2HQWA

Crystal structure of ca2+/calmodulin bound to nmda receptor nr1c1 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
138
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMDA Receptor NR1 C1 Region Bound to Calmodulin: Structural Insights into Functional Differences between Homologous Domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
molecule keywords Calmodulin
total genus 47
structure length 138
sequence length 144
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hqwA00
1Y1AA 1UHJA 2F33A 2JT0A 3SG2A 1Y6WA 1JFKA 1AJ5A 1A03A 1F70A 1B1GA 4ZCUA 1B4CA 2WCFA 4GGFA 3DVMA 1YUSA 2M97A 3TZ1A 1A4PA 1DF0B 1TCOB 4ORAB 1OSAA 1CDNA 1SW8A 1YVLA 1EXRA 1K90D 1DJIA 1DT7B 2MAZA 2MLEC 2M1KB 1BG1A 1ZMZA 3SIBA 1F4OA 1CKKA 4PHNA 1NX1A 3WHTB 3M0WA 2BBNA 2LV7A 2HQ8A 1K93D 1N2DA 4OKHA 1RK9A 2JPTA 3EVUA 4JPZB 4YI9A 1JFJA 1CDLA 1DTLA 4CIDA 1DF0A 2HPSA 2JT8A 2CNPA 4AQIA 1OZSA 4PALA 3PM8A 4E68A 1NSHA 1J7PA 4I5KA 3BXKA 4Q04A 1YVHA 1XFWO 1NX3A 2LP2A 3TDIA 4PCWA 2WC8A 4GGNA 1CMFA 1WRZA 2Q4UA 3GK4X 1SMGA 2KI4B 4U8DA 2FCDA 1S5GZ 2JTZA 2KGBC 2K0JA 1YUUA 2OS8C 5ER5A 1YRUB 1E8AA 3QRXA 4OVNF 2MA2A 2Y4QA 2EC6B 2L4IA 1IGVA 1IRJA 2K7DA 2JTTA 1AK8A 1DJZA 2GV5A 1QJTA 3GK2A 1B9AA 2BKHB 4P5OE 5KTYA 3EVRA 2MLFC 2HETA 3CR4X 1SY9A 2F3YA 1SCMB 2JNXA 3VRPA 1XK4A 1J55A 3PSRA 1DJHA 2KNEA 4BY5A 3EK8A 1CMGA 2CCMA 2PVBA 4ICBA 5G08A 3EK4A 3RM1A 4TNCA 4N1GA 2OPOA 3I5GC 4CLNA 2LMTA 3EKHA 2F2PA 3DF0A 3NSKA 1QX5B 2ZN8A 4ORBB 1RROA 1CDMA 2MRDA 1PRWA 2IS9A 1MUXA 4PDZA 2PRUA 2LLUA 2KYFA 3LK0A 1AP4A 1CFCA 2JXLA 1SL8A 1QV0A 1YTZC 2AMIA 4MZKA 4NDBA 1FBVA 5ER4X 3I5HC 1MR8A 3FWCA 3F45A 1Q80A 2ZN9A 3BUMB 1QVIZ 4PHKA 1WLMA 1F55A 4WQ2A 4FTGA 4MRXA 1SR6C 1NWDA 1XK4C 3E3RA 1QLSA 5I8NA 3SG7A 1IWQA 1F8HA 1TNWA 1BR1B 4UPGA 2L2EA 1WRKA 1TOPA 2LVJA 3GOFA 1B8LA 2NCPA 5CSIA 2L4HA 4CPVA 3TS5C 1CB1A 3BUOB 2KDHA 1LINA 1WLZA 2QPTA 4PE0A 5HKYA 2BCXA 4WQ3A 4XJKB 1XO5A 1S6IA 4N5XA 2JXCA 1S5GY 3LL8B 4CFRA 3H4SE 2LCPA 3DF0B 3O4YA 1IKUA 3JTDC 2ISDA 3PFVA 3LLEA 1CM4A 4AQJA 2KI6D 2Y1NA 2JULA 2KGRA 1CM1A 1LKJA 3SG3A 2L0PA 3HX4A 1ALWA 1BMOA 3AAJA 3IF7A 2LHIA 3FIAA 5CPVA 4MN0A 2ZNDA 4MZLA 1S1EA 2EGDA 2H61C 2LE9B 1ODBA 4QJ4B 1ZOTB 2O5GA 1TRFA 4HREE 1DJXA 3I5FC 1KK8C 1CLBA 2A4JA 1QX7A 4USLA 3BUWB 1OMVA 2M3WA 4YGAA 4MLWA 1Y1UA 1UP5A 2LANA 1FF1A 1WY9A 3JTDB 4MSPA 2M7LA 1KFXS 3VROA 2ZRSA 3CZTX 1KQVA 2KQYA 2TN4A 2EC6C 4YI8A 3DVJA 3KF9A 2MJWB 1PVBA 2R2IA 3OHMB 5DKQA 1XVJA 5AANA 3EK7A 4DUQA 3IQQA 1K9KA 5KSZA 1J1EA 1NCXA 1MXLC 3D10A 2KI4C 5K89A 4YBHB 3VRRA 4YGBB 1EH2A 3PATA 1QASA 3O78A 1F71A 3ZNIA 4PE7A 1C7WA 4M2QA 3I5GB 3KHEA 3NSOA 4GNKB 1XFYO 1K94A 2P6BB 1SCVA 1LA0A 2NXQA 3OB1B 1UUSA 3OX5A 5I2LA 1WDCC 2L51A 1BT6A 2JC2A 3A4UB 5CSJA 4HSZA 4GBAA 2V53A 1YRTB 2KAXA 1UHNA 4YGCB 3CR2A 1IH0A 1EG3A 1LA3A 2LC5A 3IQOA 4GUKA 4NDCA 1BJFA 3MSEB 3TS5B 1DJYA 1IJ5A 3TDZA 1U5IA 5AEQA 1WRLA 2O60A 1NIWA 1L2OC 4DS7A 1A2XA 4OCIA 4YGDB 1H8BA 2K61A 2LHLA 1M31A 1QIVA 5HLVA 2MHHA 1W7IB 2H61A 1KFUL 1RTP1 3ICBA 5HKWA 1UHKA 2COLB 3NSIA 1CFPA 3DD4A 2M9GA 2VRGA 1OQPA 4GAOA 1KQMC 1G8IA 4JWQA 1V1FA 5TNCA 1K2HA 3BOWA 2F2OA 3C1VA 1RWYA 1TIZA 3I5HB 4ORCB 2E6WA 2JRFA 1QVIY 2PMYA 1KSOA 5AFPA 1KK7Z 1NUBA 1QV1A 5AXIA 1PULA 4FQOA 1OMRA 2WORA 3CLNA 3SJSA 1NP8A 1EL4A 1N65A 1TTXA 1KWOB 3OX6A 4ZCVA 3KEVA 2K7BA 4NQGA 3CR5X 2KAVA 3I5IC 5JOLA 2CT9A 3RLZA 1B8CA 1CFDA 1CTRA 1KFXL 1GGZA 1XYDA 1PALA 4MBEA 3EVVA 1YURA 4A4CA 2K2AA 4BY4A 3CS1A 3VGOA 2FCEA 1NCYA 1DGUA 2Q91A 2OTGB 2BKIB 5KU1A 4AOMA 1J7QA 1SYMA 3KPXA 2JQ6A 2BCBA 3FS7A 1DJGA 2DOQA 4ETOA 5CSNA 3D0YB 1JF2A 2LVVA 1SBJA 1OE9B 3VRQA 2FJUB 3SIAA 2KQ6A 1A75B 4MZJA 3LCPC 2RGIA 4XJKA 1S6JA 1ZACA 2ZKMX 1W7JB 2L50A 3BUXB 1MQ1A 2OTGC 5J3XA 4OR9B 1H4BA 2M8UA 2OS8B 1JC2A 2JWWA 2M1UA 1TCFA 3A8RA 4I5JA 4C0LA 5DKRA 1SL9A 3DVEA 1ALVA 4IL1A 1IJ6A 4XYNA 1BODA 2G2BA 2CTNA 1SRAA 1BR4B 1MHOA 1RJVA 3HCMA 5GQQC 5D69A 5HYDA 1FPWA 1U5IB 1GGWA 2M7NA 1R6PA 4L9MA 1JF0A 1K95A 1XFUO 3TUYB 3AAKA 4PHMA 1A29A 4D1EA 1TNPA 1BOCA 2HQWA 1QXPA 1IQ5A 2L98A 5I2QA 1JBAA 4GFTA 2H2KA 3ZWHA 5BPJA 1B7TZ 3SG6A 1CNPA 2ZFDA 2KSPA 2Y1MA 2KHNA 3VRNA 3NXAA 2PALA 2KBIA 4P2YB 1BLQA 4HRGA 3WNXB 1NPQA 1X02A 3D0YA 4QJ3B 1EG4A 1RECA 2LLSA 3OP0A 1CLLA 3NSLA 1M45A 2BBMA 4DRWA 2F8PA 4QJ5B 3O6BA 5JJGA 4PE1A 1HT9A 2MBXA 4MRYA 1DMOA 1Y1XA 1DGVA 2KYCA 1EJ3A 1M63B 2NZ0A 4PE4A 1J7OA 1SR6B 3I5FB 1B47A 1QTXA 5DKNA 3AKAA 1KQMB 1XFVO 4MEWA 1V1GA 3WXAA 1F54A 1DJWA 1OMDA 1UHHA 2JOJA 2SCPA 4HRHA 3SG4A 2D8NA 1GQMA 3DVKA 1PSRA 4M2OA 4PHJA 2BE4A 1B7TY 1AUIB 1OOJA 1J1DA 1ZUZA 1KFUS 1OZOA 1SPYA 4N1FA 2EHBA 1K8UA 2KI6C 2LLTA 3AKBA 3CWGA 4MVFA 1CDPA 2KOTA 5D7FA 1PK0D 2WCEA 1HQVA 1L7ZA 1LVCD 1QIWA 4GPLB 2AUCA 1TNQA 2LM5A 2G9BA 3JVTB 1UWOA 3PALA 1SL7A 1FI6A 2LMUA 4A4BA 1NYAA 2BCAA 3PN7B 2CBLA 2Y5IA 2I7AA 1G4YR 3SG5A 2KFHA 1S6CA 1UHIA 2K8MB 1SKTA 1KWOC 1CFFA 1MXEA 2LVKA 3BYAA 1M39A 2LUXA 2HF5A 2KAYA 1B8RA 1QATA 4OV2A 3JVTC 2KFFA 2PSRA 1RFJA 4DIRA 1C7VA 2WCBA 3FWBA 2LAPA 4C0KA 1MF8B 4C0JA 5I2OA 3TUYC 1D1OA 2L5XB 3BUNB 3OB2B 4JQ0D 5F6TA 1SNLA 1IQ3A 3CGAA 1YX8A 1R2UA 2I18A 3KO0A 1PSBA 2JT3A 5IBWA 2F3ZA 1S3PA 1BF5A 3WHUB 2KBMA 1JSAA 2JU0A 1C07A 2K7OA 1YR5A 1J7RA 2GGZA 2LNKA 1BU3A 1XFXO 1KSMA 3PN7C 4WRIA 1L2OB 1ZFSA 1SCMC 2BECA 4I5LB 4YGEB 1NX0A 1AHRA 2B1UA 1FW4A 1KK7Y 2CXJA 2M49B 1GJYA 1PVAA 1F4QA 2LUCA 1A75A 1JWDA 2LVIA 1K9PA 1XA5A 4NDDA 1K9UA 1S26D 1SK6D 5HLOA 2GGMA 4F0ZB 1Y0VH 1AVSA 2M0RA 3GK1A 4M2PA 1NCZA 2E30A 1XFZO 2WNDA 1LXFC 1WDCB 1K96A 2LP3A 4GGFC 5CSFA 4DCKA 1QX2A 3CTNA 1TNXA 1QS7A 2JZIA 2BE6A 5B8IB 1G33A 2NCOA 2BL0B 3I5IB 1M46A 2BL0C 1YX7A 2K7CA 1QLKA 2AAOA 4YRUA 2QACA 4I5NB 3BQ3A 3TDUA 3K21A 3PLFB 2LMVA 5HKZA 1N0YA 1VRKA 2PASA 4CFQA 1UURA 2K2FA 2M29A 2FOTA 1YUTA 2JNFA 1KK8B 1NX2A 1MWNA 5FYXA 2KFGA 5PALA 1JUOA 4R1EA 2ZNEA 1IG5A 2I2RE 3EKJA 1KCYA 2I94A 1TN4A 2WOSA 1S36A 1FI5A 1DVIA 1AJ4A 2ZRTA 3BOWB 3LK1A 5AERA 2SASA 3O2PA 2NLNA 1CLMA
