2HQWA

Crystal structure of ca2+/calmodulin bound to nmda receptor nr1c1 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
138
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title The NMDA Receptor NR1 C1 Region Bound to Calmodulin: Structural Insights into Functional Differences between Homologous Domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 47
structure length 138
sequence length 144
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hqwA00
3OX6A 1KQMC 2Q4UA 5CPVA 3TUYB 1VRKA 4MZJA 1B4CA 1B47A 2E30A 1DJZA 3CR2A 1SYMA 1HQVA 2F2OA 2K7OA 1L2OC 1NYAA 2KAXA 2ZN9A 2EGDA 1UHHA 4R1EA 4DIRA 1M63B 1KQVA 3LK1A 2JXCA 3D10A 5J3XA 1XYDA 1BJFA 1KFUS 1UHNA 3QRXA 1A75A 3SIBA 2O5GA 2F8PA 1YVHA 1PVAA 2D8NA 1SL9A 1J1EA 1G4YR 2KFHA 2LMUA 3VGOA 1EG4A 3BYAA 3FWCA 2HPSA 1IGVA 2Y4QA 4ORCB 2H61A 2L4IA 1KFUL 3F45A 3KF9A 1DJXA 3I5IC 1LA3A 2CNPA 1MXLC 1S6JA 3TS5C 4GGFA 2BL0B 1MHOA 2WCFA 1BR1B 2WCBA 4USLA 4F0ZB 1CDPA 1IKUA 1NX1A 2L5XB 4BY4A 1IJ5A 1XFWO 1V1FA 2M1KB 2MA2A 1QIWA 1QTXA 1Q80A 4FTGA 5HLOA 1QASA 4HRGA 1WDCB 4Q04A 5CSIA 5TNCA 5HKYA 1U5IB 3IQOA 1NWDA 3KHEA 4NDBA 2ZRTA 2KI6C 5AFPA 2KAVA 1GGWA 1UURA 4GNKB 3SG7A 4M2OA 1NPQA 2DOQA 2KDHA 2OTGB 2KBIA 3EK7A 3D0YB 3EK4A 4QJ4B 4MZLA 1K95A 1A4PA 5D69A 3H4SE 1NSHA 1OSAA 1Y0VH 2FJUB 1CB1A 2BE4A 2Y5IA 2K2FA 2KGBC 2O60A 1CDLA 2FCDA 2I18A 1IWQA 2EHBA 2Q91A 3WXAA 1TNXA 1SR6B 2HETA 1XFZO 2OS8C 2KNEA 1F4OA 2JTZA 1FF1A 2BCXA 4DS7A 3BOWB 3VRNA 4XJKB 1QS7A 1DF0B 1S6CA 5HKWA 1S3PA 3CR4X 5PALA 2KI4B 1GGZA 1B8RA 1OMDA 1F55A 3VROA 2F33A 4JQ0D 1OQPA 2JU0A 1OZOA 2ZNEA 4DCKA 1H8BA 1UWOA 2COLB 2CTNA 1KSMA 3KPXA 4MEWA 1TCFA 4HREE 1FPWA 2H2KA 2ZKMX 1JF0A 1IG5A 4YI9A 1DJWA 3SIAA 2G2BA 5F6TA 1AK8A 2P6BB 1EH2A 4ETOA 1NCYA 2I2RE 2LC5A 2PASA 4MRYA 1KK7Z 1UHJA 2Y1NA 4PHMA 2CCMA 2GGZA 4AQJA 2RGIA 3NXAA 1BF5A 1CKKA 1ODBA 1DT7B 1A75B 1KWOB 2K7DA 1K9KA 1K93D 1XFXO 2M3WA 1WLMA 1LKJA 1YRUB 1J7PA 2JT8A 3PN7C 1C7WA 4GFTA 3TDIA 4CFQA 1KK8C 1TCOB 2GV5A 1KSOA 2QACA 1GQMA 3AAKA 4XYNA 4C0KA 1SCVA 1G33A 1YUUA 3SG6A 1DJGA 4L9MA 1HT9A 3BOWA 1IJ6A 5DKQA 3IQQA 2M0RA 1JSAA 2MAZA 1SPYA 4A4CA 2L0PA 1N2DA 3I5HB 2BECA 5KSZA 2HQ8A 1CMGA 2LAPA 1RK9A 2CBLA 3LK0A 1NCXA 1F70A 2LLTA 1BT6A 3CR5X 1AVSA 5ER4X 2K61A 3K21A 2L50A 1NX3A 1XK4C 4YBHB 1XO5A 3A4UB 3JVTB 2L4HA 1MQ1A 1DMOA 1NIWA 1QVIY 1M45A 2NLNA 4JPZB 5IBWA 1QX2A 1DJYA 5I2OA 1F4QA 1KQMB 4HSZA 1SNLA 2LMVA 1LVCD 3O4YA 5AERA 1FI6A 1F54A 1AUIB 3CGAA 1IQ3A 1L2OB 1DTLA 2LUXA 1TNPA 1DJIA 2EC6C 1BOCA 1ZMZA 4E68A 1EJ3A 1YURA 4PE0A 3NSIA 4OKHA 1MF8B 2K0JA 2JRFA 5AXIA 2LHIA 1QV0A 1IH0A 1NCZA 1S1EA 3O2PA 1PK0D 3NSKA 3PATA 4CFRA 2ZFDA 1JFKA 2ZN8A 1M31A 2PALA 3I5IB 1V1GA 4PE4A 1J1DA 3TS5B 1BG1A 4MSPA 4YGBB 1B1GA 2K7BA 1JC2A 1J55A 2LP3A 2QPTA 1S5GY 2JWWA 3PSRA 3BUXB 4GGNA 3JTDC 1NUBA 2M1UA 1G8IA 1W7IB 1LXFC 1M46A 4M2PA 2KYFA 3OB2B 1KCYA 2A4JA 4NQGA 2NXQA 2JQ6A 2WORA 1R2UA 2FCEA 2MJWB 5JOLA 2NCOA 1SRAA 1SL7A 3I5FC 4YGCB 2OPOA 2OTGC 1XK4A 3SJSA 1CDNA 3PM8A 1RROA 2WC8A 1B8CA 1PULA 2ZNDA 1EXRA 1SKTA 1YUTA 2LP2A 2BCAA 1C7VA 1MWNA 1Y6WA 2JTTA 2LNKA 3NSLA 3SG2A 2M8UA 3OB1B 2BBMA 1JUOA 3LL8B 1A29A 4YGAA 1XFVO 2LLSA 1QXPA 1UUSA 1BMOA 2VRGA 3KEVA 2M7LA 1QVIZ 4ORAB 4I5LB 1CNPA 2OS8B 3KO0A 2LVVA 4WQ3A 1K96A 3IF7A 1EG3A 1QX7A 2CT9A 1AJ4A 2M49B 4OR9B 2HF5A 4U8DA 2M97A 1BODA 2KAYA 1ALVA 1MXEA 1OMRA 1W7JB 3GOFA 4PE7A 1CFFA 3PLFB 1TTXA 3EKJA 3AKBA 4PE1A 5KTYA 1N0YA 2PRUA 1AP4A 1CLLA 3SG4A 3PALA 3TDZA 1SY9A 2JT0A 1WLZA 2I94A 2R2IA 2LCPA 4PDZA 5G08A 1RTP1 2JULA 1TRFA 1YUSA 4QJ3B 3DVJA 3I5GC 1MR8A 1YRTB 5BPJA 2SASA 2LVKA 2BCBA 1SMGA 1S5GZ 4PCWA 1N65A 1IRJA 1CFDA 3DD4A 3RLZA 1A2XA 2M9GA 3CZTX 3ZNIA 1SCMC 2MLEC 1IQ5A 3NSOA 2MRDA 3DVEA 4ZCVA 5CSNA 3RM1A 2NZ0A 2H61C 1RFJA 2WOSA 4P2YB 3M0WA 2KHNA 3VRQA 2JT3A 2AMIA 4P5OE 1ZUZA 3PN7B 1KK8B 3TDUA 1MUXA 1RECA 1SL8A 1SBJA 1LA0A 1CLBA 1X02A 4N1GA 1YX8A 3CLNA 4N1FA 4WQ2A 1QLSA 1H4BA 4PHKA 1CM4A 2JNXA 4AOMA 2TN4A 1OMVA 5I2LA 1BLQA 1PVBA 1NX0A 1QIVA 3EVUA 1E8AA 3A8RA 2PSRA 3FWBA 5AEQA 4AQIA 1SK6D 3TUYC 1XFYO 1NP8A 1FBVA 2LVJA 1OZSA 5K89A 2BBNA 5DKNA 2ISDA 2LM5A 1TIZA 1M39A 1CDMA 1K94A 1AJ5A 1LINA 1FI5A 1Y1XA 2WCEA 2AAOA 2BKHB 2KQYA 1TNQA 5I8NA 1B7TY 3AKAA 3BXKA 4PHJA 3OX5A 5HKZA 1RJVA 1EL4A 1AHRA 2LHLA 3EVRA 1PRWA 3LCPC 4N5XA 3HCMA 2BL0C 5CSJA 5KU1A 1K2HA 2EC6B 4TNCA 3BUOB 1JF2A 2LVIA 1ALWA 1K9UA 4I5NB 4C0LA 1WRZA 4MZKA 1R6PA 5FYXA 5JJGA 3FS7A 1WDCC 2M7NA 1CFCA 1WRKA 1D1OA 2MHHA 4GBAA 2NCPA 3CWGA 1YX7A 2KGRA 1CM1A 4HRHA 2F3YA 1PALA 1TOPA 3VRRA 3DVMA 1OOJA 5AANA 3LLEA 1KK7Y 2MBXA 2FOTA 3OHMB 3GK2A 1S6IA 1XVJA 1UHKA 3JTDB 4IL1A 4PHNA 3PFVA 1KFXS 1UHIA 1Y1AA 2L98A 4GUKA 2LUCA 5I2QA 4NDCA 4DRWA 2L51A 1NX2A 1ZACA 2F3ZA 2ZRSA 4D1EA 2KI6D 1F71A 1S36A 4ORBB 2WNDA 3DVKA 1KFXL 4YGDB 2KBMA 4MLWA 3BUWB 3I5FB 1B8LA 4JWQA 1TNWA 1SR6C 3C1VA 4FQOA 2PMYA 5CSFA 1Y1UA 4YGEB 4GPLB 2JC2A 4CLNA 2PVBA 4WRIA 3GK4X 1K90D 1QX5B 2AUCA 2Y1MA 3BQ3A 3WNXB 1JFJA 2KI4C 4MVFA 5GQQC 2F2PA 3O78A 1C07A 3TZ1A 5HYDA 1BU3A 2G9BA 3OP0A 4A4BA 1B7TZ 1YVLA 2E6WA 1WY9A 1XFUO 3BUMB 1CTRA 1J7RA 3DF0B 2K7CA 4I5KA 1K9PA 4BY5A 1CLMA 2BKIB 3FIAA 2BE6A 3E3RA 4UPGA 1RWYA 4ICBA 3SG5A 4C0JA 3MSEB 1PSRA 1XA5A 1DGVA 1F8HA 1U5IA 3EVVA 2JPTA 1FW4A 1SW8A 1WRLA 2K2AA 2V53A 4OV2A 2KFFA 5D7FA 2KQ6A 1OE9B 1PSBA 3AAJA 2L2EA 2JNFA 2LANA 3CS1A 3SG3A 1KWOC 3GK1A 1JBAA 2GGMA 1K8UA 2LV7A 4GAOA 4NDDA 1JWDA 2B1UA 3I5GB 2KOTA 2SCPA 3D0YA 1S26D 1A03A 4CPVA 2CXJA 4MRXA 3BUNB 1TN4A 2MLFC 4GGFC 2I7AA 2K8MB 1L7ZA 1BR4B 2HQWA 1CMFA 1SCMB 1UP5A 3ZWHA 4I5JA 5DKRA 1ZFSA 3EK8A 2KFGA 2IS9A 3CTNA 4M2QA 4QJ5B 3I5HC 3WHTB 2M29A 1QV1A 5HLVA 1J7QA 1GJYA 4DUQA 3O6BA 4ZCUA 1DGUA 2JXLA 3DF0A 4XJKA 2LE9B 2LMTA 4OCIA 4PALA 4CIDA 1DF0A 1CFPA 1QJTA 3ICBA 1ZOTB 2LLUA 2KYCA 4MBEA 3VRPA 1QATA 4YRUA 2KSPA 1DJHA 4OVNF 3JVTC 3HX4A 5ER5A 1YR5A 1J7OA 2JOJA 1DVIA 1YTZC 3WHUB 1B9AA 3EKHA 4MN0A 4YI8A 2JZIA 5B8IB 1QLKA
