2HQWA

Crystal structure of ca2+/calmodulin bound to nmda receptor nr1c1 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
138
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin
publication title The NMDA Receptor NR1 C1 Region Bound to Calmodulin: Structural Insights into Functional Differences between Homologous Domains.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 47
structure length 138
sequence length 144
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hqwA00
3TS5C 1FBVA 3C1VA 2BCBA 4MVFA 4CIDA 2CTNA 4OVNF 1QIVA 2WNDA 1J7PA 3LK0A 4JWQA 1AUIB 5G08A 1C7WA 1F4QA 1M39A 1XVJA 2LUXA 2KYFA 1QLSA 3GK2A 4I5LB 1CFFA 2L2EA 1TRFA 3OX5A 2LVJA 3TZ1A 1K93D 1BJFA 2LMUA 1U5IA 1M45A 2KI4C 2LHLA 1JWDA 3TDIA 1VRKA 2M1KB 3FWCA 1KWOB 4QJ4B 2F3ZA 3TDUA 5I2QA 2L5XB 3AKAA 1CFPA 2BL0B 2LAPA 2LVKA 2K2FA 4MZLA 3WXAA 2JRFA 3DVEA 2SASA 3EK7A 2K7OA 1SBJA 4GNKB 3I5IC 1NCZA 4PE7A 5HKYA 1A03A 1QX5B 3LLEA 4HSZA 1J7RA 1LVCD 3KEVA 1E8AA 1ALVA 2JNFA 1LA0A 2KOTA 4N1GA 1JFJA 2JXCA 4TNCA 3GK1A 1ZMZA 1JC2A 3DF0A 3WHTB 2O5GA 1SKTA 1K9PA 2L4IA 1SCVA 3EK4A 1IKUA 1UHHA 1QASA 1WRZA 2BKIB 5I8NA 2DOQA 1PALA 1QS7A 3FWBA 1XFYO 1M31A 1G8IA 1TCOB 3AAJA 4PE4A 3TDZA 3FIAA 1UP5A 1PVAA 3TS5B 3JTDC 2CBLA 3SIBA 1ALWA 3CTNA 2NLNA 3ZWHA 3ICBA 1CDLA 4C0KA 2A4JA 1YX8A 5DKRA 1JSAA 2ZKMX 1FPWA 4HREE 4CFRA 3KHEA 1KSMA 1X02A 4E68A 1B47A 1DJZA 2KI4B 2L51A 4QJ3B 1B9AA 2L98A 2H61C 1B7TY 1BMOA 1G4YR 1R2UA 2I2RE 3PFVA 1KK8C 5HKWA 3SG6A 1IGVA 4BY4A 1CDNA 4MZKA 4PHJA 4WRIA 1B1GA 2EC6C 3I5IB 1CNPA 1UWOA 1WLMA 1F71A 1YRUB 2Y1NA 4CLNA 1V1FA 1XA5A 2MBXA 1BR1B 4PHKA 4GAOA 4DRWA 2GV5A 4PCWA 1JF0A 2F33A 2K2AA 1F70A 4AQIA 3KO0A 1B4CA 1S26D 1CFCA 3VGOA 1EJ3A 2F3YA 1AJ4A 2NCOA 4I5KA 2LLUA 1ZACA 4ORBB 1SMGA 4PE1A 3EVUA 3I5GC 1AVSA 2M8UA 2LM5A 3CWGA 1J55A 2NZ0A 1EG3A 4JPZB 1QIWA 2WC8A 3IQOA 2RGIA 4DUQA 1K8UA 2LVVA 1SL7A 1B8RA 2JTTA 3LL8B 1F55A 1XK4A 3K21A 1H8BA 2AAOA 3BUOB 1NCXA 1KSOA 1K9KA 2FJUB 2FCEA 5GQQC 3BUMB 2HF5A 2F2PA 1A29A 2M1UA 1RK9A 1S5GZ 1SL9A 2L0PA 4PE0A 1QVIY 1OZSA 1ZUZA 1GGZA 1UHJA 1S3PA 4OR9B 2JT3A 1KK8B 2G9BA 2L4HA 1DJIA 2D8NA 2EC6B 2BCXA 3QRXA 1DGUA 1SCMB 2GGZA 2EHBA 2MAZA 4OKHA 4PALA 3RLZA 2Y1MA 3KPXA 1PULA 2F2OA 1WDCC 1XFVO 2KNEA 2LP3A 1TNWA 1ZOTB 1K94A 3VROA 5B8IB 2ZRTA 3WNXB 1A75A 2KYCA 3EKJA 3MSEB 4MBEA 4HRGA 2K8MB 4YRUA 3IQQA 1SK6D 1RROA 3I5GB 3CZTX 4OV2A 1UHNA 1FI5A 1CDPA 1CLMA 4A4CA 1YUSA 1DT7B 1XFXO 4ETOA 2LV7A 1ODBA 3FS7A 3DD4A 5JOLA 2OPOA 4MSPA 1N2DA 1XO5A 5KTYA 1D1OA 5FYXA 3JVTC 1F54A 1SR6C 2BKHB 3SG2A 1IG5A 1TOPA 1UUSA 2BBNA 2AMIA 3I5HC 3PN7C 1W7JB 1BG1A 1MR8A 3SG3A 3O78A 3H4SE 1KQMC 3NSOA 2M7LA 4GGFA 5ER4X 1MF8B 3CS1A 4MRXA 2M0RA 2JXLA 5I2LA 2PMYA 1NWDA 2AUCA 1Q80A 1AK8A 1SL8A 3E3RA 4IL1A 1CDMA 2KFFA 3O4YA 5HLVA 1C7VA 2JQ6A 2O60A 1S6CA 1BOCA 3CR4X 2BECA 1LINA 3OP0A 1BODA 1AHRA 4YGCB 4JQ0D 5ER5A 1WDCB 1DJXA 1NPQA 1Y6WA 1DTLA 2V53A 5K89A 1FW4A 3DVJA 2LE9B 2PSRA 5DKNA 1WRKA 2JTZA 3BOWB 4GPLB 1G33A 3OB2B 1QXPA 3VRRA 5D7FA 4CPVA 2JULA 1DMOA 1SPYA 1KCYA 1L2OC 3D10A 1OMVA 1XFUO 2BBMA 1N0YA 1CM4A 1GGWA 1BR4B 3OHMB 4YBHB 4YGBB 1TNQA 1TNXA 2M97A 3KF9A 2WOSA 3JVTB 3D0YA 1DF0A 1MXEA 2KGRA 5J3XA 4CFQA 1BLQA 1SR6B 2PALA 1TIZA 2CT9A 1CKKA 2KQ6A 4MRYA 2H61A 3I5HB 3PN7B 1WRLA 1CTRA 4NDCA 1IRJA 4MEWA 1KQMB 1IH0A 1SCMC 4XJKA 1U5IB 4YGDB 1NP8A 2ZN9A 1QX2A 1N65A 1YX7A 2QPTA 2LLTA 3AAKA 1IJ5A 1OMDA 1A2XA 2M9GA 1JBAA 1DJYA 1K2HA 4GUKA 2KQYA 1EL4A 4ORCB 1SW8A 1NYAA 1XYDA 5AEQA 2LHIA 3I5FB 2VRGA 1EH2A 1YTZC 4P2YB 1NX1A 4GBAA 1CMGA 3EVRA 1HT9A 4N1FA 1RFJA 1SYMA 2HPSA 3EK8A 3PATA 4YI9A 2KSPA 1NIWA 2LANA 3DF0B 2I18A 2LNKA 3EKHA 1OZOA 1L2OB 2OS8C 2COLB 3DVMA 1S1EA 3GOFA 1B8CA 1F4OA 5AERA 1WLZA 2L50A 1S5GY 2JT8A 2OTGC 2WCFA 4ORAB 1LA3A 2CXJA 2MHHA 2BCAA 3NSLA 4MN0A 4DIRA 2GGMA 1YUUA 4DCKA 1XK4C 1KK7Z 2TN4A 1YURA 2WORA 3TUYC 1BT6A 1K9UA 1NCYA 1UHKA 3LK1A 1UHIA 4NDDA 4XYNA 4R1EA 1TCFA 2JPTA 1RECA 2K0JA 2LLSA 5AFPA 3AKBA 2Y4QA 2KDHA 4MLWA 2JT0A 1YVLA 4NDBA 3SJSA 1F8HA 1SY9A 1DJGA 1SNLA 3SG5A 2LC5A 4PHMA 2KI6D 4GFTA 4PHNA 1QV1A 3CR2A 4YI8A 3PLFB 4ICBA 5DKQA 1EXRA 1IJ6A 3BQ3A 1IWQA 4DS7A 1MHOA 1RJVA 2KBMA 4D1EA 1OOJA 2LUCA 3VRPA 2LMVA 3M0WA 4GGNA 1J7OA 1LXFC 1IQ5A 1SRAA 1H4BA 2K7DA 4AQJA 2E6WA 3VRNA 4BY5A 1KQVA 1A4PA 2LVIA 4OCIA 2OS8B 1OMRA 1EG4A 1TTXA 1AP4A 1CLLA 1OQPA 1M63B 3A8RA 4C0LA 5BPJA 2Q4UA 1CFDA 2OTGB 2K7BA 1KFUL 2ZRSA 5KSZA 2WCBA 3NSKA 3O6BA 5AXIA 4C0JA 2H2KA 2JOJA 3SG7A 2FOTA 1S6IA 1BF5A 2G2BA 2MJWB 3F45A 2EGDA 4M2PA 2MLEC 2PRUA 1UURA 3BXKA 4M2QA 3TUYB 4YGAA 1V1GA 2R2IA 2K61A 3O2PA 1S36A 1DJHA 1QATA 3I5FC 5HYDA 1KFXL 2I94A 2M29A 2LCPA 3ZNIA 1AJ5A 1Y1UA 3NSIA 4GGFC 1PVBA 1L7ZA 4ZCVA 1FF1A 1CB1A 1QX7A 1NSHA 1NX3A 2HETA 4N5XA 2LP2A 2QACA 5HLOA 4I5JA 2NXQA 1RWYA 4F0ZB 1CMFA 1J1EA 2M49B 1TNPA 5CPVA 1PK0D 3A4UB 1B8LA 1BU3A 2KFHA 2CCMA 2FCDA 4P5OE 3CLNA 2PVBA 1A75B 1YVHA 2HQ8A 2ZN8A 1IQ3A 4USLA 1HQVA 2K7CA 1K90D 1NUBA 4FQOA 4MZJA 2M3WA 4A4BA 1JUOA 5TNCA 5HKZA 1PRWA 3WHUB 2HQWA 1TN4A 4PDZA 1YR5A 1KFUS 1MWNA 1K95A 1CM1A 1Y0VH 3BUXB 5D69A 3NXAA 1GQMA 2KFGA 1RTP1 1FI6A 1B7TZ 1MQ1A 5KU1A 1DGVA 4AOMA 2CNPA 2MA2A 2LMTA 1J7QA 3LCPC 5CSFA 1DVIA 1PSRA 2F8PA 2PASA 2KI6C 3HX4A 1WY9A 2NCPA 5F6TA 1Y1AA 1NX2A 2BE4A 1ZFSA 3BYAA 4YGEB 1KFXS 3PM8A 2KGBC 1QLKA 1R6PA 4I5NB 1XFWO 4HRHA 4WQ2A 2B1UA 2KBIA 2KAXA 3SG4A 3PALA 4WQ3A 2KAVA 2ZFDA 1MXLC 5CSNA 3VRQA 1S6JA 4L9MA 2M7NA 3OX6A 2JNXA 1YRTB 1DJWA 1QTXA 2Y5IA 4FTGA 4U8DA 1GJYA 3RM1A 2JWWA 4UPGA 2I7AA 1OE9B 3BUNB 1QJTA 1QV0A 2JU0A 5CSIA 1MUXA 2KHNA 3DVKA 4Q04A 3JTDB 2IS9A 5AANA 1Y1XA 1JF2A 3IF7A 1KK7Y 1KWOC 1LKJA 4NQGA 1PSBA 4QJ5B 2BL0C 2ZNEA 1CLBA 3EVVA 5I2OA 1QVIZ 3HCMA 3D0YB 1DF0B 1J1DA 1XFZO 1JFKA 2SCPA 2WCEA 2BE6A 3SIAA 1W7IB 3PSRA 2KAYA 4M2OA 4ZCUA 5PALA 2MLFC 3CR5X 1K96A 2JC2A 3GK4X 3BOWA 2JZIA 5CSJA 4XJKB 1NX0A 2ISDA 1YUTA 2Q91A 5IBWA 2ZNDA 3CGAA 3OB1B 1C07A 1M46A 2E30A 1OSAA 2P6BB 3BUWB 5JJGA 2MRDA
