2HQWA

Crystal structure of ca2+/calmodulin bound to nmda receptor nr1c1 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
138
Chain Sequence
b'QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title The NMDA Receptor NR1 C1 Region Bound to Calmodulin: Structural Insights into Functional Differences between Homologous Domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 47
structure length 138
sequence length 144
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hqwA00
1YRUB 3EK4A 2SASA 4OCIA 2K61A 4YI8A 1TCOB 1YTZC 1YRTB 2Q4UA 4QJ3B 1KCYA 1IJ5A 1NIWA 4YGEB 4C0KA 4HRGA 1A4PA 4GGFA 3BOWB 2FJUB 2L4IA 4PE4A 5IBWA 1KWOC 3LCPC 1NWDA 3CTNA 1DGUA 1CDNA 1PSRA 1XA5A 1JBAA 1C07A 2EHBA 3EK8A 4OKHA 1G4YR 1KFUL 4PALA 1IWQA 1QS7A 1MXLC 1UUSA 2NXQA 5HKZA 4YGDB 1XFYO 3JVTB 4L9MA 4PDZA 4NQGA 2P6BB 1YVHA 5DKQA 2JT0A 3O78A 2JNFA 1DTLA 1OMRA 1XYDA 2LVIA 3AAKA 3EKJA 4A4BA 2OPOA 1QATA 4N5XA 3PN7B 1QV0A 2CNPA 4PE0A 2JT8A 2OTGC 1RJVA 5DKRA 1CFPA 3LLEA 4GAOA 2EC6C 4USLA 3TUYC 2BCXA 3IQQA 3KPXA 1PSBA 2KFHA 1W7JB 1S3PA 2JU0A 2LANA 2ZRTA 1LXFC 3PATA 1H4BA 2QPTA 2F2OA 3TS5C 1SR6C 3TDIA 4OV2A 4DRWA 3DVMA 1BG1A 2LP2A 3LL8B 4PE1A 1TOPA 2M3WA 5KTYA 4DIRA 1F4QA 1MXEA 1UP5A 2BKIB 2PSRA 4GBAA 2JOJA 1NX2A 1CB1A 1N2DA 3FS7A 3I5HB 1OZSA 3VRPA 5AXIA 3I5FC 5K89A 1U5IB 1J1DA 3SG5A 1QLSA 2O5GA 2KYCA 2LMUA 2MRDA 1B7TY 1QVIZ 2GGZA 5ER4X 2BCAA 2JTZA 2AAOA 4ORAB 1QLKA 2KSPA 2K7DA 2KQ6A 1IH0A 1B1GA 1TIZA 3BXKA 3EVRA 4PHMA 2ZN8A 2LLUA 1B8RA 1DJWA 3TZ1A 2L0PA 1EL4A 4GPLB 1L2OB 1NP8A 1AJ5A 4PHNA 2MHHA 3LK0A 3DVEA 2ZRSA 3EK7A 4HRHA 2QACA 1UHJA 3FWCA 1ZACA 4AOMA 2D8NA 1LKJA 3VRRA 3CGAA 4UPGA 1CDPA 3IF7A 5G08A 1WY9A 2JT3A 2LMTA 3D10A 5AANA 3I5GB 1K90D 1XFXO 2GGMA 4DS7A 1XK4A 2HQWA 3K21A 4A4CA 1H8BA 1SK6D 1WLMA 1M31A 2PASA 3DD4A 4PE7A 3KF9A 2JWWA 4XYNA 1NX0A 1QX2A 1A29A 5KSZA 4XJKB 2LM5A 1EG4A 2PALA 2BCBA 1Y6WA 1W7IB 2H61A 3GK2A 3PFVA 3CZTX 3ZNIA 4CFRA 1JUOA 3ICBA 1DJIA 2E30A 1A75B 3BOWA 2LUCA 2CCMA 1MHOA 2I18A 3I5IB 1SL7A 4JWQA 5JJGA 1YVLA 4M2PA 1K9UA 2M8UA 3TDUA 1L7ZA 3OHMB 1V1GA 1LA0A 1N65A 3AKAA 3BUNB 3TDZA 1KK8C 1CDLA 4NDCA 1RWYA 3SJSA 2KDHA 1PVBA 1SBJA 2WCFA 2K0JA 1J7RA 3BQ3A 3SIAA 1CM4A 4NDDA 1CFCA 1HQVA 1Q80A 4CFQA 4IL1A 1S5GY 2BE6A 2LVKA 4FTGA 5F6TA 2Y1NA 5HLOA 1M46A 2F33A 2M49B 1KK7Y 1NX3A 1A03A 2IS9A 1XFVO 2KBMA 1DGVA 1OE9B 3OX5A 2NCOA 3OB2B 2HETA 1IQ5A 1BLQA 4CIDA 4F0ZB 1KWOB 2M29A 1HT9A 1CTRA 4MLWA 4PHJA 5JOLA 2MLFC 1Y1XA 1FI6A 1DJHA 2G2BA 3FIAA 3CR2A 1XO5A 3NSKA 1F55A 2JXCA 4I5JA 2KHNA 4WQ2A 2WNDA 1WDCC 1SL9A 1UHNA 2ZKMX 5CSFA 2COLB 4YRUA 2Y4QA 3NSIA 3EVVA 1XVJA 1S5GZ 2KAXA 5KU1A 2ZNDA 2R2IA 1FBVA 1U5IA 1RK9A 1SRAA 1QVIY 2CT9A 1F70A 1TCFA 1KK7Z 2B1UA 2LMVA 4MZKA 2ZNEA 4CPVA 3D0YB 2EC6B 3TUYB 4OVNF 1OOJA 1CMGA 3PLFB 4ICBA 2M1UA 5I8NA 3FWBA 2WORA 4MSPA 5CSNA 3IQOA 3WXAA 1F8HA 1VRKA 4AQIA 2Y1MA 3SG6A 2LUXA 3TS5B 1GGZA 1SR6B 1TNQA 3RLZA 1K93D 1DJXA 4GGFC 1QX7A 1K94A 1ZFSA 3WHTB 1FW4A 5AERA 5D69A 1JSAA 2F3YA 1WRZA 1RECA 3E3RA 2KGBC 4YGBB 1ODBA 5I2OA 1MQ1A 1NCXA 2LP3A 3I5FB 4GGNA 1AK8A 1B47A 3M0WA 1YUSA 2JTTA 1NCZA 1ZOTB 1G8IA 2KI6C 4I5LB 4MZJA 1GGWA 2L50A 3SG2A 1S6JA 2BBNA 2DOQA 2LE9B 1XFZO 1JF2A 2BECA 3HX4A 4HREE 5TNCA 3H4SE 3BUMB 2F2PA 4XJKA 1CLLA 1WRKA 2WOSA 3F45A 2MBXA 1SY9A 1TNPA 3MSEB 2KGRA 2ZFDA 4YGCB 4N1GA 5CPVA 1QIWA 2M7LA 2ZN9A 1OZOA 3SIBA 4R1EA 5ER5A 2TN4A 1DVIA 1LINA 1EG3A 1YX8A 1S1EA 4OR9B 1A75A 1KFXS 3QRXA 1AJ4A 2WCEA 4I5KA 3PM8A 3BUOB 2O60A 3EVUA 4JPZB 1FI5A 2BL0C 4Q04A 2JQ6A 1WLZA 1MR8A 1XFWO 3CS1A 1J7QA 1KQVA 2KFGA 2K2AA 2WCBA 1EJ3A 1OSAA 1UURA 3DF0B 5D7FA 2FCEA 5CSJA 2KBIA 3CR4X 1N0YA 2JZIA 2KAVA 1CM1A 4ORBB 5FYXA 5HYDA 3SG3A 2OS8C 3KHEA 1TTXA 1NUBA 1UHKA 1WRLA 2A4JA 1M63B 3JTDC 1OMDA 1K9PA 4QJ4B 1QTXA 2I2RE 2Y5IA 2HPSA 2EGDA 5DKNA 3A4UB 5HKWA 2MLEC 2E6WA 3VROA 1SCMC 1SNLA 5HLVA 4ORCB 2KNEA 3RM1A 4YBHB 3BUXB 2KI4C 1CLBA 1XFUO 1BR1B 2LAPA 4MRYA 1SMGA 3WNXB 2I94A 3SG7A 4WQ3A 2JRFA 4N1FA 4MN0A 5PALA 1K2HA 4P5OE 4ZCVA 2WC8A 1J55A 1J7OA 1ALVA 4BY5A 3KO0A 4FQOA 1AVSA 1TNXA 5CSIA 2HF5A 1BT6A 1R6PA 1X02A 2M1KB 2FCDA 3NXAA 4U8DA 4ZCUA 1KQMC 1TRFA 2KYFA 1YUUA 1XK4C 1AUIB 1BJFA 2I7AA 2K2FA 2LVVA 3GK1A 3O2PA 1CMFA 1CFDA 2BKHB 1NCYA 1MUXA 1CNPA 1NX1A 2F3ZA 2K7OA 3D0YA 5I2QA 1C7WA 2K7CA 3C1VA 3VGOA 4MVFA 2LHIA 1S26D 2H61C 1TN4A 2L98A 2M7NA 2K7BA 3AAJA 5I2LA 1LA3A 1BF5A 4PHKA 3AKBA 4NDBA 3GOFA 1WDCB 4MRXA 1B8LA 1QIVA 1NPQA 1C7VA 1RROA 1QX5B 1V1FA 1RFJA 1SL8A 3VRQA 2ISDA 3WHUB 1QXPA 1YX7A 5BPJA 1JFJA 2LVJA 2OTGB 3JVTC 4HSZA 4WRIA 4DCKA 5HKYA 1IQ3A 1DF0B 1E8AA 3KEVA 3OX6A 2KOTA 3O6BA 1CFFA 1Y0VH 2V53A 1F71A 1F4OA 2SCPA 3PN7C 4MBEA 2JC2A 3BYAA 3SG4A 5AEQA 2NZ0A 1BOCA 4CLNA 3PALA 1PULA 2G9BA 1MWNA 1OMVA 1S6CA 1BMOA 4D1EA 1KFUS 1UHIA 2MJWB 1ZUZA 2PMYA 1B8CA 1KSOA 2AUCA 1KFXL 1NSHA 1M39A 3OP0A 2M97A 1AHRA 3DF0A 2L5XB 4GUKA 1UHHA 1CLMA 2K8MB 4C0LA 1J1EA 1B9AA 1IRJA 2VRGA 3EKHA 3OB1B 2JNXA 2CXJA 2Q91A 2M0RA 2MA2A 1SW8A 2BBMA 1FF1A 1B4CA 3HCMA 3NSOA 1YR5A 3I5HC 5AFPA 1DJZA 2RGIA 1IJ6A 2NCPA 1BODA 3VRNA 4AQJA 4DUQA 2JXLA 1AP4A 1SCVA 4YI9A 2CTNA 2GV5A 1Y1UA 4TNCA 2L4HA 2L2EA 2HQ8A 1M45A 2PRUA 1DJYA 1SKTA 4E68A 1QASA 3CWGA 1Y1AA 1SPYA 1RTP1 1JFKA 1QJTA 1K8UA 2L51A 1A2XA 3LK1A 3GK4X 2BL0B 1DT7B 1L2OC 1DJGA 3DVKA 4M2OA 3DVJA 4P2YB 2KFFA 2AMIA 1BR4B 1JC2A 2LLTA 1FPWA 1R2UA 1NYAA 2PVBA 2LCPA 2LV7A 5J3XA 4M2QA 2OS8B 3A8RA 3ZWHA 2KAYA 1PK0D 3I5GC 3JTDB 2KQYA 4I5NB 2NLNA 1GJYA 1IG5A 1OQPA 2KI6D 1IKUA 1QV1A 1PVAA 4YGAA 1EH2A 1K95A 1PALA 1YUTA 2BE4A 1ZMZA 3NSLA 1TNWA 2H2KA 3O4YA 1EXRA 1K96A 1SCMB 1IGVA 1B7TZ 4MZLA 1S36A 4ETOA 4QJ5B 1D1OA 3CLNA 1ALWA 1DMOA 2CBLA 2F8PA 2LLSA 2KI4B 4C0JA 1BU3A 1KK8B 4BY4A 1GQMA 1F54A 4JQ0D 2MAZA 2LHLA 1CKKA 4PCWA 2JPTA 3I5IC 2LC5A 5B8IB 2LNKA 2JULA 3BUWB 1JF0A 3PSRA 1J7PA 1YURA 3CR5X 1KQMB 1G33A 4MEWA 1MF8B 1CDMA 2FOTA 1UWOA 2M9GA 4GFTA 1LVCD 1S6IA 1JWDA 1DF0A 1SYMA 1KSMA 5GQQC 1PRWA 1K9KA 4GNKB