chains in the Genus database with same CATH superfamily
3OX6A 1KQMC 2Q4UA 5CPVA 3TUYB 1VRKA 4KYNA 4MZJA 1B4CA 1B47A 2E30A 1DJZA 3CR2A 1SYMA 1HQVA 2F2OA 2K7OA 1L2OC 1NYAA 2KAXA 2ZN9A 2EGDA 1UHHA 4R1EA 4DIRA 1M63B 1KQVA 3LK1A 2JXCA 3D10A 5J3XA 1XYDA 1BJFA 1KFUS 1UHNA 3QRXA 1A75A 3SIBA 2O5GA 2F8PA 1YVHA 1PVAA 2D8NA 1SL9A 1J1EA 1G4YR 2KFHA 2LMUA 3L4AA 3VGOA 1EG4A 3BYAA 3FWCA 2HPSA 1IGVA 2Y4QA 4ORCB 2H61A 2L4IA 1KFUL 3F45A 3KF9A 3FE8A 3NGVA 1DJXA 3I5IC 1LA3A 2CNPA 1MXLC 1S6JA 2QEBA 3OGNA 3TS5C 4GGFA 2BL0B 1MHOA 2WCFA 1BR1B 2WCBA 4USLA 4F0ZB 1CDPA 1IKUA 1NX1A 2L5XB 4BY4A 1IJ5A 1XFWO 1V1FA 2M1KB 2MA2A 3CZ0A 1QIWA 1QTXA 1Q80A 4FTGA 5HLOA 1QASA 3SS4A 4HRGA 1WDCB 4Q04A 5CSIA 5TNCA 5HKYA 1U5IB 3IQOA 1NWDA 3KHEA 4NDBA 3BFAA 2ZRTA 2KI6C 5AFPA 2KAVA 1GGWA 1UURA 3D73A 4GNKB 3SG7A 4M2OA 1NPQA 2DOQA 2KDHA 2OTGB 2KBIA 3EK7A 3D0YB 3EK4A 4QJ4B 4MZLA 1K95A 1A4PA 5D69A 1T14A 3H4SE 3BJHA 1NSHA 1OSAA 1Y0VH 2FJUB 1CB1A 1TUZA 2BE4A 2Y5IA 2K2FA 2KGBC 2O60A 3D74A 3BFHA 1CDLA 2FCDA 2I18A 1IWQA 2EHBA 2Q91A 2WCKA 3WXAA 1TNXA 3VB1A 1SR6B 2HETA 1XFZO 2H8VA 2OS8C 2KNEA 1F4OA 2JTZA 1FF1A 2BCXA 4DS7A 4INWA 3BOWB 3VRNA 4XJKB 1QS7A 1DF0B 1S6CA 5HKWA 1C7VA 1S3PA 3CR4X 5PALA 2KI4B 4AQJA 1GGZA 1B8RA 1OMDA 1OOIX 1F55A 3VROA 2F33A 4JQ0D 1OQPA 2YGUA 2JU0A 3D77A 2PQLA 3NHIA 1OZOA 2ZNEA 4DCKA 1H8BA 1UWOA 2COLB 2CTNA 1KSMA 3KPXA 4MEWA 1TCFA 2QDIA 2ERBA 4HREE 1FPWA 1Z4HA 2H2KA 2ZKMX 2QEOA 3Q8IA 1JF0A 1IG5A 4YI9A 1DJWA 3SIAA 2G2BA 5F6TA 1AK8A 2P6BB 1EH2A 4ETOA 3CZ2A 1NCYA 2I2RE 2LC5A 2PASA 3DXLA 1KK7Z 1UHJA 2Y1NA 2L5YA 2CCMA 2GGZA 4MRYA 2RGIA 3NXAA 3PM2A 1BF5A 1CKKA 1ODBA 3L4LA 1DT7B 1A75B 1KWOB 2K7DA 1K9KA 1K93D 1XFXO 2M3WA 1WLMA 1LKJA 1YRUB 3B86A 3UO9A 1J7PA 2JT8A 1GM0A 3PN7C 1C7WA 4GFTA 3TDIA 4CFQA 1KK8C 1TCOB 2GV5A 1KSOA 2QACA 1GQMA 3AAKA 4XYNA 4C0KA 1SCVA 1G33A 1YUUA 3S0BA 3SG6A 5HL1A 1DJGA 4L9MA 1HT9A 3BOWA 1IJ6A 5DKQA 3IQQA 2M0RA 1JSAA 2MAZA 1SPYA 4A4CA 2L0PA 1N2DA 5FI6A 3CABA 3S0DA 3I5HB 2BECA 5KSZA 2HQ8A 1CMGA 2LAPA 1RK9A 2CBLA 3LK0A 1NCXA 1F70A 2LLTA 1BT6A 3CR5X 1AVSA 5ER4X 2K61A 3K21A 1LS8A 2L50A 1NX3A 3D78A 3K1EA 1XK4C 1P28A 2WC6A 4YBHB 3RZSA 1XO5A 3A4UB 3JVTB 2L4HA 1MQ1A 1DMOA 1NIWA 1QVIY 1M45A 2NLNA 4JPZB 5IBWA 3R72A 1QX2A 1DJYA 5I2OA 1F4QA 1KQMB 4HSZA 1SNLA 2LMVA 1LVCD 3O4YA 5AERA 1FI6A 1F54A 1AUIB 1XFRA 3CGAA 1IQ3A 1L2OB 1DTLA 2LUXA 1TNPA 1DJIA 2EC6C 4IJ7A 1BOCA 1ZMZA 4E68A 3V2LA 1EJ3A 1YURA 4PE0A 3NSIA 4OKHA 1MF8B 2K0JA 2JRFA 5AXIA 2LHIA 1QV0A 1IH0A 1NCZA 1S1EA 3O2PA 1PK0D 3NSKA 3PATA 4CFRA 2ZFDA 1JFKA 2ZN8A 3S0GA 1IIOA 1M31A 2PALA 3L47A 2KPHA 3I5IB 1V1GA 4PE4A 1J1DA 2WCMA 3TS5B 1BG1A 4MSPA 4YGBB 1B1GA 2K7BA 1JC2A 1J55A 2LP3A 2QPTA 1S5GY 2JWWA 3PSRA 3BUXB 4GGNA 3JTDC 3B87A 1NUBA 2M1UA 1G8IA 1W7IB 1LXFC 1M46A 4M2PA 2KYFA 3OB2B 1KCYA 2A4JA 4NQGA 2NXQA 2JQ6A 2WORA 4JKTA 1R2UA 2FCEA 2MJWB 5JOLA 2NCOA 1SRAA 1SL7A 3I5FC 4YGCB 2OPOA 2OTGC 1XK4A 2K60A 3SJSA 1CDNA 3PM8A 1RROA 2WC8A 1B8CA 1PULA 2ZNDA 1EXRA 1SKTA 1YUTA 2LP2A 2BCAA 2P70A 1MWNA 1Y6WA 2JTTA 2LNKA 3NSLA 1ORGA 3SG2A 2M8UA 3OB1B 2BBMA 1JUOA 1W9ZA 2PYQA 3LL8B 1A29A 4YGAA 1XFVO 2LLSA 1QXPA 1UUSA 1BMOA 2VRGA 3KEVA 5D3OA 2M7LA 1QVIZ 4ORAB 4I5LB 1CNPA 1C3YA 4INXA 3B88A 1OOHA 1QWVA 2OS8B 2LVVA 3KO0A 4WQ3A 1K96A 3IF7A 1EG3A 3B6XA 1SSEB 1QX7A 2CT9A 1AJ4A 2M49B 4OR9B 2HF5A 4U8DA 2M97A 1BODA 2KAYA 5I94A 1ALVA 4OZDA 1MXEA 1OMRA 1W7JB 3GOFA 4PE7A 1CFFA 3PLFB 1TTXA 3EKJA 3AKBA 4PE1A 5KTYA 1N0YA 2PRUA 1AP4A 1CLLA 3SG4A 3PALA 3TDZA 1SY9A 1OOGA 2JT0A 1WLZA 2I94A 2R2IA 2LCPA 4JD9A 4PDZA 1RTP1 5G08A 2JULA 1TRFA 1YUSA 3OBVA 3DVJA 4QJ3B 3I5GC 1MR8A 3S0FA 1YRTB 5BPJA 1DQEA 2SASA 2LVKA 2BCBA 2KLEA 1SMGA 1S5GZ 4PCWA 5EL2A 1N65A 1IRJA 1CFDA 1TWOA 3DD4A 3RLZA 1A2XA 2M9GA 3CZTX 3PJIA 3ZNIA 1SCMC 3UNWA 2MLEC 1IQ5A 3NSOA 2MRDA 3DVEA 4ZCVA 5CSNA 3RM1A 2NZ0A 2H61C 1RFJA 2WOSA 4P2YB 3M0WA 2KHNA 3VRQA 2JT3A 2AMIA 4P5OE 1ZUZA 3PN7B 2L2CA 1KK8B 3TDUA 1MUXA 1RECA 1SL8A 3R1PA 1SBJA 3FE9A 1LA0A 1CLBA 2KLDA 1X02A 4N1GA 1YX8A 3CLNA 4N1FA 4WQ2A 1QLSA 1H4BA 4PHKA 1CM4A 2JNXA 5DICA 4AOMA 3SS5A 2TN4A 1OMVA 5I2LA 3S0EA 1BLQA 1PVBA 3CYZA 1NX0A 1QIVA 3EVUA 4PT1A 1E8AA 3A8RA 2PSRA 3FWBA 5AEQA 4AQIA 1SK6D 3TUYC 1XFYO 1NP8A 1FBVA 2LVJA 1OZSA 5K89A 2BBNA 2WCHA 5DKNA 2ISDA 2LM5A 3BFBA 1TIZA 1M39A 1CDMA 1K94A 1AJ5A 1LINA 1FI5A 1Y1XA 2WC5A 2WCEA 2AAOA 2BKHB 2KQYA 1TNQA 5I8NA 1B7TY 3AKAA 3BXKA 4PHJA 3OX5A 3D76A 5HKZA 1RJVA 1EL4A 1AHRA 2LHLA 3EVRA 1PRWA 3LCPC 4N5XA 3HCMA 2BL0C 5CSJA 5KU1A 1K2HA 2EC6B 4TNCA 2WCJA 3BUOB 3O4XA 1JF2A 4F7FA 2LVIA 3DZTA 1ALWA 1K9UA 4I5NB 5FI2A 4C0LA 1WRZA 4MZKA 1R6PA 5FYXA 5JJGA 3FS7A 1DELA 1WDCC 2M7NA 1CFCA 1WRKA 1D1OA 2MHHA 3CDNA 2NCPA 3CWGA 1YX7A 2KGRA 4GBAA 1CM1A 4HRHA 2F3YA 3NHTA 1PALA 1TOPA 3VRRA 3DVMA 1OOJA 5AANA 3LLEA 1C3ZA 1KK7Y 2MBXA 2FOTA 3OHMB 3GK2A 1S6IA 1XVJA 1UHKA 3JTDB 3QMEA 4IL1A 4PHNA 2P71A 1OOFA 3PFVA 1KFXS 1UHIA 1Y1AA 2L98A 4GUKA 2LUCA 5I2QA 4NDCA 4DRWA 2L51A 1NX2A 1ZACA 2F3ZA 2ZRSA 4D1EA 2KI6D 1F71A 