A;  1M31 A;  1QS7 A;  3FWC A;  3PN7 C;  3SG3 A;  5KTY A;  1J7Q A;  4QJ3 B;  2KSP A;  2L5X B;  2K7D A;  1QLK A;  1R6P A;  1W7I B;  3BOW A;  3RLZ A;  1OQP A;  1Y0V H;  2KOT A;  3EKH A;  2ISD A;  1B8C A;  1HT9 A;  1SNL A;  1GQM A;  1XVJ A;  1KCY A;  2LV7 A;  4MRX A;  4PDZ A;  1X02 A;  5GQQ C;  1VRK A;  1DF0 A;  4A4B A;  1QV0 A;  1XA5 A;  1DMO A;  1C7V A;  1TN4 A;  1M45 A;  1WRZ A;  2E30 A;  2TN4 A;  3CZT X;  2PRU A;  4XJK A;  1S36 A;  4MZJ A;  3K21 A;  4YRU A;  2LMU A;  1BJF A;  3DVJ A;  2M8U A;  2WND A;  3TUY B;  4MVF A;  1QIV A;  1OE9 B;  1JFK A;  3OP0 A;  5JOL A;  1UP5 A;  1FI6 A;  3VRR A;  2ZRS A;  1V1G A;  3EVU A;  2MAZ A;  4R1E A;  3F45 A;  3GK4 X;  3NSO A;  1M46 A;  3O2P A;  3I5I B;  1SL8 A;  2LNK A;  2LVJ A;  1NWD A;  4CID A;  1BOC A;  1LA3 A;  4ZCU A;  3D0Y B;  1SK6 D;  2Q4U A;  3I5I C;  3TDU A;  2JPT A;  3OX5 A;  4WQ3 A;  1KWO B;  1ZOT B;  2JUL A;  3LCP C;  4NDB A;  4OKH A;  2M49 B;  4L9M A;  1Y6W A;  2F33 A;  4HRG A;  4GGN A;  1TTX A;  3FWB A;  3SG4 A;  4YGB B;  1DJI A;  2WCF A;  1IKU A;  1CLM A;  2KHN A;  2F8P A;  3OX6 A;  1TIZ A;  1MF8 B;  1QX7 A;  3SG6 A;  2ZND A;  2LCP A;  1JF2 A;  2CTN A;  1TCF A;  3NSI A;  1ALW A;  4HRH A;  1IH0 A;  1J7P A;  5HYD A;  4FTG A;  1S5G Y;  1SKT A;  3EK4 A;  1JUO A;  2R2I A;  2JTT A;  1CM1 A;  2NCO A;  5HLO A;  2NXQ A;  5KU1 A;  1F71 A;  3FS7 A;  4IL1 A;  1DJH A;  1PSR A;  4JQ0 D;  2NLN A;  5CSN A;  3BQ3 A;  2LE9 B;  2LUX A;  1TRF A;  1WDC B;  3CLN A;  1BMO A;  1YUT A;  4GFT A;  1WDC C;  1F8H A;  5CPV A;  2LLT A;  2K7C A;  1XK4 C;  1PSB A;  4DUQ A;  2JXL A;  2LVK A;  1SL7 A;  1SYM A;  4PCW A;  1JWD A;  1QIW A;  1FBV A;  4NQG A;  1AVS A;  1XFX O;  4ICB A;  1YX8 A;  3SG7 A;  5CSJ A;  3LK1 A;  3A8R A;  2KQ6 A;  3I5F B;  3NXA A;  1NCX A;  1AP4 A;  2H61 A;  4PE1 A;  2LHI A;  1DJZ A;  2B1U A;  2OPO A;  3H4S E;  4OR9 B;  2LAN A;  2GGZ A;  1W7J B;  4GUK A;  1DVI A;  2PVB A;  3AKB A;  2LC5 A;  2KDH A;  1XYD A;  3QRX A;  3ICB A;  4N1G A;  4I5J A;  2LUC A;  3BUX B;  1IRJ A;  1WLZ A;  5G08 A;  2KAY A;  5HKZ A;  2ZN9 A;  1LKJ A;  5I2Q A;  3VRP A;  1B8R A;  2JZI A;  1YUS A;  2H2K A;  1TOP A;  1V1F A;  2HQW A;  3ZWH A;  1YRU B;  1B1G A;  2L50 A;  3EKJ A;  1BOD A;  5HKY A;  1CDN A;  3DF0 A;  1GGW A;  1A03 A;  1H4B A;  1JF0 A;  2F3Y A;  1Y1A A;  1AK8 A;  1CLB A;  2CBL A;  2WC8 A;  1OOJ A;  4ORA B;  1WY9 A;  3I5H C;  2K0J A;  1F55 A;  1YUR A;  2K8M B;  1NX0 A;  1PVB A;  1U5I A;  4YGE B;  1CFD A;  1XFW O;  2FCD A;  1DTL A;  2JT0 A;  3DVK A;  5K89 A;  4MZL A;  2LP3 A;  4AQJ A;  2KI6 D;  1IGV A;  1IJ6 A;  2I7A A;  1NX1 A;  2LAP A;  1KK7 Y;  1KQM B;  1NP8 A;  1UHH A;  2KFG A;  1FW4 A;  2ZNE A;  3GK1 A;  3VGO A;  2OTG B;  2PMY A;  4DRW A;  2JQ6 A;  2ZFD A;  1PAL A;  2MHH A;  3BXK A;  1QV1 A;  1K95 A;  1QJT A;  2OS8 B;  5AER A;  1QVI Y;  2F2O A;  2ZRT A;  1J1E A;  4C0J A;  2AMI A;  1XFY O;  2OS8 C;  1NIW A;  1L7Z A;  1NX3 A;  2BE6 A;  1J7O A;  2M9G A;  2M3W A;  2RGI A;  