chains in the Genus database with same CATH superfamily
1YRUB 3L47A 3EK4A 2SASA 4OCIA 1Z4HA 2K61A 3R1VA 4YI8A 1TCOB 1YTZC 1YRTB 2Q4UA 4INWA 4QJ3B 1KCYA 1IJ5A 1NIWA 4YGEB 4C0KA 4HRGA 1A4PA 4GGFA 3BOWB 2FJUB 2L4IA 4PE4A 1OOFA 5IBWA 1KWOC 3SS5A 3LCPC 1NWDA 3CTNA 1DGUA 1CDNA 1PSRA 1XA5A 1JBAA 1C07A 2EHBA 3EK8A 4OKHA 1G4YR 1KFUL 4PALA 1IWQA 3RZSA 1QS7A 1MXLC 1UUSA 2NXQA 5HKZA 4JKTA 4YGDB 1XFYO 3JVTB 4L9MA 4PDZA 4NQGA 2P6BB 1YVHA 5DKQA 2JT0A 3O78A 2JNFA 1DTLA 1OMRA 1XYDA 2LVIA 3AAKA 3EKJA 4A4BA 3L4AA 2OPOA 1QATA 4N5XA 3PN7B 1OOGA 3VB1A 1QV0A 3R72A 2CNPA 4PE0A 2JT8A 2OTGC 1RJVA 5DKRA 1CFPA 3LLEA 4GAOA 2EC6C 4USLA 3TUYC 3B6XA 2BCXA 3IQQA 3KPXA 1PSBA 2KFHA 1W7JB 1S3PA 2JU0A 4F7FA 2LANA 2ZRTA 1LXFC 3PATA 1H4BA 2QPTA 2F2OA 3TS5C 1SR6C 3TDIA 4OV2A 4DRWA 3DVMA 1BG1A 2LP2A 3LL8B 4PE1A 1TOPA 2M3WA 5KTYA 4DIRA 3D76A 1F4QA 1MXEA 1UP5A 2BKIB 2PSRA 4GBAA 2WCJA 2JOJA 1NX2A 1CB1A 1N2DA 3FS7A 3I5HB 1OZSA 3VRPA 5AXIA 3I5FC 5K89A 1U5IB 1J1DA 3SG5A 1QLSA 2O5GA 2KYCA 2LMUA 2MRDA 3BFBA 1B7TY 1QVIZ 2GGZA 1DC1A 5ER4X 2BCAA 4U8DA 2JTZA 2AAOA 4ORAB 1QLKA 2KSPA 2K7DA 2KQ6A 1IH0A 1B1GA 1TIZA 3BXKA 3EVRA 4PHMA 2ZN8A 2LLUA 1B8RA 1DJWA 2WCHA 3TZ1A 2L0PA 1EL4A 2BAPA 4GPLB 1L2OB 1NP8A 1AJ5A 4PHNA 2MHHA 3LK0A 3SS4A 5I94A 3DVEA 2ZRSA 3EK7A 4HRHA 2QACA 1UHJA 3K1EA 3FWCA 1ZACA 4AOMA 2D8NA 1LKJA 3VRRA 3CGAA 4UPGA 1CDPA 2L2CA 3IF7A 3D75A 5G08A 1WY9A 2JT3A 2LMTA 3D10A 5AANA 3I5GB 1K90D 1XFXO 2GGMA 4DS7A 1XK4A 2HQWA 3K21A 4A4CA 1H8BA 1SK6D 1WLMA 1M31A 2PASA 3DD4A 3NHTA 3KF9A 2JWWA 4PE7A 4XYNA 1NX0A 1QX2A 1C3ZA 1A29A 5KSZA 4XJKB 2LM5A 1EG4A 2PALA 2BCBA 1Y6WA 1W7IB 2H61A 3EG5B 3GK2A 3D73A 2GTEA 3CZ1A 3PFVA 3CZTX 3ZNIA 4CFRA 1JUOA 3ICBA 1DJIA 2E30A 1A75B 2P70A 3BOWA 2LUCA 2CCMA 1MHOA 2I18A 3I5IB 1SL7A 4JWQA 2KLEA 5JJGA 1YVLA 4M2PA 1K9UA 2M8UA 3TDUA 1L7ZA 3OHMB 3CABA 1V1GA 1LA0A 1N65A 3AKAA 3BUNB 3TDZA 1KK8C 1CDLA 4NDCA 1RWYA 3SJSA 2KDHA 1PVBA 1SBJA 2WCFA 2K0JA 1J7RA 3BQ3A 3SIAA 1CM4A 1TUZA 4NDDA 4INXA 1CFCA 1HQVA 1Q80A 4CFQA 4IL1A 1S5GY 2BE6A 2LVKA 3CYZA 4FTGA 2Y1NA 5F6TA 5HLOA 1M46A 2F33A 2M49B 1KK7Y 3D74A 1NX3A 1A03A 2IS9A 1XFVO 2KBMA 1DELA 1DGVA 1OE9B 3OX5A 2NCOA 3OB2B 2HETA 1IQ5A 1BLQA 3B88A 4CIDA 4F0ZB 1KWOB 2M29A 1HT9A 1CTRA 4MLWA 3B87A 4PHJA 2MLFC 1Y1XA 5JOLA 1FI6A 1DJHA 2G2BA 3FIAA 3CR2A 1XO5A 3NSKA 1F55A 2JXCA 4I5JA 2KHNA 4WQ2A 2WNDA 1WDCC 1SL9A 1UHNA 2ZKMX 5CSFA 2COLB 4YRUA 3DYEA 2Y4QA 3NSIA 3EVVA 1XVJA 1S5GZ 2KAXA 1DEKA 5KU1A 2ZNDA 2R2IA 1FBVA 1U5IA 3FE6A 1RK9A 1SRAA 1QVIY 2CT9A 1F70A 1TCFA 1KK7Z 1IIOA 2B1UA 1LS8A 3Q8IA 2LMVA 4MZKA 2ZNEA 4CPVA 3D0YB 2EC6B 3TUYB 4OVNF 1OOJA 1CMGA 3PLFB 2WCKA 2M1UA 4ICBA 3FWBA 5I8NA 2WORA 4MSPA 5CSNA 3IQOA 2WC5A 3WXAA 1F8HA 1VRKA 5FI7A 4AQIA 2Y1MA 2QEVA 2LUXA 3SG6A 3TS5B 1GGZA 1SR6B 1TNQA 3D78A 3RLZA 1K93D 1DJXA 4GGFC 1QX7A 1K94A 1ZFSA 3WHTB 1FW4A 4OZDA 3DXLA 5AERA 5D69A 3S0DA 1JSAA 2F3YA 1WRZA 1RECA 3E3RA 2KGBC 4YGBB 1ODBA 5I2OA 1MQ1A 1NCXA 2LP3A 3I5FB 4GGNA 1AK8A 1B47A 2QEHA 1YUSA 2JTTA 1NCZA 1ZOTB 1G8IA 2KI6C 3CDNA 3M0WA 4I5LB 2L50A 4MZJA 3SG2A 1S6JA 2BBNA 2DOQA 2LE9B 3FE9A 1XFZO 1JF2A 2BECA 3HX4A 4HREE 5TNCA 1ORGA 3H4SE 3BUMB 2FJYA 2F2PA 4XJKA 1CLLA 1WRKA 2WOSA 3F45A 2MBXA 1SY9A 1TNPA 3MSEB 2KGRA 2ZFDA 4FQTA 4N1GA 4YGCB 5CPVA 1QIWA 2M7LA 2ZN9A 1OZOA 3SIBA 4R1EA 3R1PA 2TN4A 5ER5A 1DVIA 1LINA 3S0EA 1EG3A 1YX8A 1S1EA 4OR9B 1A75A 1KFXS 3QRXA 1AJ4A 2WCEA 4I5KA 3PM8A 3BUOB 2O60A 3SS3A 3EVUA 4JPZB 1FI5A 2BL0C 4Q04A 2JQ6A 1WLZA 1MR8A 1XFWO 3CS1A 1J7QA 1KQVA 2KFGA 2K2AA 2WCBA 1EJ3A 1OSAA 1UURA 3DF0B 2PQLA 3NHIA 5D7FA 2FCEA 5CSJA 2KBIA 3CR4X 1N0YA 2JZIA 2KAVA 1CM1A 4ORBB 5FYXA 5HYDA 3SG3A 2OS8C 3KHEA 1TTXA 1NUBA 1UHKA 1WRLA 2A4JA 1M63B 3JTDC 1OMDA 1K9PA 4QJ4B 1QTXA 5HL1A 1C3YA 3DY9A 2I2RE 2Y5IA 2HPSA 2EGDA 5DKNA 3A4UB 5HKWA 2MLEC 1SSEB 2E6WA 3VROA 1SCMC 1SNLA 5HLVA 1TUJA 4ORCB 2L5YA 2KNEA 3RM1A 4YBHB 3UO9A 3BUXB 2KI4C 1CLBA 1XFUO 1BR1B 2LAPA 4MRYA 1SMGA 3WNXB 2I94A 3SG7A 4WQ3A 2JRFA 4N1FA 4MN0A 1Z2CB 5PALA 1K2HA 4P5OE 4ZCVA 2WC8A 1J55A 1J7OA 1ALVA 4BY5A 3KO0A 4FQOA 1AVSA 1TNXA 4KYNA 2HF5A 1BT6A 1R6PA 1X02A 2M1KB 2FCDA 2KPHA 3NXAA 3R1OA 1KQMC 1TRFA 4ZCUA 2KYFA 1YUUA 1XK4C 1AUIB 1BJFA 2I7AA 2K2FA 2LVVA 3GK1A 3O2PA 1CMFA 1CFDA 2BKHB 1NCYA 1MUXA 1CNPA 1NX1A 2F3ZA 2K7OA 3BJHA 3D0YA 5I2QA 3S0AA 1C7WA 2KLDA 2K7CA 5FI2A 3C1VA 3VGOA 4MVFA 2LHIA 1S26D 2H61C 1TN4A 2L98A 2M7NA 3NGVA 1DQEA 2K7BA 3AAJA 5I2LA 1LA3A 1BF5A 1T14A 4PHKA 5EL2A 3AKBA 4NDBA 2H8VA 3GOFA 1WDCB 4MRXA 1B8LA 1QIVA 1NPQA 1C7VA 1RROA 1QX5B 1V1FA 3OBVA 1RFJA 1SL8A 3VRQA 2ISDA 3WHUB 1QXPA 1YX7A 5BPJA 1JFJA 3UNWA 2LVJA 2OTGB 3JVTC 4HSZA 4WRIA 4DCKA 5HKYA 1IQ3A 4PT1A 1DF0B 1E8AA 3KEVA 3OX6A 2KOTA 5FI6A 3O6BA 1CFFA 1Y0VH 2V53A 1F71A 1F4OA 2SCPA 3PN7C 4MBEA 2JC2A 5D3OA 3BYAA 3SG4A 5AEQA 2NZ0A 1BOCA 4CLNA 3PALA 1GGWA 3DZTA 1PULA 2G9BA 1MWNA 1OMVA 1S6CA 1BMOA 4D1EA 1OOIX 1KFUS 1UHIA 2MJWB 1ZUZA 2PMYA 1B8CA 1KSOA 3B7AA 5CSIA 2AUCA 1KFXL 1NSHA 1M39A 3CZ0A 3N7HA 