chains in the Genus database with same CATH superfamily
1Y1AA 1UHJA 2F33A 2JT0A 3SG2A 1Y6WA 1JFKA 1AJ5A 1A03A 1F70A 1B1GA 4ZCUA 1B4CA 2WCFA 4GGFA 3DVMA 1YUSA 2M97A 1OOFA 3TZ1A 5FI6A 1OOIX 4FQTA 1A4PA 1DF0B 1TCOB 4ORAB 1OSAA 1CDNA 1SW8A 1YVLA 1EXRA 1K90D 1DJIA 3DZTA 1DT7B 2MAZA 2MLEC 2M1KB 1BG1A 1ZMZA 3SIBA 1F4OA 1CKKA 4PHNA 1NX1A 3WHTB 3M0WA 2BBNA 2LV7A 2HQ8A 1K93D 1N2DA 4OKHA 1RK9A 2JPTA 3EVUA 4JPZB 4YI9A 1JFJA 1CDLA 2YGUA 1DTLA 2WCJA 1DF0A 2HPSA 4CIDA 2JT8A 2L2CA 2CNPA 5I94A 4AQIA 1OZSA 4PALA 3PM8A 1IIOA 3BFAA 1NSHA 4E68A 3DXLA 1J7PA 3DY9A 4I5KA 3BXKA 4Q04A 1YVHA 1XFWO 3PM2A 1NX3A 2LP2A 3TDIA 4PCWA 2WC8A 4GGNA 1CMFA 1WRZA 2Q4UA 3DYEA 1SMGA 2KI4B 3GK4X 4U8DA 2FCDA 1S5GZ 2JTZA 2KGBC 4OZDA 3RZSA 2K0JA 1YUUA 3K1EA 2OS8C 5ER5A 1YRUB 3B7AA 5D3OA 1E8AA 3QRXA 4OVNF 2MA2A 2Y4QA 1OOHA 2EC6B 2L4IA 1IGVA 1Z4HA 2BNXA 1IRJA 2K7DA 2JTTA 1AK8A 1DJZA 1QJTA 2GV5A 3GK2A 1B9AA 2BKHB 1T14A 4P5OE 5KTYA 3EVRA 2MLFC 2HETA 3CR4X 1SY9A 2F3YA 2WCKA 1SCMB 2JNXA 3VRPA 3R72A 1XK4A 1J55A 3PSRA 3CZ0A 1DJHA 2KNEA 4BY5A 3EK8A 1CMGA 2CCMA 3S0DA 2PVBA 4ICBA 5G08A 3EK4A 3RM1A 4TNCA 4N1GA 2OPOA 3I5GC 1DEKA 4CLNA 2LMTA 1DQEA 3EKHA 2F2PA 3DF0A 3NSKA 1QX5B 2ZN8A 3CYZA 1RROA 4ORBB 1CDMA 2MRDA 1PRWA 2IS9A 1MUXA 4PDZA 2PRUA 1ORGA 2LLUA 2KYFA 3LK0A 1AP4A 1CFCA 2JXLA 4IJ7A 1SL8A 1QV0A 1YTZC 2AMIA 4MZKA 4NDBA 3S0AA 2H8VA 1FBVA 5ER4X 3I5HC 1MR8A 3FWCA 3F45A 1Q80A 2ZN9A 3BUMB 1QVIZ 4PHKA 1WLMA 1F55A 4WQ2A 4FTGA 4MRXA 1SR6C 1NWDA 1XK4C 1GM0A 3B86A 1QLSA 3E3RA 5I8NA 3SG7A 1IWQA 1F8HA 1TNWA 1BR1B 3FE9A 4UPGA 2L2EA 1WRKA 1TOPA 3UNWA 2LVJA 3GOFA 1B8LA 2NCPA 5CSIA 2L4HA 4CPVA 3TS5C 1CB1A 3BUOB 2KDHA 1LINA 1WLZA 2QPTA 3FE6A 4PE0A 2BCXA 5HKYA 4WQ3A 4XJKB 3SS5A 1XO5A 1S6IA 1XFRA 4N5XA 2JXCA 1S5GY 3LL8B 4CFRA 3H4SE 2LCPA 3CZ2A 3DF0B 3O4YA 1IKUA 3JTDC 2ISDA 2K60A 3PFVA 3LLEA 3NHIA 1CM4A 2WCHA 4AQJA 2KI6D 2Y1NA 2JULA 3EG5B 2KGRA 1CM1A 1LKJA 4JD9A 3SG3A 2L0PA 3HX4A 1ALWA 3FE8A 1BMOA 3AAJA 3IF7A 2LHIA 3FIAA 4INXA 5CPVA 4MN0A 2ZNDA 4MZLA 1S1EA 2EGDA 2H61C 2LE9B 1DELA 1ODBA 4QJ4B 1W9ZA 1ZOTB 2O5GA 1TRFA 4HREE 1DJXA 1OOGA 3I5FC 1KK8C 1CLBA 2A4JA 1QX7A 4USLA 3BUWB 3S0EA 1OMVA 2M3WA 4YGAA 4MLWA 1Y1UA 1UP5A 2LANA 3OGNA 1FF1A 1WY9A 3JTDB 4MSPA 2M7LA 1KFXS 3VROA 2ZRSA 3B88A 3CZTX 2KQYA 2TN4A 2EC6C 3R1PA 4YI8A 3DVJA 3KF9A 2MJWB 1PVBA 2R2IA 3OHMB 5DKQA 1XVJA 2WC6A 5AANA 3EK7A 4DUQA 3CZ1A 3IQQA 1K9KA 5KSZA 1J1EA 1NCXA 3L47A 1MXLC 3D10A 1C3YA 2KI4C 2JPOA 5K89A 4YBHB 3VRRA 1Z2CB 4YGBB 1EH2A 3PATA 1QASA 3O78A 1F71A 3ZNIA 4PE7A 1C7WA 4M2QA 3I5GB 3KHEA 3PJIA 3NSOA 4GNKB 1XFYO 1K94A 2P6BB 1SCVA 1LA0A 2NXQA 3D78A 1UUSA 3OB1B 3OX5A 5I2LA 1DC1A 1WDCC 2L51A 1BT6A 2JC2A 3A4UB 5CSJA 4HSZA 4GBAA 2V53A 1YRTB 2KAXA 1UHNA 4YGCB 3CR2A 1IH0A 1EG3A 1LA3A 2LC5A 2PQLA 3IQOA 4GUKA 4NDCA 1BJFA 3MSEB 3TS5B 1DJYA 1IJ5A 2P71A 3TDZA 1U5IA 5AEQA 1WRLA 2O60A 1NIWA 1TUZA 1L2OC 4DS7A 1A2XA 4OCIA 4YGDB 1H8BA 2K61A 2LHLA 1M31A 1QIVA 5HLVA 2MHHA 1W7IB 2H61A 2QEVA 1KFUL 1RTP1 3ICBA 5HKWA 1UHKA 2COLB 3NSIA 1CFPA 3DD4A 2M9GA 2VRGA 1OQPA 4GAOA 1KQMC 1G8IA 4JWQA 5HL1A 1V1FA 5TNCA 3O4XA 1K2HA 3B87A 3BOWA 2F2OA 3C1VA 1RWYA 1TIZA 3I5HB 4ORCB 2E6WA 2JRFA 1QVIY 2PMYA 1KSOA 1LS8A 3D73A 5AFPA 1KK7Z 1NUBA 2KLDA 1QV1A 5AXIA 1PULA 4FQOA 1OMRA 2WORA 3SS3A 3CLNA 3SJSA 1NP8A 1EL4A 1N65A 1TTXA 1KWOB 3OX6A 4ZCVA 3KEVA 2K7BA 4NQGA 3R1VA 3CR5X 2KAVA 3CDNA 3I5IC 2CT9A 5JOLA 3RLZA 1B8CA 1CFDA 1CTRA 1KFXL 1GGZA 1XYDA 1PALA 2ERBA 4MBEA 3S0BA 3EVVA 3R1OA 5DICA 1YURA 4A4CA 2K2AA 4BY4A 3CS1A 3OBVA 2FCEA 3VGOA 1NCYA 1DGUA 2Q91A 2OTGB 2BKIB 5KU1A 1TUJA 2KLEA 4AOMA 1J7QA 1SYMA 3KPXA 2JQ6A 2BCBA 3FS7A 1DJGA 2DOQA 4ETOA 5CSNA 3D0YB 1JF2A 3D74A 2LVVA 1SBJA 1OE9B 3VRQA 2FJUB 3SIAA 2KQ6A 1A75B 4MZJA 3LCPC 2RGIA 3S0GA 4XJKA 1S6JA 1ZACA 2ZKMX 1W7JB 2L50A 3BUXB 3SS4A 1MQ1A 2OTGC 5J3XA 4OR9B 2QEOA 3BJHA 1H4BA 2M8UA 2OS8B 4JKTA 3UO9A 2JWWA 1JC2A 2M1UA 1TCFA 1OW4A 3A8RA 4I5JA 4C0LA 5DKRA 1SL9A 3DVEA 1ALVA 1SSEB 4IL1A 1IJ6A 4XYNA 1BODA 2G2BA 2CTNA 1SRAA 1BR4B 1MHOA 1RJVA 3HCMA 5GQQC 5D69A 5HYDA 1FPWA 1U5IB 1GGWA 2M7NA 1R6PA 4L9MA 1JF0A 1K95A 1XFUO 3TUYB 2KPHA 3AAKA 4PHMA 1A29A 4D1EA 1TNPA 1BOCA 2HQWA 4KYNA 1QXPA 1IQ5A 2L98A 5I2QA 1JBAA 4GFTA 2H2KA 3ZWHA 5BPJA 1B7TZ 3SG6A 2QEBA 2ZFDA 1CNPA 2KSPA 2Y1MA 2KHNA 3VRNA 3NXAA 2PALA 2KBIA 4P2YB 1BLQA 4HRGA 3WNXB 1NPQA 1X02A 3D0YA 4QJ3B 1EG4A 1RECA 2LLSA 3OP0A 1CLLA 3NSLA 1M45A 2BBMA 4DRWA 2F8PA 4QJ5B 3O6BA 5JJGA 4PE1A 1HT9A 2MBXA 4MRYA 1DMOA 1Y1XA 1DGVA 2KYCA 1EJ3A 1M63B 2NZ0A 4PE4A 1J7OA 1SR6B 3I5FB 1B47A 1QTXA 5DKNA 3AKAA 1KQMB 1XFVO 4MEWA 1V1GA 3WXAA 1F54A 1DJWA 1OMDA 1UHHA 2JOJA 2SCPA 4HRHA 3SG4A 2D8NA 1KQVA 1GQMA 3DVKA 4F7FA 1PSRA 4M2OA 4PHJA 2BE4A 1B7TY 1AUIB 1OOJA 2QEHA 3NGVA 1J1DA 1ZUZA 1KFUS 1OZOA 1SPYA 4N1FA 2EHBA 1K8UA 2KI6C 5FI7A 2LLTA 3AKBA 3CWGA 4MVFA 1CDPA 2KOTA 5D7FA 1PK0D 2WCEA 3V2LA 1HQVA 1L7ZA 1LVCD 1QIWA 4GPLB 2AUCA 1TNQA 2LM5A 2G9BA 3JVTB 1UWOA 1QWVA 4PT1A 3PALA 1SL7A 1FI6A 