1S36A 2BNXA 4ORBB 2QEHA 2WNDA 1DC1A 3DVKA 1KFXL 2BAPA 2KBMA 4YGDB 4FQTA 4MLWA 3BUWB 2JPOA 3I5FB 1B8LA 4JWQA 1TNWA 1SR6C 3C1VA 4FQOA 2PMYA 3SS3A 5CSFA 1Y1UA 2GTEA 4GPLB 4YGEB 2JC2A 4CLNA 2PVBA 4WRIA 3GK4X 1K90D 1QX5B 2AUCA 2Y1MA 3BQ3A 3WNXB 1JFJA 2KI4C 3CZ1A 4MVFA 5GQQC 2F2PA 3O78A 1C07A 3TZ1A 5HYDA 1BU3A 2G9BA 3FE6A 3OP0A 4A4BA 1B7TZ 1YVLA 2E6WA 1WY9A 1XFUO 3BUMB 1CTRA 1J7RA 3DF0B 2K7CA 4I5KA 1OW4A 3D75A 1K9PA 4BY5A 1CLMA 2BKIB 3FIAA 2BE6A 3E3RA 4UPGA 1RWYA 4ICBA 3SG5A 4C0JA 3MSEB 1PSRA 3N7HA 1XA5A 1DGVA 1F8HA 1U5IA 3EVVA 2JPTA 1FW4A 1SW8A 1WRLA 2K2AA 2V53A 4OV2A 2KFFA 5D7FA 2KQ6A 1OE9B 1PSBA 3AAJA 3R1OA 2L2EA 2JNFA 2FJYA 2LANA 3CS1A 1KWOC 3R1VA 3SG3A 3GK1A 1JBAA 2GGMA 1K8UA 2LV7A 4GAOA 4NDDA 1JWDA 2B1UA 3I5GB 2KOTA 1TUJA 2SCPA 2WCLA 3D0YA 5FI7A 1S26D 1DEKA 1A03A 4CPVA 2CXJA 4MRXA 3BUNB 1TN4A 2MLFC 4GGFC 2QEVA 2I7AA 2K8MB 1L7ZA 1BR4B 2HQWA 1CMFA 1SCMB 3DY9A 1UP5A 3ZWHA 4I5JA 5DKRA 1Z2CB 1ZFSA 3EK8A 3S0AA 2KFGA 2IS9A 3CTNA 4M2QA 4QJ5B 3I5HC 3WHTB 2M29A 1QV1A 5HLVA 1J7QA 1GJYA 4DUQA 3O6BA 4ZCUA 1DGUA 2JXLA 3DF0A 4XJKA 2LE9B 2LMTA 4OCIA 3DYEA 4PALA 1DF0A 4CIDA 1CFPA 1QJTA 3ICBA 3IVTA 1ZOTB 2LLUA 2KYCA 4MBEA 3VRPA 1QATA 4YRUA 2KSPA 1DJHA 4OVNF 3EG5B 3JVTC 3HX4A 3B7AA 1YR5A 5ER5A 2JOJA 1DVIA 1YTZC 3WHUB 1J7OA 1B9AA 4PHMA 3EKHA 4MN0A 4YI8A 2JZIA 5B8IB 1QLKA
chains in the Genus database with same CATH topology
3OX6A 1KQMC 2Q4UA 5CPVA 3TUYB 1VRKA 4MZJA 1B4CA 1B47A 2E30A 1DJZA 3CR2A 1SYMA 1HQVA 2F2OA 2K7OA 1L2OC 1NYAA 2KAXA 2ZN9A 2EGDA 1UHHA 4R1EA 4DIRA 1M63B 1KQVA 3LK1A 2JXCA 3D10A 5J3XA 1XYDA 1BJFA 1KFUS 1UHNA 3QRXA 1A75A 3SIBA 2O5GA 2F8PA 1YVHA 1PVAA 2D8NA 1SL9A 1J1EA 1G4YR 2KFHA 2LMUA 3VGOA 1EG4A 3BYAA 3FWCA 2HPSA 1IGVA 2Y4QA 4ORCB 2H61A 2L4IA 1KFUL 3F45A 3KF9A 1DJXA 3I5IC 1LA3A 2CNPA 1MXLC 1S6JA 3TS5C 4GGFA 2BL0B 1MHOA 2WCFA 1BR1B 2WCBA 4USLA 4F0ZB 1CDPA 1IKUA 1NX1A 2L5XB 4BY4A 1IJ5A 1XFWO 1V1FA 2M1KB 2MA2A 1QIWA 1QTXA 1Q80A 4FTGA 5HLOA 1QASA 4HRGA 1WDCB 4Q04A 5CSIA 5TNCA 5HKYA 1U5IB 3IQOA 1NWDA 3KHEA 4NDBA 2ZRTA 2KI6C 5AFPA 2KAVA 1GGWA 1UURA 4GNKB 3SG7A 4M2OA 1NPQA 2DOQA 2KDHA 2OTGB 2KBIA 3EK7A 3D0YB 3EK4A 4QJ4B 4MZLA 1K95A 1A4PA 5D69A 3H4SE 1NSHA 1OSAA 1Y0VH 2FJUB 1CB1A 2BE4A 2Y5IA 2K2FA 2KGBC 2O60A 1CDLA 2FCDA 2I18A 1IWQA 2EHBA 2Q91A 3WXAA 1TNXA 1SR6B 2HETA 1XFZO 2OS8C 2KNEA 1F4OA 2JTZA 1FF1A 2BCXA 4DS7A 3BOWB 3VRNA 4XJKB 1QS7A 1DF0B 1S6CA 5HKWA 1S3PA 3CR4X 5PALA 2KI4B 1GGZA 1B8RA 1OMDA 1F55A 3VROA 2F33A 4JQ0D 1OQPA 2JU0A 1OZOA 2ZNEA 4DCKA 1H8BA 1UWOA 2COLB 2CTNA 1KSMA 3KPXA 4MEWA 1TCFA 4HREE 1FPWA 2H2KA 2ZKMX 1JF0A 1IG5A 4YI9A 1DJWA 3SIAA 2G2BA 5F6TA 1AK8A 2P6BB 1EH2A 4ETOA 1NCYA 2I2RE 2LC5A 2PASA 4MRYA 1KK7Z 1UHJA 2Y1NA 4PHMA 2CCMA 2GGZA 4AQJA 2RGIA 3NXAA 1BF5A 1CKKA 1ODBA 1DT7B 1A75B 1KWOB 2K7DA 1K9KA 1K93D 1XFXO 2M3WA 1WLMA 1LKJA 1YRUB 1J7PA 2JT8A 3PN7C 1C7WA 4GFTA 3TDIA 4CFQA 1KK8C 1TCOB 2GV5A 1KSOA 2QACA 1GQMA 3AAKA 4XYNA 4C0KA 1SCVA 1G33A 1YUUA 3SG6A 1DJGA 4L9MA 1HT9A 3BOWA 1IJ6A 5DKQA 3IQQA 2M0RA 1JSAA 2MAZA 1SPYA 4A4CA 2L0PA 1N2DA 3I5HB 2BECA 5KSZA 2HQ8A 1CMGA 2LAPA 1RK9A 2CBLA 3LK0A 1NCXA 1F70A 2LLTA 1BT6A 3CR5X 1AVSA 5ER4X 2K61A 3K21A 2L50A 1NX3A 1XK4C 4YBHB 1XO5A 3A4UB 3JVTB 2L4HA 1MQ1A 1DMOA 1NIWA 1QVIY 1M45A 2NLNA 4JPZB 5IBWA 1QX2A 1DJYA 5I2OA 1F4QA 1KQMB 4HSZA 1SNLA 2LMVA 1LVCD 3O4YA 5AERA 1FI6A 1F54A 1AUIB 3CGAA 1IQ3A 1L2OB 1DTLA 2LUXA 1TNPA 1DJIA 2EC6C 1BOCA 1ZMZA 4E68A 1EJ3A 1YURA 4PE0A 3NSIA 4OKHA 1MF8B 2K0JA 2JRFA 5AXIA 2LHIA 1QV0A 1IH0A 1NCZA 1S1EA 3O2PA 1PK0D 3NSKA 3PATA 4CFRA 2ZFDA 1JFKA 2ZN8A 1M31A 2PALA 3I5IB 1V1GA 4PE4A 1J1DA 3TS5B 1BG1A 4MSPA 4YGBB 1B1GA 2K7BA 1JC2A 1J55A 2LP3A 2QPTA 1S5GY 2JWWA 3PSRA 3BUXB 4GGNA 3JTDC 1NUBA 2M1UA 1G8IA 1W7IB 1LXFC 1M46A 4M2PA 2KYFA 3OB2B 1KCYA 2A4JA 4NQGA 2NXQA 2JQ6A 2WORA 1R2UA 2FCEA 2MJWB 5JOLA 2NCOA 1SRAA 1SL7A 3I5FC 4YGCB 2OPOA 2OTGC 1XK4A 3SJSA 1CDNA 3PM8A 1RROA 2WC8A 1B8CA 1PULA 2ZNDA 1EXRA 1SKTA 1YUTA 2LP2A 2BCAA 1C7VA 1MWNA 1Y6WA 2JTTA 2LNKA 3NSLA 3SG2A 2M8UA 3OB1B 2BBMA 1JUOA 3LL8B 1A29A 4YGAA 1XFVO 2LLSA 1QXPA 1UUSA 1BMOA 2VRGA 3KEVA 2M7LA 1QVIZ 4ORAB 4I5LB 1CNPA 2OS8B 3KO0A 2LVVA 4WQ3A 1K96A 3IF7A 1EG3A 1QX7A 2CT9A 1AJ4A 2M49B 4OR9B 2HF5A 4U8DA 2M97A 1BODA 2KAYA 1ALVA 1MXEA 1OMRA 1W7JB 3GOFA 4PE7A 1CFFA 3PLFB 1TTXA 3EKJA 3AKBA 4PE1A 5KTYA 1N0YA 2PRUA 1AP4A 1CLLA 3SG4A 3PALA 3TDZA 1SY9A 2JT0A 1WLZA 2I94A 2R2IA 2LCPA 4PDZA 5G08A 1RTP1 2JULA 1TRFA 1YUSA 4QJ3B 3DVJA 3I5GC 1MR8A 1YRTB 5BPJA 2SASA 2LVKA 2BCBA 1SMGA 1S5GZ 4PCWA 1N65A 1IRJA 1CFDA 3DD4A 3RLZA 1A2XA 2M9GA 3CZTX 3ZNIA 1SCMC 2MLEC 1IQ5A 3NSOA 2MRDA 3DVEA 4ZCVA 5CSNA 3RM1A 2NZ0A 2H61C 1RFJA 2WOSA 4P2YB 3M0WA 2KHNA 3VRQA 2JT3A 2AMIA 4P5OE 1ZUZA 3PN7B 1KK8B 3TDUA 1MUXA 1RECA 1SL8A 1SBJA 1LA0A 1CLBA 1X02A 4N1GA 1YX8A 3CLNA 4N1FA 4WQ2A 1QLSA 1H4BA 4PHKA 1CM4A 2JNXA 4AOMA 2TN4A 1OMVA 5I2LA 1BLQA 1PVBA 1NX0A 1QIVA 3EVUA 1E8AA 3A8RA 2PSRA 3FWBA 5AEQA 4AQIA 1SK6D 3TUYC 1XFYO 1NP8A 1FBVA 2LVJA 1OZSA 5K89A 2BBNA 5DKNA 2ISDA 2LM5A 1TIZA 1M39A 1CDMA 1K94A 1AJ5A 1LINA 1FI5A 1Y1XA 2WCEA 2AAOA 2BKHB 2KQYA 1TNQA 5I8NA 1B7TY 3AKAA 3BXKA 4PHJA 3OX5A 5HKZA 1RJVA 1EL4A 1AHRA 2LHLA 3EVRA 1PRWA 3LCPC 4N5XA 3HCMA 2BL0C 5CSJA 5KU1A 1K2HA 2EC6B 4TNCA 3BUOB 1JF2A 2LVIA 1ALWA 1K9UA 4I5NB 4C0LA 1WRZA 4MZKA 1R6PA 5FYXA 5JJGA 3FS7A 1WDCC 2M7NA 1CFCA 1WRKA 1D1OA 2MHHA 4GBAA 2NCPA 3CWGA 1YX7A 2KGRA 1CM1A 4HRHA 2F3YA 1PALA 1TOPA 3VRRA 3DVMA 