2WORA

Co-structure of s100a7 with 1,8 ans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A7
publication title Identification and Characterization of Binding Sites on S100A7, a Participant in Cancer and Inflammation Pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 36
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2worA00
1R2UA 1F71A 1G33A 5CSNA 2EC6B 1ODBA 1F70A 2LHLA 4JWQA 1SPYA 2OS8C 4YBHB 1B4CA 4N1FA 2KFGA 1J7QA 4UPGA 1UUSA 4DRWA 2LHIA 3NXAA 2KAVA 1KK7Y 4P5OE 2HQWA 4CLNA 4DIRA 1CFDA 2JQ6A 1WRKA 3JVTC 4JPZB 1SR6B 1AUIB 3K21A 1UHHA 1C07A 1XFZO 5PALA 3RLZA 1CM1A 4NDCA 1JF0A 4QJ3B 1VRKA 3FWBA 2LLTA 1UURA 4GGNA 1NCXA 3D0YB 4OCIA 1YUUA 2FOTA 2CTNA 5AEQA 1QIWA 2ZN9A 3EVUA 3HX4A 3CZTX 1H4BA 2M29A 2MJWB 3AKBA 3BYAA 1KWOB 3I5IC 1KSOA 4OV2A 3TDUA 1BT6A 5AERA 3TUYC 1V1GA 1BU3A 2JNXA 1K93D 1DGVA 1KFUS 1XFWO 2MLEC 1XYDA 3FIAA 2LANA 1Y1AA 3EK4A 2NZ0A 3PLFB 1W7IB 1QS7A 2NLNA 2JT0A 3QRXA 1JC2A 1ALWA 2R2IA 1SRAA 2COLB 3SG2A 2KAYA 3JTDB 4L9MA 4A4CA 1V1FA 2ZRSA 3BOWA 4YGBB 2ISDA 3CR2A 1CM4A 2KI6C 1CLLA 1KK7Z 2JU0A 3TZ1A 2PALA 3VRPA 4MZKA 3SJSA 4AOMA 1YUSA 1PSRA 2L50A 1OZOA 1S6IA 2LUCA 2LCPA 4R1EA 1K2HA 1G4YR 4U8DA 1DJGA 4OVNF 1CNPA 1MR8A 1OMVA 1NX1A 1QVIY 1J7OA 3IQOA 3I5HB 3VROA 1SL8A 3LL8B 1S1EA 4QJ4B 1AJ5A 1DF0A 2BCAA 1RTP1 1TCFA 3F45A 2CBLA 3A4UB 2ZNDA 1RECA 4M2OA 1A03A 5FYXA 3TDIA 1TN4A 1D1OA 2CCMA 3HCMA 1WRLA 3EK8A 5J3XA 3EVRA 2M97A 1YX7A 2ZRTA 1PVBA 1CB1A 1FI6A 3WHUB 2KYFA 2LM5A 4P2YB 1GJYA 1S6JA 4ICBA 4YGCB 1XVJA 3WNXB 4D1EA 1RWYA 2JT3A 3CLNA 1ZFSA 1B7TZ 1K96A 1RJVA 4HSZA 1J7RA 1DGUA 2VRGA 5DKQA 1BR4B 2LVJA 2A4JA 5AXIA 2LUXA 1IKUA 1ZMZA 2V53A 1MXLC 1DJIA 4FQOA 2M7LA 1J7PA 2ZFDA 2KYCA 2KHNA 3A8RA 1IRJA 3BUWB 2M3WA 1F8HA 2JZIA 2JXLA 2KNEA 5D69A 2L5XB 1F55A 2JTZA 1KK8C 2H2KA 2NCOA 4GPLB 1FF1A 4HREE 3I5FB 4I5KA 1AP4A 4AQJA 1QVIZ 1DTLA 2OTGC 1S6CA 4CPVA 2JWWA 2LMVA 1NX3A 1GGWA 2K8MB 2LE9B 2RGIA 3CGAA 