2LMUA 4A4BA 1NYAA 3BFBA 2BCAA 2WC5A 3PN7B 2CBLA 2Y5IA 2I7AA 1G4YR 3SG5A 2KFHA 1S6CA 1UHIA 2K8MB 1SKTA 1KWOC 1CFFA 3B6XA 1MXEA 2LVKA 3BYAA 1M39A 2L5YA 2LUXA 2HF5A 3IVTA 2KAYA 1B8RA 1QATA 4OV2A 3JVTC 2KFFA 2PSRA 1RFJA 2WCMA 4DIRA 1C7VA 2WCBA 2PYQA 3FWBA 2LAPA 4C0KA 1MF8B 4C0JA 5I2OA 3TUYC 3D77A 1D1OA 2L5XB 3BUNB 3OB2B 4JQ0D 5F6TA 1SNLA 1IQ3A 3CGAA 1YX8A 1R2UA 2I18A 3S0FA 3KO0A 1P28A 1PSBA 2JT3A 3NHTA 3D76A 2F3ZA 1S3PA 5IBWA 1BF5A 3VB1A 3WHUB 2KBMA 3N7HA 1JSAA 2JU0A 1C07A 2K7OA 1YR5A 1J7RA 2GGZA 2LNKA 1BU3A 1XFXO 1KSMA 3PN7C 4WRIA 5EL2A 2FJYA 1L2OB 1ZFSA 1SCMC 2BECA 4I5LB 4YGEB 1NX0A 1AHRA 2B1UA 1FW4A 1KK7Y 2CXJA 2M49B 1GJYA 3L4LA 1PVAA 1F4QA 2LUCA 1A75A 3Q8IA 2WCLA 1JWDA 2LVIA 1K9PA 1XA5A 4NDDA 5FI2A 1K9UA 1S26D 1SK6D 5HLOA 2GGMA 4F0ZB 1Y0VH 1AVSA 2M0RA 3CABA 3D75A 1NCZA 2E30A 3GK1A 1XFZO 2WNDA 1LXFC 4M2PA 1WDCB 3L4AA 1K96A 2P70A 2LP3A 4GGFC 5CSFA 4DCKA 1QX2A 3CTNA 1TNXA 1QS7A 2JZIA 2BE6A 5B8IB 1G33A 2NCOA 2BL0B 2GTEA 3I5IB 4INWA 1M46A 2BL0C 1YX7A 2K7CA 1QLKA 2AAOA 3BFHA 4YRUA 2QACA 4I5NB 3BQ3A 3TDUA 3K21A 1TWOA 3PLFB 2LMVA 5HKZA 1N0YA 1VRKA 2PASA 4CFQA 1UURA 2K2FA 2M29A 2FOTA 1YUTA 2JNFA 1KK8B 1NX2A 1MWNA 5FYXA 2KFGA 5PALA 1JUOA 4R1EA 2ZNEA 1IG5A 2I2RE 3QMEA 3EKJA 1KCYA 2I94A 1TN4A 2WOSA 1S36A 1FI5A 1DVIA 2BAPA 1AJ4A 2ZRTA 3BOWB 3LK1A 5AERA 2SASA 1C3ZA 3O2PA 2NLNA 1CLMA 2QDIA
chains in the Genus database with same CATH topology
1Y1AA 1UHJA 2F33A 2JT0A 3SG2A 1Y6WA 1JFKA 1AJ5A 1A03A 1F70A 1B1GA 4ZCUA 1B4CA 2WCFA 4GGFA 3DVMA 1YUSA 2M97A 3TZ1A 1A4PA 1DF0B 1TCOB 4ORAB 1OSAA 1CDNA 1SW8A 1YVLA 1EXRA 1K90D 1DJIA 1DT7B 2MAZA 2MLEC 2M1KB 1BG1A 1ZMZA 3SIBA 1F4OA 1CKKA 4PHNA 1NX1A 3WHTB 3M0WA 2BBNA 2LV7A 2HQ8A 1K93D 1N2DA 4OKHA 1RK9A 2JPTA 3EVUA 4JPZB 4YI9A 1JFJA 1CDLA 1DTLA 4CIDA 1DF0A 2HPSA 2JT8A 2CNPA 4AQIA 1OZSA 4PALA 3PM8A 4E68A 1NSHA 1J7PA 4I5KA 3BXKA 4Q04A 1YVHA 1XFWO 1NX3A 2LP2A 3TDIA 4PCWA 2WC8A 4GGNA 1CMFA 1WRZA 2Q4UA 3GK4X 1SMGA 2KI4B 4U8DA 2FCDA 1S5GZ 2JTZA 2KGBC 2K0JA 1YUUA 2OS8C 5ER5A 1YRUB 1E8AA 3QRXA 4OVNF 2MA2A 2Y4QA 2EC6B 2L4IA 1IGVA 1IRJA 2K7DA 2JTTA 1AK8A 1DJZA 2GV5A 1QJTA 3GK2A 1B9AA 2BKHB 4P5OE 5KTYA 3EVRA 2MLFC 2HETA 3CR4X 1SY9A 2F3YA 1SCMB 2JNXA 3VRPA 1XK4A 1J55A 3PSRA 1DJHA 2KNEA 4BY5A 3EK8A 1CMGA 2CCMA 2PVBA 4ICBA 5G08A 3EK4A 3RM1A 4TNCA 4N1GA 2OPOA 3I5GC 4CLNA 2LMTA 3EKHA 2F2PA 3DF0A 3NSKA 1QX5B 2ZN8A 4ORBB 1RROA 1CDMA 2MRDA 1PRWA 2IS9A 1MUXA 4PDZA 2PRUA 2LLUA 2KYFA 3LK0A 1AP4A 1CFCA 2JXLA 1SL8A 1QV0A 1YTZC 2AMIA 4MZKA 4NDBA 1FBVA 5ER4X 3I5HC 1MR8A 3FWCA 3F45A 1Q80A 2ZN9A 3BUMB 1QVIZ 4PHKA 1WLMA 1F55A 4WQ2A 4FTGA 4MRXA 1SR6C 1NWDA 1XK4C 3E3RA 1QLSA 5I8NA 3SG7A 1IWQA 1F8HA 1TNWA 1BR1B 4UPGA 2L2EA 1WRKA 1TOPA 2LVJA 3GOFA 1B8LA 2NCPA 5CSIA 2L4HA 4CPVA 3TS5C 1CB1A 3BUOB 2KDHA 1LINA 1WLZA 2QPTA 4PE0A 5HKYA 2BCXA 4WQ3A 4XJKB 1XO5A 1S6IA 4N5XA 2JXCA 1S5GY 3LL8B 4CFRA 3H4SE 2LCPA 3DF0B 3O4YA 1IKUA 3JTDC 2ISDA 3PFVA 3LLEA 1CM4A 4AQJA 2KI6D 2Y1NA 2JULA 2KGRA 1CM1A 1LKJA 3SG3A 2L0PA 3HX4A 1ALWA 1BMOA 3AAJA 3IF7A 2LHIA 3FIAA 5CPVA 4MN0A 2ZNDA 4MZLA 1S1EA 2EGDA 2H61C 2LE9B 1ODBA 4QJ4B 1ZOTB 2O5GA 1TRFA 4HREE 1DJXA 3I5FC 1KK8C 1CLBA 2A4JA 1QX7A 4USLA 3BUWB 1OMVA 2M3WA 4YGAA 4MLWA 1Y1UA 1UP5A 2LANA 1FF1A 1WY9A 3JTDB 4MSPA 2M7LA 1KFXS 3VROA 2ZRSA 3CZTX 1KQVA 2KQYA 2TN4A 2EC6C 4YI8A 3DVJA 3KF9A 2MJWB 1PVBA 2R2IA 3OHMB 5DKQA 1XVJA 5AANA 3EK7A 4DUQA 3IQQA 1K9KA 5KSZA 1J1EA 1NCXA 1MXLC 3D10A 2KI4C 5K89A 4YBHB 3VRRA 4YGBB 1EH2A 3PATA 1QASA 3O78A 1F71A 3ZNIA 4PE7A 1C7WA 4M2QA 3I5GB 3KHEA 3NSOA 4GNKB 1XFYO 1K94A 2P6BB 1SCVA 1LA0A 2NXQA 3OB1B 1UUSA 3OX5A 5I2LA 1WDCC 2L51A 1BT6A 2JC2A 3A4UB 5CSJA 4HSZA 4GBAA 2V53A 1YRTB 2KAXA 1UHNA 4YGCB 3CR2A 1IH0A 1EG3A 1LA3A 2LC5A 3IQOA 4GUKA 4NDCA 1BJFA 3MSEB 3TS5B 1DJYA 1IJ5A 3TDZA 1U5IA 5AEQA 1WRLA 2O60A 1NIWA 1L2OC 4DS7A 1A2XA 4OCIA 4YGDB 1H8BA 2K61A 2LHLA 1M31A 1QIVA 5HLVA 2MHHA 1W7IB 2H61A 1KFUL 1RTP1 3ICBA 5HKWA 1UHKA 2COLB 3NSIA 1CFPA 3DD4A 2M9GA 2VRGA 1OQPA 4GAOA 1KQMC 1G8IA 4JWQA 1V1FA 5TNCA 1K2HA 3BOWA 2F2OA 3C1VA 1RWYA 1TIZA 3I5HB 4ORCB 2E6WA 2JRFA 1QVIY 2PMYA 1KSOA 5AFPA 1KK7Z 1NUBA 1QV1A 5AXIA 1PULA 4FQOA 1OMRA 2WORA 3CLNA 3SJSA 1NP8A 1EL4A 1N65A 1TTXA 1KWOB 3OX6A 4ZCVA 3KEVA 2K7BA 4NQGA 3CR5X 2KAVA 3I5IC 5JOLA 2CT9A 3RLZA 1B8CA 1CFDA 1CTRA 1KFXL 1GGZA 1XYDA 1PALA 4MBEA 3EVVA 1YURA 4A4CA 2K2AA 4BY4A 3CS1A 3VGOA 2FCEA 1NCYA 1DGUA 2Q91A 2OTGB 2BKIB 5KU1A 4AOMA 1J7QA 1SYMA 3KPXA 2JQ6A 2BCBA 3FS7A 1DJGA 2DOQA 4ETOA 5CSNA 3D0YB 1JF2A 2LVVA 1SBJA 1OE9B 3VRQA 2FJUB 3SIAA 2KQ6A 1A75B 4MZJA 3LCPC 2RGIA 4XJKA 1S6JA 1ZACA 2ZKMX 1W7JB 2L50A 3BUXB 1MQ1A 2OTGC 5J3XA 4OR9B 1H4BA 2M8UA 2OS8B 1JC2A 2JWWA 2M1UA 1TCFA 3A8RA 4I5JA 4C0LA 5DKRA 1SL9A 3DVEA 1ALVA 4IL1A 1IJ6A 4XYNA 1BODA 2G2BA 2CTNA 1SRAA 1BR4B 1MHOA 1RJVA 3HCMA 5GQQC 5D69A 5HYDA 1FPWA 1U5IB 1GGWA 2M7NA 1R6PA 4L9MA 1JF0A 1K95A 1XFUO 3TUYB 3AAKA 4PHMA 1A29A 4D1EA 1TNPA 1BOCA 2HQWA 1QXPA 1IQ5A 2L98A 5I2QA 1JBAA 4GFTA 2H2KA 3ZWHA 5BPJA 1B7TZ 3SG6A 1CNPA 2ZFDA 2KSPA 2Y1MA 2KHNA 3VRNA 3NXAA 2PALA 2KBIA 4P2YB 1BLQA 4HRGA 3WNXB 1NPQA 1X02A 3D0YA 4QJ3B 1EG4A 1RECA 2LLSA 3OP0A 1CLLA 3NSLA 1M45A 2BBMA 4DRWA 2F8PA 4QJ5B 3O6BA 5JJGA 4PE1A 1HT9A 2MBXA 4MRYA 1DMOA 1Y1XA 1DGVA 2KYCA 1EJ3A 1M63B 2NZ0A 4PE4A 1J7OA 1SR6B 3I5FB 1B47A 1QTXA 5DKNA 3AKAA 1KQMB 1XFVO 4MEWA 1V1GA 3WXAA 1F54A 1DJWA 1OMDA 1UHHA 2JOJA 2SCPA 4HRHA 3SG4A 2D8NA 1GQMA 3DVKA 1PSRA 4M2OA 4PHJA 2BE4A 1B7TY 