1OOJA 5AANA 3LLEA 1KK7Y 2MBXA 2FOTA 3OHMB 3GK2A 1S6IA 1XVJA 1UHKA 3JTDB 4IL1A 4PHNA 3PFVA 1KFXS 1UHIA 1Y1AA 2L98A 4GUKA 2LUCA 5I2QA 4NDCA 4DRWA 2L51A 1NX2A 1ZACA 2F3ZA 2ZRSA 4D1EA 2KI6D 1F71A 1S36A 4ORBB 2WNDA 3DVKA 1KFXL 4YGDB 2KBMA 4MLWA 3BUWB 3I5FB 1B8LA 4JWQA 1TNWA 1SR6C 3C1VA 4FQOA 2PMYA 5CSFA 1Y1UA 4YGEB 4GPLB 2JC2A 4CLNA 2PVBA 4WRIA 3GK4X 1K90D 1QX5B 2AUCA 2Y1MA 3BQ3A 3WNXB 1JFJA 2KI4C 4MVFA 5GQQC 2F2PA 3O78A 1C07A 3TZ1A 5HYDA 1BU3A 2G9BA 3OP0A 4A4BA 1B7TZ 1YVLA 2E6WA 1WY9A 1XFUO 3BUMB 1CTRA 1J7RA 3DF0B 2K7CA 4I5KA 1K9PA 4BY5A 1CLMA 2BKIB 3FIAA 2BE6A 3E3RA 4UPGA 1RWYA 4ICBA 3SG5A 4C0JA 3MSEB 1PSRA 1XA5A 1DGVA 1F8HA 1U5IA 3EVVA 2JPTA 1FW4A 1SW8A 1WRLA 2K2AA 2V53A 4OV2A 2KFFA 5D7FA 2KQ6A 1OE9B 1PSBA 3AAJA 2L2EA 2JNFA 2LANA 3CS1A 3SG3A 1KWOC 3GK1A 1JBAA 2GGMA 1K8UA 2LV7A 4GAOA 4NDDA 1JWDA 2B1UA 3I5GB 2KOTA 2SCPA 3D0YA 1S26D 1A03A 4CPVA 2CXJA 4MRXA 3BUNB 1TN4A 2MLFC 4GGFC 2I7AA 2K8MB 1L7ZA 1BR4B 2HQWA 1CMFA 1SCMB 1UP5A 3ZWHA 4I5JA 5DKRA 1ZFSA 3EK8A 2KFGA 2IS9A 3CTNA 4M2QA 4QJ5B 3I5HC 3WHTB 2M29A 1QV1A 5HLVA 1J7QA 1GJYA 4DUQA 3O6BA 4ZCUA 1DGUA 2JXLA 3DF0A 4XJKA 2LE9B 2LMTA 4OCIA 4PALA 4CIDA 1DF0A 1CFPA 1QJTA 3ICBA 1ZOTB 2LLUA 2KYCA 4MBEA 3VRPA 1QATA 4YRUA 2KSPA 1DJHA 4OVNF 3JVTC 3HX4A 5ER5A 1YR5A 1J7OA 2JOJA 1DVIA 1YTZC 3WHUB 1B9AA 3EKHA 4MN0A 4YI8A 2JZIA 5B8IB 1QLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OX6 A;  1KQM C;  2Q4U A;  5CPV A;  3TUY B;  1VRK A;  4MZJ A;  1B4C A;  1B47 A;  2E30 A;  1DJZ A;  3CR2 A;  1SYM A;  1HQV A;  2F2O A;  2K7O A;  1L2O C;  1NYA A;  2KAX A;  2ZN9 A;  2EGD A;  1UHH A;  4R1E A;  4DIR A;  1M63 B;  1KQV A;  3LK1 A;  2JXC A;  3D10 A;  5J3X A;  1XYD A;  1BJF A;  1KFU S;  1UHN A;  3QRX A;  1A75 A;  3SIB A;  2O5G A;  2F8P A;  1YVH A;  1PVA A;  2D8N A;  1SL9 A;  1J1E A;  1G4Y R;  2KFH A;  2LMU A;  3VGO A;  1EG4 A;  3BYA A;  3FWC A;  2HPS A;  1IGV A;  2Y4Q A;  4ORC B;  2H61 A;  2L4I A;  1KFU L;  3F45 A;  3KF9 A;  1DJX A;  3I5I C;  1LA3 A;  2CNP A;  1MXL C;  1S6J A;  3TS5 C;  4GGF A;  2BL0 B;  1MHO A;  2WCF A;  1BR1 B;  2WCB A;  4USL A;  4F0Z B;  1CDP A;  1IKU A;  1NX1 A;  2L5X B;  4BY4 A;  1IJ5 A;  1XFW O;  1V1F A;  2M1K B;  2MA2 A;  1QIW A;  1QTX A;  1Q80 A;  4FTG A;  5HLO A;  1QAS A;  4HRG A;  1WDC B;  4Q04 A;  5CSI A;  5TNC A;  5HKY A;  1U5I B;  3IQO A;  1NWD A;  3KHE A;  4NDB A;  2ZRT A;  2KI6 C;  5AFP A;  2KAV A;  1GGW A;  1UUR A;  4GNK B;  3SG7 A;  4M2O A;  1NPQ A;  2DOQ A;  2KDH A;  2OTG B;  2KBI A;  3EK7 A;  3D0Y B;  3EK4 A;  4QJ4 B;  4MZL A;  1K95 A;  1A4P A;  5D69 A;  3H4S E;  1NSH A;  1OSA A;  1Y0V H;  2FJU B;  1CB1 A;  2BE4 A;  2Y5I A;  2K2F A;  2KGB C;  2O60 A;  1CDL A;  2FCD A;  2I18 A;  1IWQ A;  2EHB A;  2Q91 A;  3WXA A;  1TNX A;  1SR6 B;  2HET A;  1XFZ O;  2OS8 C;  2KNE A;  1F4O A;  2JTZ A;  1FF1 A;  2BCX A;  4DS7 A;  3BOW B;  3VRN A;  4XJK B;  1QS7 A;  1DF0 B;  1S6C A;  5HKW A;  1S3P A;  3CR4 X;  5PAL A;  2KI4 B;  1GGZ A;  1B8R A;  1OMD A;  1F55 A;  3VRO A;  2F33 A;  4JQ0 D;  1OQP A;  2JU0 A;  1OZO A;  2ZNE A;  4DCK A;  1H8B A;  1UWO A;  2COL B;  2CTN A;  1KSM A;  3KPX A;  4MEW A;  1TCF A;  4HRE E;  1FPW A;  2H2K A;  2ZKM X;  1JF0 A;  1IG5 A;  4YI9 A;  1DJW A;  3SIA A;  2G2B A;  5F6T A;  1AK8 A;  2P6B B;  1EH2 A;  4ETO A;  1NCY A;  2I2R E;  2LC5 A;  2PAS A;  4MRY A;  1KK7 Z;  1UHJ A;  2Y1N A;  4PHM A;  2CCM A;  2GGZ A;  4AQJ A;  2RGI A;  3NXA A;  1BF5 A;  1CKK A;  1ODB A;  1DT7 B;  1A75 B;  1KWO B;  2K7D A;  1K9K A;  1K93 D;  1XFX O;  2M3W A;  1WLM A;  1LKJ A;  1YRU B;  1J7P A;  2JT8 A;  3PN7 C;  1C7W A;  4GFT A;  3TDI A;  4CFQ A;  1KK8 C;  1TCO B;  2GV5 A;  1KSO A;  2QAC A;  1GQM A;  3AAK A;  4XYN A;  4C0K A;  1SCV A;  1G33 A;  1YUU A;  3SG6 A;  1DJG A;  4L9M A;  1HT9 A;  3BOW A;  1IJ6 A;  5DKQ A;  3IQQ A;  2M0R A;  1JSA A;  2MAZ A;  1SPY A;  4A4C A;  2L0P A;  1N2D A;  3I5H B;  2BEC A;  5KSZ A;  2HQ8 A;  1CMG A;  2LAP A;  1RK9 A;  2CBL A;  3LK0 A;  1NCX A;  1F70 A;  2LLT A;  1BT6 A;  3CR5 X;  1AVS A;  5ER4 X;  2K61 A;  3K21 A;  2L50 A;  1NX3 A;  1XK4 C;  4YBH B;  1XO5 A;  3A4U B;  3JVT B;  2L4H A;  1MQ1 A;  1DMO A;  1NIW A;  1QVI Y;  1M45 A;  2NLN A;  4JPZ B;  5IBW A;  1QX2 A;  1DJY A;  5I2O A;  1F4Q A;  1KQM B;  4HSZ A;  1SNL A;  2LMV A;  1LVC D;  3O4Y A;  5AER A;  1FI6 A;  1F54 A;  1AUI B;  3CGA A;  1IQ3 A;  1L2O B;  1DTL A;  2LUX A;  1TNP A;  1DJI A;  2EC6 C;  1BOC A;  1ZMZ A;  4E68 A;  1EJ3 A;  1YUR A;  4PE0 A;  3NSI A;  4OKH A;  1MF8 B;  2K0J A;  2JRF A;  5AXI A;  2LHI A;  1QV0 A;  1IH0 A;  1NCZ A;  1S1E A;  3O2P A;  1PK0 D;  3NSK A;  3PAT A;  4CFR A;  2ZFD A;  1JFK A;  2ZN8 A;  1M31 A;  2PAL A;  3I5I B;  1V1G A;  4PE4 A;  1J1D A;  3TS5 B;  1BG1 A;  4MSP A;  4YGB B;  1B1G A;  2K7B A;  1JC2 A;  1J55 A;  2LP3 A;  2QPT A;  1S5G Y;  2JWW A;  3PSR A;  3BUX B;  4GGN A;  3JTD C;  1NUB A;  2M1U A;  1G8I A;  1W7I B;  1LXF C;  1M46 A;  4M2P A;  2KYF A;  3OB2 B;  1KCY A;  2A4J A;  4NQG A;  2NXQ A;  2JQ6 A;  2WOR A;  1R2U A;  2FCE A;  2MJW B;  5JOL A;  2NCO A;  1SRA A;  1SL7 A;  3I5F C;  4YGC B;  2OPO A;  2OTG C;  1XK4 A;  3SJS A;  1CDN A;  3PM8 A;  1RRO A;  2WC8 A;  1B8C A;  1PUL A;  2ZND A;  1EXR A;  1SKT A;  1YUT A;  2LP2 A;  2BCA A;  1C7V A;  1MWN A;  1Y6W A;  2JTT A;  2LNK A;  3NSL A;  3SG2 A;  2M8U A;  3OB1 B;  2BBM A;  1JUO A;  3LL8 B;  1A29 A;  4YGA A;  1XFV O;  2LLS A;  1QXP A;  