chains in the Genus database with same CATH superfamily
3SS5A 2KPHA 3TS5C 1FBVA 3C1VA 2KLDA 2BCBA 4MVFA 4CIDA 2CTNA 4OVNF 1QIVA 2WNDA 1J7PA 3LK0A 4JWQA 1AUIB 5G08A 1C7WA 1F4QA 1M39A 1XVJA 2LUXA 2KYFA 1DQEA 1QLSA 3GK2A 4I5LB 1CFFA 2L2EA 1TRFA 3OX5A 2LVJA 3TZ1A 1K93D 1BJFA 2LMUA 1U5IA 1M45A 2KI4C 2LHLA 1JWDA 3TDIA 1VRKA 2M1KB 3FWCA 1KWOB 4QJ4B 2F3ZA 3TDUA 5I2QA 2L5XB 3AKAA 1CFPA 2BL0B 2LAPA 2LVKA 2K2FA 4MZLA 3WXAA 2JRFA 1DC1A 3DVEA 2SASA 3EK7A 2K7OA 1SBJA 4GNKB 3I5IC 1NCZA 4PE7A 5HKYA 1A03A 1QX5B 3LLEA 4HSZA 5HL1A 1J7RA 1LVCD 3KEVA 1E8AA 1ALVA 2JNFA 1LA0A 2KOTA 4N1GA 3S0BA 1JFJA 2JXCA 4TNCA 3GK1A 2WCMA 1ZMZA 1JC2A 3DF0A 3WHTB 2O5GA 1SKTA 1K9PA 2L4IA 1SCVA 3EK4A 1IKUA 1UHHA 1QASA 1WRZA 2BKIB 5I8NA 3FE8A 2DOQA 1PALA 1QS7A 3FWBA 1XFYO 1M31A 1G8IA 1TCOB 3AAJA 4PE4A 3TDZA 3FIAA 1UP5A 1PVAA 1W9ZA 3TS5B 3JTDC 2CBLA 3SIBA 1ALWA 3CTNA 5FI7A 2NLNA 3ZWHA 3ICBA 1CDLA 4C0KA 1OOGA 2A4JA 1YX8A 5DKRA 1JSAA 2ZKMX 1FPWA 3L4LA 4HREE 4CFRA 3KHEA 1KSMA 1X02A 4E68A 4IJ7A 1B47A 1DJZA 2KI4B 2L51A 4QJ3B 1B9AA 2L98A 3L47A 1GM0A 2H61C 1B7TY 1BMOA 1G4YR 1R2UA 2I2RE 3PFVA 1KK8C 5HKWA 3SG6A 1IGVA 4BY4A 3D78A 1CDNA 4MZKA 4PHJA 4WRIA 1B1GA 2EC6C 3I5IB 1CNPA 1UWOA 1WLMA 1F71A 1YRUB 2Y1NA 4CLNA 1V1FA 1XA5A 4PT1A 2MBXA 1BR1B 4PHKA 4GAOA 4DRWA 2GV5A 4PCWA 1JF0A 3NGVA 2QEBA 2F33A 2K2AA 1F70A 4AQIA 3KO0A 1B4CA 1S26D 1CFCA 3VGOA 1EJ3A 2F3YA 3RZSA 1AJ4A 2GTEA 2NCOA 2P71A 4I5KA 3S0GA 2LLUA 1ZACA 2PYQA 4ORBB 1SMGA 4PE1A 3EVUA 3I5GC 1AVSA 2M8UA 2LM5A 3CWGA 1J55A 2NZ0A 3D74A 1EG3A 4JPZB 1QIWA 2WC8A 3IQOA 2RGIA 1SSEB 3SS3A 1K8UA 2LVVA 1SL7A 1B8RA 2JTTA 3LL8B 4DUQA 1XK4A 3K21A 1F55A 1H8BA 2AAOA 3BUOB 1NCXA 1KSOA 1K9KA 2FJUB 2FCEA 5GQQC 3BUMB 2HF5A 2F2PA 1A29A 2M1UA 1RK9A 3CABA 1S5GZ 1SL9A 2L0PA 4PE0A 3S0AA 1QVIY 1OZSA 1ZUZA 1GGZA 1UHJA 1S3PA 4OR9B 2JT3A 1KK8B 2G9BA 2L4HA 1DJIA 1OOHA 2D8NA 3CZ1A 2EC6B 2BCXA 3QRXA 1DGUA 1SCMB 2GGZA 2EHBA 2MAZA 4OKHA 4PALA 3RLZA 2Y1MA 3KPXA 1PULA 2F2OA 1WDCC 1XFVO 2KNEA 2LP3A 3B86A 1TNWA 1ZOTB 1K94A 3VROA 5B8IB 2PQLA 2ZRTA 3WNXB 1A75A 2KYCA 3EKJA 3MSEB 4MBEA 4HRGA 3S0FA 2K8MB 4YRUA 3IQQA 2WC6A 1SK6D 1RROA 3I5GB 3CZTX 4OV2A 3CZ2A 1UHNA 1FI5A 1CDPA 1CLMA 4A4CA 1YUSA 3K1EA 1XFXO 4ETOA 2LV7A 1ODBA 1DT7B 3FS7A 3DD4A 5JOLA 2OPOA 4MSPA 1N2DA 1XO5A 5KTYA 1D1OA 5FYXA 3DY9A 3JVTC 1F54A 1SR6C 3BFBA 3N7HA 3QMEA 2BKHB 3SG2A 1IG5A 1TOPA 1UUSA 2BBNA 2AMIA 3I5HC 3O4XA 3PN7C 1W7JB 3UO9A 1BG1A 1MR8A 3SG3A 3O78A 3R1PA 3H4SE 1KQMC 3NSOA 3OGNA 2M7LA 3BFHA 4GGFA 5ER4X 1MF8B 3CS1A 4MRXA 2M0RA 2JXLA 5D3OA 2PMYA 5I2LA 1NWDA 2AUCA 3DXLA 1Q80A 1AK8A 1SL8A 3E3RA 3B88A 1CDMA 1DELA 4IL1A 2KFFA 3O4YA 3SS4A 2BAPA 5HLVA 1C7VA 2JQ6A 2O60A 1S6CA 1BOCA 3CR4X 2BECA 3B87A 1LINA 3OP0A 1BODA 1AHRA 4YGCB 4JQ0D 5ER5A 1WDCB 1DJXA 1NPQA 1Y6WA 1DTLA 2V53A 5K89A 3CZ0A 1FW4A 3DVJA 2LE9B 5EL2A 2PSRA 5DKNA 1WRKA 2JTZA 3BOWB 4GPLB 1G33A 3OB2B 1QXPA 2K60A 3CYZA 3VRRA 5D7FA 4CPVA 2JULA 4OZDA 1DMOA 1SPYA 1KCYA 1L2OC 3D10A 1OMVA 1XFUO 3D77A 2BBMA 1N0YA 1CM4A 1GGWA 1BR4B 3Q8IA 3OHMB 4YBHB 4YGBB 5I94A 1TNQA 1TNXA 2L5YA 2M97A 3KF9A 2ERBA 2WOSA 3JVTB 3D0YA 1DF0A 1MXEA 2KGRA 5J3XA 4CFQA 1BLQA 2L2CA 1SR6B 2PALA 1TIZA 2CT9A 1CKKA 2KQ6A 4MRYA 2H61A 3I5HB 3PN7B 1WRLA 3IVTA 1CTRA 4NDCA 1IRJA 4MEWA 1KQMB 1IH0A 1SCMC 2WCLA 4XJKA 3S0DA 1U5IB 4YGDB 1NP8A 2ZN9A 1QX2A 1N65A 1YX7A 2QPTA 3S0EA 2LLTA 3D73A 3AAKA 1IJ5A 1OMDA 1A2XA 2M9GA 1JBAA 1DJYA 1K2HA 4GUKA 2KQYA 1EL4A 4ORCB 1SW8A 1NYAA 1XYDA 3OBVA 2LHIA 5AEQA 2WCHA 3I5FB 2VRGA 1EH2A 1YTZC 3DZTA 4P2YB 1NX1A 3PJIA 2H8VA 4GBAA 1CMGA 3EVRA 1HT9A 4N1FA 1RFJA 1SYMA 2HPSA 3EK8A 3PATA 4YI9A 2KSPA 1TWOA 1NIWA 1C3ZA 2LANA 3DF0B 4KYNA 2I18A 2LNKA 1OW4A 1OZOA 1L2OB 3EKHA 3PM2A 2OS8C 2COLB 3DVMA 2YGUA 1S1EA 3GOFA 1B8CA 1F4OA 5AERA 1WLZA 2L50A 1S5GY 2JT8A 2OTGC 2WCFA 4ORAB 1LA3A 1Z4HA 2CXJA 2BCAA 2MHHA 3NSLA 4MN0A 2GGMA 4DIRA 1YUUA 4DCKA 1XK4C 1KK7Z 2TN4A 1YURA 2WORA 3NHIA 1BT6A 1K9UA 1NCYA 3TUYC 1UHKA 4F7FA 3LK1A 1UHIA 2WCJA 4NDDA 4XYNA 2JPOA 4R1EA 1TCFA 2JPTA 1RECA 2K0JA 2LLSA 5AFPA 3AKBA 2Y4QA 2KDHA 4MLWA 2JT0A 1YVLA 4NDBA 3SJSA 4FQTA 1F8HA 1QWVA 1SY9A 1DJGA 1SNLA 3SG5A 2LC5A 4PHMA 2KI6D 4GFTA 4PHNA 1QV1A 5DICA 3CDNA 3CR2A 4YI8A 3PLFB 4ICBA 5DKQA 1EXRA 1IJ6A 3BQ3A 1IWQA 3DYEA 1MHOA 4DS7A 2QEVA 1RJVA 2KBMA 4D1EA 3B7AA 1OOJA 2LUCA 3VRPA 2LMVA 3M0WA 4GGNA 1J7OA 1LXFC 1IQ5A 1SRAA 1H4BA 2K7DA 4AQJA 2E6WA 3BFAA 5FI6A 3VRNA 4BY5A 1KQVA 1A4PA 2LVIA 2QDIA 4OCIA 2OS8B 1OMRA 3NHTA 1EG4A 1TTXA 1AP4A 1CLLA 1OQPA 1M63B 3A8RA 4C0LA 5BPJA 2Q4UA 1CFDA 2OTGB 2K7BA 1KFUL 2ZRSA 5KSZA 2WCBA 3NSKA 3O6BA 5AXIA 4C0JA 2H2KA 2JOJA 3SG7A 2FOTA 1S6IA 2WC5A 4JD9A 1BF5A 2G2BA 2MJWB 3F45A 2EGDA 4M2PA 2MLEC 3FE6A 2PRUA 1UURA 3BXKA 4M2QA 3TUYB 4YGAA 1V1GA 2R2IA 2K61A 1T14A 3O2PA 1S36A 1DJHA 3R1OA 1QATA 3I5FC 5HYDA 1KFXL 2I94A 2M29A 2LCPA 3ZNIA 1AJ5A 1Y1UA 3NSIA 4GGFC 1PVBA 1L7ZA 4ZCVA 1FF1A 1CB1A 1QX7A 1NSHA 3D76A 1NX3A 2HETA 4N5XA 2LP2A 2QACA 5HLOA 4I5JA 2NXQA 1RWYA 4F0ZB 