3OP0A 2M97A 1AHRA 3DF0A 3V2LA 2K60A 2L5XB 4GUKA 1UHHA 1CLMA 2K8MB 4C0LA 1J1EA 1B9AA 1IRJA 2VRGA 3EKHA 3OB1B 2JNXA 3CZ2A 2CXJA 3PJIA 2Q91A 3S0FA 2M0RA 2MA2A 1SW8A 2BBMA 1FF1A 1B4CA 3HCMA 3NSOA 1YR5A 3I5HC 5AFPA 1DJZA 2RGIA 1IJ6A 2NCPA 3PM2A 1BODA 3VRNA 4AQJA 4DUQA 2JXLA 1AP4A 1SCVA 4YI9A 2CTNA 2GV5A 1Y1UA 1OOHA 4IJ7A 4TNCA 2L4HA 2L2EA 3S0GA 2HQ8A 2WCLA 3QMEA 1M45A 1W9ZA 2PRUA 1DJYA 1SKTA 3BFAA 4E68A 1QASA 3CWGA 1GM0A 1Y1AA 1SPYA 1RTP1 2YGUA 1JFKA 1QJTA 1K8UA 2L51A 1A2XA 2QDIA 3GK4X 2BL0B 3LK1A 1L2OC 1DJGA 3B86A 3DVKA 4M2OA 3DVJA 3BFHA 4P2YB 3FE8A 2KFFA 2AMIA 1BR4B 2WC6A 3L4LA 2LLTA 1JC2A 1FPWA 1R2UA 1NYAA 2PVBA 2LCPA 2LV7A 5J3XA 4M2QA 2OS8B 3A8RA 3ZWHA 2KAYA 1PK0D 3I5GC 3JTDB 2KQYA 4I5NB 2NLNA 1GJYA 1IG5A 1OQPA 2KI6D 5DICA 2JPOA 2ERBA 1IKUA 1QV1A 1PVAA 3D77A 3IVTA 4YGAA 1EH2A 1K95A 1PALA 1YUTA 2BE4A 1ZMZA 2BNXA 2P71A 3NSLA 1TNWA 2H2KA 3O4YA 1EXRA 1K96A 1SCMB 1IGVA 1B7TZ 4MZLA 1S36A 4ETOA 4QJ5B 1D1OA 2WCMA 1ALWA 3CLNA 1DMOA 1QWVA 2CBLA 2F8PA 2LLSA 2KI4B 3OGNA 4C0JA 1BU3A 1KK8B 4JD9A 4BY4A 1GQMA 1XFRA 1F54A 4JQ0D 1TWOA 2MAZA 2LHLA 1OW4A 1CKKA 4PCWA 2JPTA 3I5IC 3S0BA 2LC5A 5B8IB 2QEOA 2LNKA 1DT7B 2JULA 3BUWB 1JF0A 3PSRA 1J7PA 1YURA 3CR5X 3O4XA 1KQMB 1G33A 2QEBA 4MEWA 1MF8B 1CDMA 2FOTA 2PYQA 1P28A 1UWOA 2M9GA 4GFTA 1LVCD 1S6IA 1JWDA 1DF0A 1SYMA 1KSMA 5GQQC 1PRWA 1K9KA 4GNKB
chains in the Genus database with same CATH topology
1YRUB 3EK4A 2SASA 4OCIA 2K61A 4YI8A 1TCOB 1YTZC 1YRTB 2Q4UA 4QJ3B 1KCYA 1IJ5A 1NIWA 4YGEB 4C0KA 4HRGA 1A4PA 4GGFA 3BOWB 2FJUB 2L4IA 4PE4A 5IBWA 1KWOC 3LCPC 1NWDA 3CTNA 1DGUA 1CDNA 1PSRA 1XA5A 1JBAA 1C07A 2EHBA 3EK8A 4OKHA 1G4YR 1KFUL 4PALA 1IWQA 1QS7A 1MXLC 1UUSA 2NXQA 5HKZA 4YGDB 1XFYO 3JVTB 4L9MA 4PDZA 4NQGA 2P6BB 1YVHA 5DKQA 2JT0A 3O78A 2JNFA 1DTLA 1OMRA 1XYDA 2LVIA 3AAKA 3EKJA 4A4BA 2OPOA 1QATA 4N5XA 3PN7B 1QV0A 2CNPA 4PE0A 2JT8A 2OTGC 1RJVA 5DKRA 1CFPA 3LLEA 4GAOA 2EC6C 4USLA 3TUYC 2BCXA 3IQQA 3KPXA 1PSBA 2KFHA 1W7JB 1S3PA 2JU0A 2LANA 2ZRTA 1LXFC 3PATA 1H4BA 2QPTA 2F2OA 3TS5C 1SR6C 3TDIA 4OV2A 4DRWA 3DVMA 1BG1A 2LP2A 3LL8B 4PE1A 1TOPA 2M3WA 5KTYA 4DIRA 1F4QA 1MXEA 1UP5A 2BKIB 2PSRA 4GBAA 2JOJA 1NX2A 1CB1A 1N2DA 3FS7A 3I5HB 1OZSA 3VRPA 5AXIA 3I5FC 5K89A 1U5IB 1J1DA 3SG5A 1QLSA 2O5GA 2KYCA 2LMUA 2MRDA 1B7TY 1QVIZ 2GGZA 5ER4X 2BCAA 2JTZA 2AAOA 4ORAB 1QLKA 2KSPA 2K7DA 2KQ6A 1IH0A 1B1GA 1TIZA 3BXKA 3EVRA 4PHMA 2ZN8A 2LLUA 1B8RA 1DJWA 3TZ1A 2L0PA 1EL4A 4GPLB 1L2OB 1NP8A 1AJ5A 4PHNA 2MHHA 3LK0A 3DVEA 2ZRSA 3EK7A 4HRHA 2QACA 1UHJA 3FWCA 1ZACA 4AOMA 2D8NA 1LKJA 3VRRA 3CGAA 4UPGA 1CDPA 3IF7A 5G08A 1WY9A 2JT3A 2LMTA 3D10A 5AANA 3I5GB 1K90D 1XFXO 2GGMA 4DS7A 1XK4A 2HQWA 3K21A 4A4CA 1H8BA 1SK6D 1WLMA 1M31A 2PASA 3DD4A 4PE7A 3KF9A 2JWWA 4XYNA 1NX0A 1QX2A 1A29A 5KSZA 4XJKB 2LM5A 1EG4A 2PALA 2BCBA 1Y6WA 1W7IB 2H61A 3GK2A 3PFVA 3CZTX 3ZNIA 4CFRA 1JUOA 3ICBA 1DJIA 2E30A 1A75B 3BOWA 2LUCA 2CCMA 1MHOA 2I18A 3I5IB 1SL7A 4JWQA 5JJGA 1YVLA 4M2PA 1K9UA 2M8UA 3TDUA 1L7ZA 3OHMB 1V1GA 1LA0A 1N65A 3AKAA 3BUNB 3TDZA 1KK8C 1CDLA 4NDCA 1RWYA 3SJSA 2KDHA 1PVBA 1SBJA 2WCFA 2K0JA 1J7RA 3BQ3A 3SIAA 1CM4A 4NDDA 1CFCA 1HQVA 1Q80A 4CFQA 4IL1A 1S5GY 2BE6A 2LVKA 4FTGA 5F6TA 2Y1NA 5HLOA 1M46A 2F33A 2M49B 1KK7Y 1NX3A 1A03A 2IS9A 1XFVO 2KBMA 1DGVA 1OE9B 3OX5A 2NCOA 3OB2B 2HETA 1IQ5A 1BLQA 4CIDA 4F0ZB 1KWOB 2M29A 1HT9A 1CTRA 4MLWA 4PHJA 5JOLA 2MLFC 1Y1XA 1FI6A 1DJHA 2G2BA 3FIAA 3CR2A 1XO5A 3NSKA 1F55A 2JXCA 4I5JA 2KHNA 4WQ2A 2WNDA 1WDCC 1SL9A 1UHNA 2ZKMX 5CSFA 2COLB 4YRUA 2Y4QA 3NSIA 3EVVA 1XVJA 1S5GZ 2KAXA 5KU1A 2ZNDA 2R2IA 1FBVA 1U5IA 1RK9A 1SRAA 1QVIY 2CT9A 1F70A 1TCFA 1KK7Z 2B1UA 2LMVA 4MZKA 2ZNEA 4CPVA 3D0YB 2EC6B 3TUYB 4OVNF 1OOJA 1CMGA 3PLFB 4ICBA 2M1UA 5I8NA 3FWBA 2WORA 4MSPA 5CSNA 3IQOA 3WXAA 1F8HA 1VRKA 4AQIA 2Y1MA 3SG6A 2LUXA 3TS5B 1GGZA 1SR6B 1TNQA 3RLZA 1K93D 1DJXA 4GGFC 1QX7A 1K94A 1ZFSA 3WHTB 1FW4A 5AERA 5D69A 1JSAA 2F3YA 1WRZA 1RECA 3E3RA 2KGBC 4YGBB 1ODBA 5I2OA 1MQ1A 1NCXA 2LP3A 3I5FB 4GGNA 1AK8A 1B47A 3M0WA 1YUSA 2JTTA 1NCZA 1ZOTB 1G8IA 2KI6C 4I5LB 4MZJA 1GGWA 2L50A 3SG2A 1S6JA 2BBNA 2DOQA 2LE9B 1XFZO 1JF2A 2BECA 3HX4A 4HREE 5TNCA 3H4SE 3BUMB 2F2PA 4XJKA 1CLLA 1WRKA 2WOSA 3F45A 2MBXA 1SY9A 1TNPA 3MSEB 2KGRA 2ZFDA 4YGCB 4N1GA 5CPVA 1QIWA 2M7LA 2ZN9A 1OZOA 3SIBA 4R1EA 5ER5A 2TN4A 1DVIA 1LINA 1EG3A 1YX8A 1S1EA 4OR9B 1A75A 1KFXS 3QRXA 1AJ4A 2WCEA 4I5KA 3PM8A 3BUOB 2O60A 3EVUA 4JPZB 1FI5A 2BL0C 4Q04A 2JQ6A 1WLZA 1MR8A 1XFWO 3CS1A 1J7QA 1KQVA 2KFGA 2K2AA 2WCBA 1EJ3A 1OSAA 1UURA 3DF0B 5D7FA 2FCEA 5CSJA 2KBIA 3CR4X 1N0YA 2JZIA 2KAVA 1CM1A 4ORBB 5FYXA 5HYDA 3SG3A 2OS8C 3KHEA 1TTXA 1NUBA 1UHKA 1WRLA 2A4JA 1M63B 3JTDC 1OMDA 1K9PA 4QJ4B 1QTXA 2I2RE 2Y5IA 2HPSA 2EGDA 5DKNA 3A4UB 5HKWA 2MLEC 2E6WA 3VROA 1SCMC 1SNLA 5HLVA 4ORCB 2KNEA 3RM1A 4YBHB 3BUXB 2KI4C 1CLBA 1XFUO 1BR1B 2LAPA 4MRYA 1SMGA 3WNXB 2I94A 3SG7A 4WQ3A 2JRFA 4N1FA 4MN0A 5PALA 1K2HA 4P5OE 4ZCVA 2WC8A 1J55A 1J7OA 1ALVA 4BY5A 3KO0A 4FQOA 1AVSA 1TNXA 5CSIA 2HF5A 1BT6A 1R6PA 1X02A 2M1KB 2FCDA 3NXAA 4U8DA 4ZCUA 1KQMC 1TRFA 2KYFA 1YUUA 1XK4C 1AUIB 1BJFA 2I7AA 2K2FA 2LVVA 3GK1A 3O2PA 1CMFA 1CFDA 2BKHB 1NCYA 1MUXA 1CNPA 1NX1A 2F3ZA 2K7OA 3D0YA 5I2QA 1C7WA 2K7CA 3C1VA 3VGOA 4MVFA 2LHIA 1S26D 2H61C 1TN4A 2L98A 2M7NA 2K7BA 3AAJA 5I2LA 1LA3A 1BF5A 4PHKA 3AKBA 4NDBA 3GOFA 1WDCB 4MRXA 1B8LA 1QIVA 1NPQA 1C7VA 1RROA 1QX5B 1V1FA 1RFJA 1SL8A 3VRQA 2ISDA 3WHUB 1QXPA 1YX7A 5BPJA 1JFJA 2LVJA 2OTGB 3JVTC 4HSZA 4WRIA 