3GK4X 3TS5C 3PATA 4C0JA 3BUMB 4Q04A 1MWNA 2Y5IA 2E30A 3BUOB 1XFUO 1EH2A 1UHIA 3H4SE 5G08A 2JPTA 1TIZA 1NIWA 2ZNEA 4I5JA 1SYMA 1TTXA 1BG1A 1FPWA 1QX5B 3BOWB 1EG3A 4I5NB 3BUXB 4PCWA 5KTYA 2JRFA 1SCMC 2LLSA 2NCPA 3GK2A 1SKTA 2LVKA 4QJ5B 3E3RA 1K9UA 1UHJA 2H61C 4TNCA 1M45A 1KFUL 1SL9A 1DJXA 1MXEA 2M7NA 3SG4A 2L98A 2K7CA 2Y4QA 1K9KA 3DVEA 4GBAA 1PK0D 1JF2A 2LP3A 1XA5A 5AFPA 4PHMA 3KEVA 4MN0A 2H61A 3EK7A 3VRNA 1A75A 1UHNA 1BF5A 2MRDA 3KO0A 2WORA 2HQ8A 3CR5X 1K8UA 1IJ6A 1DF0B 3AAKA 3NSOA 1F54A 4OR9B 2KFFA 2BCXA 4ETOA 1OZSA 1QV1A 1ZACA 4HRGA 5DKNA 1C7WA 2LMUA 1NCZA 2LNKA 1DVIA 1KQMB 1YX8A 3EKJA 1DJYA 1S36A 2SASA 1KFXS 2JULA 2I18A 1K9PA 4ORBB 5F6TA 2BL0C 1OMRA 1F4OA 3I5GC 1ZOTB 1H8BA 1NPQA 2PMYA 5HYDA 2I94A 5CSJA 3KF9A 1B9AA 1A2XA 2M1KB 2F3YA 4C0LA 1YVLA 1CLMA 2BCBA 1IGVA 1QIVA 4YGDB 1B7TY 1BLQA 4JQ0D 5KU1A 1FW4A 2KQ6A 2G9BA 3PN7C 1B47A 2KOTA 2GGZA 2JT8A 2FCDA 3DF0A 2ZN8A 1E8AA 1OOJA 3NSKA 5DKRA 4MLWA 1OQPA 4C0KA 2Y1NA 1OSAA 4N1GA 1S5GY 3CWGA 4GUKA 3BXKA 3NSLA 2MA2A 4PHNA 2GV5A 1YR5A 2NXQA 1K94A 2BBNA 2G2BA 3EKHA 1M46A 2WCFA 1DJZA 1U5IA 1GQMA 2F2OA 1M31A 1B8CA 1NSHA 2K2FA 2OTGB 4PHKA 5K89A 2CT9A 1QJTA 1XFYO 2WOSA 4PALA 5HKWA 4PE4A 4PE0A 4BY5A 1SY9A 3DVJA 1X02A 4CFRA 2KSPA 4ORAB 1LA3A 2CXJA 1AVSA 2PRUA 2L0PA 2F3ZA 1M39A 1WY9A 5HKYA 4AQIA 1LKJA 2FCEA 2LAPA 4NDDA 1A4PA 4ZCVA 1WLZA 5I8NA 1EJ3A 2L51A 2K61A 4CIDA 1Y1XA 1LVCD 1QLKA 1A75B 1DMOA 1CDNA 3CTNA 2PASA 1HQVA 3KPXA 1DJWA 4WQ2A 5ER4X 5HLVA 2JTTA 1B1GA 3O2PA 2OS8B 3BUNB 2LP2A 1YVHA 2QPTA 2LV7A 5B8IB 1LA0A 2TN4A 2GGMA 1IWQA 3OX6A 3CR4X 3O78A 1TCOB 1BODA 1S5GZ 1Y1UA 2M49B 3JVTB 2KI4C 5JOLA 4BY4A 1KQVA 1OE9B 1EL4A 2P6BB 3O4YA 2K7DA 1UHKA 1N2DA 1R6PA 2B1UA 1A29A 3SIAA 2ZKMX 1MF8B 5HLOA 1IH0A 3PFVA 2AAOA 1NCYA 1JFJA 2K0JA 4MVFA 1NUBA 1RK9A 4YGAA 3SG6A 1CDPA 1NP8A 1XFVO 5IBWA 3C1VA 4GFTA 3PM8A 2HETA 4E68A 1LINA 1JSAA 5CSIA 1CDLA 3LLEA 2AMIA 1KFXL 3I5IB 1CKKA 4XYNA 