1CMFA 1J1EA 2M49B 1TNPA 5CPVA 1PK0D 3A4UB 1B8LA 1BU3A 2KFHA 2CCMA 2FCDA 3D75A 4P5OE 3CLNA 2PVBA 1A75B 1YVHA 2HQ8A 2ZN8A 1IQ3A 4USLA 1HQVA 5FI2A 2K7CA 2QEOA 1K90D 1NUBA 1DEKA 4FQOA 4MZJA 2M3WA 4A4BA 1JUOA 1OOFA 2BNXA 5TNCA 1C3YA 5HKZA 1PRWA 3WHUB 2HQWA 1TN4A 4PDZA 1YR5A 1KFUS 1MWNA 1K95A 1CM1A 1Y0VH 3BUXB 5D69A 3NXAA 1GQMA 2KFGA 1RTP1 1FI6A 1B7TZ 1MQ1A 1LS8A 5KU1A 1DGVA 4AOMA 2CNPA 2MA2A 2LMTA 1J7QA 3LCPC 5CSFA 1DVIA 1PSRA 2F8PA 2PASA 2KI6C 3FE9A 3HX4A 1WY9A 2NCPA 5F6TA 1Y1AA 1NX2A 3V2LA 2BE4A 1ZFSA 3BJHA 3BYAA 4YGEB 1KFXS 3PM8A 2KGBC 1QLKA 1R6PA 4I5NB 1XFWO 3EG5B 1Z2CB 4HRHA 2B1UA 1TUZA 2KBIA 2KAXA 4WQ2A 3SG4A 3PALA 4WQ3A 2KAVA 2ZFDA 1MXLC 5CSNA 3VRQA 1S6JA 4L9MA 2M7NA 3OX6A 3VB1A 2JNXA 1YRTB 1DJWA 1QTXA 2Y5IA 4FTGA 4U8DA 1GJYA 3R1VA 2JWWA 3RM1A 4UPGA 2I7AA 1OE9B 3BUNB 1QJTA 1QV0A 2WCKA 2JU0A 5CSIA 1MUXA 2KHNA 3DVKA 4Q04A 3JTDB 2IS9A 5AANA 1Y1XA 1JF2A 3IF7A 1KK7Y 1KWOC 1LKJA 4NQGA 1PSBA 4QJ5B 4INXA 2BL0C 3R72A 2ZNEA 1CLBA 3EVVA 5I2OA 2KLEA 1P28A 3L4AA 1QVIZ 3HCMA 3D0YB 1DF0B 1J1DA 1XFZO 2QEHA 1TUJA 1ORGA 1JFKA 2SCPA 2P70A 2BE6A 2WCEA 3SIAA 1W7IB 3UNWA 3B6XA 3PSRA 2KAYA 4M2OA 4ZCUA 5PALA 2MLFC 3CR5X 1K96A 2JC2A 3GK4X 3BOWA 2JZIA 5CSJA 4XJKB 1NX0A 2ISDA 1YUTA 1XFRA 1OOIX 2Q91A 4INWA 5IBWA 2ZNDA 3CGAA 3OB1B 1C07A 1IIOA 2FJYA 1M46A 2E30A 4JKTA 1OSAA 2P6BB 3BUWB 5JJGA 2MRDA
chains in the Genus database with same CATH topology
3TS5C 1FBVA 3C1VA 2BCBA 4MVFA 4CIDA 2CTNA 4OVNF 1QIVA 2WNDA 1J7PA 3LK0A 4JWQA 1AUIB 5G08A 1C7WA 1F4QA 1M39A 1XVJA 2LUXA 2KYFA 1QLSA 3GK2A 4I5LB 1CFFA 2L2EA 1TRFA 3OX5A 2LVJA 3TZ1A 1K93D 1BJFA 2LMUA 1U5IA 1M45A 2KI4C 2LHLA 1JWDA 3TDIA 1VRKA 2M1KB 3FWCA 1KWOB 4QJ4B 2F3ZA 3TDUA 5I2QA 2L5XB 3AKAA 1CFPA 2BL0B 2LAPA 2LVKA 2K2FA 4MZLA 3WXAA 2JRFA 3DVEA 2SASA 3EK7A 2K7OA 1SBJA 4GNKB 3I5IC 1NCZA 4PE7A 5HKYA 1A03A 1QX5B 3LLEA 4HSZA 1J7RA 1LVCD 3KEVA 1E8AA 1ALVA 2JNFA 1LA0A 2KOTA 4N1GA 1JFJA 2JXCA 4TNCA 3GK1A 1ZMZA 1JC2A 3DF0A 3WHTB 2O5GA 1SKTA 1K9PA 2L4IA 1SCVA 3EK4A 1IKUA 1UHHA 1QASA 1WRZA 2BKIB 5I8NA 2DOQA 1PALA 1QS7A 3FWBA 1XFYO 1M31A 1G8IA 1TCOB 3AAJA 4PE4A 3TDZA 3FIAA 1UP5A 1PVAA 3TS5B 3JTDC 2CBLA 3SIBA 1ALWA 3CTNA 2NLNA 3ZWHA 3ICBA 1CDLA 4C0KA 2A4JA 1YX8A 5DKRA 1JSAA 2ZKMX 1FPWA 4HREE 4CFRA 3KHEA 1KSMA 1X02A 4E68A 1B47A 1DJZA 2KI4B 2L51A 4QJ3B 1B9AA 2L98A 2H61C 1B7TY 1BMOA 1G4YR 1R2UA 2I2RE 3PFVA 1KK8C 5HKWA 3SG6A 1IGVA 4BY4A 1CDNA 4MZKA 4PHJA 4WRIA 1B1GA 2EC6C 3I5IB 1CNPA 1UWOA 1WLMA 1F71A 1YRUB 2Y1NA 4CLNA 1V1FA 1XA5A 2MBXA 1BR1B 4PHKA 4GAOA 4DRWA 2GV5A 4PCWA 1JF0A 2F33A 2K2AA 1F70A 4AQIA 3KO0A 1B4CA 1S26D 1CFCA 3VGOA 1EJ3A 2F3YA 1AJ4A 2NCOA 4I5KA 2LLUA 1ZACA 4ORBB 1SMGA 4PE1A 3EVUA 3I5GC 1AVSA 2M8UA 2LM5A 3CWGA 1J55A 2NZ0A 1EG3A 4JPZB 1QIWA 2WC8A 3IQOA 2RGIA 4DUQA 1K8UA 2LVVA 1SL7A 1B8RA 2JTTA 3LL8B 1F55A 1XK4A 3K21A 1H8BA 2AAOA 3BUOB 1NCXA 1KSOA 1K9KA 2FJUB 2FCEA 5GQQC 3BUMB 2HF5A 2F2PA 1A29A 2M1UA 1RK9A 1S5GZ 1SL9A 2L0PA 4PE0A 1QVIY 1OZSA 1ZUZA 1GGZA 1UHJA 1S3PA 4OR9B 2JT3A 1KK8B 2G9BA 2L4HA 1DJIA 2D8NA 2EC6B 2BCXA 3QRXA 1DGUA 1SCMB 2GGZA 2EHBA 2MAZA 4OKHA 4PALA 3RLZA 2Y1MA 3KPXA 1PULA 2F2OA 1WDCC 1XFVO 2KNEA 2LP3A 1TNWA 1ZOTB 1K94A 3VROA 5B8IB 2ZRTA 3WNXB 1A75A 2KYCA 3EKJA 3MSEB 4MBEA 4HRGA 2K8MB 4YRUA 3IQQA 1SK6D 1RROA 3I5GB 3CZTX 4OV2A 1UHNA 1FI5A 1CDPA 1CLMA 4A4CA 1YUSA 1DT7B 1XFXO 4ETOA 2LV7A 1ODBA 3FS7A 3DD4A 5JOLA 2OPOA 4MSPA 1N2DA 1XO5A 5KTYA 1D1OA 5FYXA 3JVTC 1F54A 1SR6C 2BKHB 3SG2A 1IG5A 1TOPA 1UUSA 2BBNA 2AMIA 3I5HC 3PN7C 1W7JB 1BG1A 1MR8A 3SG3A 3O78A 3H4SE 1KQMC 3NSOA 2M7LA 4GGFA 5ER4X 1MF8B 3CS1A 4MRXA 2M0RA 2JXLA 5I2LA 2PMYA 1NWDA 2AUCA 1Q80A 1AK8A 1SL8A 3E3RA 4IL1A 1CDMA 2KFFA 3O4YA 5HLVA 1C7VA 2JQ6A 2O60A 1S6CA 1BOCA 3CR4X 2BECA 1LINA 3OP0A 1BODA 1AHRA 4YGCB 4JQ0D 5ER5A 1WDCB 1DJXA 1NPQA 1Y6WA 1DTLA 2V53A 5K89A 1FW4A 3DVJA 2LE9B 2PSRA 5DKNA 1WRKA 2JTZA 3BOWB 4GPLB 1G33A 3OB2B 1QXPA 3VRRA 5D7FA 4CPVA 2JULA 1DMOA 1SPYA 1KCYA 1L2OC 3D10A 1OMVA 1XFUO 2BBMA 1N0YA 1CM4A 1GGWA 1BR4B 3OHMB 4YBHB 4YGBB 1TNQA 1TNXA 2M97A 3KF9A 2WOSA 3JVTB 3D0YA 1DF0A 1MXEA 2KGRA 5J3XA 4CFQA 1BLQA 1SR6B 2PALA 1TIZA 2CT9A 1CKKA 2KQ6A 4MRYA 2H61A 3I5HB 3PN7B 1WRLA 1CTRA 4NDCA 1IRJA 4MEWA 1KQMB 1IH0A 1SCMC 4XJKA 1U5IB 4YGDB 1NP8A 2ZN9A 1QX2A 1N65A 1YX7A 2QPTA 2LLTA 3AAKA 1IJ5A 1OMDA 1A2XA 2M9GA 1JBAA 1DJYA 1K2HA 4GUKA 2KQYA 1EL4A 4ORCB 1SW8A 1NYAA 1XYDA 5AEQA 2LHIA 3I5FB 2VRGA 1EH2A 1YTZC 4P2YB 1NX1A 4GBAA 1CMGA 3EVRA 1HT9A 4N1FA 1RFJA 1SYMA 2HPSA 3EK8A 3PATA 4YI9A 2KSPA 1NIWA 2LANA 3DF0B 2I18A 2LNKA 3EKHA 1OZOA 1L2OB 2OS8C 2COLB 3DVMA 1S1EA 3GOFA 1B8CA 1F4OA 5AERA 1WLZA 2L50A 1S5GY 2JT8A 2OTGC 2WCFA 4ORAB 1LA3A 2CXJA 2MHHA 2BCAA 3NSLA 4MN0A 4DIRA 2GGMA 1YUUA 4DCKA 1XK4C 1KK7Z 2TN4A 1YURA 2WORA 3TUYC 1BT6A 1K9UA 1NCYA 1UHKA 3LK1A 1UHIA 4NDDA 4XYNA 4R1EA 1TCFA 2JPTA 1RECA 2K0JA 2LLSA 5AFPA 3AKBA 2Y4QA 2KDHA 4MLWA 2JT0A 1YVLA 4NDBA 3SJSA 1F8HA 1SY9A 1DJGA 1SNLA 3SG5A 2LC5A 4PHMA 2KI6D 4GFTA 4PHNA 1QV1A 3CR2A 4YI8A 3PLFB 4ICBA 5DKQA 1EXRA 1IJ6A 3BQ3A 1IWQA 4DS7A 1MHOA 1RJVA 2KBMA 4D1EA 1OOJA 2LUCA 3VRPA 2LMVA 3M0WA 4GGNA 1J7OA 1LXFC 1IQ5A 1SRAA 1H4BA 2K7DA 4AQJA 2E6WA 3VRNA 4BY5A 1KQVA 1A4PA 2LVIA 4OCIA 2OS8B 1OMRA 1EG4A 1TTXA 1AP4A 1CLLA 1OQPA 1M63B 3A8RA 4C0LA 5BPJA 2Q4UA 1CFDA 2OTGB 2K7BA 1KFUL 2ZRSA 5KSZA 2WCBA 3NSKA 3O6BA 5AXIA 4C0JA 2H2KA 2JOJA 3SG7A 2FOTA 1S6IA 1BF5A 2G2BA 2MJWB 3F45A 2EGDA 4M2PA 2MLEC 2PRUA 1UURA 3BXKA 4M2QA 3TUYB 