4DCKA 5HKYA 1IQ3A 1DF0B 1E8AA 3KEVA 3OX6A 2KOTA 3O6BA 1CFFA 1Y0VH 2V53A 1F71A 1F4OA 2SCPA 3PN7C 4MBEA 2JC2A 3BYAA 3SG4A 5AEQA 2NZ0A 1BOCA 4CLNA 3PALA 1PULA 2G9BA 1MWNA 1OMVA 1S6CA 1BMOA 4D1EA 1KFUS 1UHIA 2MJWB 1ZUZA 2PMYA 1B8CA 1KSOA 2AUCA 1KFXL 1NSHA 1M39A 3OP0A 2M97A 1AHRA 3DF0A 2L5XB 4GUKA 1UHHA 1CLMA 2K8MB 4C0LA 1J1EA 1B9AA 1IRJA 2VRGA 3EKHA 3OB1B 2JNXA 2CXJA 2Q91A 2M0RA 2MA2A 1SW8A 2BBMA 1FF1A 1B4CA 3HCMA 3NSOA 1YR5A 3I5HC 5AFPA 1DJZA 2RGIA 1IJ6A 2NCPA 1BODA 3VRNA 4AQJA 4DUQA 2JXLA 1AP4A 1SCVA 4YI9A 2CTNA 2GV5A 1Y1UA 4TNCA 2L4HA 2L2EA 2HQ8A 1M45A 2PRUA 1DJYA 1SKTA 4E68A 1QASA 3CWGA 1Y1AA 1SPYA 1RTP1 1JFKA 1QJTA 1K8UA 2L51A 1A2XA 3LK1A 3GK4X 2BL0B 1DT7B 1L2OC 1DJGA 3DVKA 4M2OA 3DVJA 4P2YB 2KFFA 2AMIA 1BR4B 1JC2A 2LLTA 1FPWA 1R2UA 1NYAA 2PVBA 2LCPA 2LV7A 5J3XA 4M2QA 2OS8B 3A8RA 3ZWHA 2KAYA 1PK0D 3I5GC 3JTDB 2KQYA 4I5NB 2NLNA 1GJYA 1IG5A 1OQPA 2KI6D 1IKUA 1QV1A 1PVAA 4YGAA 1EH2A 1K95A 1PALA 1YUTA 2BE4A 1ZMZA 3NSLA 1TNWA 2H2KA 3O4YA 1EXRA 1K96A 1SCMB 1IGVA 1B7TZ 4MZLA 1S36A 4ETOA 4QJ5B 1D1OA 3CLNA 1ALWA 1DMOA 2CBLA 2F8PA 2LLSA 2KI4B 4C0JA 1BU3A 1KK8B 4BY4A 1GQMA 1F54A 4JQ0D 2MAZA 2LHLA 1CKKA 4PCWA 2JPTA 3I5IC 2LC5A 5B8IB 2LNKA 2JULA 3BUWB 1JF0A 3PSRA 1J7PA 1YURA 3CR5X 1KQMB 1G33A 4MEWA 1MF8B 1CDMA 2FOTA 1UWOA 2M9GA 4GFTA 1LVCD 1S6IA 1JWDA 1DF0A 1SYMA 1KSMA 5GQQC 1PRWA 1K9KA 4GNKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRU B;  3EK4 A;  2SAS A;  4OCI A;  2K61 A;  4YI8 A;  1TCO B;  1YTZ C;  1YRT B;  2Q4U A;  4QJ3 B;  1KCY A;  1IJ5 A;  1NIW A;  4YGE B;  4C0K A;  4HRG A;  1A4P A;  4GGF A;  3BOW B;  2FJU B;  2L4I A;  4PE4 A;  5IBW A;  1KWO C;  3LCP C;  1NWD A;  3CTN A;  1DGU A;  1CDN A;  1PSR A;  1XA5 A;  1JBA A;  1C07 A;  2EHB A;  3EK8 A;  4OKH A;  1G4Y R;  1KFU L;  4PAL A;  1IWQ A;  1QS7 A;  1MXL C;  1UUS A;  2NXQ A;  5HKZ A;  4YGD B;  1XFY O;  3JVT B;  4L9M A;  4PDZ A;  4NQG A;  2P6B B;  1YVH A;  5DKQ A;  2JT0 A;  3O78 A;  2JNF A;  1DTL A;  1OMR A;  1XYD A;  2LVI A;  3AAK A;  3EKJ A;  4A4B A;  2OPO A;  1QAT A;  4N5X A;  3PN7 B;  1QV0 A;  2CNP A;  4PE0 A;  2JT8 A;  2OTG C;  1RJV A;  5DKR A;  1CFP A;  3LLE A;  4GAO A;  2EC6 C;  4USL A;  3TUY C;  2BCX A;  3IQQ A;  3KPX A;  1PSB A;  2KFH A;  1W7J B;  1S3P A;  2JU0 A;  2LAN A;  2ZRT A;  1LXF C;  3PAT A;  1H4B A;  2QPT A;  2F2O A;  3TS5 C;  1SR6 C;  3TDI A;  4OV2 A;  4DRW A;  3DVM A;  1BG1 A;  2LP2 A;  3LL8 B;  4PE1 A;  1TOP A;  2M3W A;  5KTY A;  4DIR A;  1F4Q A;  1MXE A;  1UP5 A;  2BKI B;  2PSR A;  4GBA A;  2JOJ A;  1NX2 A;  1CB1 A;  1N2D A;  3FS7 A;  3I5H B;  1OZS A;  3VRP A;  5AXI A;  3I5F C;  5K89 A;  1U5I B;  1J1D A;  3SG5 A;  1QLS A;  2O5G A;  2KYC A;  2LMU A;  2MRD A;  1B7T Y;  1QVI Z;  2GGZ A;  5ER4 X;  2BCA A;  2JTZ A;  2AAO A;  4ORA B;  1QLK A;  2KSP A;  2K7D A;  2KQ6 A;  1IH0 A;  1B1G A;  1TIZ A;  3BXK A;  3EVR A;  4PHM A;  2ZN8 A;  2LLU A;  1B8R A;  1DJW A;  3TZ1 A;  2L0P A;  1EL4 A;  4GPL B;  1L2O B;  1NP8 A;  1AJ5 A;  4PHN A;  2MHH A;  3LK0 A;  3DVE A;  2ZRS A;  3EK7 A;  4HRH A;  2QAC A;  1UHJ A;  3FWC A;  1ZAC A;  4AOM A;  2D8N A;  1LKJ A;  3VRR A;  3CGA A;  4UPG A;  1CDP A;  3IF7 A;  5G08 A;  1WY9 A;  2JT3 A;  2LMT A;  3D10 A;  5AAN A;  3I5G B;  1K90 D;  1XFX O;  2GGM A;  4DS7 A;  1XK4 A;  2HQW A;  3K21 A;  4A4C A;  1H8B A;  1SK6 D;  1WLM A;  1M31 A;  2PAS A;  3DD4 A;  4PE7 A;  3KF9 A;  2JWW A;  4XYN A;  1NX0 A;  1QX2 A;  1A29 A;  5KSZ A;  4XJK B;  2LM5 A;  1EG4 A;  2PAL A;  2BCB A;  1Y6W A;  1W7I B;  2H61 A;  3GK2 A;  3PFV A;  3CZT X;  3ZNI A;  4CFR A;  1JUO A;  3ICB A;  1DJI A;  2E30 A;  1A75 B;  3BOW A;  2LUC A;  2CCM A;  1MHO A;  2I18 A;  3I5I B;  1SL7 A;  4JWQ A;  5JJG A;  1YVL A;  4M2P A;  1K9U A;  2M8U A;  3TDU A;  1L7Z A;  3OHM B;  1V1G A;  1LA0 A;  1N65 A;  3AKA A;  3BUN B;  3TDZ A;  1KK8 C;  1CDL A;  4NDC A;  1RWY A;  3SJS A;  2KDH A;  1PVB A;  1SBJ A;  2WCF A;  2K0J A;  1J7R A;  3BQ3 A;  3SIA A;  1CM4 A;  4NDD A;  1CFC A;  1HQV A;  1Q80 A;  4CFQ A;  4IL1 A;  1S5G Y;  2BE6 A;  2LVK A;  4FTG A;  5F6T A;  2Y1N A;  5HLO A;  1M46 A;  2F33 A;  2M49 B;  1KK7 Y;  1NX3 A;  1A03 A;  2IS9 A;  1XFV O;  2KBM A;  1DGV A;  1OE9 B;  3OX5 A;  2NCO A;  3OB2 B;  2HET A;  1IQ5 A;  1BLQ A;  4CID A;  4F0Z B;  1KWO B;  2M29 A;  1HT9 A;  1CTR A;  4MLW A;  4PHJ A;  5JOL A;  2MLF C;  1Y1X A;  1FI6 A;  1DJH A;  2G2B A;  3FIA A;  3CR2 A;  1XO5 A;  3NSK A;  1F55 A;  2JXC A;  4I5J A;  2KHN A;  4WQ2 A;  2WND A;  1WDC C;  1SL9 A;  1UHN A;  2ZKM X;  5CSF A;  2COL B;  4YRU A;  2Y4Q A;  3NSI A;  3EVV A;  1XVJ A;  1S5G Z;  2KAX A;  5KU1 A;  2ZND A;  2R2I A;  1FBV A;  1U5I A;  1RK9 A;  1SRA A;  1QVI Y;  2CT9 A;  1F70 A;  1TCF A;  1KK7 Z;  2B1U A;  2LMV A;  4MZK A;  2ZNE A;  4CPV A;  3D0Y B;  2EC6 B;  3TUY B;  4OVN F;  1OOJ A;  1CMG A;  3PLF B;  4ICB A;  2M1U A;  5I8N A;  3FWB A;  2WOR A;  4MSP A;  5CSN A;  3IQO A;  3WXA A;  1F8H A;  1VRK A;  4AQI A;  2Y1M A;  3SG6 A;  2LUX A;  3TS5 B;  1GGZ A;  1SR6 B;  1TNQ A;  3RLZ A;  1K93 D;  1DJX A;  4GGF C;  1QX7 A;  1K94 A;  1ZFS A;  3WHT B;  1FW4 A;  5AER A;  5D69 A;  1JSA A;  2F3Y A;  1WRZ A;  1REC A;  3E3R A;  2KGB C;  4YGB B;  1ODB A;  5I2O A;  1MQ1 A;  1NCX A;  2LP3 A;  3I5F B;  4GGN A;  1AK8 A;  1B47 A;  3M0W A;  1YUS A;  2JTT A;  1NCZ A;  1ZOT B;  1G8I A;  2KI6 C;  4I5L B;  4MZJ A;  1GGW A;  2L50 A;  3SG2 A;  1S6J A;  2BBN A;  2DOQ A;  2LE9 B;  1XFZ O;  1JF2 A;  2BEC A;  3HX4 A;  4HRE E;  5TNC A;  3H4S E;  3BUM B;  2F2P A;  4XJK A;  1CLL A;  1WRK A;  2WOS A;  3F45 A;  2MBX A;  1SY9 A;  1TNP A;  3MSE B;  2KGR A;  2ZFD A;  4YGC B;  4N1G A;  5CPV A;  1QIW A;  2M7L A;  2ZN9 A;  1OZO A;  3SIB A;  4R1E A;  5ER5 A;  2TN4 A;  1DVI A;  1LIN A;  1EG3 A;  1YX8 A;  1S1E A;  4OR9 B;  1A75 A;  1KFX S;  3QRX A;  1AJ4 A;  2WCE A;  4I5K A;  3PM8 A;  3BUO B;  2O60 A;  3EVU A;  4JPZ B;  1FI5 A;  2BL0 C;  4Q04 A;  2JQ6 A;  1WLZ A;  1MR8 A;  1XFW O;  3CS1 A;  1J7Q A;  1KQV A;  2KFG A;  2K2A A;  2WCB A;  1EJ3 A;  1OSA A;  1UUR A;  3DF0 B;  5D7F A;  2FCE A;  5CSJ A;  2KBI A;  3CR4 X;  1N0Y A;  2JZI A;  2KAV A;  1CM1 A;  4ORB B;  5FYX A;  5HYD A;  3SG3 A;  2OS8 C;  3KHE A;  1TTX A;  1NUB A;  1UHK A;  1WRL A;  2A4J A;  1M63 B;  3JTD C;  1OMD A;  1K9P A;  4QJ4 B;  1QTX A;  2I2R E;  2Y5I A;  2HPS A;  2EGD A;  5DKN A;  3A4U B;  5HKW A;  2MLE C;  2E6W A;  3VRO A;  1SCM C;  1SNL A;  5HLV A;  4ORC B;  2KNE A;  3RM1 A;  4YBH B;  3BUX B;  2KI4 C;  1CLB A;  1XFU O;  1BR1 B;  2LAP A;  4MRY A;  1SMG A;  3WNX B;  2I94 A;  3SG7 A;  4WQ3 A;  2JRF A;  4N1F A;  4MN0 A;  5PAL A;  1K2H A;  4P5O E;  4ZCV A;  2WC8 A;  1J55 A;  1J7O A;  1ALV A;  4BY5 A;  3KO0 A;  4FQO A;  1AVS A;  1TNX A;  5CSI A;  2HF5 A;  1BT6 A;  1R6P A;  1X02 A;  2M1K B;  2FCD A;  3NXA A;  4U8D A;  4ZCU A;  1KQM C;  1TRF A;  2KYF A;  1YUU A;  1XK4 C;  1AUI B;  1BJF A;  2I7A A;  2K2F A;  2LVV A;  3GK1 A;  3O2P A;  1CMF A;  1CFD A;  2BKH B;  1NCY A;  1MUX A;  1CNP A;  1NX1 A;  2F3Z A;  2K7O A;  3D0Y A;  5I2Q A;  1C7W A;  2K7C A;  3C1V A;  3VGO A;  4MVF A;  2LHI A;  1S26 D;  2H61 C;  1TN4 A;  2L98 A;  2M7N A;  2K7B A;  3AAJ A;  5I2L A;  1LA3 A;  1BF5 A;  4PHK A;  3AKB A;  4NDB A;  3GOF A;  1WDC B;  4MRX A;  1B8L A;  1QIV A;  1NPQ A;  1C7V A;  1RRO A;  1QX5 B;  1V1F A;  1RFJ A;  1SL8 A;  3VRQ A;  2ISD A;  3WHU B;  1QXP A;  1YX7 A;  5BPJ A;  1JFJ A;  2LVJ A;  2OTG B;  3JVT C;  4HSZ A;  4WRI A;  4DCK A;  5HKY A;  1IQ3 A;  1DF0 B;  1E8A A;  3KEV A;  3OX6 A;  2KOT A;  3O6B A;  1CFF A;  1Y0V H;  2V53 A;  1F71 A;  1F4O A;  2SCP A;  3PN7 C;  4MBE A;  2JC2 A;  3BYA A;  3SG4 A;  5AEQ A;  2NZ0 A;  1BOC A;  4CLN A;  3PAL A;  1PUL A;  2G9B A;  1MWN A;  1OMV A;  1S6C A;  1BMO A;  4D1E A;  1KFU S;  1UHI A;  2MJW B;  1ZUZ A;  2PMY A;  1B8C A;  1KSO A;  2AUC A;  1KFX L;  1NSH A;  1M39 A;  3OP0 A;  2M97 A;  1AHR A;  3DF0 A;  2L5X B;  4GUK A;  1UHH A;  1CLM A;  2K8M B;  4C0L A;  1J1E A;  1B9A A;  1IRJ A;  2VRG A;  3EKH A;  3OB1 B;  2JNX A;  2CXJ A;  2Q91 A;  2M0R A;  2MA2 A;  1SW8 A;  2BBM A;  1FF1 A;  1B4C A;  3HCM A;  3NSO A;  1YR5 A;  3I5H C;  5AFP A;  1DJZ A;  2RGI A;  1IJ6 A;  2NCP A;  1BOD A;  3VRN A;  4AQJ A;  4DUQ A;  2JXL A;  1AP4 A;  1SCV A;  4YI9 A;  2CTN A;  2GV5 A;  1Y1U A;  4TNC A;  2L4H A;  2L2E A;  2HQ8 A;  1M45 A;  2PRU A;  1DJY A;  1SKT A;  4E68 A;  1QAS A;  3CWG A;  1Y1A A;  1SPY A;  1RTP 1;  1JFK A;  1QJT A;  1K8U A;  2L51 A;  1A2X A;  3LK1 A;  3GK4 X;  2BL0 B;  1DT7 B;  1L2O C;  1DJG A;  3DVK A;  4M2O A;  3DVJ A;  4P2Y B;  2KFF A;  2AMI A;  1BR4 B;  1JC2 A;  2LLT A;  1FPW A;  1R2U A;  1NYA A;  2PVB A;  2LCP A;  2LV7 A;  5J3X A;  4M2Q A;  2OS8 B;  3A8R A;  3ZWH A;  2KAY A;  1PK0 D;  3I5G C;  3JTD B;  2KQY A;  4I5N B;  2NLN A;  1GJY A;  1IG5 A;  1OQP A;  2KI6 D;  1IKU A;  1QV1 A;  1PVA A;  4YGA A;  1EH2 A;  1K95 A;  1PAL A;  1YUT A;  2BE4 A;  1ZMZ A;  3NSL A;  1TNW A;  2H2K A;  3O4Y A;  1EXR A;  1K96 A;  1SCM B;  1IGV A;  1B7T Z;  4MZL A;  1S36 A;  4ETO A;  4QJ5 B;  1D1O A;  3CLN A;  1ALW A;  1DMO A;  2CBL A;  2F8P A;  2LLS A;  2KI4 B;  4C0J A;  1BU3 A;  1KK8 B;  4BY4 A;  1GQM A;  1F54 A;  4JQ0 D;  2MAZ A;  2LHL A;  1CKK A;  4PCW A;  2JPT A;  3I5I C;  2LC5 A;  5B8I B;  2LNK A;  2JUL A;  3BUW B;  1JF0 A;  3PSR A;  1J7P A;  1YUR A;  3CR5 X;  1KQM B;  1G33 A;  4MEW A;  1MF8 B;  1CDM A;  2FOT A;  1UWO A;  2M9G A;  4GFT A;  1LVC D;  1S6I A;  1JWD A;  1DF0 A;  1SYM A;  1KSM A;  5GQQ C;  1PRW A;  1K9K A;  4GNK B; 
#chains in the Genus database with same CATH topology
 1YRU B;  3L47 A;  3EK4 A;  2SAS A;  4OCI A;  1Z4H A;  2K61 A;  3R1V A;  4YI8 A;  1TCO B;  1YTZ C;  1YRT B;  2Q4U A;  4INW A;  4QJ3 B;  1KCY A;  1IJ5 A;  1NIW A;  4YGE B;  4C0K A;  4HRG A;  1A4P A;  4GGF A;  3BOW B;  2FJU B;  2L4I A;  4PE4 A;  1OOF A;  5IBW A;  1KWO C;  3SS5 A;  3LCP C;  1NWD A;  3CTN A;  1DGU A;  1CDN A;  1PSR A;  1XA5 A;  1JBA A;  1C07 A;  2EHB A;  3EK8 A;  4OKH A;  1G4Y R;  1KFU L;  4PAL A;  1IWQ A;  3RZS A;  1QS7 A;  1MXL C;  1UUS A;  2NXQ A;  5HKZ A;  4JKT A;  4YGD B;  1XFY O;  3JVT B;  4L9M A;  4PDZ A;  4NQG A;  2P6B B;  1YVH A;  5DKQ A;  2JT0 A;  3O78 A;  2JNF A;  1DTL A;  1OMR A;  1XYD A;  2LVI A;  3AAK A;  3EKJ A;  4A4B A;  3L4A A;  2OPO A;  1QAT A;  4N5X A;  3PN7 B;  1OOG A;  3VB1 A;  1QV0 A;  3R72 A;  2CNP A;  4PE0 A;  2JT8 A;  2OTG C;  1RJV A;  5DKR A;  1CFP A;  3LLE A;  4GAO A;  2EC6 C;  4USL A;  3TUY C;  3B6X A;  2BCX A;  3IQQ A;  3KPX A;  1PSB A;  2KFH A;  1W7J B;  1S3P A;  2JU0 A;  4F7F A;  2LAN A;  2ZRT A;  1LXF C;  3PAT A;  1H4B A;  2QPT A;  2F2O A;  3TS5 C;  1SR6 C;  3TDI A;  4OV2 A;  4DRW A;  3DVM A;  1BG1 A;  2LP2 A;  3LL8 B;  4PE1 A;  1TOP A;  2M3W A;  5KTY A;  4DIR A;  3D76 A;  1F4Q A;  1MXE A;  1UP5 A;  2BKI B;  2PSR A;  4GBA A;  2WCJ A;  2JOJ A;  1NX2 A;  1CB1 