1UUS A;  1BMO A;  2VRG A;  3KEV A;  2M7L A;  1QVI Z;  4ORA B;  4I5L B;  1CNP A;  2OS8 B;  3KO0 A;  2LVV A;  4WQ3 A;  1K96 A;  3IF7 A;  1EG3 A;  1QX7 A;  2CT9 A;  1AJ4 A;  2M49 B;  4OR9 B;  2HF5 A;  4U8D A;  2M97 A;  1BOD A;  2KAY A;  1ALV A;  1MXE A;  1OMR A;  1W7J B;  3GOF A;  4PE7 A;  1CFF A;  3PLF B;  1TTX A;  3EKJ A;  3AKB A;  4PE1 A;  5KTY A;  1N0Y A;  2PRU A;  1AP4 A;  1CLL A;  3SG4 A;  3PAL A;  3TDZ A;  1SY9 A;  2JT0 A;  1WLZ A;  2I94 A;  2R2I A;  2LCP A;  4PDZ A;  5G08 A;  1RTP 1;  2JUL A;  1TRF A;  1YUS A;  4QJ3 B;  3DVJ A;  3I5G C;  1MR8 A;  1YRT B;  5BPJ A;  2SAS A;  2LVK A;  2BCB A;  1SMG A;  1S5G Z;  4PCW A;  1N65 A;  1IRJ A;  1CFD A;  3DD4 A;  3RLZ A;  1A2X A;  2M9G A;  3CZT X;  3ZNI A;  1SCM C;  2MLE C;  1IQ5 A;  3NSO A;  2MRD A;  3DVE A;  4ZCV A;  5CSN A;  3RM1 A;  2NZ0 A;  2H61 C;  1RFJ A;  2WOS A;  4P2Y B;  3M0W A;  2KHN A;  3VRQ A;  2JT3 A;  2AMI A;  4P5O E;  1ZUZ A;  3PN7 B;  1KK8 B;  3TDU A;  1MUX A;  1REC A;  1SL8 A;  1SBJ A;  1LA0 A;  1CLB A;  1X02 A;  4N1G A;  1YX8 A;  3CLN A;  4N1F A;  4WQ2 A;  1QLS A;  1H4B A;  4PHK A;  1CM4 A;  2JNX A;  4AOM A;  2TN4 A;  1OMV A;  5I2L A;  1BLQ A;  1PVB A;  1NX0 A;  1QIV A;  3EVU A;  1E8A A;  3A8R A;  2PSR A;  3FWB A;  5AEQ A;  4AQI A;  1SK6 D;  3TUY C;  1XFY O;  1NP8 A;  1FBV A;  2LVJ A;  1OZS A;  5K89 A;  2BBN A;  5DKN A;  2ISD A;  2LM5 A;  1TIZ A;  1M39 A;  1CDM A;  1K94 A;  1AJ5 A;  1LIN A;  1FI5 A;  1Y1X A;  2WCE A;  2AAO A;  2BKH B;  2KQY A;  1TNQ A;  5I8N A;  1B7T Y;  3AKA A;  3BXK A;  4PHJ A;  3OX5 A;  5HKZ A;  1RJV A;  1EL4 A;  1AHR A;  2LHL A;  3EVR A;  1PRW A;  3LCP C;  4N5X A;  3HCM A;  2BL0 C;  5CSJ A;  5KU1 A;  1K2H A;  2EC6 B;  4TNC A;  3BUO B;  1JF2 A;  2LVI A;  1ALW A;  1K9U A;  4I5N B;  4C0L A;  1WRZ A;  4MZK A;  1R6P A;  5FYX A;  5JJG A;  3FS7 A;  1WDC C;  2M7N A;  1CFC A;  1WRK A;  1D1O A;  2MHH A;  4GBA A;  2NCP A;  3CWG A;  1YX7 A;  2KGR A;  1CM1 A;  4HRH A;  2F3Y A;  1PAL A;  1TOP A;  3VRR A;  3DVM A;  1OOJ A;  5AAN A;  3LLE A;  1KK7 Y;  2MBX A;  2FOT A;  3OHM B;  3GK2 A;  1S6I A;  1XVJ A;  1UHK A;  3JTD B;  4IL1 A;  4PHN A;  3PFV A;  1KFX S;  1UHI A;  1Y1A A;  2L98 A;  4GUK A;  2LUC A;  5I2Q A;  4NDC A;  4DRW A;  2L51 A;  1NX2 A;  1ZAC A;  2F3Z A;  2ZRS A;  4D1E A;  2KI6 D;  1F71 A;  1S36 A;  4ORB B;  2WND A;  3DVK A;  1KFX L;  4YGD B;  2KBM A;  4MLW A;  3BUW B;  3I5F B;  1B8L A;  4JWQ A;  1TNW A;  1SR6 C;  3C1V A;  4FQO A;  2PMY A;  5CSF A;  1Y1U A;  4YGE B;  4GPL B;  2JC2 A;  4CLN A;  2PVB A;  4WRI A;  3GK4 X;  1K90 D;  1QX5 B;  2AUC A;  2Y1M A;  3BQ3 A;  3WNX B;  1JFJ A;  2KI4 C;  4MVF A;  5GQQ C;  2F2P A;  3O78 A;  1C07 A;  3TZ1 A;  5HYD A;  1BU3 A;  2G9B A;  3OP0 A;  4A4B A;  1B7T Z;  1YVL A;  2E6W A;  1WY9 A;  1XFU O;  3BUM B;  1CTR A;  1J7R A;  3DF0 B;  2K7C A;  4I5K A;  1K9P A;  4BY5 A;  1CLM A;  2BKI B;  3FIA A;  2BE6 A;  3E3R A;  4UPG A;  1RWY A;  4ICB A;  3SG5 A;  4C0J A;  3MSE B;  1PSR A;  1XA5 A;  1DGV A;  1F8H A;  1U5I A;  3EVV A;  2JPT A;  1FW4 A;  1SW8 A;  1WRL A;  2K2A A;  2V53 A;  4OV2 A;  2KFF A;  5D7F A;  2KQ6 A;  1OE9 B;  1PSB A;  3AAJ A;  2L2E A;  2JNF A;  2LAN A;  3CS1 A;  3SG3 A;  1KWO C;  3GK1 A;  1JBA A;  2GGM A;  1K8U A;  2LV7 A;  4GAO A;  4NDD A;  1JWD A;  2B1U A;  3I5G B;  2KOT A;  2SCP A;  3D0Y A;  1S26 D;  1A03 A;  4CPV A;  2CXJ A;  4MRX A;  3BUN B;  1TN4 A;  2MLF C;  4GGF C;  2I7A A;  2K8M B;  1L7Z A;  1BR4 B;  2HQW A;  1CMF A;  1SCM B;  1UP5 A;  3ZWH A;  4I5J A;  5DKR A;  1ZFS A;  3EK8 A;  2KFG A;  2IS9 A;  3CTN A;  4M2Q A;  4QJ5 B;  3I5H C;  3WHT B;  2M29 A;  1QV1 A;  5HLV A;  1J7Q A;  1GJY A;  4DUQ A;  3O6B A;  4ZCU A;  1DGU A;  2JXL A;  3DF0 A;  4XJK A;  2LE9 B;  2LMT A;  4OCI A;  4PAL A;  4CID A;  1DF0 A;  1CFP A;  1QJT A;  3ICB A;  1ZOT B;  2LLU A;  2KYC A;  4MBE A;  3VRP A;  1QAT A;  4YRU A;  2KSP A;  1DJH A;  4OVN F;  3JVT C;  3HX4 A;  5ER5 A;  1YR5 A;  1J7O A;  2JOJ A;  1DVI A;  1YTZ C;  3WHU B;  1B9A A;  3EKH A;  4MN0 A;  4YI8 A;  2JZI A;  5B8I B;  1QLK A; 
#chains in the Genus database with same CATH topology
 3OX6 A;  1KQM C;  2Q4U A;  5CPV A;  3TUY B;  1VRK A;  4KYN A;  4MZJ A;  1B4C A;  1B47 A;  2E30 A;  1DJZ A;  3CR2 A;  1SYM A;  1HQV A;  2F2O A;  2K7O A;  1L2O C;  1NYA A;  2KAX A;  2ZN9 A;  2EGD A;  1UHH A;  4R1E A;  4DIR A;  1M63 B;  1KQV A;  3LK1 A;  2JXC A;  3D10 A;  5J3X A;  1XYD A;  1BJF A;  1KFU S;  1UHN A;  3QRX A;  1A75 A;  3SIB A;  2O5G A;  2F8P A;  1YVH A;  1PVA A;  2D8N A;  1SL9 A;  1J1E A;  1G4Y R;  2KFH A;  2LMU A;  3L4A A;  3VGO A;  1EG4 A;  3BYA A;  3FWC A;  2HPS A;  1IGV A;  2Y4Q A;  4ORC B;  2H61 A;  2L4I A;  1KFU L;  3F45 A;  3KF9 A;  3FE8 A;  3NGV A;  1DJX A;  3I5I C;  1LA3 A;  2CNP A;  1MXL C;  1S6J A;  2QEB A;  3OGN A;  3TS5 C;  4GGF A;  2BL0 B;  1MHO A;  2WCF A;  1BR1 B;  2WCB A;  4USL A;  4F0Z B;  1CDP A;  1IKU A;  1NX1 A;  2L5X B;  4BY4 A;  1IJ5 A;  1XFW O;  1V1F A;  2M1K B;  2MA2 A;  3CZ0 A;  1QIW A;  1QTX A;  1Q80 A;  4FTG A;  5HLO A;  1QAS A;  3SS4 A;  4HRG A;  1WDC B;  4Q04 A;  5CSI A;  5TNC A;  5HKY A;  1U5I B;  3IQO A;  1NWD A;  3KHE A;  4NDB A;  3BFA A;  2ZRT A;  2KI6 C;  5AFP A;  2KAV A;  1GGW A;  1UUR A;  3D73 A;  4GNK B;  3SG7 A;  4M2O A;  1NPQ A;  2DOQ A;  2KDH A;  2OTG B;  2KBI A;  3EK7 A;  3D0Y B;  3EK4 A;  4QJ4 B;  4MZL A;  1K95 A;  1A4P A;  5D69 A;  1T14 A;  3H4S E;  3BJH