4YGAA 1V1GA 2R2IA 2K61A 3O2PA 1S36A 1DJHA 1QATA 3I5FC 5HYDA 1KFXL 2I94A 2M29A 2LCPA 3ZNIA 1AJ5A 1Y1UA 3NSIA 4GGFC 1PVBA 1L7ZA 4ZCVA 1FF1A 1CB1A 1QX7A 1NSHA 1NX3A 2HETA 4N5XA 2LP2A 2QACA 5HLOA 4I5JA 2NXQA 1RWYA 4F0ZB 1CMFA 1J1EA 2M49B 1TNPA 5CPVA 1PK0D 3A4UB 1B8LA 1BU3A 2KFHA 2CCMA 2FCDA 4P5OE 3CLNA 2PVBA 1A75B 1YVHA 2HQ8A 2ZN8A 1IQ3A 4USLA 1HQVA 2K7CA 1K90D 1NUBA 4FQOA 4MZJA 2M3WA 4A4BA 1JUOA 5TNCA 5HKZA 1PRWA 3WHUB 2HQWA 1TN4A 4PDZA 1YR5A 1KFUS 1MWNA 1K95A 1CM1A 1Y0VH 3BUXB 5D69A 3NXAA 1GQMA 2KFGA 1RTP1 1FI6A 1B7TZ 1MQ1A 5KU1A 1DGVA 4AOMA 2CNPA 2MA2A 2LMTA 1J7QA 3LCPC 5CSFA 1DVIA 1PSRA 2F8PA 2PASA 2KI6C 3HX4A 1WY9A 2NCPA 5F6TA 1Y1AA 1NX2A 2BE4A 1ZFSA 3BYAA 4YGEB 1KFXS 3PM8A 2KGBC 1QLKA 1R6PA 4I5NB 1XFWO 4HRHA 4WQ2A 2B1UA 2KBIA 2KAXA 3SG4A 3PALA 4WQ3A 2KAVA 2ZFDA 1MXLC 5CSNA 3VRQA 1S6JA 4L9MA 2M7NA 3OX6A 2JNXA 1YRTB 1DJWA 1QTXA 2Y5IA 4FTGA 4U8DA 1GJYA 3RM1A 2JWWA 4UPGA 2I7AA 1OE9B 3BUNB 1QJTA 1QV0A 2JU0A 5CSIA 1MUXA 2KHNA 3DVKA 4Q04A 3JTDB 2IS9A 5AANA 1Y1XA 1JF2A 3IF7A 1KK7Y 1KWOC 1LKJA 4NQGA 1PSBA 4QJ5B 2BL0C 2ZNEA 1CLBA 3EVVA 5I2OA 1QVIZ 3HCMA 3D0YB 1DF0B 1J1DA 1XFZO 1JFKA 2SCPA 2WCEA 2BE6A 3SIAA 1W7IB 3PSRA 2KAYA 4M2OA 4ZCUA 5PALA 2MLFC 3CR5X 1K96A 2JC2A 3GK4X 3BOWA 2JZIA 5CSJA 4XJKB 1NX0A 2ISDA 1YUTA 2Q91A 5IBWA 2ZNDA 3CGAA 3OB1B 1C07A 1M46A 2E30A 1OSAA 2P6BB 3BUWB 5JJGA 2MRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS5 C;  1FBV A;  3C1V A;  2BCB A;  4MVF A;  4CID A;  2CTN A;  4OVN F;  1QIV A;  2WND A;  1J7P A;  3LK0 A;  4JWQ A;  1AUI B;  5G08 A;  1C7W A;  1F4Q A;  1M39 A;  1XVJ A;  2LUX A;  2KYF A;  1QLS A;  3GK2 A;  4I5L B;  1CFF A;  2L2E A;  1TRF A;  3OX5 A;  2LVJ A;  3TZ1 A;  1K93 D;  1BJF A;  2LMU A;  1U5I A;  1M45 A;  2KI4 C;  2LHL A;  1JWD A;  3TDI A;  1VRK A;  2M1K B;  3FWC A;  1KWO B;  4QJ4 B;  2F3Z A;  3TDU A;  5I2Q A;  2L5X B;  3AKA A;  1CFP A;  2BL0 B;  2LAP A;  2LVK A;  2K2F A;  4MZL A;  3WXA A;  2JRF A;  3DVE A;  2SAS A;  3EK7 A;  2K7O A;  1SBJ A;  4GNK B;  3I5I C;  1NCZ A;  4PE7 A;  5HKY A;  1A03 A;  1QX5 B;  3LLE A;  4HSZ A;  1J7R A;  1LVC D;  3KEV A;  1E8A A;  1ALV A;  2JNF A;  1LA0 A;  2KOT A;  4N1G A;  1JFJ A;  2JXC A;  4TNC A;  3GK1 A;  1ZMZ A;  1JC2 A;  3DF0 A;  3WHT B;  2O5G A;  1SKT A;  1K9P A;  2L4I A;  1SCV A;  3EK4 A;  1IKU A;  1UHH A;  1QAS A;  1WRZ A;  2BKI B;  5I8N A;  2DOQ A;  1PAL A;  1QS7 A;  3FWB A;  1XFY O;  1M31 A;  1G8I A;  1TCO B;  3AAJ A;  4PE4 A;  3TDZ A;  3FIA A;  1UP5 A;  1PVA A;  3TS5 B;  3JTD C;  2CBL A;  3SIB A;  1ALW A;  3CTN A;  2NLN A;  3ZWH A;  3ICB A;  1CDL A;  4C0K A;  2A4J A;  1YX8 A;  5DKR A;  1JSA A;  2ZKM X;  1FPW A;  4HRE E;  4CFR A;  3KHE A;  1KSM A;  1X02 A;  4E68 A;  1B47 A;  1DJZ A;  2KI4 B;  2L51 A;  4QJ3 B;  1B9A A;  2L98 A;  2H61 C;  1B7T Y;  1BMO A;  1G4Y R;  1R2U A;  2I2R E;  3PFV A;  1KK8 C;  5HKW A;  3SG6 A;  1IGV A;  4BY4 A;  1CDN A;  4MZK A;  4PHJ A;  4WRI A;  1B1G A;  2EC6 C;  3I5I B;  1CNP A;  1UWO A;  1WLM A;  1F71 A;  1YRU B;  2Y1N A;  4CLN A;  1V1F A;  1XA5 A;  2MBX A;  1BR1 B;  4PHK A;  4GAO A;  4DRW A;  2GV5 A;  4PCW A;  1JF0 A;  2F33 A;  2K2A A;  1F70 A;  4AQI A;  3KO0 A;  1B4C A;  1S26 D;  1CFC A;  3VGO A;  1EJ3 A;  2F3Y A;  1AJ4 A;  2NCO A;  4I5K A;  2LLU A;  1ZAC A;  4ORB B;  1SMG A;  4PE1 A;  3EVU A;  3I5G C;  1AVS A;  2M8U A;  2LM5 A;  3CWG A;  1J55 A;  2NZ0 A;  1EG3 A;  4JPZ B;  1QIW A;  2WC8 A;  3IQO A;  2RGI A;  4DUQ A;  1K8U A;  2LVV A;  1SL7 A;  1B8R A;  2JTT A;  3LL8 B;  1F55 A;  1XK4 A;  3K21 A;  1H8B A;  2AAO A;  3BUO B;  1NCX A;  1KSO A;  1K9K A;  2FJU B;  2FCE A;  5GQQ C;  3BUM B;  2HF5 A;  2F2P A;  1A29 A;  2M1U A;  1RK9 A;  1S5G Z;  1SL9 A;  2L0P A;  4PE0 A;  1QVI Y;  1OZS A;  1ZUZ A;  1GGZ A;  1UHJ A;  1S3P A;  4OR9 B;  2JT3 A;  1KK8 B;  2G9B A;  2L4H A;  1DJI A;  2D8N A;  2EC6 B;  2BCX A;  3QRX A;  1DGU A;  1SCM B;  2GGZ A;  2EHB A;  2MAZ A;  4OKH A;  4PAL A;  3RLZ A;  2Y1M A;  3KPX A;  1PUL A;  2F2O A;  1WDC C;  1XFV O;  2KNE A;  2LP3 A;  1TNW A;  1ZOT B;  1K94 A;  3VRO A;  5B8I B;  2ZRT A;  3WNX B;  1A75 A;  2KYC A;  3EKJ A;  3MSE B;  4MBE A;  4HRG A;  2K8M B;  4YRU A;  3IQQ A;  1SK6 D;  1RRO A;  3I5G B;  3CZT X;  4OV2 A;  1UHN A;  1FI5 A;  1CDP A;  1CLM A;  4A4C A;  1YUS A;  1DT7 B;  1XFX O;  4ETO A;  2LV7 A;  1ODB A;  3FS7 A;  3DD4 A;  5JOL A;  2OPO A;  4MSP A;  1N2D A;  1XO5 A;  5KTY A;  1D1O A;  5FYX A;  3JVT C;  1F54 A;  1SR6 C;  2BKH B;  3SG2 A;  1IG5 A;  1TOP A;  1UUS A;  2BBN A;  2AMI A;  3I5H C;  3PN7 C;  1W7J B;  1BG1 A;  1MR8 A;  3SG3 A;  3O78 A;  3H4S E;  1KQM C;  3NSO A;  2M7L A;  4GGF A;  5ER4 X;  1MF8 B;  3CS1 A;  4MRX A;  2M0R A;  2JXL A;  5I2L A;  2PMY A;  1NWD A;  2AUC A;  1Q80 A;  1AK8 A;  1SL8 A;  3E3R A;  4IL1 A;  1CDM A;  2KFF A;  3O4Y A;  5HLV A;  1C7V A;  2JQ6 A;  2O60 A;  1S6C A;  1BOC A;  3CR4 X;  2BEC A;  1LIN A;  3OP0 A;  1BOD A;  1AHR A;  4YGC B;  4JQ0 D;  5ER5 A;  1WDC B;  1DJX A;  1NPQ A;  1Y6W A;  1DTL A;  2V53 A;  5K89 A;  1FW4 A;  3DVJ A;  2LE9 B;  2PSR A;  5DKN A;  1WRK A;  2JTZ A;  3BOW B;  4GPL B;  1G33 A;  3OB2 B;  1QXP A;  3VRR A;  5D7F A;  4CPV A;  2JUL A;  1DMO A;  1SPY A;  1KCY A;  1L2O C;  3D10 A;  1OMV A;  1XFU O;  2BBM A;  1N0Y A;  1CM4 A;  1GGW A;  1BR4 B;  3OHM B;  4YBH B;  4YGB B;  1TNQ A;  1TNX A;  2M97 A;  3KF9 A;  2WOS A;  3JVT B;  3D0Y A;  1DF0 A;  1MXE A;  2KGR A;  5J3X A;  