3TUYB 2BE6A 2LVIA 2PVBA 1J55A 1JBAA 4OKHA 1UP5A 1WDCC 2KI6D 2Q4UA 3AAJA 1CFCA 3I5HC 1YTZC 3DF0B 5I2LA 1NX0A 3LCPC 5I2QA 1N0YA 5CSFA 2BECA 1FBVA 1QXPA 2L4IA 1TNXA 3D10A 3GK1A 3BQ3A 2OPOA 1CTRA 1F4QA 1L2OC 2EHBA 4MSPA 3PN7B 2KAXA 1U5IB 2BE4A 3OB1B 1SL7A 3DVKA 2M0RA 3LK1A 4I5LB 1DJHA 1NWDA 2F8PA 1K95A 3GOFA 1QTXA 1BMOA 3SIBA 4XJKA 1DT7B 1BOCA 4GAOA 2K2AA 1TOPA 1YRUB 3SG3A 2JNFA 1ZUZA 4HRHA 1BJFA 2JC2A 2JXCA 4NQGA 1CLBA 2KBIA 2MAZA 2K7BA 4YGEB 1FI5A 3KHEA 4PHJA 4YRUA 1CMGA 3I5FC 2Y1MA 1TNQA 1SNLA 1SW8A 3FS7A 2F33A 1OMDA 4CFQA 3LK0A 5HKZA 3MSEB 1WLMA 1B8RA 1MHOA 2HF5A 5KSZA 1TNWA 4USLA 2WCEA 2LVVA 5I2OA 4F0ZB 4M2QA 1PRWA 3OB2B 3PSRA 4PE1A 1RROA 4MRXA 3M0WA 1SBJA 2KFHA 1PALA 2QACA 4YI8A 5D7FA 1MUXA 1SK6D 1QATA 3VGOA 1CDMA 1B8LA 4DS7A 1KK8B 2KI4B 3AKAA 2DOQA 1XFXO 3VRRA 2BKIB 3WXAA 3TDZA 2L2EA 2EC6C 3OP0A 1PVAA 1JWDA 5ER5A 4PE7A 2KDHA 4MZLA 1L7ZA 2M9GA 2WC8A 2SCPA 1SMGA 5CPVA 1YUTA 3TS5B 5JJGA 1CMFA 1SCVA 1IG5A 1IJ5A 1XK4C 2HPSA 2MBXA 2LMTA 2Q91A 1J1EA 1SR6C 1NX2A 4PDZA 1Y0VH 1PSBA 1NYAA 1TNPA 1SCMB 1WDCB 1GGZA 3IF7A 1KQMC 3WHTB 1XK4A 4MRYA 1AJ4A 2M1UA 4IL1A 4MEWA 4WRIA 1UWOA 3ICBA 5TNCA 1QLSA 2O60A 2WNDA 1L2OB 5AANA 2WCBA 3NSIA 4MZJA 1EXRA 1TRFA 4ORCB 1KWOC 1S3PA 1XO5A 2CNPA 1S26D 4XJKB 4GNKB 1CFFA 4FTGA 3D0YA 1QX2A 2I2RE 1QV0A 1RFJA 4GGFC 1W7JB 1KSMA 2M8UA 3SG7A 1LXFC 1WRZA 4ZCUA 1IQ3A 2O5GA 2I7AA 2JOJA 3JTDC 1CFPA 4WQ3A 3SG5A 2LLUA 2BKHB 2KGBC 4A4BA 1Q80A 1QX7A 1HT9A 1JUOA 1G8IA 4GGFA 1N65A 1K90D 3DD4A 2E6WA 2BL0B 1C7VA 1M63B 3I5GB 1AHRA 3CS1A 1IQ5A 3OX5A 4NDBA 4YI9A 3ZNIA 1QASA 5GQQC 2MLFC 3FWCA 1YRTB 2BBMA 2F2PA 4N5XA 1KCYA 1ALVA 3PALA 2K7OA 3DVMA 3IQQA 2PSRA 1PULA 1YURA 4DCKA 3O6BA 2KGRA 1AK8A 4M2PA 3RM1A 3ZWHA 1JFKA 1MQ1A 2LC5A 4DUQA 2D8NA 1Y6WA 3VRQA 2L4HA 2EGDA 2KQYA 2KBMA 1EG4A 3EVVA 2MHHA 1BR1B 3OHMB 2FJUB 2IS9A 5BPJA 1J1DA 2AUCA 4MBEA
chains in the Genus database with same CATH superfamily