1AUIB 1OOJA 1J1DA 1ZUZA 1KFUS 1OZOA 1SPYA 4N1FA 2EHBA 1K8UA 2KI6C 2LLTA 3AKBA 3CWGA 4MVFA 1CDPA 2KOTA 5D7FA 1PK0D 2WCEA 1HQVA 1L7ZA 1LVCD 1QIWA 4GPLB 2AUCA 1TNQA 2LM5A 2G9BA 3JVTB 1UWOA 3PALA 1SL7A 1FI6A 2LMUA 4A4BA 1NYAA 2BCAA 3PN7B 2CBLA 2Y5IA 2I7AA 1G4YR 3SG5A 2KFHA 1S6CA 1UHIA 2K8MB 1SKTA 1KWOC 1CFFA 1MXEA 2LVKA 3BYAA 1M39A 2LUXA 2HF5A 2KAYA 1B8RA 1QATA 4OV2A 3JVTC 2KFFA 2PSRA 1RFJA 4DIRA 1C7VA 2WCBA 3FWBA 2LAPA 4C0KA 1MF8B 4C0JA 5I2OA 3TUYC 1D1OA 2L5XB 3BUNB 3OB2B 4JQ0D 5F6TA 1SNLA 1IQ3A 3CGAA 1YX8A 1R2UA 2I18A 3KO0A 1PSBA 2JT3A 5IBWA 2F3ZA 1S3PA 1BF5A 3WHUB 2KBMA 1JSAA 2JU0A 1C07A 2K7OA 1YR5A 1J7RA 2GGZA 2LNKA 1BU3A 1XFXO 1KSMA 3PN7C 4WRIA 1L2OB 1ZFSA 1SCMC 2BECA 4I5LB 4YGEB 1NX0A 1AHRA 2B1UA 1FW4A 1KK7Y 2CXJA 2M49B 1GJYA 1PVAA 1F4QA 2LUCA 1A75A 1JWDA 2LVIA 1K9PA 1XA5A 4NDDA 1K9UA 1S26D 1SK6D 5HLOA 2GGMA 4F0ZB 1Y0VH 1AVSA 2M0RA 3GK1A 4M2PA 1NCZA 2E30A 1XFZO 2WNDA 1LXFC 1WDCB 1K96A 2LP3A 4GGFC 5CSFA 4DCKA 1QX2A 3CTNA 1TNXA 1QS7A 2JZIA 2BE6A 5B8IB 1G33A 2NCOA 2BL0B 3I5IB 1M46A 2BL0C 1YX7A 2K7CA 1QLKA 2AAOA 4YRUA 2QACA 4I5NB 3BQ3A 3TDUA 3K21A 3PLFB 2LMVA 5HKZA 1N0YA 1VRKA 2PASA 4CFQA 1UURA 2K2FA 2M29A 2FOTA 1YUTA 2JNFA 1KK8B 1NX2A 1MWNA 5FYXA 2KFGA 5PALA 1JUOA 4R1EA 2ZNEA 1IG5A 2I2RE 3EKJA 1KCYA 2I94A 1TN4A 2WOSA 1S36A 1FI5A 1DVIA 1AJ4A 2ZRTA 3BOWB 3LK1A 5AERA 2SASA 3O2PA 2NLNA 1CLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1A A;  1UHJ A;  2F33 A;  2JT0 A;  3SG2 A;  1Y6W A;  1JFK A;  1AJ5 A;  1A03 A;  1F70 A;  1B1G A;  4ZCU A;  1B4C A;  2WCF A;  4GGF A;  3DVM A;  1YUS A;  2M97 A;  3TZ1 A;  1A4P A;  1DF0 B;  1TCO B;  4ORA B;  1OSA A;  1CDN A;  1SW8 A;  1YVL A;  1EXR A;  1K90 D;  1DJI A;  1DT7 B;  2MAZ A;  2MLE C;  2M1K B;  1BG1 A;  1ZMZ A;  3SIB A;  1F4O A;  1CKK A;  4PHN A;  1NX1 A;  3WHT B;  3M0W A;  2BBN A;  2LV7 A;  2HQ8 A;  1K93 D;  1N2D A;  4OKH A;  1RK9 A;  2JPT A;  3EVU A;  4JPZ B;  4YI9 A;  1JFJ A;  1CDL A;  1DTL A;  4CID A;  1DF0 A;  2HPS A;  2JT8 A;  2CNP A;  4AQI A;  1OZS A;  4PAL A;  3PM8 A;  4E68 A;  1NSH A;  1J7P A;  4I5K A;  3BXK A;  4Q04 A;  1YVH A;  1XFW O;  1NX3 A;  2LP2 A;  3TDI A;  4PCW A;  2WC8 A;  4GGN A;  1CMF A;  1WRZ A;  2Q4U A;  3GK4 X;  1SMG A;  2KI4 B;  4U8D A;  2FCD A;  1S5G Z;  2JTZ A;  2KGB C;  2K0J A;  1YUU A;  2OS8 C;  5ER5 A;  1YRU B;  1E8A A;  3QRX A;  4OVN F;  2MA2 A;  2Y4Q A;  2EC6 B;  2L4I A;  1IGV A;  1IRJ A;  2K7D A;  2JTT A;  1AK8 A;  1DJZ A;  2GV5 A;  1QJT A;  3GK2 A;  1B9A A;  2BKH B;  4P5O E;  5KTY A;  3EVR A;  2MLF C;  2HET A;  3CR4 X;  1SY9 A;  2F3Y A;  1SCM B;  2JNX A;  3VRP A;  1XK4 A;  1J55 A;  3PSR A;  1DJH A;  2KNE A;  4BY5 A;  3EK8 A;  1CMG A;  2CCM A;  2PVB A;  4ICB A;  5G08 A;  3EK4 A;  3RM1 A;  4TNC A;  4N1G A;  2OPO A;  3I5G C;  4CLN A;  2LMT A;  3EKH A;  2F2P A;  3DF0 A;  3NSK A;  1QX5 B;  2ZN8 A;  4ORB B;  1RRO A;  1CDM A;  2MRD A;  1PRW A;  2IS9 A;  1MUX A;  4PDZ A;  2PRU A;  2LLU A;  2KYF A;  3LK0 A;  1AP4 A;  1CFC A;  2JXL A;  1SL8 A;  1QV0 A;  1YTZ C;  2AMI A;  4MZK A;  4NDB A;  1FBV A;  5ER4 X;  3I5H C;  1MR8 A;  3FWC A;  3F45 A;  1Q80 A;  2ZN9 A;  3BUM B;  1QVI Z;  4PHK A;  1WLM A;  1F55 A;  4WQ2 A;  4FTG A;  4MRX A;  1SR6 C;  1NWD A;  1XK4 C;  3E3R A;  1QLS A;  5I8N A;  3SG7 A;  1IWQ A;  1F8H A;  1TNW A;  1BR1 B;  4UPG A;  2L2E A;  1WRK A;  1TOP A;  2LVJ A;  3GOF A;  1B8L A;  2NCP A;  5CSI A;  2L4H A;  4CPV A;  3TS5 C;  1CB1 A;  3BUO B;  2KDH A;  1LIN A;  1WLZ A;  2QPT A;  4PE0 A;  5HKY A;  2BCX A;  4WQ3 A;  4XJK B;  1XO5 A;  1S6I A;  4N5X A;  2JXC A;  1S5G Y;  3LL8 B;  4CFR A;  3H4S E;  2LCP A;  3DF0 B;  3O4Y A;  1IKU A;  3JTD C;  2ISD A;  3PFV A;  3LLE A;  1CM4 A;  4AQJ A;  2KI6 D;  2Y1N A;  2JUL A;  2KGR A;  1CM1 A;  1LKJ A;  3SG3 A;  2L0P A;  3HX4 A;  1ALW A;  1BMO A;  3AAJ A;  3IF7 A;  2LHI A;  3FIA A;  5CPV A;  4MN0 A;  2ZND A;  4MZL A;  1S1E A;  2EGD A;  2H61 C;  2LE9 B;  1ODB A;  4QJ4 B;  1ZOT B;  2O5G A;  1TRF A;  4HRE E;  1DJX A;  3I5F C;  1KK8 C;  1CLB A;  2A4J A;  1QX7 A;  4USL A;  3BUW B;  1OMV A;  2M3W A;  4YGA A;  4MLW A;  1Y1U A;  1UP5 A;  2LAN A;  1FF1 A;  1WY9 A;  3JTD B;  4MSP A;  2M7L A;  1KFX S;  3VRO A;  2ZRS A;  3CZT X;  1KQV A;  2KQY A;  2TN4 A;  2EC6 C;  4YI8 A;  3DVJ A;  3KF9 A;  2MJW B;  1PVB A;  2R2I A;  3OHM B;  5DKQ A;  1XVJ A;  5AAN A;  3EK7 A;  4DUQ A;  3IQQ A;  1K9K A;  5KSZ A;  1J1E A;  1NCX A;  1MXL C;  3D10 A;  2KI4 C;  5K89 A;  4YBH B;  3VRR A;  4YGB B;  1EH2 A;  3PAT A;  1QAS A;  3O78 A;  1F71 A;  3ZNI A;  4PE7 A;  1C7W A;  4M2Q A;  3I5G B;  3KHE A;  3NSO A;  4GNK B;  1XFY O;  1K94 A;  2P6B B;  1SCV A;  1LA0 A;  2NXQ A;  3OB1 B;  1UUS A;  3OX5 A;  5I2L A;  1WDC C;  2L51 A;  1BT6 A;  2JC2 A;  3A4U B;  5CSJ A;  4HSZ A;  4GBA A;  2V53 A;  1YRT B;  2KAX A;  1UHN A;  4YGC B;  3CR2 A;  1IH0 A;  1EG3 A;  1LA3 A;  2LC5 A;  3IQO A;  4GUK A;  4NDC A;  1BJF A;  3MSE B;  3TS5 B;  1DJY A;  1IJ5 A;  3TDZ A;  1U5I A;  5AEQ A;  1WRL A;  2O60 A;  1NIW A;  1L2O C;  4DS7 A;  1A2X A;  4OCI A;  4YGD B;  1H8B A;  2K61 A;  2LHL A;  1M31 A;  1QIV A;  5HLV A;  2MHH A;  1W7I B;  2H61 A;  1KFU L;  1RTP 1;  3ICB A;  5HKW A;  1UHK A;  2COL B;  3NSI A;  1CFP A;  3DD4 A;  2M9G A;  2VRG A;  1OQP A;  4GAO A;  1KQM C;  1G8I A;  4JWQ A;  1V1F A;  5TNC A;  1K2H A;  3BOW A;  2F2O A;  3C1V A;  1RWY A;  1TIZ A;  3I5H B;  4ORC B;  2E6W A;  2JRF A;  1QVI Y;  2PMY