A;  1NSH A;  1OSA A;  1Y0V H;  2FJU B;  1CB1 A;  1TUZ A;  2BE4 A;  2Y5I A;  2K2F A;  2KGB C;  2O60 A;  3D74 A;  3BFH A;  1CDL A;  2FCD A;  2I18 A;  1IWQ A;  2EHB A;  2Q91 A;  2WCK A;  3WXA A;  1TNX A;  3VB1 A;  1SR6 B;  2HET A;  1XFZ O;  2H8V A;  2OS8 C;  2KNE A;  1F4O A;  2JTZ A;  1FF1 A;  2BCX A;  4DS7 A;  4INW A;  3BOW B;  3VRN A;  4XJK B;  1QS7 A;  1DF0 B;  1S6C A;  5HKW A;  1C7V A;  1S3P A;  3CR4 X;  5PAL A;  2KI4 B;  4AQJ A;  1GGZ A;  1B8R A;  1OMD A;  1OOI X;  1F55 A;  3VRO A;  2F33 A;  4JQ0 D;  1OQP A;  2YGU A;  2JU0 A;  3D77 A;  2PQL A;  3NHI A;  1OZO A;  2ZNE A;  4DCK A;  1H8B A;  1UWO A;  2COL B;  2CTN A;  1KSM A;  3KPX A;  4MEW A;  1TCF A;  2QDI A;  2ERB A;  4HRE E;  1FPW A;  1Z4H A;  2H2K A;  2ZKM X;  2QEO A;  3Q8I A;  1JF0 A;  1IG5 A;  4YI9 A;  1DJW A;  3SIA A;  2G2B A;  5F6T A;  1AK8 A;  2P6B B;  1EH2 A;  4ETO A;  3CZ2 A;  1NCY A;  2I2R E;  2LC5 A;  2PAS A;  3DXL A;  1KK7 Z;  1UHJ A;  2Y1N A;  2L5Y A;  2CCM A;  2GGZ A;  4MRY A;  2RGI A;  3NXA A;  3PM2 A;  1BF5 A;  1CKK A;  1ODB A;  3L4L A;  1DT7 B;  1A75 B;  1KWO B;  2K7D A;  1K9K A;  1K93 D;  1XFX O;  2M3W A;  1WLM A;  1LKJ A;  1YRU B;  3B86 A;  3UO9 A;  1J7P A;  2JT8 A;  1GM0 A;  3PN7 C;  1C7W A;  4GFT A;  3TDI A;  4CFQ A;  1KK8 C;  1TCO B;  2GV5 A;  1KSO A;  2QAC A;  1GQM A;  3AAK A;  4XYN A;  4C0K A;  1SCV A;  1G33 A;  1YUU A;  3S0B A;  3SG6 A;  5HL1 A;  1DJG A;  4L9M A;  1HT9 A;  3BOW A;  1IJ6 A;  5DKQ A;  3IQQ A;  2M0R A;  1JSA A;  2MAZ A;  1SPY A;  4A4C A;  2L0P A;  1N2D A;  5FI6 A;  3CAB A;  3S0D A;  3I5H B;  2BEC A;  5KSZ A;  2HQ8 A;  1CMG A;  2LAP A;  1RK9 A;  2CBL A;  3LK0 A;  1NCX A;  1F70 A;  2LLT A;  1BT6 A;  3CR5 X;  1AVS A;  5ER4 X;  2K61 A;  3K21 A;  1LS8 A;  2L50 A;  1NX3 A;  3D78 A;  3K1E A;  1XK4 C;  1P28 A;  2WC6 A;  4YBH B;  3RZS A;  1XO5 A;  3A4U B;  3JVT B;  2L4H A;  1MQ1 A;  1DMO A;  1NIW A;  1QVI Y;  1M45 A;  2NLN A;  4JPZ B;  5IBW A;  3R72 A;  1QX2 A;  1DJY A;  5I2O A;  1F4Q A;  1KQM B;  4HSZ A;  1SNL A;  2LMV A;  1LVC D;  3O4Y A;  5AER A;  1FI6 A;  1F54 A;  1AUI B;  1XFR A;  3CGA A;  1IQ3 A;  1L2O B;  1DTL A;  2LUX A;  1TNP A;  1DJI A;  2EC6 C;  4IJ7 A;  1BOC A;  1ZMZ A;  4E68 A;  3V2L A;  1EJ3 A;  1YUR A;  4PE0 A;  3NSI A;  4OKH A;  1MF8 B;  2K0J A;  2JRF A;  5AXI A;  2LHI A;  1QV0 A;  1IH0 A;  1NCZ A;  1S1E A;  3O2P A;  1PK0 D;  3NSK A;  3PAT A;  4CFR A;  2ZFD A;  1JFK A;  2ZN8 A;  3S0G A;  1IIO A;  1M31 A;  2PAL A;  3L47 A;  2KPH A;  3I5I B;  1V1G A;  4PE4 A;  1J1D A;  2WCM A;  3TS5 B;  1BG1 A;  4MSP A;  4YGB B;  1B1G A;  2K7B A;  1JC2 A;  1J55 A;  2LP3 A;  2QPT A;  1S5G Y;  2JWW A;  3PSR A;  3BUX B;  4GGN A;  3JTD C;  3B87 A;  1NUB A;  2M1U A;  1G8I A;  1W7I B;  1LXF C;  1M46 A;  4M2P A;  2KYF A;  3OB2 B;  1KCY A;  2A4J A;  4NQG A;  2NXQ A;  2JQ6 A;  2WOR A;  4JKT A;  1R2U A;  2FCE A;  2MJW B;  5JOL A;  2NCO A;  1SRA A;  1SL7 A;  3I5F C;  4YGC B;  2OPO A;  2OTG C;  1XK4 A;  2K60 A;  3SJS A;  1CDN A;  3PM8 A;  1RRO A;  2WC8 A;  1B8C A;  1PUL A;  2ZND A;  1EXR A;  1SKT A;  1YUT A;  2LP2 A;  2BCA A;  2P70 A;  1MWN A;  1Y6W A;  2JTT A;  2LNK A;  3NSL A;  1ORG A;  3SG2 A;  2M8U A;  3OB1 B;  2BBM A;  1JUO A;  1W9Z A;  2PYQ A;  3LL8 B;  1A29 A;  4YGA A;  1XFV O;  2LLS A;  1QXP A;  1UUS A;  1BMO A;  2VRG A;  3KEV A;  5D3O A;  2M7L A;  1QVI Z;  4ORA B;  4I5L B;  1CNP A;  1C3Y A;  4INX A;  3B88 A;  1OOH A;  1QWV A;  2OS8 B;  2LVV A;  3KO0 A;  4WQ3 A;  1K96 A;  3IF7 A;  1EG3 A;  3B6X A;  1SSE B;  1QX7 A;  2CT9 A;  1AJ4 A;  2M49 B;  4OR9 B;  2HF5 A;  4U8D A;  2M97 A;  1BOD A;  2KAY A;  5I94 A;  1ALV A;  4OZD A;  1MXE A;  1OMR A;  1W7J B;  3GOF A;  4PE7 A;  1CFF A;  3PLF B;  1TTX A;  3EKJ A;  3AKB A;  4PE1 A;  5KTY A;  1N0Y A;  2PRU A;  1AP4 A;  1CLL A;  3SG4 A;  3PAL A;  3TDZ A;  1SY9 A;  1OOG A;  2JT0 A;  1WLZ A;  2I94 A;  2R2I A;  2LCP A;  4JD9 A;  4PDZ A;  1RTP 1;  5G08 A;  2JUL A;  1TRF A;  1YUS A;  3OBV A;  3DVJ A;  4QJ3 B;  3I5G C;  1MR8 A;  3S0F A;  1YRT B;  5BPJ A;  1DQE A;  2SAS A;  2LVK A;  2BCB A;  2KLE A;  1SMG A;  1S5G Z;  4PCW A;  5EL2 A;  1N65 A;  1IRJ A;  1CFD A;  1TWO A;  3DD4 A;  3RLZ A;  1A2X A;  2M9G A;  3CZT X;  3PJI A;  3ZNI A;  1SCM C;  3UNW A;  2MLE C;  1IQ5 A;  3NSO A;  2MRD A;  3DVE A;  4ZCV A;  5CSN A;  3RM1 A;  2NZ0 A;  2H61 C;  1RFJ A;  2WOS A;  4P2Y B;  3M0W A;  2KHN A;  3VRQ A;  2JT3 A;  2AMI A;  4P5O E;  1ZUZ A;  3PN7 B;  2L2C A;  1KK8 B;  3TDU A;  1MUX A;  1REC A;  1SL8 A;  3R1P A;  1SBJ A;  3FE9 A;  1LA0 A;  1CLB A;  2KLD A;  1X02 A;  4N1G A;  1YX8 A;  3CLN A;  4N1F A;  4WQ2 A;  1QLS A;  1H4B A;  4PHK A;  1CM4 A;  2JNX A;  5DIC A;  4AOM A;  3SS5 A;  2TN4 A;  1OMV A;  5I2L A;  3S0E A;  1BLQ A;  1PVB A;  3CYZ A;  1NX0 A;  1QIV A;  3EVU A;  4PT1 A;  1E8A A;  3A8R A;  2PSR A;  3FWB A;  5AEQ A;  4AQI A;  1SK6 D;  3TUY C;  1XFY O;  1NP8 A;  1FBV A;  2LVJ A;  1OZS A;  5K89 A;  2BBN A;  2WCH A;  5DKN A;  2ISD A;  2LM5 A;  3BFB A;  1TIZ A;  1M39 A;  1CDM A;  1K94 A;  1AJ5 A;  1LIN A;  1FI5 A;  1Y1X A;  2WC5 A;  2WCE A;  2AAO A;  2BKH B;  2KQY A;  1TNQ A;  5I8N A;  1B7T Y;  3AKA A;  3BXK A;  4PHJ A;  3OX5 A;  3D76 A;  5HKZ A;  1RJV A;  1EL4 A;  1AHR A;  2LHL A;  3EVR A;  1PRW A;  3LCP C;  4N5X A;  3HCM A;  2BL0 C;  5CSJ A;  5KU1 A;  1K2H A;  2EC6 B;  4TNC A;  2WCJ A;  3BUO B;  3O4X A;  1JF2 A;  4F7F A;  2LVI A;  3DZT A;  1ALW