A;  1N2D A;  3FS7 A;  3I5H B;  1OZS A;  3VRP A;  5AXI A;  3I5F C;  5K89 A;  1U5I B;  1J1D A;  3SG5 A;  1QLS A;  2O5G A;  2KYC A;  2LMU A;  2MRD A;  3BFB A;  1B7T Y;  1QVI Z;  2GGZ A;  1DC1 A;  5ER4 X;  2BCA A;  4U8D A;  2JTZ A;  2AAO A;  4ORA B;  1QLK A;  2KSP A;  2K7D A;  2KQ6 A;  1IH0 A;  1B1G A;  1TIZ A;  3BXK A;  3EVR A;  4PHM A;  2ZN8 A;  2LLU A;  1B8R A;  1DJW A;  2WCH A;  3TZ1 A;  2L0P A;  1EL4 A;  2BAP A;  4GPL B;  1L2O B;  1NP8 A;  1AJ5 A;  4PHN A;  2MHH A;  3LK0 A;  3SS4 A;  5I94 A;  3DVE A;  2ZRS A;  3EK7 A;  4HRH A;  2QAC A;  1UHJ A;  3K1E A;  3FWC A;  1ZAC A;  4AOM A;  2D8N A;  1LKJ A;  3VRR A;  3CGA A;  4UPG A;  1CDP A;  2L2C A;  3IF7 A;  3D75 A;  5G08 A;  1WY9 A;  2JT3 A;  2LMT A;  3D10 A;  5AAN A;  3I5G B;  1K90 D;  1XFX O;  2GGM A;  4DS7 A;  1XK4 A;  2HQW A;  3K21 A;  4A4C A;  1H8B A;  1SK6 D;  1WLM A;  1M31 A;  2PAS A;  3DD4 A;  3NHT A;  3KF9 A;  2JWW A;  4PE7 A;  4XYN A;  1NX0 A;  1QX2 A;  1C3Z A;  1A29 A;  5KSZ A;  4XJK B;  2LM5 A;  1EG4 A;  2PAL A;  2BCB A;  1Y6W A;  1W7I B;  2H61 A;  3EG5 B;  3GK2 A;  3D73 A;  2GTE A;  3CZ1 A;  3PFV A;  3CZT X;  3ZNI A;  4CFR A;  1JUO A;  3ICB A;  1DJI A;  2E30 A;  1A75 B;  2P70 A;  3BOW A;  2LUC A;  2CCM A;  1MHO A;  2I18 A;  3I5I B;  1SL7 A;  4JWQ A;  2KLE A;  5JJG A;  1YVL A;  4M2P A;  1K9U A;  2M8U A;  3TDU A;  1L7Z A;  3OHM B;  3CAB A;  1V1G A;  1LA0 A;  1N65 A;  3AKA A;  3BUN B;  3TDZ A;  1KK8 C;  1CDL A;  4NDC A;  1RWY A;  3SJS A;  2KDH A;  1PVB A;  1SBJ A;  2WCF A;  2K0J A;  1J7R A;  3BQ3 A;  3SIA A;  1CM4 A;  1TUZ A;  4NDD A;  4INX A;  1CFC A;  1HQV A;  1Q80 A;  4CFQ A;  4IL1 A;  1S5G Y;  2BE6 A;  2LVK A;  3CYZ A;  4FTG A;  2Y1N A;  5F6T A;  5HLO A;  1M46 A;  2F33 A;  2M49 B;  1KK7 Y;  3D74 A;  1NX3 A;  1A03 A;  2IS9 A;  1XFV O;  2KBM A;  1DEL A;  1DGV A;  1OE9 B;  3OX5 A;  2NCO A;  3OB2 B;  2HET A;  1IQ5 A;  1BLQ A;  3B88 A;  4CID A;  4F0Z B;  1KWO B;  2M29 A;  1HT9 A;  1CTR A;  4MLW A;  3B87 A;  4PHJ A;  2MLF C;  1Y1X A;  5JOL A;  1FI6 A;  1DJH A;  2G2B A;  3FIA A;  3CR2 A;  1XO5 A;  3NSK A;  1F55 A;  2JXC A;  4I5J A;  2KHN A;  4WQ2 A;  2WND A;  1WDC C;  1SL9 A;  1UHN A;  2ZKM X;  5CSF A;  2COL B;  4YRU A;  3DYE A;  2Y4Q A;  3NSI A;  3EVV A;  1XVJ A;  1S5G Z;  2KAX A;  1DEK A;  5KU1 A;  2ZND A;  2R2I A;  1FBV A;  1U5I A;  3FE6 A;  1RK9 A;  1SRA A;  1QVI Y;  2CT9 A;  1F70 A;  1TCF A;  1KK7 Z;  1IIO A;  2B1U A;  1LS8 A;  3Q8I A;  2LMV A;  4MZK A;  2ZNE A;  4CPV A;  3D0Y B;  2EC6 B;  3TUY B;  4OVN F;  1OOJ A;  1CMG A;  3PLF B;  2WCK A;  2M1U A;  4ICB A;  3FWB A;  5I8N A;  2WOR A;  4MSP A;  5CSN A;  3IQO A;  2WC5 A;  3WXA A;  1F8H A;  1VRK A;  5FI7 A;  4AQI A;  2Y1M A;  2QEV A;  2LUX A;  3SG6 A;  3TS5 B;  1GGZ A;  1SR6 B;  1TNQ A;  3D78 A;  3RLZ A;  1K93 D;  1DJX A;  4GGF C;  1QX7 A;  1K94 A;  1ZFS A;  3WHT B;  1FW4 A;  4OZD A;  3DXL A;  5AER A;  5D69 A;  3S0D A;  1JSA A;  2F3Y A;  1WRZ A;  1REC A;  3E3R A;  2KGB C;  4YGB B;  1ODB A;  5I2O A;  1MQ1 A;  1NCX A;  2LP3 A;  3I5F B;  4GGN A;  1AK8 A;  1B47 A;  2QEH A;  1YUS A;  2JTT A;  1NCZ A;  1ZOT B;  1G8I A;  2KI6 C;  3CDN A;  3M0W A;  4I5L B;  2L50 A;  4MZJ A;  3SG2 A;  1S6J A;  2BBN A;  2DOQ A;  2LE9 B;  3FE9 A;  1XFZ O;  1JF2 A;  2BEC A;  3HX4 A;  4HRE E;  5TNC A;  1ORG A;  3H4S E;  3BUM B;  2FJY A;  2F2P A;  4XJK A;  1CLL A;  1WRK A;  2WOS A;  3F45 A;  2MBX A;  1SY9 A;  1TNP A;  3MSE B;  2KGR A;  2ZFD A;  4FQT A;  4N1G A;  4YGC B;  5CPV A;  1QIW A;  2M7L A;  2ZN9 A;  1OZO A;  3SIB A;  4R1E A;  3R1P A;  2TN4 A;  5ER5 A;  1DVI A;  1LIN A;  3S0E A;  1EG3 A;  1YX8 A;  1S1E A;  4OR9 B;  1A75 A;  1KFX S;  3QRX A;  1AJ4 A;  2WCE A;  4I5K A;  3PM8 A;  3BUO B;  2O60 A;  3SS3 A;  3EVU A;  4JPZ B;  1FI5 A;  2BL0 C;  4Q04 A;  2JQ6 A;  1WLZ A;  1MR8 A;  1XFW O;  3CS1 A;  1J7Q A;  1KQV A;  2KFG A;  2K2A A;  2WCB A;  1EJ3 A;  1OSA A;  1UUR A;  3DF0 B;  2PQL A;  3NHI A;  5D7F A;  2FCE A;  5CSJ A;  2KBI A;  3CR4 X;  1N0Y A;  2JZI A;  2KAV A;  1CM1 A;  4ORB B;  5FYX A;  5HYD A;  3SG3 A;  2OS8 C;  3KHE A;  1TTX A;  1NUB A;  1UHK A;  1WRL A;  2A4J A;  1M63 B;  3JTD C;  1OMD A;  1K9P A;  4QJ4 B;  1QTX A;  5HL1 A;  1C3Y A;  3DY9 A;  2I2R E;  2Y5I A;  2HPS A;  2EGD A;  5DKN A;  3A4U B;  5HKW A;  2MLE C;  1SSE B;  2E6W A;  3VRO A;  1SCM C;  1SNL A;  5HLV A;  1TUJ A;  4ORC B;  2L5Y A;  2KNE A;  3RM1 A;  4YBH B;  3UO9 A;  3BUX B;  2KI4 C;  1CLB A;  1XFU O;  1BR1 B;  2LAP A;  4MRY A;  1SMG A;  3WNX B;  2I94 A;  3SG7 A;  4WQ3 A;  2JRF A;  4N1F A;  4MN0 A;  1Z2C B;  5PAL A;  1K2H A;  4P5O E;  4ZCV A;  2WC8 A;  1J55 A;  1J7O A;  1ALV A;  4BY5 A;  3KO0 A;  4FQO A;  1AVS A;  1TNX A;  4KYN A;  2HF5 A;  1BT6 A;  1R6P A;  1X02 A;  2M1K B;  2FCD A;  2KPH A;  3NXA A;  3R1O A;  1KQM C;  1TRF A;  4ZCU A;  2KYF A;  1YUU A;  1XK4 C;  1AUI B;  1BJF A;  2I7A A;  2K2F A;  2LVV A;  3GK1 A;  3O2P A;  1CMF A;  1CFD A;  2BKH B;  1NCY A;  1MUX A;  1CNP A;  1NX1 A;  2F3Z A;  2K7O A;  3BJH A;  3D0Y A;  5I2Q A;  3S0A A;  1C7W A;  2KLD A;  2K7C A;  5FI2 A;  3C1V A;  3VGO A;  4MVF A;  2LHI A;  1S26 D;  2H61 C;  1TN4 A;  2L98 A;  2M7N A;  3NGV A;  1DQE A;  2K7B A;  3AAJ A;  5I2L A;  1LA3 A;  1BF5 A;  1T14 A;  4PHK A;  5EL2 A;  3AKB A;  4NDB A;  2H8V A;  3GOF A;  1WDC B;  4MRX A;  1B8L A;  1QIV A;  1NPQ A;  1C7V A;  1RRO A;  1QX5 B;  1V1F A;  3OBV A;  1RFJ A;  1SL8 A;  3VRQ A;  