1R2UA 1F71A 1G33A 5CSNA 5EL2A 3NGVA 2EC6B 1ODBA 1F70A 2LHLA 4JWQA 1SPYA 2OS8C 4YBHB 1B4CA 4N1FA 2KFGA 1J7QA 4UPGA 1UUSA 4DRWA 2LHIA 3NXAA 2KAVA 1KK7Y 3L4LA 2HQWA 4P5OE 4CLNA 4DIRA 1CFDA 2JQ6A 1WRKA 3JVTC 4JPZB 1SR6B 1AUIB 3K21A 1UHHA 3R1VA 1C07A 1XFZO 5PALA 3RLZA 1QWVA 1CM1A 4NDCA 1JF0A 4QJ3B 1VRKA 3FWBA 2LLTA 1UURA 4GGNA 1NCXA 3D0YB 3B86A 4OCIA 1YUUA 2FOTA 2CTNA 5AEQA 1QIWA 2ZN9A 3EVUA 3HX4A 2WCKA 3Q8IA 3S0FA 3CZTX 1H4BA 2M29A 2MJWB 3AKBA 3BYAA 1KWOB 3I5IC 1KSOA 2QEOA 4OV2A 1BT6A 3TDUA 3TUYC 1V1GA 1BU3A 2JNXA 1K93D 1DGVA 1KFUS 1XFWO 2MLEC 1XYDA 3FIAA 2LANA 1Y1AA 3EK4A 2NZ0A 3PLFB 1W7IB 1QS7A 2NLNA 2JT0A 2P70A 3QRXA 1JC2A 1ALWA 2R2IA 1SRAA 2COLB 3SG2A 2KAYA 3JTDB 2FJYA 4L9MA 4A4CA 1V1FA 2ZRSA 3BOWA 4YGBB 1C3ZA 2ISDA 3CR2A 3EG5B 1CM4A 2KI6C 1CLLA 1KK7Z 2JU0A 2QEBA 3TZ1A 2PALA 3VRPA 4MZKA 3SJSA 4AOMA 1YUSA 1PSRA 2L50A 1OOGA 1OZOA 1S6IA 1TUZA 2LUCA 2LCPA 4R1EA 5DICA 1K2HA 1G4YR 4U8DA 1DJGA 4OVNF 1CNPA 1MR8A 5AERA 1OMVA 1NX1A 1QVIY 1J7OA 3IQOA 3I5HB 3VROA 1SL8A 3LL8B 1S1EA 4QJ4B 4IJ7A 1AJ5A 1DF0A 2K60A 2BCAA 3CZ2A 1RTP1 1TCFA 3F45A 2CBLA 3A4UB 2ZNDA 1RECA 4M2OA 1A03A 5FYXA 3TDIA 1TN4A 1D1OA 2CCMA 3HCMA 1WRLA 3EK8A 5J3XA 3PM2A 3EVRA 2M97A 1YX7A 2ZRTA 1PVBA 1CB1A 1FI6A 3WHUB 2KYFA 2LM5A 4P2YB 1GJYA 1S6JA 2WCMA 4ICBA 1XVJA 3CDNA 1TUJA 4YGCB 3WNXB 4D1EA 1RWYA 2JT3A 3CLNA 4ETOA 1ZFSA 1B7TZ 1K96A 1RJVA 3B6XA 1J7RA 4HSZA 1IIOA 1DGUA 2VRGA 5DKQA 1BR4B 2LVJA 2A4JA 5AXIA 2LUXA 1IKUA 1ZMZA 2V53A 1DEKA 1MXLC 1DJIA 4FQOA 2M7LA 1J7PA 3BJHA 2ZFDA 2KYCA 2KHNA 3A8RA 1IRJA 3BUWB 2M3WA 1F8HA 2JZIA 3CZ0A 2JXLA 2KNEA 5D69A 2L5XB 1F55A 2JTZA 2WC5A 1KK8C 2H2KA 2NCOA 4GPLB 1FF1A 4HREE 1W9ZA 3I5FB 3OGNA 4I5KA 1AP4A 4AQJA 3O4XA 1QVIZ 1DTLA 3R1OA 2OTGC 3B87A 3PJIA 1S6CA 4CPVA 2JWWA 2LMVA 1NX3A 1GGWA 2K8MB 2LE9B 2RGIA 3CYZA 3CGAA 3GK4X 3TS5C 3PATA 4C0JA 3BUMB 3CZ1A 1MWNA 2GTEA 2Y5IA 4Q04A 2E30A 3BUOB 1XFUO 1EH2A 1UHIA 3H4SE 5G08A 2JPTA 