A;  1KSO A;  5AFP A;  1KK7 Z;  1NUB A;  1QV1 A;  5AXI A;  1PUL A;  4FQO A;  1OMR A;  2WOR A;  3CLN A;  3SJS A;  1NP8 A;  1EL4 A;  1N65 A;  1TTX A;  1KWO B;  3OX6 A;  4ZCV A;  3KEV A;  2K7B A;  4NQG A;  3CR5 X;  2KAV A;  3I5I C;  5JOL A;  2CT9 A;  3RLZ A;  1B8C A;  1CFD A;  1CTR A;  1KFX L;  1GGZ A;  1XYD A;  1PAL A;  4MBE A;  3EVV A;  1YUR A;  4A4C A;  2K2A A;  4BY4 A;  3CS1 A;  3VGO A;  2FCE A;  1NCY A;  1DGU A;  2Q91 A;  2OTG B;  2BKI B;  5KU1 A;  4AOM A;  1J7Q A;  1SYM A;  3KPX A;  2JQ6 A;  2BCB A;  3FS7 A;  1DJG A;  2DOQ A;  4ETO A;  5CSN A;  3D0Y B;  1JF2 A;  2LVV A;  1SBJ A;  1OE9 B;  3VRQ A;  2FJU B;  3SIA A;  2KQ6 A;  1A75 B;  4MZJ A;  3LCP C;  2RGI A;  4XJK A;  1S6J A;  1ZAC A;  2ZKM X;  1W7J B;  2L50 A;  3BUX B;  1MQ1 A;  2OTG C;  5J3X A;  4OR9 B;  1H4B A;  2M8U A;  2OS8 B;  1JC2 A;  2JWW A;  2M1U A;  1TCF A;  3A8R A;  4I5J A;  4C0L A;  5DKR A;  1SL9 A;  3DVE A;  1ALV A;  4IL1 A;  1IJ6 A;  4XYN A;  1BOD A;  2G2B A;  2CTN A;  1SRA A;  1BR4 B;  1MHO A;  1RJV A;  3HCM A;  5GQQ C;  5D69 A;  5HYD A;  1FPW A;  1U5I B;  1GGW A;  2M7N A;  1R6P A;  4L9M A;  1JF0 A;  1K95 A;  1XFU O;  3TUY B;  3AAK A;  4PHM A;  1A29 A;  4D1E A;  1TNP A;  1BOC A;  2HQW A;  1QXP A;  1IQ5 A;  2L98 A;  5I2Q A;  1JBA A;  4GFT A;  2H2K A;  3ZWH A;  5BPJ A;  1B7T Z;  3SG6 A;  1CNP A;  2ZFD A;  2KSP A;  2Y1M A;  2KHN A;  3VRN A;  3NXA A;  2PAL A;  2KBI A;  4P2Y B;  1BLQ A;  4HRG A;  3WNX B;  1NPQ A;  1X02 A;  3D0Y A;  4QJ3 B;  1EG4 A;  1REC A;  2LLS A;  3OP0 A;  1CLL A;  3NSL A;  1M45 A;  2BBM A;  4DRW A;  2F8P A;  4QJ5 B;  3O6B A;  5JJG A;  4PE1 A;  1HT9 A;  2MBX A;  4MRY A;  1DMO A;  1Y1X A;  1DGV A;  2KYC A;  1EJ3 A;  1M63 B;  2NZ0 A;  4PE4 A;  1J7O A;  1SR6 B;  3I5F B;  1B47 A;  1QTX A;  5DKN A;  3AKA A;  1KQM B;  1XFV O;  4MEW A;  1V1G A;  3WXA A;  1F54 A;  1DJW A;  1OMD A;  1UHH A;  2JOJ A;  2SCP A;  4HRH A;  3SG4 A;  2D8N A;  1GQM A;  3DVK A;  1PSR A;  4M2O A;  4PHJ A;  2BE4 A;  1B7T Y;  1AUI B;  1OOJ A;  1J1D A;  1ZUZ A;  1KFU S;  1OZO A;  1SPY A;  4N1F A;  2EHB A;  1K8U A;  2KI6 C;  2LLT A;  3AKB A;  3CWG A;  4MVF A;  1CDP A;  2KOT A;  5D7F A;  1PK0 D;  2WCE A;  1HQV A;  1L7Z A;  1LVC D;  1QIW A;  4GPL B;  2AUC A;  1TNQ A;  2LM5 A;  2G9B A;  3JVT B;  1UWO A;  3PAL A;  1SL7 A;  1FI6 A;  2LMU A;  4A4B A;  1NYA A;  2BCA A;  3PN7 B;  2CBL A;  2Y5I A;  2I7A A;  1G4Y R;  3SG5 A;  2KFH A;  1S6C A;  1UHI A;  2K8M B;  1SKT A;  1KWO C;  1CFF A;  1MXE A;  2LVK A;  3BYA A;  1M39 A;  2LUX A;  2HF5 A;  2KAY A;  1B8R A;  1QAT A;  4OV2 A;  3JVT C;  2KFF A;  2PSR A;  1RFJ A;  4DIR A;  1C7V A;  2WCB A;  3FWB A;  2LAP A;  4C0K A;  1MF8 B;  4C0J A;  5I2O A;  3TUY C;  1D1O A;  2L5X B;  3BUN B;  3OB2 B;  4JQ0 D;  5F6T A;  1SNL A;  1IQ3 A;  3CGA A;  1YX8 A;  1R2U A;  2I18 A;  3KO0 A;  1PSB A;  2JT3 A;  5IBW A;  2F3Z A;  1S3P A;  1BF5 A;  3WHU B;  2KBM A;  1JSA A;  2JU0 A;  1C07 A;  2K7O A;  1YR5 A;  1J7R A;  2GGZ A;  2LNK A;  1BU3 A;  1XFX O;  1KSM A;  3PN7 C;  4WRI A;  1L2O B;  1ZFS A;  1SCM C;  2BEC A;  4I5L B;  4YGE B;  1NX0 A;  1AHR A;  2B1U A;  1FW4 A;  1KK7 Y;  2CXJ A;  2M49 B;  1GJY A;  1PVA A;  1F4Q A;  2LUC A;  1A75 A;  1JWD A;  2LVI A;  1K9P A;  1XA5 A;  4NDD A;  1K9U A;  1S26 D;  1SK6 D;  5HLO A;  2GGM A;  4F0Z B;  1Y0V H;  1AVS A;  2M0R A;  3GK1 A;  4M2P A;  1NCZ A;  2E30 A;  1XFZ O;  2WND A;  1LXF C;  1WDC B;  1K96 A;  2LP3 A;  4GGF C;  5CSF A;  4DCK A;  1QX2 A;  3CTN A;  1TNX A;  1QS7 A;  2JZI A;  2BE6 A;  5B8I B;  1G33 A;  2NCO A;  2BL0 B;  3I5I B;  1M46 A;  2BL0 C;  1YX7 A;  2K7C A;  1QLK A;  2AAO A;  4YRU A;  2QAC A;  4I5N B;  3BQ3 A;  3TDU A;  3K21 A;  3PLF B;  2LMV A;  5HKZ A;  1N0Y A;  1VRK A;  2PAS A;  4CFQ A;  1UUR A;  2K2F A;  2M29 A;  2FOT A;  1YUT A;  2JNF A;  1KK8 B;  1NX2 A;  1MWN A;  5FYX A;  2KFG A;  5PAL A;  1JUO A;  4R1E A;  2ZNE A;  1IG5 A;  2I2R E;  3EKJ A;  1KCY A;  2I94 A;  1TN4 A;  2WOS A;  1S36 A;  1FI5 A;  1DVI A;  1AJ4 A;  2ZRT A;  3BOW B;  3LK1 A;  5AER A;  2SAS A;  3O2P A;  2NLN A;  1CLM A; 
#chains in the Genus database with same CATH topology
 1Y1A A;  1UHJ A;  2F33 A;  2JT0 A;  3SG2 A;  1Y6W A;  1JFK A;  1AJ5 A;  1A03 A;  1F70 A;  1B1G A;  4ZCU A;  1B4C A;  2WCF A;  4GGF A;  3DVM A;  1YUS A;  2M97 A;  1OOF A;  3TZ1 A;  5FI6 A;  1OOI X;  4FQT A;  1A4P A;  1DF0 B;  1TCO B;  4ORA B;  1OSA A;  1CDN A;  1SW8 A;  1YVL A;  1EXR A;  1K90 D;  1DJI A;  3DZT A;  1DT7 B;  2MAZ A;  2MLE C;  2M1K B;  1BG1 A;  1ZMZ A;  3SIB A;  1F4O A;  1CKK A;  4PHN A;  1NX1 A;  3WHT B;  3M0W A;  2BBN A;  2LV7 A;  2HQ8 A;  1K93 D;  1N2D A;  4OKH A;  1RK9 A;  2JPT A;  3EVU A;  4JPZ B;  4YI9 A;  1JFJ A;  1CDL A;  2YGU A;  1DTL A;  2WCJ A;  1DF0 A;  2HPS A;  4CID A;  2JT8 A;  2L2C A;  2CNP A;  5I94 A;  4AQI A;  1OZS A;  4PAL A;  3PM8 A;  1IIO A;  3BFA A;  1NSH A;  4E68 A;  3DXL A;  1J7P A;  3DY9 A;  4I5K A;  3BXK A;  4Q04 A;  1YVH A;  1XFW O;  3PM2 A;  1NX3 A;  2LP2 A;  3TDI A;  4PCW A;  2WC8 A;  4GGN A;  1CMF A;  1WRZ A;  2Q4U A;  3DYE A;  1SMG A;  2KI4 B;  3GK4 X;  4U8D A;  2FCD A;  1S5G Z;  2JTZ A;  2KGB C;  4OZD A;  3RZS A;  2K0J A;  1YUU A;  3K1E A;  2OS8 C;  5ER5 A;  1YRU B;  3B7A A;  5D3O A;  1E8A A;  3QRX A;  4OVN F;  2MA2 A;  2Y4Q A;  1OOH A;  2EC6 B;  2L4I A;  1IGV A;  1Z4H A;  2BNX A;  1IRJ A;  2K7D A;  2JTT A;  1AK8 A;  1DJZ A;  1QJT A;  2GV5 A;  3GK2 A;  