2ISD A;  3WHU B;  1QXP A;  1YX7 A;  5BPJ A;  1JFJ A;  3UNW A;  2LVJ A;  2OTG B;  3JVT C;  4HSZ A;  4WRI A;  4DCK A;  5HKY A;  1IQ3 A;  4PT1 A;  1DF0 B;  1E8A A;  3KEV A;  3OX6 A;  2KOT A;  5FI6 A;  3O6B A;  1CFF A;  1Y0V H;  2V53 A;  1F71 A;  1F4O A;  2SCP A;  3PN7 C;  4MBE A;  2JC2 A;  5D3O A;  3BYA A;  3SG4 A;  5AEQ A;  2NZ0 A;  1BOC A;  4CLN A;  3PAL A;  1GGW A;  3DZT A;  1PUL A;  2G9B A;  1MWN A;  1OMV A;  1S6C A;  1BMO A;  4D1E A;  1OOI X;  1KFU S;  1UHI A;  2MJW B;  1ZUZ A;  2PMY A;  1B8C A;  1KSO A;  3B7A A;  5CSI A;  2AUC A;  1KFX L;  1NSH A;  1M39 A;  3CZ0 A;  3N7H A;  3OP0 A;  2M97 A;  1AHR A;  3DF0 A;  3V2L A;  2K60 A;  2L5X B;  4GUK A;  1UHH A;  1CLM A;  2K8M B;  4C0L A;  1J1E A;  1B9A A;  1IRJ A;  2VRG A;  3EKH A;  3OB1 B;  2JNX A;  3CZ2 A;  2CXJ A;  3PJI A;  2Q91 A;  3S0F A;  2M0R A;  2MA2 A;  1SW8 A;  2BBM A;  1FF1 A;  1B4C A;  3HCM A;  3NSO A;  1YR5 A;  3I5H C;  5AFP A;  1DJZ A;  2RGI A;  1IJ6 A;  2NCP A;  3PM2 A;  1BOD A;  3VRN A;  4AQJ A;  4DUQ A;  2JXL A;  1AP4 A;  1SCV A;  4YI9 A;  2CTN A;  2GV5 A;  1Y1U A;  1OOH A;  4IJ7 A;  4TNC A;  2L4H A;  2L2E A;  3S0G A;  2HQ8 A;  2WCL A;  3QME A;  1M45 A;  1W9Z A;  2PRU A;  1DJY A;  1SKT A;  3BFA A;  4E68 A;  1QAS A;  3CWG A;  1GM0 A;  1Y1A A;  1SPY A;  1RTP 1;  2YGU A;  1JFK A;  1QJT A;  1K8U A;  2L51 A;  1A2X A;  2QDI A;  3GK4 X;  2BL0 B;  3LK1 A;  1L2O C;  1DJG A;  3B86 A;  3DVK A;  4M2O A;  3DVJ A;  3BFH A;  4P2Y B;  3FE8 A;  2KFF A;  2AMI A;  1BR4 B;  2WC6 A;  3L4L A;  2LLT A;  1JC2 A;  1FPW A;  1R2U A;  1NYA A;  2PVB A;  2LCP A;  2LV7 A;  5J3X A;  4M2Q A;  2OS8 B;  3A8R A;  3ZWH A;  2KAY A;  1PK0 D;  3I5G C;  3JTD B;  2KQY A;  4I5N B;  2NLN A;  1GJY A;  1IG5 A;  1OQP A;  2KI6 D;  5DIC A;  2JPO A;  2ERB A;  1IKU A;  1QV1 A;  1PVA A;  3D77 A;  3IVT A;  4YGA A;  1EH2 A;  1K95 A;  1PAL A;  1YUT A;  2BE4 A;  1ZMZ A;  2BNX A;  2P71 A;  3NSL A;  1TNW A;  2H2K A;  3O4Y A;  1EXR A;  1K96 A;  1SCM B;  1IGV A;  1B7T Z;  4MZL A;  1S36 A;  4ETO A;  4QJ5 B;  1D1O A;  2WCM A;  1ALW A;  3CLN A;  1DMO A;  1QWV A;  2CBL A;  2F8P A;  2LLS A;  2KI4 B;  3OGN A;  4C0J A;  1BU3 A;  1KK8 B;  4JD9 A;  4BY4 A;  1GQM A;  1XFR A;  1F54 A;  4JQ0 D;  1TWO A;  2MAZ A;  2LHL A;  1OW4 A;  1CKK A;  4PCW A;  2JPT A;  3I5I C;  3S0B A;  2LC5 A;  5B8I B;  2QEO A;  2LNK A;  1DT7 B;  2JUL A;  3BUW B;  1JF0 A;  3PSR A;  1J7P A;  1YUR A;  3CR5 X;  3O4X A;  1KQM B;  1G33 A;  2QEB A;  4MEW A;  1MF8 B;  1CDM A;  2FOT A;  2PYQ A;  1P28 A;  1UWO A;  2M9G A;  4GFT A;  1LVC D;  1S6I A;  1JWD A;  1DF0 A;  1SYM A;  1KSM A;  5GQQ C;  1PRW A;  1K9K A;  4GNK B; 
#chains in the Genus database with same CATH homology
 1YRU B;  3EK4 A;  2SAS A;  4OCI A;  2K61 A;  4YI8 A;  1TCO B;  1YTZ C;  1YRT B;  2Q4U A;  4QJ3 B;  1KCY A;  1IJ5 A;  1NIW A;  4YGE B;  4C0K A;  4HRG A;  1A4P A;  4GGF A;  3BOW B;  2FJU B;  2L4I A;  4PE4 A;  5IBW A;  1KWO C;  3LCP C;  1NWD A;  3CTN A;  1DGU A;  1CDN A;  1PSR A;  1XA5 A;  1JBA A;  1C07 A;  2EHB A;  3EK8 A;  4OKH A;  1G4Y R;  1KFU L;  4PAL A;  1IWQ A;  1QS7 A;  1MXL C;  1UUS A;  2NXQ A;  5HKZ A;  4YGD B;  1XFY O;  3JVT B;  4L9M A;  4PDZ A;  4NQG A;  2P6B B;  1YVH A;  5DKQ A;  2JT0 A;  3O78 A;  2JNF A;  1DTL A;  1OMR A;  1XYD A;  2LVI A;  3AAK A;  3EKJ A;  4A4B A;  2OPO A;  1QAT A;  4N5X A;  3PN7 B;  1QV0 A;  2CNP A;  4PE0 A;  2JT8 A;  2OTG C;  1RJV A;  5DKR A;  1CFP A;  3LLE A;  4GAO A;  2EC6 C;  4USL A;  3TUY C;  2BCX A;  3IQQ A;  3KPX A;  1PSB A;  2KFH A;  1W7J B;  1S3P A;  2JU0 A;  2LAN A;  2ZRT A;  1LXF C;  3PAT A;  1H4B A;  2QPT A;  2F2O A;  3TS5 C;  1SR6 C;  3TDI A;  4OV2 A;  4DRW A;  3DVM A;  1BG1 A;  2LP2 A;  3LL8 B;  4PE1 A;  1TOP A;  2M3W A;  5KTY A;  4DIR A;  1F4Q A;  1MXE A;  1UP5 A;  2BKI B;  2PSR A;  4GBA A;  2JOJ A;  1NX2 A;  1CB1 A;  1N2D A;  3FS7 A;  3I5H B;  1OZS A;  3VRP A;  5AXI A;  3I5F C;  5K89 A;  1U5I B;  1J1D A;  3SG5 A;  1QLS A;  2O5G A;  2KYC A;  2LMU A;  2MRD A;  1B7T Y;  1QVI Z;  2GGZ A;  5ER4 X;  2BCA A;  2JTZ A;  2AAO A;  4ORA B;  1QLK A;  2KSP A;  2K7D A;  2KQ6 A;  1IH0 A;  1B1G A;  1TIZ A;  3BXK A;  3EVR A;  4PHM A;  2ZN8 A;  2LLU A;  1B8R A;  1DJW A;  3TZ1 A;  2L0P A;  1EL4 A;  4GPL B;  1L2O B;  1NP8 A;  1AJ5 A;  4PHN A;  2MHH A;  3LK0 A;  3DVE A;  2ZRS A;  3EK7 A;  4HRH A;  2QAC A;  1UHJ A;  3FWC A;  1ZAC A;  4AOM A;  2D8N A;  1LKJ A;  3VRR A;  3CGA A;  4UPG A;  1CDP A;  3IF7 A;  5G08 A;  1WY9 A;  2JT3 A;  2LMT A;  3D10 A;  5AAN A;  3I5G B;  1K90 D;  1XFX O;  2GGM A;  4DS7 A;  1XK4 A;  2HQW A;  3K21 A;  4A4C A;  1H8B A;  1SK6 D;  1WLM A;  1M31 A;  2PAS A;  3DD4 A;  4PE7 A;  3KF9 A;  2JWW A;  4XYN A;  1NX0 A;  1QX2 A;  1A29 A;  5KSZ A;  4XJK B;  2LM5 A;  1EG4 A;  2PAL A;  2BCB A;  1Y6W A;  1W7I B;  2H61 A;  3GK2 A;  3PFV A;  3CZT X;  3ZNI A;  4CFR A;  1JUO A;  3ICB A;  1DJI A;  2E30 A;  1A75 B;  3BOW A;  2LUC A;  2CCM A;  1MHO A;  2I18 A;  3I5I B;  1SL7 A;  4JWQ A;  5JJG A;  1YVL A;  4M2P A;  1K9U A;  2M8U A;  3TDU A;  1L7Z A;  3OHM B;  1V1G A;  1LA0 A;  1N65 A;  3AKA A;  3BUN B;  3TDZ A;  1KK8 C;  1CDL A;  4NDC A;  1RWY A;  3SJS A;  2KDH A;  1PVB A;  1SBJ A;  2WCF A;  2K0J A;  1J7R A;  3BQ3 A;  3SIA A;  1CM4 A;  4NDD A;  1CFC A;  1HQV A;  1Q80 A;  4CFQ A;  4IL1 A;  1S5G Y;  2BE6 A;  2LVK A;  4FTG A;  5F6T A;  2Y1N A;  5HLO A;  1M46 A;  2F33 A;  2M49 B;  1KK7 Y;  