2KLDA 1TIZA 1NIWA 2ZNEA 3K1EA 4I5JA 1ORGA 1SYMA 1TTXA 1BG1A 1FPWA 1QX5B 3BOWB 1EG3A 4I5NB 3D73A 3BUXB 4PCWA 5KTYA 2JRFA 1SCMC 2LLSA 2NCPA 3GK2A 1SKTA 2LVKA 4QJ5B 3E3RA 1K9UA 1UHJA 2H61C 4TNCA 1M45A 1KFUL 1OOIX 1DJXA 1MXEA 1SL9A 2M7NA 3SG4A 2L98A 2K7CA 2Y4QA 1K9KA 3DVEA 4GBAA 1PK0D 3D74A 1JF2A 2LP3A 1XA5A 5AFPA 4PHMA 3KEVA 4MN0A 2H61A 3EK7A 3VRNA 1A75A 1UHNA 1BF5A 2MRDA 1XFRA 3D77A 2WORA 2HQ8A 3KO0A 3CR5X 1K8UA 1IJ6A 1DF0B 3AAKA 3NSOA 1F54A 4OR9B 2KFFA 2BCXA 3D75A 1OZSA 1QV1A 1TWOA 1ZACA 4HRGA 1C7WA 5DKNA 2QEVA 2LMUA 1NCZA 2LNKA 1DVIA 1KQMB 1YX8A 3EKJA 1DJYA 1S36A 2SASA 1KFXS 3SS3A 2JULA 2I18A 1K9PA 4ORBB 3DY9A 5F6TA 2BL0C 1OMRA 1F4OA 2KLEA 3I5GC 1ZOTB 1H8BA 1NPQA 2PMYA 5HYDA 2I94A 5CSJA 3KF9A 1B9AA 1A2XA 2M1KB 2F3YA 4C0LA 1YVLA 1CLMA 1IGVA 1QIVA 2BCBA 4YGDB 1B7TY 1BLQA 4JQ0D 5KU1A 1FW4A 1LS8A 2KQ6A 3FE6A 4JD9A 2G9BA 3PN7C 1B47A 2KOTA 2GGZA 2JT8A 2FCDA 3DZTA 3DF0A 2ZN8A 1E8AA 1OOJA 3CABA 3NSKA 4MLWA 1OQPA 5DKRA 2Y1NA 3VB1A 3B88A 4C0KA 1OSAA 4N1GA 1S5GY 3CWGA 4GUKA 3BXKA 3NSLA 2MA2A 4PHNA 2GV5A 1YR5A 2NXQA 1K94A 2BBNA 2G2BA 5FI7A 3EKHA 1M46A 2WCFA 1DJZA 1U5IA 1GQMA 2F2OA 3NHTA 1M31A 1B8CA 1NSHA 2K2FA 2OTGB 3D78A 4PHKA 3UNWA 5K89A 2CT9A 1QJTA 1XFYO 2WOSA 4PALA 5HKWA 4PE4A 4PE0A 4BY5A 5HL1A 1SY9A 3DVJA 1X02A 3B7AA 2KSPA 2KPHA 2WC6A 4ORAB 4CFRA 1LA3A 2CXJA 1AVSA 2PRUA 2L0PA 3S0GA 1GM0A 2F3ZA 1M39A 1WY9A 2PQLA 5HKYA 4AQIA 1LKJA 2FCEA 2LAPA 4JKTA 1A4PA 4NDDA 1WLZA 4ZCVA 5I8NA 1EJ3A 2L51A 2K61A 4PT1A 1Y1XA 4CIDA 1LVCD 1QLKA 1A75B 1DMOA 1CDNA 3CTNA 2PASA 1HQVA 3KPXA 1DJWA 4WQ2A 5ER4X 5HLVA 2JTTA 1B1GA 3O2PA 2OS8B 3BUNB 2LP2A 1YVHA 2QPTA 2LV7A 3S0DA 1LA0A 5B8IB 2TN4A 2GGMA 1IWQA 3OX6A 3CR4X 2WCLA 1OOFA 3O78A 1TCOB 1BODA 1S5GZ 1Y1UA 2M49B 3JVTB 2KI4C 5JOLA 4BY4A 1KQVA 1OE9B 1T14A 1EL4A 2P6BB 3O4YA 2K7DA 1UHKA 1N2DA 1DQEA 1R6PA 1A29A 2B1UA 3SIAA 2ZKMX 1MF8B 2QDIA 5HLOA 1IH0A 3PFVA 2AAOA 3BFBA 1NCYA 3R1PA 3RZSA 1JFJA 