A;  1K9U A;  4I5N B;  5FI2 A;  4C0L A;  1WRZ A;  4MZK A;  1R6P A;  5FYX A;  5JJG A;  3FS7 A;  1DEL A;  1WDC C;  2M7N A;  1CFC A;  1WRK A;  1D1O A;  2MHH A;  3CDN A;  2NCP A;  3CWG A;  1YX7 A;  2KGR A;  4GBA A;  1CM1 A;  4HRH A;  2F3Y A;  3NHT A;  1PAL A;  1TOP A;  3VRR A;  3DVM A;  1OOJ A;  5AAN A;  3LLE A;  1C3Z A;  1KK7 Y;  2MBX A;  2FOT A;  3OHM B;  3GK2 A;  1S6I A;  1XVJ A;  1UHK A;  3JTD B;  3QME A;  4IL1 A;  4PHN A;  2P71 A;  1OOF A;  3PFV A;  1KFX S;  1UHI A;  1Y1A A;  2L98 A;  4GUK A;  2LUC A;  5I2Q A;  4NDC A;  4DRW A;  2L51 A;  1NX2 A;  1ZAC A;  2F3Z A;  2ZRS A;  4D1E A;  2KI6 D;  1F71 A;  1S36 A;  2BNX A;  4ORB B;  2QEH A;  2WND A;  1DC1 A;  3DVK A;  1KFX L;  2BAP A;  2KBM A;  4YGD B;  4FQT A;  4MLW A;  3BUW B;  2JPO A;  3I5F B;  1B8L A;  4JWQ A;  1TNW A;  1SR6 C;  3C1V A;  4FQO A;  2PMY A;  3SS3 A;  5CSF A;  1Y1U A;  2GTE A;  4GPL B;  4YGE B;  2JC2 A;  4CLN A;  2PVB A;  4WRI A;  3GK4 X;  1K90 D;  1QX5 B;  2AUC A;  2Y1M A;  3BQ3 A;  3WNX B;  1JFJ A;  2KI4 C;  3CZ1 A;  4MVF A;  5GQQ C;  2F2P A;  3O78 A;  1C07 A;  3TZ1 A;  5HYD A;  1BU3 A;  2G9B A;  3FE6 A;  3OP0 A;  4A4B A;  1B7T Z;  1YVL A;  2E6W A;  1WY9 A;  1XFU O;  3BUM B;  1CTR A;  1J7R A;  3DF0 B;  2K7C A;  4I5K A;  1OW4 A;  3D75 A;  1K9P A;  4BY5 A;  1CLM A;  2BKI B;  3FIA A;  2BE6 A;  3E3R A;  4UPG A;  1RWY A;  4ICB A;  3SG5 A;  4C0J A;  3MSE B;  1PSR A;  3N7H A;  1XA5 A;  1DGV A;  1F8H A;  1U5I A;  3EVV A;  2JPT A;  1FW4 A;  1SW8 A;  1WRL A;  2K2A A;  2V53 A;  4OV2 A;  2KFF A;  5D7F A;  2KQ6 A;  1OE9 B;  1PSB A;  3AAJ A;  3R1O A;  2L2E A;  2JNF A;  2FJY A;  2LAN A;  3CS1 A;  1KWO C;  3R1V A;  3SG3 A;  3GK1 A;  1JBA A;  2GGM A;  1K8U A;  2LV7 A;  4GAO A;  4NDD A;  1JWD A;  2B1U A;  3I5G B;  2KOT A;  1TUJ A;  2SCP A;  2WCL A;  3D0Y A;  5FI7 A;  1S26 D;  1DEK A;  1A03 A;  4CPV A;  2CXJ A;  4MRX A;  3BUN B;  1TN4 A;  2MLF C;  4GGF C;  2QEV A;  2I7A A;  2K8M B;  1L7Z A;  1BR4 B;  2HQW A;  1CMF A;  1SCM B;  3DY9 A;  1UP5 A;  3ZWH A;  4I5J A;  5DKR A;  1Z2C B;  1ZFS A;  3EK8 A;  3S0A A;  2KFG A;  2IS9 A;  3CTN A;  4M2Q A;  4QJ5 B;  3I5H C;  3WHT B;  2M29 A;  1QV1 A;  5HLV A;  1J7Q A;  1GJY A;  4DUQ A;  3O6B A;  4ZCU A;  1DGU A;  2JXL A;  3DF0 A;  4XJK A;  2LE9 B;  2LMT A;  4OCI A;  3DYE A;  4PAL A;  1DF0 A;  4CID A;  1CFP A;  1QJT A;  3ICB A;  3IVT A;  1ZOT B;  2LLU A;  2KYC A;  4MBE A;  3VRP A;  1QAT A;  4YRU A;  2KSP A;  1DJH A;  4OVN F;  3EG5 B;  3JVT C;  3HX4 A;  3B7A A;  1YR5 A;  5ER5 A;  2JOJ A;  1DVI A;  1YTZ C;  3WHU B;  1J7O A;  1B9A A;  4PHM A;  3EKH A;  4MN0 A;  4YI8 A;  2JZI A;  5B8I B;  1QLK A; 
#chains in the Genus database with same CATH homology
 3OX6 A;  1KQM C;  2Q4U A;  5CPV A;  3TUY B;  1VRK A;  4MZJ A;  1B4C A;  1B47 A;  2E30 A;  1DJZ A;  3CR2 A;  1SYM A;  1HQV A;  2F2O A;  2K7O A;  1L2O C;  1NYA A;  2KAX A;  2ZN9 A;  2EGD A;  1UHH A;  4R1E A;  4DIR A;  1M63 B;  1KQV A;  3LK1 A;  2JXC A;  3D10 A;  5J3X A;  1XYD A;  1BJF A;  1KFU S;  1UHN A;  3QRX A;  1A75 A;  3SIB A;  2O5G A;  2F8P A;  1YVH A;  1PVA A;  2D8N A;  1SL9 A;  1J1E A;  1G4Y R;  2KFH A;  2LMU A;  3VGO A;  1EG4 A;  3BYA A;  3FWC A;  2HPS A;  1IGV A;  2Y4Q A;  4ORC B;  2H61 A;  2L4I A;  1KFU L;  3F45 A;  3KF9 A;  1DJX A;  3I5I C;  1LA3 A;  2CNP A;  1MXL C;  1S6J A;  3TS5 C;  4GGF A;  2BL0 B;  1MHO A;  2WCF A;  1BR1 B;  2WCB A;  4USL A;  4F0Z B;  1CDP A;  1IKU A;  1NX1 A;  2L5X B;  4BY4 A;  1IJ5 A;  1XFW O;  1V1F A;  2M1K B;  2MA2 A;  1QIW A;  1QTX A;  1Q80 A;  4FTG A;  5HLO A;  1QAS A;  4HRG A;  1WDC B;  4Q04 A;  5CSI A;  5TNC A;  5HKY A;  1U5I B;  3IQO A;  1NWD A;  3KHE A;  4NDB A;  2ZRT A;  2KI6 C;  5AFP A;  2KAV A;  1GGW A;  1UUR A;  4GNK B;  3SG7 A;  4M2O A;  1NPQ A;  2DOQ A;  2KDH A;  2OTG B;  2KBI A;  3EK7 A;  3D0Y B;  3EK4 A;  4QJ4 B;  4MZL A;  1K95 A;  1A4P A;  5D69 A;  3H4S E;  1NSH A;  1OSA A;  1Y0V H;  2FJU B;  1CB1 A;  2BE4 A;  2Y5I A;  2K2F A;  2KGB C;  2O60 A;  1CDL A;  2FCD A;  2I18 A;  1IWQ A;  2EHB A;  2Q91 A;  3WXA A;  1TNX A;  1SR6 B;  2HET A;  1XFZ O;  2OS8 C;  2KNE A;  1F4O A;  2JTZ A;  1FF1 A;  2BCX A;  4DS7 A;  3BOW B;  3VRN A;  4XJK B;  1QS7 A;  1DF0 B;  1S6C A;  5HKW A;  1S3P A;  3CR4 X;  5PAL A;  2KI4 B;  1GGZ A;  1B8R A;  1OMD A;  1F55 A;  3VRO A;  2F33 A;  4JQ0 D;  1OQP A;  2JU0 A;  1OZO A;  2ZNE A;  4DCK A;  1H8B A;  1UWO A;  2COL B;  2CTN A;  1KSM A;  3KPX A;  4MEW A;  1TCF A;  4HRE E;  1FPW A;  2H2K A;  2ZKM X;  1JF0 A;  1IG5 A;  4YI9 A;  1DJW A;  3SIA A;  2G2B A;  5F6T A;  1AK8 A;  2P6B B;  1EH2 A;  4ETO A;  1NCY A;  2I2R E;  2LC5 A;  2PAS A;  4MRY A;  1KK7 Z;  1UHJ A;  2Y1N A;  4PHM A;  2CCM A;  2GGZ A;  4AQJ A;  2RGI A;  3NXA A;  1BF5 A;  1CKK A;  1ODB A;  1DT7 B;  1A75 B;  1KWO B;  2K7D A;  1K9K A;  1K93 D;  1XFX O;  2M3W A;  1WLM A;  1LKJ A;  1YRU B;  1J7P A;  2JT8 A;  3PN7 C;  1C7W A;  4GFT A;  3TDI A;  4CFQ A;  1KK8 C;  1TCO B;  2GV5 A;  1KSO A;  2QAC A;  1GQM A;  3AAK A;  4XYN A;  4C0K A;  1SCV A;  1G33 A;  1YUU A;  3SG6 A;  1DJG A;  4L9M A;  1HT9 A;  3BOW A;  1IJ6 A;  5DKQ A;  3IQQ A;  2M0R A;  1JSA A;  2MAZ A;  1SPY A;  4A4C A;  2L0P A;  1N2D A;  3I5H B;  2BEC A;  5KSZ A;  2HQ8 A;  1CMG A;  2LAP A;  1RK9 A;  2CBL A;  3LK0 A;  1NCX A;  1F70 A;  2LLT A;  1BT6 A;  3CR5 X;  1AVS A;  5ER4 X;  2K61 A;  3K21 A;  2L50 A;  1NX3 A;  1XK4 C;  4YBH B;  1XO5 A;  3A4U