4CFQ A;  1BLQ A;  1SR6 B;  2PAL A;  1TIZ A;  2CT9 A;  1CKK A;  2KQ6 A;  4MRY A;  2H61 A;  3I5H B;  3PN7 B;  1WRL A;  1CTR A;  4NDC A;  1IRJ A;  4MEW A;  1KQM B;  1IH0 A;  1SCM C;  4XJK A;  1U5I B;  4YGD B;  1NP8 A;  2ZN9 A;  1QX2 A;  1N65 A;  1YX7 A;  2QPT A;  2LLT A;  3AAK A;  1IJ5 A;  1OMD A;  1A2X A;  2M9G A;  1JBA A;  1DJY A;  1K2H A;  4GUK A;  2KQY A;  1EL4 A;  4ORC B;  1SW8 A;  1NYA A;  1XYD A;  5AEQ A;  2LHI A;  3I5F B;  2VRG A;  1EH2 A;  1YTZ C;  4P2Y B;  1NX1 A;  4GBA A;  1CMG A;  3EVR A;  1HT9 A;  4N1F A;  1RFJ A;  1SYM A;  2HPS A;  3EK8 A;  3PAT A;  4YI9 A;  2KSP A;  1NIW A;  2LAN A;  3DF0 B;  2I18 A;  2LNK A;  3EKH A;  1OZO A;  1L2O B;  2OS8 C;  2COL B;  3DVM A;  1S1E A;  3GOF A;  1B8C A;  1F4O A;  5AER A;  1WLZ A;  2L50 A;  1S5G Y;  2JT8 A;  2OTG C;  2WCF A;  4ORA B;  1LA3 A;  2CXJ A;  2MHH A;  2BCA A;  3NSL A;  4MN0 A;  4DIR A;  2GGM A;  1YUU A;  4DCK A;  1XK4 C;  1KK7 Z;  2TN4 A;  1YUR A;  2WOR A;  3TUY C;  1BT6 A;  1K9U A;  1NCY A;  1UHK A;  3LK1 A;  1UHI A;  4NDD A;  4XYN A;  4R1E A;  1TCF A;  2JPT A;  1REC A;  2K0J A;  2LLS A;  5AFP A;  3AKB A;  2Y4Q A;  2KDH A;  4MLW A;  2JT0 A;  1YVL A;  4NDB A;  3SJS A;  1F8H A;  1SY9 A;  1DJG A;  1SNL A;  3SG5 A;  2LC5 A;  4PHM A;  2KI6 D;  4GFT A;  4PHN A;  1QV1 A;  3CR2 A;  4YI8 A;  3PLF B;  4ICB A;  5DKQ A;  1EXR A;  1IJ6 A;  3BQ3 A;  1IWQ A;  4DS7 A;  1MHO A;  1RJV A;  2KBM A;  4D1E A;  1OOJ A;  2LUC A;  3VRP A;  2LMV A;  3M0W A;  4GGN A;  1J7O A;  1LXF C;  1IQ5 A;  1SRA A;  1H4B A;  2K7D A;  4AQJ A;  2E6W A;  3VRN A;  4BY5 A;  1KQV A;  1A4P A;  2LVI A;  4OCI A;  2OS8 B;  1OMR A;  1EG4 A;  1TTX A;  1AP4 A;  1CLL A;  1OQP A;  1M63 B;  3A8R A;  4C0L A;  5BPJ A;  2Q4U A;  1CFD A;  2OTG B;  2K7B A;  1KFU L;  2ZRS A;  5KSZ A;  2WCB A;  3NSK A;  3O6B A;  5AXI A;  4C0J A;  2H2K A;  2JOJ A;  3SG7 A;  2FOT A;  1S6I A;  1BF5 A;  2G2B A;  2MJW B;  3F45 A;  2EGD A;  4M2P A;  2MLE C;  2PRU A;  1UUR A;  3BXK A;  4M2Q A;  3TUY B;  4YGA A;  1V1G A;  2R2I A;  2K61 A;  3O2P A;  1S36 A;  1DJH A;  1QAT A;  3I5F C;  5HYD A;  1KFX L;  2I94 A;  2M29 A;  2LCP A;  3ZNI A;  1AJ5 A;  1Y1U A;  3NSI A;  4GGF C;  1PVB A;  1L7Z A;  4ZCV A;  1FF1 A;  1CB1 A;  1QX7 A;  1NSH A;  1NX3 A;  2HET A;  4N5X A;  2LP2 A;  2QAC A;  5HLO A;  4I5J A;  2NXQ A;  1RWY A;  4F0Z B;  1CMF A;  1J1E A;  2M49 B;  1TNP A;  5CPV A;  1PK0 D;  3A4U B;  1B8L A;  1BU3 A;  2KFH A;  2CCM A;  2FCD A;  4P5O E;  3CLN A;  2PVB A;  1A75 B;  1YVH A;  2HQ8 A;  2ZN8 A;  1IQ3 A;  4USL A;  1HQV A;  2K7C A;  1K90 D;  1NUB A;  4FQO A;  4MZJ A;  2M3W A;  4A4B A;  1JUO A;  5TNC A;  5HKZ A;  1PRW A;  3WHU B;  2HQW A;  1TN4 A;  4PDZ A;  1YR5 A;  1KFU S;  1MWN A;  1K95 A;  1CM1 A;  1Y0V H;  3BUX B;  5D69 A;  3NXA A;  1GQM A;  2KFG A;  1RTP 1;  1FI6 A;  1B7T Z;  1MQ1 A;  5KU1 A;  1DGV A;  4AOM A;  2CNP A;  2MA2 A;  2LMT A;  1J7Q A;  3LCP C;  5CSF A;  1DVI A;  1PSR A;  2F8P A;  2PAS A;  2KI6 C;  3HX4 A;  1WY9 A;  2NCP A;  5F6T A;  1Y1A A;  1NX2 A;  2BE4 A;  1ZFS A;  3BYA A;  4YGE B;  1KFX S;  3PM8 A;  2KGB C;  1QLK A;  1R6P A;  4I5N B;  1XFW O;  4HRH A;  4WQ2 A;  2B1U A;  2KBI A;  2KAX A;  3SG4 A;  3PAL A;  4WQ3 A;  2KAV A;  2ZFD A;  1MXL C;  5CSN A;  3VRQ A;  1S6J A;  4L9M A;  2M7N A;  3OX6 A;  2JNX A;  1YRT B;  1DJW A;  1QTX A;  2Y5I A;  4FTG A;  4U8D A;  1GJY A;  3RM1 A;  2JWW A;  4UPG A;  2I7A A;  1OE9 B;  3BUN B;  1QJT A;  1QV0 A;  2JU0 A;  5CSI A;  1MUX A;  2KHN A;  3DVK A;  4Q04 A;  3JTD B;  2IS9 A;  5AAN A;  1Y1X A;  1JF2 A;  3IF7 A;  1KK7 Y;  1KWO C;  1LKJ A;  4NQG A;  1PSB A;  4QJ5 B;  2BL0 C;  2ZNE A;  1CLB A;  3EVV A;  5I2O A;  1QVI Z;  3HCM A;  3D0Y B;  1DF0 B;  1J1D A;  1XFZ O;  1JFK A;  2SCP A;  2WCE A;  2BE6 A;  3SIA A;  1W7I B;  3PSR A;  2KAY A;  4M2O A;  4ZCU A;  5PAL A;  2MLF C;  3CR5 X;  1K96 A;  2JC2 A;  3GK4 X;  3BOW A;  2JZI A;  5CSJ A;  4XJK B;  1NX0 A;  2ISD A;  1YUT A;  2Q91 A;  5IBW A;  2ZND A;  3CGA A;  3OB1 B;  1C07 A;  1M46 A;  2E30 A;  1OSA A;  2P6B B;  3BUW B;  5JJG A;  2MRD A; 
#chains in the Genus database with same CATH topology
 3SS5 A;  2KPH A;  3TS5 C;  1FBV A;  3C1V A;  2KLD A;  2BCB A;  4MVF A;  4CID A;  2CTN A;  4OVN F;  1QIV A;  2WND A;  1J7P A;  3LK0 A;  4JWQ A;  1AUI B;  5G08 A;  1C7W A;  1F4Q A;  1M39 A;  1XVJ A;  2LUX A;  2KYF A;  1DQE A;  1QLS A;  3GK2 A;  4I5L B;  1CFF A;  2L2E A;  1TRF A;  3OX5 A;  2LVJ A;  3TZ1 A;  1K93 D;  1BJF A;  2LMU A;  1U5I A;  1M45 A;  2KI4 C;  2LHL A;  1JWD A;  3TDI A;  1VRK A;  2M1K B;  3FWC A;  1KWO B;  4QJ4 B;  2F3Z A;  3TDU A;  5I2Q A;  2L5X B;  3AKA A;  1CFP A;  2BL0 B;  2LAP A;  2LVK A;  2K2F A;  4MZL A;  3WXA A;  2JRF A;  1DC1 A;  3DVE A;  2SAS A;  3EK7 A;  2K7O A;  1SBJ A;  4GNK B;  3I5I C;  1NCZ A;  4PE7 A;  5HKY A;  1A03 A;  1QX5 B;  3LLE A;  4HSZ A;  5HL1 A;  1J7R A;  1LVC D;  3KEV A;  1E8A A;  1ALV A;  2JNF A;  1LA0 A;  2KOT A;  4N1G A;  3S0B A;  1JFJ A;  2JXC A;  4TNC A;  3GK1 A;  2WCM A;  1ZMZ A;  1JC2 A;  3DF0 A;  3WHT B;  2O5G A;  1SKT A;  1K9P A;  2L4I A;  1SCV A;  3EK4 A;  1IKU A;  1UHH A;  1QAS A;  1WRZ A;  2BKI B;  5I8N A;  3FE8 A;  2DOQ A;  1PAL A;  1QS7 A;  3FWB A;  1XFY O;  1M31 A;  1G8I A;  1TCO B;  3AAJ A;  4PE4 A;  3TDZ A;  3FIA A;  1UP5 A;  1PVA A;  1W9Z A;  3TS5 B;  3JTD C;  2CBL A;  3SIB A;  1ALW A;  3CTN A;  5FI7 A;  2NLN A;  3ZWH A;  3ICB A;  1CDL A;  4C0K