2K0JA 4MVFA 1NUBA 1RK9A 4YGAA 3SG6A 1CDPA 1NP8A 1XFVO 5IBWA 3C1VA 4GFTA 5I94A 3PM8A 2HETA 4E68A 1LINA 1JSAA 5CSIA 1CDLA 3LLEA 2AMIA 1KFXL 3I5IB 1CKKA 2L2CA 4XYNA 3TUYB 2BE6A 2LVIA 2PVBA 1J55A 1JBAA 4OKHA 1UP5A 1WDCC 2KI6D 2Q4UA 3AAJA 1CFCA 1DC1A 3I5HC 1YTZC 3DF0B 5I2LA 3FE9A 1NX0A 3LCPC 5I2QA 1N0YA 5CSFA 2BECA 1FBVA 1QXPA 2L4IA 1TNXA 3D10A 3GK1A 3BQ3A 2OPOA 1CTRA 1OOHA 1F4QA 1L2OC 4FQTA 2EHBA 4MSPA 3PN7B 2KAXA 1U5IB 2BE4A 3OB1B 4INWA 1SSEB 1SL7A 3DVKA 2M0RA 3LK1A 4I5LB 1DJHA 1NWDA 2F8PA 1K95A 1DELA 3GOFA 1QTXA 3R72A 3OBVA 1BMOA 3SIBA 4XJKA 2L5YA 1DT7B 1BOCA 4GAOA 2K2AA 1TOPA 4INXA 2YGUA 3N7HA 1YRUB 3SG3A 2JNFA 1ZUZA 4HRHA 1BJFA 2JC2A 2JXCA 4NQGA 1CLBA 2KBIA 2MAZA 2K7BA 3L47A 4YGEB 1FI5A 3KHEA 4PHJA 4YRUA 1CMGA 3FE8A 3I5FC 2Y1MA 1TNQA 1SNLA 1SW8A 3FS7A 2F33A 1OMDA 4CFQA 3LK0A 2ERBA 5HKZA 3MSEB 1WLMA 3DXLA 1B8RA 1MHOA 2HF5A 5KSZA 1TNWA 4USLA 2WCEA 2LVVA 2QEHA 5I2OA 4F0ZB 4M2QA 1PRWA 3OB2B 3PSRA 3BFHA 4PE1A 1RROA 4MRXA 3M0WA 1SBJA 2KFHA 1PALA 3L4AA 2QACA 4YI8A 5D7FA 3NHIA 3IVTA 1MUXA 1SK6D 1QATA 3VGOA 2JPOA 1CDMA 3S0BA 1B8LA 3S0EA 4DS7A 1KK8B 2KI4B 3AKAA 3D76A 2DOQA 2P71A 1XFXO 3VRRA 2BKIB 3WXAA 3TDZA 2L2EA 2EC6C 3OP0A 1PVAA 1JWDA 5ER5A 4PE7A 2KDHA 4MZLA 1L7ZA 2M9GA 2WC8A 2BAPA 2SCPA 1SMGA 5CPVA 1YUTA 3TS5B 5JJGA 1CMFA 1SCVA 1IG5A 1IJ5A 1XK4C 2HPSA 2MBXA 2LMTA 2Q91A 1J1EA 1SR6C 3BFAA 2BNXA 1NX2A 4PDZA 1Y0VH 1P28A 2H8VA 3DYEA 4OZDA 1PSBA 1NYAA 1TNPA 1SCMB 1WDCB 1GGZA 3IF7A 1KQMC 3WHTB 1XK4A 4MRYA 1AJ4A 2M1UA 4IL1A 4MEWA 4WRIA 4F7FA 1UWOA 3ICBA 5TNCA 1QLSA 2O60A 2WNDA 1L2OB 5AANA 2WCBA 3NSIA 4MZJA 1EXRA 1TRFA 4ORCB 1KWOC 1S3PA 1XO5A 2CNPA 1S26D 5FI6A 4XJKB 4GNKB 1CFFA 4FTGA 3D0YA 1QX2A 3SS5A 2I2RE 1QV0A 1RFJA 4GGFC 1W7JB 1Z2CB 1KSMA 2M8UA 3UO9A 3SG7A 1LXFC 1WRZA 4ZCUA 1IQ3A 2O5GA 2I7AA 2JOJA 3JTDC 1CFPA 4WQ3A 3SG5A 3S0AA 2LLUA 2BKHB 2KGBC 5D3OA 4A4BA 1Q80A 1QX7A 3SS4A 1HT9A 1JUOA 1G8IA 4GGFA 1N65A 1K90D 