B;  3JVT B;  2L4H A;  1MQ1 A;  1DMO A;  1NIW A;  1QVI Y;  1M45 A;  2NLN A;  4JPZ B;  5IBW A;  1QX2 A;  1DJY A;  5I2O A;  1F4Q A;  1KQM B;  4HSZ A;  1SNL A;  2LMV A;  1LVC D;  3O4Y A;  5AER A;  1FI6 A;  1F54 A;  1AUI B;  3CGA A;  1IQ3 A;  1L2O B;  1DTL A;  2LUX A;  1TNP A;  1DJI A;  2EC6 C;  1BOC A;  1ZMZ A;  4E68 A;  1EJ3 A;  1YUR A;  4PE0 A;  3NSI A;  4OKH A;  1MF8 B;  2K0J A;  2JRF A;  5AXI A;  2LHI A;  1QV0 A;  1IH0 A;  1NCZ A;  1S1E A;  3O2P A;  1PK0 D;  3NSK A;  3PAT A;  4CFR A;  2ZFD A;  1JFK A;  2ZN8 A;  1M31 A;  2PAL A;  3I5I B;  1V1G A;  4PE4 A;  1J1D A;  3TS5 B;  1BG1 A;  4MSP A;  4YGB B;  1B1G A;  2K7B A;  1JC2 A;  1J55 A;  2LP3 A;  2QPT A;  1S5G Y;  2JWW A;  3PSR A;  3BUX B;  4GGN A;  3JTD C;  1NUB A;  2M1U A;  1G8I A;  1W7I B;  1LXF C;  1M46 A;  4M2P A;  2KYF A;  3OB2 B;  1KCY A;  2A4J A;  4NQG A;  2NXQ A;  2JQ6 A;  2WOR A;  1R2U A;  2FCE A;  2MJW B;  5JOL A;  2NCO A;  1SRA A;  1SL7 A;  3I5F C;  4YGC B;  2OPO A;  2OTG C;  1XK4 A;  3SJS A;  1CDN A;  3PM8 A;  1RRO A;  2WC8 A;  1B8C A;  1PUL A;  2ZND A;  1EXR A;  1SKT A;  1YUT A;  2LP2 A;  2BCA A;  1C7V A;  1MWN A;  1Y6W A;  2JTT A;  2LNK A;  3NSL A;  3SG2 A;  2M8U A;  3OB1 B;  2BBM A;  1JUO A;  3LL8 B;  1A29 A;  4YGA A;  1XFV O;  2LLS A;  1QXP A;  1UUS A;  1BMO A;  2VRG A;  3KEV A;  2M7L A;  1QVI Z;  4ORA B;  4I5L B;  1CNP A;  2OS8 B;  3KO0 A;  2LVV A;  4WQ3 A;  1K96 A;  3IF7 A;  1EG3 A;  1QX7 A;  2CT9 A;  1AJ4 A;  2M49 B;  4OR9 B;  2HF5 A;  4U8D A;  2M97 A;  1BOD A;  2KAY A;  1ALV A;  1MXE A;  1OMR A;  1W7J B;  3GOF A;  4PE7 A;  1CFF A;  3PLF B;  1TTX A;  3EKJ A;  3AKB A;  4PE1 A;  5KTY A;  1N0Y A;  2PRU A;  1AP4 A;  1CLL A;  3SG4 A;  3PAL A;  3TDZ A;  1SY9 A;  2JT0 A;  1WLZ A;  2I94 A;  2R2I A;  2LCP A;  4PDZ A;  5G08 A;  1RTP 1;  2JUL A;  1TRF A;  1YUS A;  4QJ3 B;  3DVJ A;  3I5G C;  1MR8 A;  1YRT B;  5BPJ A;  2SAS A;  2LVK A;  2BCB A;  1SMG A;  1S5G Z;  4PCW A;  1N65 A;  1IRJ A;  1CFD A;  3DD4 A;  3RLZ A;  1A2X A;  2M9G A;  3CZT X;  3ZNI A;  1SCM C;  2MLE C;  1IQ5 A;  3NSO A;  2MRD A;  3DVE A;  4ZCV A;  5CSN A;  3RM1 A;  2NZ0 A;  2H61 C;  1RFJ A;  2WOS A;  4P2Y B;  3M0W A;  2KHN A;  3VRQ A;  2JT3 A;  2AMI A;  4P5O E;  1ZUZ A;  3PN7 B;  1KK8 B;  3TDU A;  1MUX A;  1REC A;  1SL8 A;  1SBJ A;  1LA0 A;  1CLB A;  1X02 A;  4N1G A;  1YX8 A;  3CLN A;  4N1F A;  4WQ2 A;  1QLS A;  1H4B A;  4PHK A;  1CM4 A;  2JNX A;  4AOM A;  2TN4 A;  1OMV A;  5I2L A;  1BLQ A;  1PVB A;  1NX0 A;  1QIV A;  3EVU A;  1E8A A;  3A8R A;  2PSR A;  3FWB A;  5AEQ A;  4AQI A;  1SK6 D;  3TUY C;  1XFY O;  1NP8 A;  1FBV A;  2LVJ A;  1OZS A;  5K89 A;  2BBN A;  5DKN A;  2ISD A;  2LM5 A;  1TIZ A;  1M39 A;  1CDM A;  1K94 A;  1AJ5 A;  1LIN A;  1FI5 A;  1Y1X A;  2WCE A;  2AAO A;  2BKH B;  2KQY A;  1TNQ A;  5I8N A;  1B7T Y;  3AKA A;  3BXK A;  4PHJ A;  3OX5 A;  5HKZ A;  1RJV A;  1EL4 A;  1AHR A;  2LHL A;  3EVR A;  1PRW A;  3LCP C;  4N5X A;  3HCM A;  2BL0 C;  5CSJ A;  5KU1 A;  1K2H A;  2EC6 B;  4TNC A;  3BUO B;  1JF2 A;  2LVI A;  1ALW A;  1K9U A;  4I5N B;  4C0L A;  1WRZ A;  4MZK A;  1R6P A;  5FYX A;  5JJG A;  3FS7 A;  1WDC C;  2M7N A;  1CFC A;  1WRK A;  1D1O A;  2MHH A;  4GBA A;  2NCP A;  3CWG A;  1YX7 A;  2KGR A;  1CM1 A;  4HRH A;  2F3Y A;  1PAL A;  1TOP A;  3VRR A;  3DVM A;  1OOJ A;  5AAN A;  3LLE A;  1KK7 Y;  2MBX A;  2FOT A;  3OHM B;  3GK2 A;  1S6I A;  1XVJ A;  1UHK A;  3JTD B;  4IL1 A;  4PHN A;  3PFV A;  1KFX S;  1UHI A;  1Y1A A;  2L98 A;  4GUK A;  2LUC A;  5I2Q A;  4NDC A;  4DRW A;  2L51 A;  1NX2 A;  1ZAC A;  2F3Z A;  2ZRS A;  4D1E A;  2KI6 D;  1F71 A;  1S36 A;  4ORB B;  2WND A;  3DVK A;  1KFX L;  4YGD B;  2KBM A;  4MLW A;  3BUW B;  3I5F B;  1B8L A;  4JWQ A;  1TNW A;  1SR6 C;  3C1V A;  4FQO A;  2PMY A;  5CSF A;  1Y1U A;  4YGE B;  4GPL B;  2JC2 A;  4CLN A;  2PVB A;  4WRI A;  3GK4 X;  1K90 D;  1QX5 B;  2AUC A;  2Y1M A;  3BQ3 A;  3WNX B;  1JFJ A;  2KI4 C;  4MVF A;  5GQQ C;  2F2P A;  3O78 A;  1C07 A;  3TZ1 A;  5HYD A;  1BU3 A;  2G9B A;  3OP0 A;  4A4B A;  1B7T Z;  1YVL A;  2E6W A;  1WY9 A;  1XFU O;  3BUM B;  1CTR A;  1J7R A;  3DF0 B;  2K7C A;  4I5K A;  1K9P A;  4BY5 A;  1CLM A;  2BKI B;  3FIA A;  2BE6 A;  3E3R A;  4UPG A;  1RWY A;  4ICB A;  3SG5 A;  4C0J A;  3MSE B;  1PSR A;  1XA5 A;  1DGV A;  1F8H A;  1U5I A;  3EVV A;  2JPT A;  1FW4 A;  1SW8 A;  1WRL A;  2K2A A;  2V53 A;  4OV2 A;  2KFF A;  5D7F A;  2KQ6 A;  1OE9 B;  1PSB A;  3AAJ A;  2L2E A;  2JNF A;  2LAN A;  3CS1 A;  3SG3 A;  1KWO C;  3GK1 A;  1JBA A;  2GGM A;  1K8U A;  2LV7 A;  4GAO A;  4NDD A;  1JWD A;  2B1U A;  3I5G B;  2KOT A;  2SCP A;  3D0Y A;  1S26 D;  1A03 A;  4CPV A;  2CXJ A;  4MRX A;  3BUN B;  1TN4 A;  2MLF C;  4GGF C;  2I7A A;  2K8M B;  1L7Z A;  1BR4 B;  2HQW A;  1CMF A;  1SCM B;  1UP5 A;  3ZWH A;  4I5J A;  5DKR A;  1ZFS A;  3EK8 A;  2KFG A;  2IS9 A;  3CTN A;  4M2Q A;  4QJ5 B;  3I5H C;  3WHT B;  2M29 A;  1QV1 A;  5HLV A;  1J7Q A;  1GJY A;  4DUQ A;  3O6B A;  4ZCU A;  1DGU A;  2JXL A;  3DF0 A;  4XJK A;  2LE9 B;  2LMT A;  4OCI A;  4PAL A;  4CID A;  1DF0 A;  1CFP A;  1QJT A;  3ICB A;  1ZOT B;  2LLU A;  2KYC A;  4MBE A;  3VRP A;  1QAT A;  4YRU A;  2KSP A;  1DJH A;  4OVN F;  3JVT C;  3HX4 A;  5ER5 A;  1YR5 A;  1J7O A;  2JOJ A;  1DVI A;  1YTZ C;  3WHU B;  1B9A A;  3EKH A;  4MN0 A;  4YI8 A;  2JZI A;  5B8I B;  1QLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...