1B9A A;  2BKH B;  1T14 A;  4P5O E;  5KTY A;  3EVR A;  2MLF C;  2HET A;  3CR4 X;  1SY9 A;  2F3Y A;  2WCK A;  1SCM B;  2JNX A;  3VRP A;  3R72 A;  1XK4 A;  1J55 A;  3PSR A;  3CZ0 A;  1DJH A;  2KNE A;  4BY5 A;  3EK8 A;  1CMG A;  2CCM A;  3S0D A;  2PVB A;  4ICB A;  5G08 A;  3EK4 A;  3RM1 A;  4TNC A;  4N1G A;  2OPO A;  3I5G C;  1DEK A;  4CLN A;  2LMT A;  1DQE A;  3EKH A;  2F2P A;  3DF0 A;  3NSK A;  1QX5 B;  2ZN8 A;  3CYZ A;  1RRO A;  4ORB B;  1CDM A;  2MRD A;  1PRW A;  2IS9 A;  1MUX A;  4PDZ A;  2PRU A;  1ORG A;  2LLU A;  2KYF A;  3LK0 A;  1AP4 A;  1CFC A;  2JXL A;  4IJ7 A;  1SL8 A;  1QV0 A;  1YTZ C;  2AMI A;  4MZK A;  4NDB A;  3S0A A;  2H8V A;  1FBV A;  5ER4 X;  3I5H C;  1MR8 A;  3FWC A;  3F45 A;  1Q80 A;  2ZN9 A;  3BUM B;  1QVI Z;  4PHK A;  1WLM A;  1F55 A;  4WQ2 A;  4FTG A;  4MRX A;  1SR6 C;  1NWD A;  1XK4 C;  1GM0 A;  3B86 A;  1QLS A;  3E3R A;  5I8N A;  3SG7 A;  1IWQ A;  1F8H A;  1TNW A;  1BR1 B;  3FE9 A;  4UPG A;  2L2E A;  1WRK A;  1TOP A;  3UNW A;  2LVJ A;  3GOF A;  1B8L A;  2NCP A;  5CSI A;  2L4H A;  4CPV A;  3TS5 C;  1CB1 A;  3BUO B;  2KDH A;  1LIN A;  1WLZ A;  2QPT A;  3FE6 A;  4PE0 A;  2BCX A;  5HKY A;  4WQ3 A;  4XJK B;  3SS5 A;  1XO5 A;  1S6I A;  1XFR A;  4N5X A;  2JXC A;  1S5G Y;  3LL8 B;  4CFR A;  3H4S E;  2LCP A;  3CZ2 A;  3DF0 B;  3O4Y A;  1IKU A;  3JTD C;  2ISD A;  2K60 A;  3PFV A;  3LLE A;  3NHI A;  1CM4 A;  2WCH A;  4AQJ A;  2KI6 D;  2Y1N A;  2JUL A;  3EG5 B;  2KGR A;  1CM1 A;  1LKJ A;  4JD9 A;  3SG3 A;  2L0P A;  3HX4 A;  1ALW A;  3FE8 A;  1BMO A;  3AAJ A;  3IF7 A;  2LHI A;  3FIA A;  4INX A;  5CPV A;  4MN0 A;  2ZND A;  4MZL A;  1S1E A;  2EGD A;  2H61 C;  2LE9 B;  1DEL A;  1ODB A;  4QJ4 B;  1W9Z A;  1ZOT B;  2O5G A;  1TRF A;  4HRE E;  1DJX A;  1OOG A;  3I5F C;  1KK8 C;  1CLB A;  2A4J A;  1QX7 A;  4USL A;  3BUW B;  3S0E A;  1OMV A;  2M3W A;  4YGA A;  4MLW A;  1Y1U A;  1UP5 A;  2LAN A;  3OGN A;  1FF1 A;  1WY9 A;  3JTD B;  4MSP A;  2M7L A;  1KFX S;  3VRO A;  2ZRS A;  3B88 A;  3CZT X;  2KQY A;  2TN4 A;  2EC6 C;  3R1P A;  4YI8 A;  3DVJ A;  3KF9 A;  2MJW B;  1PVB A;  2R2I A;  3OHM B;  5DKQ A;  1XVJ A;  2WC6 A;  5AAN A;  3EK7 A;  4DUQ A;  3CZ1 A;  3IQQ A;  1K9K A;  5KSZ A;  1J1E A;  1NCX A;  3L47 A;  1MXL C;  3D10 A;  1C3Y A;  2KI4 C;  2JPO A;  5K89 A;  4YBH B;  3VRR A;  1Z2C B;  4YGB B;  1EH2 A;  3PAT A;  1QAS A;  3O78 A;  1F71 A;  3ZNI A;  4PE7 A;  1C7W A;  4M2Q A;  3I5G B;  3KHE A;  3PJI A;  3NSO A;  4GNK B;  1XFY O;  1K94 A;  2P6B B;  1SCV A;  1LA0 A;  2NXQ A;  3D78 A;  1UUS A;  3OB1 B;  3OX5 A;  5I2L A;  1DC1 A;  1WDC C;  2L51 A;  1BT6 A;  2JC2 A;  3A4U B;  5CSJ A;  4HSZ A;  4GBA A;  2V53 A;  1YRT B;  2KAX A;  1UHN A;  4YGC B;  3CR2 A;  1IH0 A;  1EG3 A;  1LA3 A;  2LC5 A;  2PQL A;  3IQO A;  4GUK A;  4NDC A;  1BJF A;  3MSE B;  3TS5 B;  1DJY A;  1IJ5 A;  2P71 A;  3TDZ A;  1U5I A;  5AEQ A;  1WRL A;  2O60 A;  1NIW A;  1TUZ A;  1L2O C;  4DS7 A;  1A2X A;  4OCI A;  4YGD B;  1H8B A;  2K61 A;  2LHL A;  1M31 A;  1QIV A;  5HLV A;  2MHH A;  1W7I B;  2H61 A;  2QEV A;  1KFU L;  1RTP 1;  3ICB A;  5HKW A;  1UHK A;  2COL B;  3NSI A;  1CFP A;  3DD4 A;  2M9G A;  2VRG A;  1OQP A;  4GAO A;  1KQM C;  1G8I A;  4JWQ A;  5HL1 A;  1V1F A;  5TNC A;  3O4X A;  1K2H A;  3B87 A;  3BOW A;  2F2O A;  3C1V A;  1RWY A;  1TIZ A;  3I5H B;  4ORC B;  2E6W A;  2JRF A;  1QVI Y;  2PMY A;  1KSO A;  1LS8 A;  3D73 A;  5AFP A;  1KK7 Z;  1NUB A;  2KLD A;  1QV1 A;  5AXI A;  1PUL A;  4FQO A;  1OMR A;  2WOR A;  3SS3 A;  3CLN A;  3SJS A;  1NP8 A;  1EL4 A;  1N65 A;  1TTX A;  1KWO B;  3OX6 A;  4ZCV A;  3KEV A;  2K7B A;  4NQG A;  3R1V A;  3CR5 X;  2KAV A;  3CDN A;  3I5I C;  2CT9 A;  5JOL A;  3RLZ A;  1B8C A;  1CFD A;  1CTR A;  1KFX L;  1GGZ A;  1XYD A;  1PAL A;  2ERB A;  4MBE A;  3S0B A;  3EVV A;  3R1O A;  5DIC A;  1YUR A;  4A4C A;  2K2A A;  4BY4 A;  3CS1 A;  3OBV A;  2FCE A;  3VGO A;  1NCY A;  1DGU A;  2Q91 A;  2OTG B;  2BKI B;  5KU1 A;  1TUJ A;  2KLE A;  4AOM A;  1J7Q A;  1SYM A;  3KPX A;  2JQ6 A;  2BCB A;  3FS7 A;  1DJG A;  2DOQ A;  4ETO A;  5CSN A;  3D0Y B;  1JF2 A;  3D74 A;  2LVV A;  1SBJ A;  1OE9 B;  3VRQ A;  2FJU B;  3SIA A;  2KQ6 A;  1A75 B;  4MZJ A;  3LCP C;  2RGI A;  3S0G A;  4XJK A;  1S6J A;  1ZAC A;  2ZKM X;  1W7J B;  2L50 A;  3BUX B;  3SS4 A;  1MQ1 A;  2OTG C;  5J3X A;  4OR9 B;  2QEO A;  3BJH A;  1H4B A;  2M8U A;  2OS8 B;  4JKT A;  3UO9 A;  2JWW A;  1JC2 A;  2M1U A;  1TCF A;  1OW4 A;  3A8R A;  4I5J A;  4C0L A;  5DKR A;  1SL9 A;  3DVE A;  1ALV A;  1SSE B;  4IL1 A;  1IJ6 A;  4XYN A;  1BOD A;  2G2B A;  2CTN A;  1SRA A;  1BR4 B;  1MHO A;  1RJV A;  3HCM A;  5GQQ C;  5D69 A;  5HYD A;  1FPW A;  1U5I B;  1GGW A;  2M7N A;  1R6P A;  4L9M A;  1JF0 A;  1K95 A;  1XFU O;  3TUY B;  2KPH A;  3AAK A;  4PHM A;  1A29 A;  4D1E A;  1TNP A;  1BOC A;  2HQW A;  4KYN A;  1QXP A;  1IQ5 A;  2L98 A;  5I2Q A;  1JBA A;  4GFT A;  2H2K A;  3ZWH A;  5BPJ A;  1B7T Z;  3SG6 A;  2QEB A;  2ZFD A;  1CNP A;  2KSP A;  2Y1M A;  2KHN A;  3VRN A;  3NXA A;  2PAL A;  2KBI A;  4P2Y B;  1BLQ A;  4HRG A;  3WNX B;  1NPQ A;  1X02 A;  3D0Y A;  4QJ3 B;  1EG4 A;  1REC A;  2LLS A;  3OP0 A;  1CLL A;  3NSL A;  1M45 A;  2BBM A;  4DRW A;  2F8P A;  4QJ5 B;  3O6B A;  5JJG A;  4PE1 A;  1HT9 A;  2MBX A;  4MRY A;  1DMO A;  1Y1X A;  1DGV A;  2KYC A;  1EJ3 A;  1M63 B;  2NZ0 A;  4PE4 A;  1J7O A;  1SR6 B;  3I5F B;  1B47 A;  1QTX A;  5DKN