4M2P A;  3WXA A;  2K2F A;  1OMR A;  4C0L A;  1L2O B;  1NCZ A;  2KBI A;  2WCB A;  4MSP A;  5DKN A;  4E68 A;  2EGD A;  3TUY C;  2K7B A;  1L2O C;  4MZK A;  2M7L A;  1ZFS A;  3BUW B;  2MBX A;  4PE7 A;  2GV5 A;  4PHK A;  1S3P A;  4D1E A;  3DD4 A;  2E6W A;  3CWG A;  3SIB A;  1B7T Z;  2BCB A;  2JRF A;  1ZMZ A;  1SRA A;  1YVH A;  2KQY A;  5PAL A;  4N1F A;  1QAT A;  3SIA A;  2LMV A;  1MXE A;  2EHB A;  2K61 A;  1B8L A;  2BKI B;  2I94 A;  1TNW A;  4NDC A;  1KWO C;  1WRK A;  1PRW A;  1QX2 A;  4N5X A;  4OV2 A;  3VRO A;  2KNE A;  3LLE A;  1NX2 A;  1J7R A;  4BY4 A;  3SG5 A;  4ETO A;  3DVM A;  2MRD A;  2FOT A;  4ZCV A;  3LK0 A;  2A4J A;  3JVT B;  2KGR A;  1LXF C;  3CTN A;  2AUC A;  2MLE C;  2V53 A;  3BOW B;  2LHL A;  1RRO A;  3I5G B;  5IBW A;  4GGF C;  4ORB B;  3DVE A;  1KFX L;  2LVI A;  1MHO A;  3I5G C;  5AEQ A;  3KPX A;  2CXJ A;  2L4H A;  1EL4 A;  1MWN A;  1NCY A;  1DF0 B;  2JTZ A;  4PE4 A;  5I2O A;  3HX4 A;  4P2Y B;  4BY5 A;  3CR5 X;  2I18 A;  3OHM B;  4OCI A;  1OSA A;  4FQO A;  5ER5 A;  1BF5 A;  1K93 D;  5I2L A;  5BPJ A;  1KFX S;  4CLN A;  1A75 A;  4XJK B;  1LIN A;  1CMF A;  1TNP A;  2KI6 C;  1NYA A;  1K8U A;  2LVV A;  1QXP A;  4YGA A;  3WHT B;  1CKK A;  1CDM A;  1XFZ O;  4HSZ A;  3AKA A;  2EC6 B;  4TNC A;  1KQV A;  5B8I B;  1G4Y R;  1KFU L;  4AQI A;  1CB1 A;  5CSF A;  1KSO A;  4ORC B;  2HF5 A;  3VRN A;  2WCE A;  2Y1N A;  4YI8 A;  2IS9 A;  3OB1 B;  1JSA A;  3CGA A;  4A4C A;  3IQQ A;  2O5G A;  5D69 A;  3PSR A;  1A4P A;  2BL0 B;  1EG4 A;  1B47 A;  1DT7 B;  2O60 A;  1QVI Z;  3I5F C;  2BL0 C;  2NZ0 A;  1F4Q A;  1SR6 B;  1CFC A;  2Y4Q A;  2L0P A;  4WRI A;  2LLU A;  1SR6 C;  3HCM A;  5D7F A;  1UUR A;  4CFR A;  2KYC A;  1A29 A;  1DGV A;  1LVC D;  1PUL A;  3KO0 A;  1GGZ A;  1CM4 A;  3WNX B;  1EJ3 A;  3JTD B;  1IQ5 A;  1PK0 D;  4U8D A;  3JTD C;  4PAL A;  2AAO A;  4MEW A;  1SW8 A;  4XYN A;  4YBH B;  4GBA A;  1ZAC A;  4YGC B;  4MLW A;  1JFJ A;  2KI4 B;  2JNX A;  1MQ1 A;  2I2R E;  2KAV A;  1M63 B;  4WQ2 A;  4HRE E;  4P5O E;  2KI4 C;  1DJW A;  1SPY A;  3MSE B;  1RJV A;  2QPT A;  1Y1U A;  4MN0 A;  4MRY A;  2BE4 A;  4I5N B;  1CLL A;  2JOJ A;  2M29 A;  1SBJ A;  1CDP A;  3D0Y A;  3KHE A;  4Q04 A;  1REC A;  3E3R A;  3FIA A;  3IF7 A;  1UHN A;  2JXC A;  1RK9 A;  1DGU A;  1S1E A;  4I5L B;  1OMD A;  1KQM C;  2NCP A;  1S5G Z;  1M39 A;  2OTG C;  2Y1M A;  1KSM A;  2F3Z A;  4CPV A;  1G33 A;  3PN7 B;  4I5K A;  1PVA A;  2BBM A;  4YI9 A;  3EVV A;  5I8N A;  3KF9 A;  2JNF A;  1IG5 A;  4GGF A;  2PSR A;  2H61 C;  1AJ5 A;  4C0K A;  1IJ5 A;  2JT8 A;  1SY9 A;  1F70 A;  1K96 A;  1K9K A;  2L2E A;  3C1V A;  1UHJ A;  1XO5 A;  3BUM B;  1C07 A;  2KGB C;  1DJY A;  1NUB A;  3PM8 A;  4OVN F;  1H8B A;  1HQV A;  1F4O A;  2D8N A;  2WOR A;  1ALV A;  3PAT A;  1UHK A;  2K2A A;  1CDL A;  3AAK A;  2ZN8 A;  4M2O A;  5FYX A;  3DF0 B;  4DCK A;  3CR4 X;  4GAO A;  1K94 A;  3PLF B;  2PAL A;  1XK4 A;  2BCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...