3DD4A 1OW4A 2E6WA 2BL0B 1C7VA 1M63B 3I5GB 1AHRA 3CS1A 1IQ5A 3OX5A 4NDBA 4YI9A 3ZNIA 1QASA 5GQQC 2MLFC 3FWCA 1YRTB 5FI2A 3V2LA 2BBMA 2F2PA 4N5XA 1KCYA 1ALVA 3PALA 2K7OA 2WCHA 3DVMA 3IQQA 2PSRA 1PULA 1YURA 4KYNA 4DCKA 3O6BA 2KGRA 1AK8A 4M2PA 3RM1A 3ZWHA 1JFKA 1MQ1A 3QMEA 2LC5A 4DUQA 2D8NA 1Y6WA 3VRQA 2L4HA 1C3YA 2EGDA 2KQYA 2KBMA 2WCJA 2PYQA 1EG4A 3EVVA 2MHHA 1Z4HA 1BR1B 3OHMB 2FJUB 2IS9A 5BPJA 1J1DA 2AUCA 4MBEA
chains in the Genus database with same CATH topology
1R2UA 1F71A 1G33A 5CSNA 2EC6B 1ODBA 1F70A 2LHLA 4JWQA 1SPYA 2OS8C 4YBHB 1B4CA 4N1FA 2KFGA 1J7QA 4UPGA 1UUSA 4DRWA 2LHIA 3NXAA 2KAVA 1KK7Y 4P5OE 2HQWA 4CLNA 4DIRA 1CFDA 2JQ6A 1WRKA 3JVTC 4JPZB 1SR6B 1AUIB 3K21A 1UHHA 1C07A 1XFZO 5PALA 3RLZA 1CM1A 4NDCA 1JF0A 4QJ3B 1VRKA 3FWBA 2LLTA 1UURA 4GGNA 1NCXA 3D0YB 4OCIA 1YUUA 2FOTA 2CTNA 5AEQA 1QIWA 2ZN9A 3EVUA 3HX4A 3CZTX 1H4BA 2M29A 2MJWB 3AKBA 3BYAA 1KWOB 3I5IC 1KSOA 4OV2A 3TDUA 1BT6A 5AERA 3TUYC 1V1GA 1BU3A 2JNXA 1K93D 1DGVA 1KFUS 1XFWO 2MLEC 1XYDA 3FIAA 2LANA 1Y1AA 3EK4A 2NZ0A 3PLFB 1W7IB 1QS7A 2NLNA 2JT0A 3QRXA 1JC2A 1ALWA 2R2IA 1SRAA 2COLB 3SG2A 2KAYA 3JTDB 4L9MA 4A4CA 1V1FA 2ZRSA 3BOWA 4YGBB 2ISDA 3CR2A 1CM4A 2KI6C 1CLLA 1KK7Z 2JU0A 3TZ1A 2PALA 3VRPA 4MZKA 3SJSA 4AOMA 1YUSA 1PSRA 2L50A 1OZOA 1S6IA 2LUCA 2LCPA 4R1EA 1K2HA 1G4YR 4U8DA 1DJGA 4OVNF 1CNPA 1MR8A 1OMVA 1NX1A 1QVIY 1J7OA 3IQOA 3I5HB 3VROA 1SL8A 3LL8B 1S1EA 4QJ4B 1AJ5A 1DF0A 2BCAA 1RTP1 1TCFA 3F45A 2CBLA 3A4UB 2ZNDA 1RECA 4M2OA 1A03A 5FYXA 3TDIA 1TN4A 1D1OA 2CCMA 3HCMA 1WRLA 3EK8A 5J3XA 3EVRA 2M97A 1YX7A 2ZRTA 1PVBA 1CB1A 1FI6A 3WHUB 2KYFA 2LM5A 4P2YB 1GJYA 1S6JA 4ICBA 4YGCB 1XVJA 3WNXB 4D1EA 1RWYA 2JT3A 3CLNA 1ZFSA 1B7TZ 1K96A 1RJVA 4HSZA 1J7RA 1DGUA 2VRGA 5DKQA 1BR4B 2LVJA 2A4JA 5AXIA 2LUXA 1IKUA 1ZMZA 2V53A 1MXLC 1DJIA 4FQOA 2M7LA 1J7PA 2ZFDA 2KYCA 2KHNA 3A8RA 1IRJA 3BUWB 2M3WA 1F8HA 2JZIA 2JXLA 2KNEA 5D69A 2L5XB 1F55A 2JTZA 1KK8C 2H2KA 