A;  3AKA A;  1KQM B;  1XFV O;  4MEW A;  1V1G A;  3WXA A;  1F54 A;  1DJW A;  1OMD A;  1UHH A;  2JOJ A;  2SCP A;  4HRH A;  3SG4 A;  2D8N A;  1KQV A;  1GQM A;  3DVK A;  4F7F A;  1PSR A;  4M2O A;  4PHJ A;  2BE4 A;  1B7T Y;  1AUI B;  1OOJ A;  2QEH A;  3NGV A;  1J1D A;  1ZUZ A;  1KFU S;  1OZO A;  1SPY A;  4N1F A;  2EHB A;  1K8U A;  2KI6 C;  5FI7 A;  2LLT A;  3AKB A;  3CWG A;  4MVF A;  1CDP A;  2KOT A;  5D7F A;  1PK0 D;  2WCE A;  3V2L A;  1HQV A;  1L7Z A;  1LVC D;  1QIW A;  4GPL B;  2AUC A;  1TNQ A;  2LM5 A;  2G9B A;  3JVT B;  1UWO A;  1QWV A;  4PT1 A;  3PAL A;  1SL7 A;  1FI6 A;  2LMU A;  4A4B A;  1NYA A;  3BFB A;  2BCA A;  2WC5 A;  3PN7 B;  2CBL A;  2Y5I A;  2I7A A;  1G4Y R;  3SG5 A;  2KFH A;  1S6C A;  1UHI A;  2K8M B;  1SKT A;  1KWO C;  1CFF A;  3B6X A;  1MXE A;  2LVK A;  3BYA A;  1M39 A;  2L5Y A;  2LUX A;  2HF5 A;  3IVT A;  2KAY A;  1B8R A;  1QAT A;  4OV2 A;  3JVT C;  2KFF A;  2PSR A;  1RFJ A;  2WCM A;  4DIR A;  1C7V A;  2WCB A;  2PYQ A;  3FWB A;  2LAP A;  4C0K A;  1MF8 B;  4C0J A;  5I2O A;  3TUY C;  3D77 A;  1D1O A;  2L5X B;  3BUN B;  3OB2 B;  4JQ0 D;  5F6T A;  1SNL A;  1IQ3 A;  3CGA A;  1YX8 A;  1R2U A;  2I18 A;  3S0F A;  3KO0 A;  1P28 A;  1PSB A;  2JT3 A;  3NHT A;  3D76 A;  2F3Z A;  1S3P A;  5IBW A;  1BF5 A;  3VB1 A;  3WHU B;  2KBM A;  3N7H A;  1JSA A;  2JU0 A;  1C07 A;  2K7O A;  1YR5 A;  1J7R A;  2GGZ A;  2LNK A;  1BU3 A;  1XFX O;  1KSM A;  3PN7 C;  4WRI A;  5EL2 A;  2FJY A;  1L2O B;  1ZFS A;  1SCM C;  2BEC A;  4I5L B;  4YGE B;  1NX0 A;  1AHR A;  2B1U A;  1FW4 A;  1KK7 Y;  2CXJ A;  2M49 B;  1GJY A;  3L4L A;  1PVA A;  1F4Q A;  2LUC A;  1A75 A;  3Q8I A;  2WCL A;  1JWD A;  2LVI A;  1K9P A;  1XA5 A;  4NDD A;  5FI2 A;  1K9U A;  1S26 D;  1SK6 D;  5HLO A;  2GGM A;  4F0Z B;  1Y0V H;  1AVS A;  2M0R A;  3CAB A;  3D75 A;  1NCZ A;  2E30 A;  3GK1 A;  1XFZ O;  2WND A;  1LXF C;  4M2P A;  1WDC B;  3L4A A;  1K96 A;  2P70 A;  2LP3 A;  4GGF C;  5CSF A;  4DCK A;  1QX2 A;  3CTN A;  1TNX A;  1QS7 A;  2JZI A;  2BE6 A;  5B8I B;  1G33 A;  2NCO A;  2BL0 B;  2GTE A;  3I5I B;  4INW A;  1M46 A;  2BL0 C;  1YX7 A;  2K7C A;  1QLK A;  2AAO A;  3BFH A;  4YRU A;  2QAC A;  4I5N B;  3BQ3 A;  3TDU A;  3K21 A;  1TWO A;  3PLF B;  2LMV A;  5HKZ A;  1N0Y A;  1VRK A;  2PAS A;  4CFQ A;  1UUR A;  2K2F A;  2M29 A;  2FOT A;  1YUT A;  2JNF A;  1KK8 B;  1NX2 A;  1MWN A;  5FYX A;  2KFG A;  5PAL A;  1JUO A;  4R1E A;  2ZNE A;  1IG5 A;  2I2R E;  3QME A;  3EKJ A;  1KCY A;  2I94 A;  1TN4 A;  2WOS A;  1S36 A;  1FI5 A;  1DVI A;  2BAP A;  1AJ4 A;  2ZRT A;  3BOW B;  3LK1 A;  5AER A;  2SAS A;  1C3Z A;  3O2P A;  2NLN A;  1CLM A;  2QDI A; 
#chains in the Genus database with same CATH homology
 1Y1A A;  1UHJ A;  2F33 A;  2JT0 A;  3SG2 A;  1Y6W A;  1JFK A;  1AJ5 A;  1A03 A;  1F70 A;  1B1G A;  4ZCU A;  1B4C A;  2WCF A;  4GGF A;  3DVM A;  1YUS A;  2M97 A;  3TZ1 A;  1A4P A;  1DF0 B;  1TCO B;  4ORA B;  1OSA A;  1CDN A;  1SW8 A;  1YVL A;  1EXR A;  1K90 D;  1DJI A;  1DT7 B;  2MAZ A;  2MLE C;  2M1K B;  1BG1 A;  1ZMZ A;  3SIB A;  1F4O A;  1CKK A;  4PHN A;  1NX1 A;  3WHT B;  3M0W A;  2BBN A;  2LV7 A;  2HQ8 A;  1K93 D;  1N2D A;  4OKH A;  1RK9 A;  2JPT A;  3EVU A;  4JPZ B;  4YI9 A;  1JFJ A;  1CDL A;  1DTL A;  4CID A;  1DF0 A;  2HPS A;  2JT8 A;  2CNP A;  4AQI A;  1OZS A;  4PAL A;  3PM8 A;  4E68 A;  1NSH A;  1J7P A;  4I5K A;  3BXK A;  4Q04 A;  1YVH A;  1XFW O;  1NX3 A;  2LP2 A;  3TDI A;  4PCW A;  2WC8 A;  4GGN A;  1CMF A;  1WRZ A;  2Q4U A;  3GK4 X;  1SMG A;  2KI4 B;  4U8D A;  2FCD A;  1S5G Z;  2JTZ A;  2KGB C;  2K0J A;  1YUU A;  2OS8 C;  5ER5 A;  1YRU B;  1E8A A;  3QRX A;  4OVN F;  2MA2 A;  2Y4Q A;  2EC6 B;  2L4I A;  1IGV A;  1IRJ A;  2K7D A;  2JTT A;  1AK8 A;  1DJZ A;  2GV5 A;  1QJT A;  3GK2 A;  1B9A A;  2BKH B;  4P5O E;  5KTY A;  3EVR A;  2MLF C;  2HET A;  3CR4 X;  1SY9 A;  2F3Y A;  1SCM B;  2JNX A;  3VRP A;  1XK4 A;  1J55 A;  3PSR A;  1DJH A;  2KNE A;  4BY5 A;  3EK8 A;  1CMG A;  2CCM A;  2PVB A;  4ICB A;  5G08 A;  3EK4 A;  3RM1 A;  4TNC A;  4N1G A;  2OPO A;  3I5G C;  4CLN A;  2LMT A;  3EKH A;  2F2P A;  3DF0 A;  3NSK A;  1QX5 B;  2ZN8 A;  4ORB B;  1RRO A;  1CDM A;  2MRD A;  1PRW A;  2IS9 A;  1MUX A;  4PDZ A;  2PRU A;  2LLU A;  2KYF A;  3LK0 A;  1AP4 A;  1CFC A;  2JXL A;  1SL8 A;  1QV0 A;  1YTZ C;  2AMI A;  4MZK A;  4NDB A;  1FBV A;  5ER4 X;  3I5H C;  1MR8 A;  3FWC A;  3F45 A;  1Q80 A;  2ZN9 A;  3BUM B;  1QVI Z;  4PHK A;  1WLM A;  1F55 A;  4WQ2 A;  4FTG A;  4MRX A;  1SR6 C;  1NWD A;  1XK4 C;  3E3R A;  1QLS A;  5I8N A;  3SG7 A;  1IWQ A;  1F8H A;  1TNW A;  1BR1 B;  4UPG A;  2L2E A;  1WRK A;  1TOP A;  2LVJ A;  3GOF A;  1B8L A;  2NCP A;  5CSI A;  2L4H A;  4CPV A;  3TS5 C;  1CB1 A;  3BUO B;  2KDH A;  1LIN A;  1WLZ A;  2QPT A;  4PE0 A;  5HKY A;  2BCX A;  4WQ3 A;  4XJK B;  1XO5 A;  1S6I A;  4N5X A;  2JXC A;  1S5G Y;  3LL8 B;  4CFR A;  3H4S E;  2LCP A;  3DF0 B;  3O4Y A;  1IKU A;  3JTD C;  2ISD A;  3PFV A;  3LLE A;  1CM4 A;  4AQJ A;  2KI6 D;  2Y1N A;  2JUL A;  2KGR A;  1CM1 A;  1LKJ A;  3SG3 A;  2L0P A;  3HX4 A;  1ALW A;  1BMO A;  3AAJ A;  3IF7 A;  2LHI A;  3FIA A;  5CPV A;  4MN0 A;  2ZND A;  4MZL A;  1S1E A;  2EGD A;  2H61 C;  2LE9 B;  1ODB A;  4QJ4 B;  1ZOT B;  2O5G A;  1TRF A;  4HRE E;  1DJX A;  3I5F C;  1KK8 C;  1CLB A;  2A4J A;  1QX7 A;  4USL A;  3BUW B;  1OMV A;  2M3W A;  4YGA A;  4MLW A;  1Y1U A;  1UP5 A;  2LAN A;  