A;  1OOG A;  2A4J A;  1YX8 A;  5DKR A;  1JSA A;  2ZKM X;  1FPW A;  3L4L A;  4HRE E;  4CFR A;  3KHE A;  1KSM A;  1X02 A;  4E68 A;  4IJ7 A;  1B47 A;  1DJZ A;  2KI4 B;  2L51 A;  4QJ3 B;  1B9A A;  2L98 A;  3L47 A;  1GM0 A;  2H61 C;  1B7T Y;  1BMO A;  1G4Y R;  1R2U A;  2I2R E;  3PFV A;  1KK8 C;  5HKW A;  3SG6 A;  1IGV A;  4BY4 A;  3D78 A;  1CDN A;  4MZK A;  4PHJ A;  4WRI A;  1B1G A;  2EC6 C;  3I5I B;  1CNP A;  1UWO A;  1WLM A;  1F71 A;  1YRU B;  2Y1N A;  4CLN A;  1V1F A;  1XA5 A;  4PT1 A;  2MBX A;  1BR1 B;  4PHK A;  4GAO A;  4DRW A;  2GV5 A;  4PCW A;  1JF0 A;  3NGV A;  2QEB A;  2F33 A;  2K2A A;  1F70 A;  4AQI A;  3KO0 A;  1B4C A;  1S26 D;  1CFC A;  3VGO A;  1EJ3 A;  2F3Y A;  3RZS A;  1AJ4 A;  2GTE A;  2NCO A;  2P71 A;  4I5K A;  3S0G A;  2LLU A;  1ZAC A;  2PYQ A;  4ORB B;  1SMG A;  4PE1 A;  3EVU A;  3I5G C;  1AVS A;  2M8U A;  2LM5 A;  3CWG A;  1J55 A;  2NZ0 A;  3D74 A;  1EG3 A;  4JPZ B;  1QIW A;  2WC8 A;  3IQO A;  2RGI A;  1SSE B;  3SS3 A;  1K8U A;  2LVV A;  1SL7 A;  1B8R A;  2JTT A;  3LL8 B;  4DUQ A;  1XK4 A;  3K21 A;  1F55 A;  1H8B A;  2AAO A;  3BUO B;  1NCX A;  1KSO A;  1K9K A;  2FJU B;  2FCE A;  5GQQ C;  3BUM B;  2HF5 A;  2F2P A;  1A29 A;  2M1U A;  1RK9 A;  3CAB A;  1S5G Z;  1SL9 A;  2L0P A;  4PE0 A;  3S0A A;  1QVI Y;  1OZS A;  1ZUZ A;  1GGZ A;  1UHJ A;  1S3P A;  4OR9 B;  2JT3 A;  1KK8 B;  2G9B A;  2L4H A;  1DJI A;  1OOH A;  2D8N A;  3CZ1 A;  2EC6 B;  2BCX A;  3QRX A;  1DGU A;  1SCM B;  2GGZ A;  2EHB A;  2MAZ A;  4OKH A;  4PAL A;  3RLZ A;  2Y1M A;  3KPX A;  1PUL A;  2F2O A;  1WDC C;  1XFV O;  2KNE A;  2LP3 A;  3B86 A;  1TNW A;  1ZOT B;  1K94 A;  3VRO A;  5B8I B;  2PQL A;  2ZRT A;  3WNX B;  1A75 A;  2KYC A;  3EKJ A;  3MSE B;  4MBE A;  4HRG A;  3S0F A;  2K8M B;  4YRU A;  3IQQ A;  2WC6 A;  1SK6 D;  1RRO A;  3I5G B;  3CZT X;  4OV2 A;  3CZ2 A;  1UHN A;  1FI5 A;  1CDP A;  1CLM A;  4A4C A;  1YUS A;  3K1E A;  1XFX O;  4ETO A;  2LV7 A;  1ODB A;  1DT7 B;  3FS7 A;  3DD4 A;  5JOL A;  2OPO A;  4MSP A;  1N2D A;  1XO5 A;  5KTY A;  1D1O A;  5FYX A;  3DY9 A;  3JVT C;  1F54 A;  1SR6 C;  3BFB A;  3N7H A;  3QME A;  2BKH B;  3SG2 A;  1IG5 A;  1TOP A;  1UUS A;  2BBN A;  2AMI A;  3I5H C;  3O4X A;  3PN7 C;  1W7J B;  3UO9 A;  1BG1 A;  1MR8 A;  3SG3 A;  3O78 A;  3R1P A;  3H4S E;  1KQM C;  3NSO A;  3OGN A;  2M7L A;  3BFH A;  4GGF A;  5ER4 X;  1MF8 B;  3CS1 A;  4MRX A;  2M0R A;  2JXL A;  5D3O A;  2PMY A;  5I2L A;  1NWD A;  2AUC A;  3DXL A;  1Q80 A;  1AK8 A;  1SL8 A;  3E3R A;  3B88 A;  1CDM A;  1DEL A;  4IL1 A;  2KFF A;  3O4Y A;  3SS4 A;  2BAP A;  5HLV A;  1C7V A;  2JQ6 A;  2O60 A;  1S6C A;  1BOC A;  3CR4 X;  2BEC A;  3B87 A;  1LIN A;  3OP0 A;  1BOD A;  1AHR A;  4YGC B;  4JQ0 D;  5ER5 A;  1WDC B;  1DJX A;  1NPQ A;  1Y6W A;  1DTL A;  2V53 A;  5K89 A;  3CZ0 A;  1FW4 A;  3DVJ A;  2LE9 B;  5EL2 A;  2PSR A;  5DKN A;  1WRK A;  2JTZ A;  3BOW B;  4GPL B;  1G33 A;  3OB2 B;  1QXP A;  2K60 A;  3CYZ A;  3VRR A;  5D7F A;  4CPV A;  2JUL A;  4OZD A;  1DMO A;  1SPY A;  1KCY A;  1L2O C;  3D10 A;  1OMV A;  1XFU O;  3D77 A;  2BBM A;  1N0Y A;  1CM4 A;  1GGW A;  1BR4 B;  3Q8I A;  3OHM B;  4YBH B;  4YGB B;  5I94 A;  1TNQ A;  1TNX A;  2L5Y A;  2M97 A;  3KF9 A;  2ERB A;  2WOS A;  3JVT B;  3D0Y A;  1DF0 A;  1MXE A;  2KGR A;  5J3X A;  4CFQ A;  1BLQ A;  2L2C A;  1SR6 B;  2PAL A;  1TIZ A;  2CT9 A;  1CKK A;  2KQ6 A;  4MRY A;  2H61 A;  3I5H B;  3PN7 B;  1WRL A;  3IVT A;  1CTR A;  4NDC A;  1IRJ A;  4MEW A;  1KQM B;  1IH0 A;  1SCM C;  2WCL A;  4XJK A;  3S0D A;  1U5I B;  4YGD B;  1NP8 A;  2ZN9 A;  1QX2 A;  1N65 A;  1YX7 A;  2QPT A;  3S0E A;  2LLT A;  3D73 A;  3AAK A;  1IJ5 A;  1OMD A;  1A2X A;  2M9G A;  1JBA A;  1DJY A;  1K2H A;  4GUK A;  2KQY A;  1EL4 A;  4ORC B;  1SW8 A;  1NYA A;  1XYD A;  3OBV A;  2LHI A;  5AEQ A;  2WCH A;  3I5F B;  2VRG A;  1EH2 A;  1YTZ C;  3DZT A;  4P2Y B;  1NX1 A;  3PJI A;  2H8V A;  4GBA A;  1CMG A;  3EVR A;  1HT9 A;  4N1F A;  1RFJ A;  1SYM A;  2HPS A;  3EK8 A;  3PAT A;  4YI9 A;  2KSP A;  1TWO A;  1NIW A;  1C3Z A;  2LAN A;  3DF0 B;  4KYN A;  2I18 A;  2LNK A;  1OW4 A;  1OZO A;  1L2O B;  3EKH A;  3PM2 A;  2OS8 C;  2COL B;  3DVM A;  2YGU A;  1S1E A;  3GOF A;  1B8C A;  1F4O A;  5AER A;  1WLZ A;  2L50 A;  1S5G Y;  2JT8 A;  2OTG C;  2WCF A;  4ORA B;  1LA3 A;  1Z4H A;  2CXJ A;  2BCA A;  2MHH A;  3NSL A;  4MN0 A;  2GGM A;  4DIR A;  1YUU A;  4DCK A;  1XK4 C;  1KK7 Z;  2TN4 A;  1YUR A;  2WOR A;  3NHI A;  1BT6 A;  1K9U A;  1NCY A;  3TUY C;  1UHK A;  4F7F A;  3LK1 A;  1UHI A;  2WCJ A;  4NDD A;  4XYN A;  2JPO A;  4R1E A;  1TCF A;  2JPT A;  1REC A;  2K0J A;  2LLS A;  5AFP A;  3AKB A;  2Y4Q A;  2KDH A;  4MLW A;  2JT0 A;  1YVL A;  4NDB A;  3SJS A;  4FQT A;  1F8H A;  1QWV A;  1SY9 A;  1DJG A;  1SNL A;  3SG5 A;  2LC5 A;  4PHM A;  2KI6 D;  4GFT A;  4PHN A;  1QV1 A;  5DIC A;  3CDN A;  3CR2 A;  4YI8 A;  3PLF B;  4ICB A;  5DKQ A;  1EXR A;  1IJ6 A;  3BQ3 A;  1IWQ A;  3DYE A;  1MHO A;  4DS7 A;  2QEV A;  1RJV A;  2KBM A;  4D1E A;  3B7A A;  1OOJ A;  2LUC A;  3VRP A;  2LMV A;  3M0W A;  4GGN A;  1J7O A;  1LXF C;  1IQ5 A;  1SRA A;  1H4B A;  2K7D A;  4AQJ A;  2E6W A;  3BFA A;  5FI6 A;  3VRN A;  4BY5 A;  1KQV A;  1A4P A;  2LVI A;  2QDI A;  4OCI A;  2OS8 B;  1OMR A;  3NHT A;  1EG4 A;  1TTX A;  1AP4 A;  1CLL A;  1OQP A;  1M63 B;  3A8R A;  4C0L A;  5BPJ A;  2Q4U A;  1CFD A;  2OTG B;  2K7B A;  1KFU L;  2ZRS A;  