1NX3 A;  1A03 A;  2IS9 A;  1XFV O;  2KBM A;  1DGV A;  1OE9 B;  3OX5 A;  2NCO A;  3OB2 B;  2HET A;  1IQ5 A;  1BLQ A;  4CID A;  4F0Z B;  1KWO B;  2M29 A;  1HT9 A;  1CTR A;  4MLW A;  4PHJ A;  5JOL A;  2MLF C;  1Y1X A;  1FI6 A;  1DJH A;  2G2B A;  3FIA A;  3CR2 A;  1XO5 A;  3NSK A;  1F55 A;  2JXC A;  4I5J A;  2KHN A;  4WQ2 A;  2WND A;  1WDC C;  1SL9 A;  1UHN A;  2ZKM X;  5CSF A;  2COL B;  4YRU A;  2Y4Q A;  3NSI A;  3EVV A;  1XVJ A;  1S5G Z;  2KAX A;  5KU1 A;  2ZND A;  2R2I A;  1FBV A;  1U5I A;  1RK9 A;  1SRA A;  1QVI Y;  2CT9 A;  1F70 A;  1TCF A;  1KK7 Z;  2B1U A;  2LMV A;  4MZK A;  2ZNE A;  4CPV A;  3D0Y B;  2EC6 B;  3TUY B;  4OVN F;  1OOJ A;  1CMG A;  3PLF B;  4ICB A;  2M1U A;  5I8N A;  3FWB A;  2WOR A;  4MSP A;  5CSN A;  3IQO A;  3WXA A;  1F8H A;  1VRK A;  4AQI A;  2Y1M A;  3SG6 A;  2LUX A;  3TS5 B;  1GGZ A;  1SR6 B;  1TNQ A;  3RLZ A;  1K93 D;  1DJX A;  4GGF C;  1QX7 A;  1K94 A;  1ZFS A;  3WHT B;  1FW4 A;  5AER A;  5D69 A;  1JSA A;  2F3Y A;  1WRZ A;  1REC A;  3E3R A;  2KGB C;  4YGB B;  1ODB A;  5I2O A;  1MQ1 A;  1NCX A;  2LP3 A;  3I5F B;  4GGN A;  1AK8 A;  1B47 A;  3M0W A;  1YUS A;  2JTT A;  1NCZ A;  1ZOT B;  1G8I A;  2KI6 C;  4I5L B;  4MZJ A;  1GGW A;  2L50 A;  3SG2 A;  1S6J A;  2BBN A;  2DOQ A;  2LE9 B;  1XFZ O;  1JF2 A;  2BEC A;  3HX4 A;  4HRE E;  5TNC A;  3H4S E;  3BUM B;  2F2P A;  4XJK A;  1CLL A;  1WRK A;  2WOS A;  3F45 A;  2MBX A;  1SY9 A;  1TNP A;  3MSE B;  2KGR A;  2ZFD A;  4YGC B;  4N1G A;  5CPV A;  1QIW A;  2M7L A;  2ZN9 A;  1OZO A;  3SIB A;  4R1E A;  5ER5 A;  2TN4 A;  1DVI A;  1LIN A;  1EG3 A;  1YX8 A;  1S1E A;  4OR9 B;  1A75 A;  1KFX S;  3QRX A;  1AJ4 A;  2WCE A;  4I5K A;  3PM8 A;  3BUO B;  2O60 A;  3EVU A;  4JPZ B;  1FI5 A;  2BL0 C;  4Q04 A;  2JQ6 A;  1WLZ A;  1MR8 A;  1XFW O;  3CS1 A;  1J7Q A;  1KQV A;  2KFG A;  2K2A A;  2WCB A;  1EJ3 A;  1OSA A;  1UUR A;  3DF0 B;  5D7F A;  2FCE A;  5CSJ A;  2KBI A;  3CR4 X;  1N0Y A;  2JZI A;  2KAV A;  1CM1 A;  4ORB B;  5FYX A;  5HYD A;  3SG3 A;  2OS8 C;  3KHE A;  1TTX A;  1NUB A;  1UHK A;  1WRL A;  2A4J A;  1M63 B;  3JTD C;  1OMD A;  1K9P A;  4QJ4 B;  1QTX A;  2I2R E;  2Y5I A;  2HPS A;  2EGD A;  5DKN A;  3A4U B;  5HKW A;  2MLE C;  2E6W A;  3VRO A;  1SCM C;  1SNL A;  5HLV A;  4ORC B;  2KNE A;  3RM1 A;  4YBH B;  3BUX B;  2KI4 C;  1CLB A;  1XFU O;  1BR1 B;  2LAP A;  4MRY A;  1SMG A;  3WNX B;  2I94 A;  3SG7 A;  4WQ3 A;  2JRF A;  4N1F A;  4MN0 A;  5PAL A;  1K2H A;  4P5O E;  4ZCV A;  2WC8 A;  1J55 A;  1J7O A;  1ALV A;  4BY5 A;  3KO0 A;  4FQO A;  1AVS A;  1TNX A;  5CSI A;  2HF5 A;  1BT6 A;  1R6P A;  1X02 A;  2M1K B;  2FCD A;  3NXA A;  4U8D A;  4ZCU A;  1KQM C;  1TRF A;  2KYF A;  1YUU A;  1XK4 C;  1AUI B;  1BJF A;  2I7A A;  2K2F A;  2LVV A;  3GK1 A;  3O2P A;  1CMF A;  1CFD A;  2BKH B;  1NCY A;  1MUX A;  1CNP A;  1NX1 A;  2F3Z A;  2K7O A;  3D0Y A;  5I2Q A;  1C7W A;  2K7C A;  3C1V A;  3VGO A;  4MVF A;  2LHI A;  1S26 D;  2H61 C;  1TN4 A;  2L98 A;  2M7N A;  2K7B A;  3AAJ A;  5I2L A;  1LA3 A;  1BF5 A;  4PHK A;  3AKB A;  4NDB A;  3GOF A;  1WDC B;  4MRX A;  1B8L A;  1QIV A;  1NPQ A;  1C7V A;  1RRO A;  1QX5 B;  1V1F A;  1RFJ A;  1SL8 A;  3VRQ A;  2ISD A;  3WHU B;  1QXP A;  1YX7 A;  5BPJ A;  1JFJ A;  2LVJ A;  2OTG B;  3JVT C;  4HSZ A;  4WRI A;  4DCK A;  5HKY A;  1IQ3 A;  1DF0 B;  1E8A A;  3KEV A;  3OX6 A;  2KOT A;  3O6B A;  1CFF A;  1Y0V H;  2V53 A;  1F71 A;  1F4O A;  2SCP A;  3PN7 C;  4MBE A;  2JC2 A;  3BYA A;  3SG4 A;  5AEQ A;  2NZ0 A;  1BOC A;  4CLN A;  3PAL A;  1PUL A;  2G9B A;  1MWN A;  1OMV A;  1S6C A;  1BMO A;  4D1E A;  1KFU S;  1UHI A;  2MJW B;  1ZUZ A;  2PMY A;  1B8C A;  1KSO A;  2AUC A;  1KFX L;  1NSH A;  1M39 A;  3OP0 A;  2M97 A;  1AHR A;  3DF0 A;  2L5X B;  4GUK A;  1UHH A;  1CLM A;  2K8M B;  4C0L A;  1J1E A;  1B9A A;  1IRJ A;  2VRG A;  3EKH A;  3OB1 B;  2JNX A;  2CXJ A;  2Q91 A;  2M0R A;  2MA2 A;  1SW8 A;  2BBM A;  1FF1 A;  1B4C A;  3HCM A;  3NSO A;  1YR5 A;  3I5H C;  5AFP A;  1DJZ A;  2RGI A;  1IJ6 A;  2NCP A;  1BOD A;  3VRN A;  4AQJ A;  4DUQ A;  2JXL A;  1AP4 A;  1SCV A;  4YI9 A;  2CTN A;  2GV5 A;  1Y1U A;  4TNC A;  2L4H A;  2L2E A;  2HQ8 A;  1M45 A;  2PRU A;  1DJY A;  1SKT A;  4E68 A;  1QAS A;  3CWG A;  1Y1A A;  1SPY A;  1RTP 1;  1JFK A;  1QJT A;  1K8U A;  2L51 A;  1A2X A;  3LK1 A;  3GK4 X;  2BL0 B;  1DT7 B;  1L2O C;  1DJG A;  3DVK A;  4M2O A;  3DVJ A;  4P2Y B;  2KFF A;  2AMI A;  1BR4 B;  1JC2 A;  2LLT A;  1FPW A;  1R2U A;  1NYA A;  2PVB A;  2LCP A;  2LV7 A;  5J3X A;  4M2Q A;  2OS8 B;  3A8R A;  3ZWH A;  2KAY A;  1PK0 D;  3I5G C;  3JTD B;  2KQY A;  4I5N B;  2NLN A;  1GJY A;  1IG5 A;  1OQP A;  2KI6 D;  1IKU A;  1QV1 A;  1PVA A;  4YGA A;  1EH2 A;  1K95 A;  1PAL A;  1YUT A;  2BE4 A;  1ZMZ A;  3NSL A;  1TNW A;  2H2K A;  3O4Y A;  1EXR A;  1K96 A;  1SCM B;  1IGV A;  1B7T Z;  4MZL A;  1S36 A;  4ETO A;  4QJ5 B;  1D1O A;  3CLN A;  1ALW A;  1DMO A;  2CBL A;  2F8P A;  2LLS A;  2KI4 B;  4C0J A;  1BU3 A;  1KK8 B;  4BY4 A;  1GQM A;  1F54 A;  4JQ0 D;  2MAZ A;  2LHL A;  1CKK A;  4PCW A;  2JPT A;  3I5I C;  2LC5 A;  5B8I B;  2LNK A;  2JUL A;  3BUW B;  1JF0 A;  3PSR A;  1J7P A;  1YUR A;  3CR5 X;  1KQM B;  1G33 A;  4MEW A;  1MF8 B;  1CDM A;  2FOT A;  1UWO A;  2M9G A;  4GFT A;  1LVC D;  1S6I A;  1JWD A;  1DF0 A;  1SYM A;  1KSM A;  5GQQ C;  1PRW A;  1K9K A;  4GNK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...