1FF1 A;  1WY9 A;  3JTD B;  4MSP A;  2M7L A;  1KFX S;  3VRO A;  2ZRS A;  3CZT X;  1KQV A;  2KQY A;  2TN4 A;  2EC6 C;  4YI8 A;  3DVJ A;  3KF9 A;  2MJW B;  1PVB A;  2R2I A;  3OHM B;  5DKQ A;  1XVJ A;  5AAN A;  3EK7 A;  4DUQ A;  3IQQ A;  1K9K A;  5KSZ A;  1J1E A;  1NCX A;  1MXL C;  3D10 A;  2KI4 C;  5K89 A;  4YBH B;  3VRR A;  4YGB B;  1EH2 A;  3PAT A;  1QAS A;  3O78 A;  1F71 A;  3ZNI A;  4PE7 A;  1C7W A;  4M2Q A;  3I5G B;  3KHE A;  3NSO A;  4GNK B;  1XFY O;  1K94 A;  2P6B B;  1SCV A;  1LA0 A;  2NXQ A;  3OB1 B;  1UUS A;  3OX5 A;  5I2L A;  1WDC C;  2L51 A;  1BT6 A;  2JC2 A;  3A4U B;  5CSJ A;  4HSZ A;  4GBA A;  2V53 A;  1YRT B;  2KAX A;  1UHN A;  4YGC B;  3CR2 A;  1IH0 A;  1EG3 A;  1LA3 A;  2LC5 A;  3IQO A;  4GUK A;  4NDC A;  1BJF A;  3MSE B;  3TS5 B;  1DJY A;  1IJ5 A;  3TDZ A;  1U5I A;  5AEQ A;  1WRL A;  2O60 A;  1NIW A;  1L2O C;  4DS7 A;  1A2X A;  4OCI A;  4YGD B;  1H8B A;  2K61 A;  2LHL A;  1M31 A;  1QIV A;  5HLV A;  2MHH A;  1W7I B;  2H61 A;  1KFU L;  1RTP 1;  3ICB A;  5HKW A;  1UHK A;  2COL B;  3NSI A;  1CFP A;  3DD4 A;  2M9G A;  2VRG A;  1OQP A;  4GAO A;  1KQM C;  1G8I A;  4JWQ A;  1V1F A;  5TNC A;  1K2H A;  3BOW A;  2F2O A;  3C1V A;  1RWY A;  1TIZ A;  3I5H B;  4ORC B;  2E6W A;  2JRF A;  1QVI Y;  2PMY A;  1KSO A;  5AFP A;  1KK7 Z;  1NUB A;  1QV1 A;  5AXI A;  1PUL A;  4FQO A;  1OMR A;  2WOR A;  3CLN A;  3SJS A;  1NP8 A;  1EL4 A;  1N65 A;  1TTX A;  1KWO B;  3OX6 A;  4ZCV A;  3KEV A;  2K7B A;  4NQG A;  3CR5 X;  2KAV A;  3I5I C;  5JOL A;  2CT9 A;  3RLZ A;  1B8C A;  1CFD A;  1CTR A;  1KFX L;  1GGZ A;  1XYD A;  1PAL A;  4MBE A;  3EVV A;  1YUR A;  4A4C A;  2K2A A;  4BY4 A;  3CS1 A;  3VGO A;  2FCE A;  1NCY A;  1DGU A;  2Q91 A;  2OTG B;  2BKI B;  5KU1 A;  4AOM A;  1J7Q A;  1SYM A;  3KPX A;  2JQ6 A;  2BCB A;  3FS7 A;  1DJG A;  2DOQ A;  4ETO A;  5CSN A;  3D0Y B;  1JF2 A;  2LVV A;  1SBJ A;  1OE9 B;  3VRQ A;  2FJU B;  3SIA A;  2KQ6 A;  1A75 B;  4MZJ A;  3LCP C;  2RGI A;  4XJK A;  1S6J A;  1ZAC A;  2ZKM X;  1W7J B;  2L50 A;  3BUX B;  1MQ1 A;  2OTG C;  5J3X A;  4OR9 B;  1H4B A;  2M8U A;  2OS8 B;  1JC2 A;  2JWW A;  2M1U A;  1TCF A;  3A8R A;  4I5J A;  4C0L A;  5DKR A;  1SL9 A;  3DVE A;  1ALV A;  4IL1 A;  1IJ6 A;  4XYN A;  1BOD A;  2G2B A;  2CTN A;  1SRA A;  1BR4 B;  1MHO A;  1RJV A;  3HCM A;  5GQQ C;  5D69 A;  5HYD A;  1FPW A;  1U5I B;  1GGW A;  2M7N A;  1R6P A;  4L9M A;  1JF0 A;  1K95 A;  1XFU O;  3TUY B;  3AAK A;  4PHM A;  1A29 A;  4D1E A;  1TNP A;  1BOC A;  2HQW A;  1QXP A;  1IQ5 A;  2L98 A;  5I2Q A;  1JBA A;  4GFT A;  2H2K A;  3ZWH A;  5BPJ A;  1B7T Z;  3SG6 A;  1CNP A;  2ZFD A;  2KSP A;  2Y1M A;  2KHN A;  3VRN A;  3NXA A;  2PAL A;  2KBI A;  4P2Y B;  1BLQ A;  4HRG A;  3WNX B;  1NPQ A;  1X02 A;  3D0Y A;  4QJ3 B;  1EG4 A;  1REC A;  2LLS A;  3OP0 A;  1CLL A;  3NSL A;  1M45 A;  2BBM A;  4DRW A;  2F8P A;  4QJ5 B;  3O6B A;  5JJG A;  4PE1 A;  1HT9 A;  2MBX A;  4MRY A;  1DMO A;  1Y1X A;  1DGV A;  2KYC A;  1EJ3 A;  1M63 B;  2NZ0 A;  4PE4 A;  1J7O A;  1SR6 B;  3I5F B;  1B47 A;  1QTX A;  5DKN A;  3AKA A;  1KQM B;  1XFV O;  4MEW A;  1V1G A;  3WXA A;  1F54 A;  1DJW A;  1OMD A;  1UHH A;  2JOJ A;  2SCP A;  4HRH A;  3SG4 A;  2D8N A;  1GQM A;  3DVK A;  1PSR A;  4M2O A;  4PHJ A;  2BE4 A;  1B7T Y;  1AUI B;  1OOJ A;  1J1D A;  1ZUZ A;  1KFU S;  1OZO A;  1SPY A;  4N1F A;  2EHB A;  1K8U A;  2KI6 C;  2LLT A;  3AKB A;  3CWG A;  4MVF A;  1CDP A;  2KOT A;  5D7F A;  1PK0 D;  2WCE A;  1HQV A;  1L7Z A;  1LVC D;  1QIW A;  4GPL B;  2AUC A;  1TNQ A;  2LM5 A;  2G9B A;  3JVT B;  1UWO A;  3PAL A;  1SL7 A;  1FI6 A;  2LMU A;  4A4B A;  1NYA A;  2BCA A;  3PN7 B;  2CBL A;  2Y5I A;  2I7A A;  1G4Y R;  3SG5 A;  2KFH A;  1S6C A;  1UHI A;  2K8M B;  1SKT A;  1KWO C;  1CFF A;  1MXE A;  2LVK A;  3BYA A;  1M39 A;  2LUX A;  2HF5 A;  2KAY A;  1B8R A;  1QAT A;  4OV2 A;  3JVT C;  2KFF A;  2PSR A;  1RFJ A;  4DIR A;  1C7V A;  2WCB A;  3FWB A;  2LAP A;  4C0K A;  1MF8 B;  4C0J A;  5I2O A;  3TUY C;  1D1O A;  2L5X B;  3BUN B;  3OB2 B;  4JQ0 D;  5F6T A;  1SNL A;  1IQ3 A;  3CGA A;  1YX8 A;  1R2U A;  2I18 A;  3KO0 A;  1PSB A;  2JT3 A;  5IBW A;  2F3Z A;  1S3P A;  1BF5 A;  3WHU B;  2KBM A;  1JSA A;  2JU0 A;  1C07 A;  2K7O A;  1YR5 A;  1J7R A;  2GGZ A;  2LNK A;  1BU3 A;  1XFX O;  1KSM A;  3PN7 C;  4WRI A;  1L2O B;  1ZFS A;  1SCM C;  2BEC A;  4I5L B;  4YGE B;  1NX0 A;  1AHR A;  2B1U A;  1FW4 A;  1KK7 Y;  2CXJ A;  2M49 B;  1GJY A;  1PVA A;  1F4Q A;  2LUC A;  1A75 A;  1JWD A;  2LVI A;  1K9P A;  1XA5 A;  4NDD A;  1K9U A;  1S26 D;  1SK6 D;  5HLO A;  2GGM A;  4F0Z B;  1Y0V H;  1AVS A;  2M0R A;  3GK1 A;  4M2P A;  1NCZ A;  2E30 A;  1XFZ O;  2WND A;  1LXF C;  1WDC B;  1K96 A;  2LP3 A;  4GGF C;  5CSF A;  4DCK A;  1QX2 A;  3CTN A;  1TNX A;  1QS7 A;  2JZI A;  2BE6 A;  5B8I B;  1G33 A;  2NCO A;  2BL0 B;  3I5I B;  1M46 A;  2BL0 C;  1YX7 A;  2K7C A;  1QLK A;  2AAO A;  4YRU A;  2QAC A;  4I5N B;  3BQ3 A;  3TDU A;  3K21 A;  3PLF B;  2LMV A;  5HKZ A;  1N0Y A;  1VRK A;  2PAS A;  4CFQ A;  1UUR A;  2K2F A;  2M29 A;  2FOT A;  1YUT A;  2JNF A;  1KK8 B;  1NX2 A;  1MWN A;  5FYX A;  2KFG A;  5PAL A;  1JUO A;  4R1E A;  2ZNE A;  1IG5 A;  2I2R E;  3EKJ A;  1KCY A;  2I94 A;  1TN4 A;  2WOS A;  1S36 A;  1FI5 A;  1DVI A;  1AJ4 A;  2ZRT A;  3BOW B;  3LK1 A;  5AER A;  2SAS A;  3O2P A;  2NLN A;  1CLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...