5KSZ A;  2WCB A;  3NSK A;  3O6B A;  5AXI A;  4C0J A;  2H2K A;  2JOJ A;  3SG7 A;  2FOT A;  1S6I A;  2WC5 A;  4JD9 A;  1BF5 A;  2G2B A;  2MJW B;  3F45 A;  2EGD A;  4M2P A;  2MLE C;  3FE6 A;  2PRU A;  1UUR A;  3BXK A;  4M2Q A;  3TUY B;  4YGA A;  1V1G A;  2R2I A;  2K61 A;  1T14 A;  3O2P A;  1S36 A;  1DJH A;  3R1O A;  1QAT A;  3I5F C;  5HYD A;  1KFX L;  2I94 A;  2M29 A;  2LCP A;  3ZNI A;  1AJ5 A;  1Y1U A;  3NSI A;  4GGF C;  1PVB A;  1L7Z A;  4ZCV A;  1FF1 A;  1CB1 A;  1QX7 A;  1NSH A;  3D76 A;  1NX3 A;  2HET A;  4N5X A;  2LP2 A;  2QAC A;  5HLO A;  4I5J A;  2NXQ A;  1RWY A;  4F0Z B;  1CMF A;  1J1E A;  2M49 B;  1TNP A;  5CPV A;  1PK0 D;  3A4U B;  1B8L A;  1BU3 A;  2KFH A;  2CCM A;  2FCD A;  3D75 A;  4P5O E;  3CLN A;  2PVB A;  1A75 B;  1YVH A;  2HQ8 A;  2ZN8 A;  1IQ3 A;  4USL A;  1HQV A;  5FI2 A;  2K7C A;  2QEO A;  1K90 D;  1NUB A;  1DEK A;  4FQO A;  4MZJ A;  2M3W A;  4A4B A;  1JUO A;  1OOF A;  2BNX A;  5TNC A;  1C3Y A;  5HKZ A;  1PRW A;  3WHU B;  2HQW A;  1TN4 A;  4PDZ A;  1YR5 A;  1KFU S;  1MWN A;  1K95 A;  1CM1 A;  1Y0V H;  3BUX B;  5D69 A;  3NXA A;  1GQM A;  2KFG A;  1RTP 1;  1FI6 A;  1B7T Z;  1MQ1 A;  1LS8 A;  5KU1 A;  1DGV A;  4AOM A;  2CNP A;  2MA2 A;  2LMT A;  1J7Q A;  3LCP C;  5CSF A;  1DVI A;  1PSR A;  2F8P A;  2PAS A;  2KI6 C;  3FE9 A;  3HX4 A;  1WY9 A;  2NCP A;  5F6T A;  1Y1A A;  1NX2 A;  3V2L A;  2BE4 A;  1ZFS A;  3BJH A;  3BYA A;  4YGE B;  1KFX S;  3PM8 A;  2KGB C;  1QLK A;  1R6P A;  4I5N B;  1XFW O;  3EG5 B;  1Z2C B;  4HRH A;  2B1U A;  1TUZ A;  2KBI A;  2KAX A;  4WQ2 A;  3SG4 A;  3PAL A;  4WQ3 A;  2KAV A;  2ZFD A;  1MXL C;  5CSN A;  3VRQ A;  1S6J A;  4L9M A;  2M7N A;  3OX6 A;  3VB1 A;  2JNX A;  1YRT B;  1DJW A;  1QTX A;  2Y5I A;  4FTG A;  4U8D A;  1GJY A;  3R1V A;  2JWW A;  3RM1 A;  4UPG A;  2I7A A;  1OE9 B;  3BUN B;  1QJT A;  1QV0 A;  2WCK A;  2JU0 A;  5CSI A;  1MUX A;  2KHN A;  3DVK A;  4Q04 A;  3JTD B;  2IS9 A;  5AAN A;  1Y1X A;  1JF2 A;  3IF7 A;  1KK7 Y;  1KWO C;  1LKJ A;  4NQG A;  1PSB A;  4QJ5 B;  4INX A;  2BL0 C;  3R72 A;  2ZNE A;  1CLB A;  3EVV A;  5I2O A;  2KLE A;  1P28 A;  3L4A A;  1QVI Z;  3HCM A;  3D0Y B;  1DF0 B;  1J1D A;  1XFZ O;  2QEH A;  1TUJ A;  1ORG A;  1JFK A;  2SCP A;  2P70 A;  2BE6 A;  2WCE A;  3SIA A;  1W7I B;  3UNW A;  3B6X A;  3PSR A;  2KAY A;  4M2O A;  4ZCU A;  5PAL A;  2MLF C;  3CR5 X;  1K96 A;  2JC2 A;  3GK4 X;  3BOW A;  2JZI A;  5CSJ A;  4XJK B;  1NX0 A;  2ISD A;  1YUT A;  1XFR A;  1OOI X;  2Q91 A;  4INW A;  5IBW A;  2ZND A;  3CGA A;  3OB1 B;  1C07 A;  1IIO A;  2FJY A;  1M46 A;  2E30 A;  4JKT A;  1OSA A;  2P6B B;  3BUW B;  5JJG A;  2MRD A; 
#chains in the Genus database with same CATH homology
 3TS5 C;  1FBV A;  3C1V A;  2BCB A;  4MVF A;  4CID A;  2CTN A;  4OVN F;  1QIV A;  2WND A;  1J7P A;  3LK0 A;  4JWQ A;  1AUI B;  5G08 A;  1C7W A;  1F4Q A;  1M39 A;  1XVJ A;  2LUX A;  2KYF A;  1QLS A;  3GK2 A;  4I5L B;  1CFF A;  2L2E A;  1TRF A;  3OX5 A;  2LVJ A;  3TZ1 A;  1K93 D;  1BJF A;  2LMU A;  1U5I A;  1M45 A;  2KI4 C;  2LHL A;  1JWD A;  3TDI A;  1VRK A;  2M1K B;  3FWC A;  1KWO B;  4QJ4 B;  2F3Z A;  3TDU A;  5I2Q A;  2L5X B;  3AKA A;  1CFP A;  2BL0 B;  2LAP A;  2LVK A;  2K2F A;  4MZL A;  3WXA A;  2JRF A;  3DVE A;  2SAS A;  3EK7 A;  2K7O A;  1SBJ A;  4GNK B;  3I5I C;  1NCZ A;  4PE7 A;  5HKY A;  1A03 A;  1QX5 B;  3LLE A;  4HSZ A;  1J7R A;  1LVC D;  3KEV A;  1E8A A;  1ALV A;  2JNF A;  1LA0 A;  2KOT A;  4N1G A;  1JFJ A;  2JXC A;  4TNC A;  3GK1 A;  1ZMZ A;  1JC2 A;  3DF0 A;  3WHT B;  2O5G A;  1SKT A;  1K9P A;  2L4I A;  1SCV A;  3EK4 A;  1IKU A;  1UHH A;  1QAS A;  1WRZ A;  2BKI B;  5I8N A;  2DOQ A;  1PAL A;  1QS7 A;  3FWB A;  1XFY O;  1M31 A;  1G8I A;  1TCO B;  3AAJ A;  4PE4 A;  3TDZ A;  3FIA A;  1UP5 A;  1PVA A;  3TS5 B;  3JTD C;  2CBL A;  3SIB A;  1ALW A;  3CTN A;  2NLN A;  3ZWH A;  3ICB A;  1CDL A;  4C0K A;  2A4J A;  1YX8 A;  5DKR A;  1JSA A;  2ZKM X;  1FPW A;  4HRE E;  4CFR A;  3KHE A;  1KSM A;  1X02 A;  4E68 A;  1B47 A;  1DJZ A;  2KI4 B;  2L51 A;  4QJ3 B;  1B9A A;  2L98 A;  2H61 C;  1B7T Y;  1BMO A;  1G4Y R;  1R2U A;  2I2R E;  3PFV A;  1KK8 C;  5HKW A;  3SG6 A;  1IGV A;  4BY4 A;  1CDN A;  4MZK A;  4PHJ A;  4WRI A;  1B1G A;  2EC6 C;  3I5I B;  1CNP A;  1UWO A;  1WLM A;  1F71 A;  1YRU B;  2Y1N A;  4CLN A;  1V1F A;  1XA5 A;  2MBX A;  1BR1 B;  4PHK A;  4GAO A;  4DRW A;  2GV5 A;  4PCW A;  1JF0 A;  2F33 A;  2K2A A;  1F70 A;  4AQI A;  3KO0 A;  1B4C A;  1S26 D;  1CFC A;  3VGO A;  1EJ3 A;  2F3Y A;  1AJ4 A;  2NCO A;  4I5K A;  2LLU A;  1ZAC A;  4ORB B;  1SMG A;  4PE1 A;  3EVU A;  3I5G C;  1AVS A;  2M8U A;  2LM5 A;  3CWG A;  1J55 A;  2NZ0 A;  1EG3 A;  4JPZ B;  1QIW A;  2WC8 A;  3IQO A;  2RGI A;  4DUQ A;  1K8U A;  2LVV A;  1SL7 A;  1B8R A;  2JTT A;  3LL8 B;  1F55 A;  1XK4 A;  3K21 A;  1H8B A;  2AAO A;  3BUO B;  1NCX A;  1KSO A;  1K9K A;  2FJU B;  2FCE A;  5GQQ C;  3BUM B;  2HF5 A;  2F2P A;  1A29 A;  2M1U A;  1RK9 A;  1S5G Z;  1SL9 A;  2L0P A;  4PE0 A;  1QVI Y;  1OZS A;  1ZUZ A;  1GGZ A;  1UHJ A;  1S3P A;  4OR9 B;  2JT3 A;  1KK8 B;  2G9B A;  2L4H A;  1DJI A;  2D8N A;  2EC6 B;  2BCX A;  3QRX A;  1DGU A;  1SCM B;  2GGZ A;  2EHB A;  2MAZ A;  4OKH A;  4PAL A;  3RLZ A;  2Y1M A;  3KPX A;  1PUL A;  2F2O A;  1WDC C;  1XFV O;  2KNE A;  2LP3 A;  1TNW A;  1ZOT B;  1K94 A;  3VRO A;  5B8I B;  2ZRT A;  3WNX B;  1A75 A;  2KYC A;  3EKJ A;  3MSE B;  4MBE A;  4HRG A;  2K8M B;  4YRU A;  3IQQ A;  1SK6 D;  1RRO A;  3I5G B;  3CZT X;  4OV2 A;  1UHN A;  1FI5 A;  1CDP A;  1CLM A;  4A4C A;  1YUS A;  1DT7 B;  1XFX O;  4ETO A;  2LV7 A;  1ODB A;  3FS7 A;  3DD4 A;  5JOL A;  2OPO A;  4MSP A;  1N2D A;  1XO5 A;  5KTY A;  1D1O A;  5FYX A;  3JVT C;  1F54 A;  1SR6 C;  2BKH B;  3SG2 A;  1IG5 A;  1TOP A;  1UUS A;  2BBN A;  2AMI A;  3I5H C;  3PN7 C;  1W7J B;  1BG1 A;  1MR8 A;  3SG3 A;  3O78 A;  3H4S E;  1KQM C;  3NSO A;  2M7L A;  4GGF A;  5ER4 X;  1MF8 B;  3CS1 A;  4MRX A;  2M0R A;  2JXL A;  5I2L A;  2PMY A;  1NWD A;  2AUC A;  1Q80 A;  1AK8 A;  1SL8 A;  3E3R A;  4IL1 A;  1CDM A;  2KFF A;  3O4Y A;  5HLV A;  1C7V A;  2JQ6 A;  2O60 A;  1S6C A;  1BOC A;  3CR4 X;  2BEC A;  1LIN A;  3OP0 A;  1BOD A;  1AHR A;  4YGC B;  4JQ0 D;  5ER5 A;  1WDC B;  1DJX A;  1NPQ A;  1Y6W A;  1DTL A;  2V53 A;  5K89 A;  1FW4 A;  3DVJ A;  2LE9 B;  2PSR A;  5DKN A;  1WRK A;  2JTZ A;  3BOW B;  4GPL B;  1G33 A;  3OB2 B;  1QXP A;  3VRR A;  5D7F A;  4CPV A;  2JUL A;  1DMO A;  1SPY A;  1KCY A;  1L2O C;  3D10 A;  1OMV A;  1XFU O;  2BBM A;  1N0Y A;  1CM4 A;  1GGW A;  1BR4 B;  3OHM B;  4YBH B;  4YGB B;  1TNQ A;  1TNX A;  2M97 A;  3KF9 A;  2WOS A;  3JVT B;  3D0Y A;  1DF0 A;  1MXE A;  2KGR A;  5J3X A;  4CFQ A;  1BLQ A;  1SR6 B;  2PAL A;  1TIZ A;  2CT9 A;  1CKK A;  2KQ6 A;  4MRY A;  2H61 A;  3I5H B;  3PN7 B;  1WRL A;  1CTR A;  4NDC A;  1IRJ A;  4MEW A;  1KQM B;  1IH0 A;  1SCM C;  4XJK A;  1U5I B;  4YGD B;  1NP8 A;  2ZN9 A;  1QX2 A;  1N65 A;  1YX7 A;  2QPT A;  2LLT A;  3AAK A;  1IJ5 A;  1OMD A;  1A2X A;  2M9G A;  1JBA A;  1DJY A;  1K2H A;  4GUK A;  2KQY A;  1EL4 A;  4ORC B;  1SW8 A;  1NYA A;  1XYD A;  5AEQ A;  2LHI A;  3I5F B;  2VRG A;  1EH2 A;  1YTZ C;  4P2Y B;  1NX1 A;  4GBA A;  1CMG A;  3EVR A;  1HT9 A;  4N1F A;  1RFJ A;  1SYM A;  2HPS A;  3EK8 A;  3PAT A;  4YI9 A;  2KSP A;  1NIW A;  2LAN A;  3DF0 B;  2I18 A;  2LNK A;  3EKH A;  1OZO A;  1L2O B;  2OS8 C;  2COL B;  3DVM A;  1S1E A;  3GOF A;  1B8C A;  1F4O A;  5AER A;  1WLZ A;  2L50 A;  1S5G Y;  2JT8 A;  2OTG C;  2WCF A;  4ORA B;  1LA3 A;  2CXJ A;  2MHH A;  2BCA A;  3NSL A;  4MN0 A;  4DIR A;  2GGM A;  1YUU A;  4DCK A;  1XK4 C;  1KK7 Z;  2TN4 A;  1YUR A;  2WOR A;  3TUY C;  1BT6 A;  1K9U A;  1NCY A;  1UHK A;  3LK1 A;  1UHI A;  4NDD A;  4XYN A;  4R1E A;  1TCF A;  2JPT A;  1REC A;  2K0J A;  2LLS A;  5AFP A;  3AKB A;  2Y4Q A;  2KDH A;  4MLW A;  2JT0 A;  1YVL A;  4NDB A;  3SJS A;  1F8H A;  1SY9 A;  1DJG A;  1SNL A;  3SG5 A;  2LC5 A;  4PHM A;  2KI6 D;  4GFT A;  4PHN A;  1QV1 A;  3CR2 A;  4YI8 A;  3PLF B;  4ICB A;  5DKQ A;  1EXR A;  1IJ6 A;  3BQ3 A;  1IWQ A;  4DS7 A;  1MHO A;  1RJV A;  2KBM A;  4D1E A;  1OOJ A;  2LUC A;  3VRP A;  2LMV A;  3M0W A;  4GGN A;  1J7O A;  1LXF C;  1IQ5 A;  1SRA A;  1H4B A;  2K7D A;  4AQJ A;  2E6W A;  3VRN A;  4BY5 A;  1KQV A;  1A4P A;  2LVI A;  4OCI A;  2OS8 B;  1OMR A;  1EG4 A;  1TTX A;  1AP4 A;  1CLL A;  1OQP A;  1M63 B;  3A8R A;  4C0L A;  5BPJ A;  2Q4U A;  1CFD A;  2OTG B;  2K7B A;  1KFU L;  2ZRS A;  5KSZ A;  2WCB A;  3NSK A;  3O6B A;  5AXI A;  4C0J A;  2H2K A;  2JOJ A;  3SG7 A;  2FOT A;  1S6I A;  1BF5 A;  2G2B A;  2MJW B;  3F45 A;  2EGD A;  4M2P A;  2MLE C;  2PRU A;  1UUR A;  3BXK A;  4M2Q A;  3TUY B;  4YGA A;  1V1G A;  2R2I A;  2K61 A;  3O2P A;  1S36 A;  1DJH A;  1QAT A;  3I5F C;  5HYD A;  1KFX L;  2I94 A;  2M29 A;  2LCP A;  3ZNI A;  1AJ5 A;  1Y1U A;  3NSI A;  4GGF C;  1PVB A;  1L7Z A;  4ZCV A;  1FF1 A;  1CB1 A;  1QX7 A;  1NSH A;  1NX3 A;  2HET A;  4N5X A;  2LP2 A;  2QAC A;  5HLO A;  4I5J A;  2NXQ A;  1RWY A;  4F0Z B;  1CMF A;  1J1E A;  2M49 B;  1TNP A;  5CPV A;  1PK0 D;  3A4U B;  1B8L A;  1BU3 A;  2KFH A;  2CCM A;  2FCD A;  4P5O E;  3CLN A;  2PVB A;  1A75 B;  1YVH A;  2HQ8 A;  2ZN8 A;  1IQ3 A;  4USL A;  1HQV A;  2K7C A;  1K90 D;  1NUB A;  4FQO A;  4MZJ A;  2M3W A;  4A4B A;  1JUO A;  5TNC A;  5HKZ A;  1PRW A;  3WHU B;  2HQW A;  1TN4 A;  4PDZ A;  1YR5 A;  1KFU S;  1MWN A;  1K95 A;  1CM1 A;  1Y0V H;  3BUX B;  5D69 A;  3NXA A;  1GQM A;  2KFG A;  1RTP 1;  1FI6 A;  1B7T Z;  1MQ1 A;  5KU1 A;  1DGV A;  4AOM A;  2CNP A;  2MA2 A;  2LMT A;  1J7Q A;  3LCP C;  5CSF A;  1DVI A;  1PSR A;  2F8P A;  2PAS A;  2KI6 C;  3HX4 A;  1WY9 A;  2NCP A;  5F6T A;  1Y1A A;  1NX2 A;  2BE4 A;  1ZFS A;  3BYA A;  4YGE B;  1KFX S;  3PM8 A;  2KGB C;  1QLK A;  1R6P A;  4I5N B;  1XFW O;  4HRH A;  4WQ2 A;  2B1U A;  2KBI A;  2KAX A;  3SG4 A;  3PAL A;  4WQ3 A;  2KAV A;  2ZFD A;  1MXL C;  5CSN A;  3VRQ A;  1S6J A;  4L9M A;  2M7N A;  3OX6 A;  2JNX A;  1YRT B;  1DJW A;  1QTX A;  2Y5I A;  4FTG A;  4U8D A;  1GJY A;  3RM1 A;  2JWW A;  4UPG A;  2I7A A;  1OE9 B;  3BUN B;  1QJT A;  1QV0 A;  2JU0 A;  5CSI A;  1MUX A;  2KHN A;  3DVK A;  4Q04 A;  3JTD B;  2IS9 A;  5AAN A;  1Y1X A;  1JF2 A;  3IF7 A;  1KK7 Y;  1KWO C;  1LKJ A;  4NQG A;  1PSB A;  4QJ5 B;  2BL0 C;  2ZNE A;  1CLB A;  3EVV A;  5I2O A;  1QVI Z;  3HCM A;  3D0Y B;  1DF0 B;  1J1D A;  1XFZ O;  1JFK A;  2SCP A;  2WCE A;  2BE6 A;  3SIA A;  1W7I B;  3PSR A;  2KAY A;  4M2O A;  4ZCU A;  5PAL A;  2MLF C;  3CR5 X;  1K96 A;  2JC2 A;  3GK4 X;  3BOW A;  2JZI A;  5CSJ A;  4XJK B;  1NX0 A;  2ISD A;  1YUT A;  2Q91 A;  5IBW A;  2ZND A;  3CGA A;  3OB1 B;  1C07 A;  1M46 A;  2E30 A;  1OSA A;  2P6B B;  3BUW B;  5JJG A;  2MRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...