2NCOA 4GPLB 1FF1A 4HREE 3I5FB 4I5KA 1AP4A 4AQJA 1QVIZ 1DTLA 2OTGC 1S6CA 4CPVA 2JWWA 2LMVA 1NX3A 1GGWA 2K8MB 2LE9B 2RGIA 3CGAA 3GK4X 3TS5C 3PATA 4C0JA 3BUMB 4Q04A 1MWNA 2Y5IA 2E30A 3BUOB 1XFUO 1EH2A 1UHIA 3H4SE 5G08A 2JPTA 1TIZA 1NIWA 2ZNEA 4I5JA 1SYMA 1TTXA 1BG1A 1FPWA 1QX5B 3BOWB 1EG3A 4I5NB 3BUXB 4PCWA 5KTYA 2JRFA 1SCMC 2LLSA 2NCPA 3GK2A 1SKTA 2LVKA 4QJ5B 3E3RA 1K9UA 1UHJA 2H61C 4TNCA 1M45A 1KFUL 1SL9A 1DJXA 1MXEA 2M7NA 3SG4A 2L98A 2K7CA 2Y4QA 1K9KA 3DVEA 4GBAA 1PK0D 1JF2A 2LP3A 1XA5A 5AFPA 4PHMA 3KEVA 4MN0A 2H61A 3EK7A 3VRNA 1A75A 1UHNA 1BF5A 2MRDA 3KO0A 2WORA 2HQ8A 3CR5X 1K8UA 1IJ6A 1DF0B 3AAKA 3NSOA 1F54A 4OR9B 2KFFA 2BCXA 4ETOA 1OZSA 1QV1A 1ZACA 4HRGA 5DKNA 1C7WA 2LMUA 1NCZA 2LNKA 1DVIA 1KQMB 1YX8A 3EKJA 1DJYA 1S36A 2SASA 1KFXS 2JULA 2I18A 1K9PA 4ORBB 5F6TA 2BL0C 1OMRA 1F4OA 3I5GC 1ZOTB 1H8BA 1NPQA 2PMYA 5HYDA 2I94A 5CSJA 3KF9A 1B9AA 1A2XA 2M1KB 2F3YA 4C0LA 1YVLA 1CLMA 2BCBA 1IGVA 1QIVA 4YGDB 1B7TY 1BLQA 4JQ0D 5KU1A 1FW4A 2KQ6A 2G9BA 3PN7C 1B47A 2KOTA 2GGZA 2JT8A 2FCDA 3DF0A 2ZN8A 1E8AA 1OOJA 3NSKA 5DKRA 4MLWA 1OQPA 4C0KA 2Y1NA 1OSAA 4N1GA 1S5GY 3CWGA 4GUKA 3BXKA 3NSLA 2MA2A 4PHNA 2GV5A 1YR5A 2NXQA 1K94A 2BBNA 2G2BA 3EKHA 1M46A 2WCFA 1DJZA 1U5IA 1GQMA 2F2OA 1M31A 1B8CA 1NSHA 2K2FA 2OTGB 4PHKA 5K89A 2CT9A 1QJTA 1XFYO 2WOSA 4PALA 5HKWA 4PE4A 4PE0A 4BY5A 1SY9A 3DVJA 1X02A 4CFRA 2KSPA 4ORAB 1LA3A 2CXJA 1AVSA 2PRUA 2L0PA 2F3ZA 1M39A 1WY9A 5HKYA 4AQIA 1LKJA 2FCEA 2LAPA 4NDDA 1A4PA 4ZCVA 1WLZA 5I8NA 1EJ3A 2L51A 2K61A 4CIDA 1Y1XA 1LVCD 1QLKA 1A75B 1DMOA 1CDNA 3CTNA 2PASA 1HQVA 3KPXA 1DJWA 4WQ2A 5ER4X 5HLVA 2JTTA 1B1GA 3O2PA 2OS8B 3BUNB 2LP2A 1YVHA 2QPTA 2LV7A 5B8IB 1LA0A 2TN4A 2GGMA 1IWQA 3OX6A 3CR4X 3O78A 1TCOB 1BODA 1S5GZ 1Y1UA 2M49B 3JVTB 2KI4C 5JOLA 4BY4A 1KQVA 1OE9B 1EL4A 2P6BB 3O4YA 2K7DA 1UHKA 1N2DA 1R6PA 2B1UA 1A29A 3SIAA 2ZKMX 1MF8B 5HLOA 1IH0A 3PFVA 2AAOA 1NCYA 1JFJA 2K0JA 4MVFA 1NUBA 1RK9A 4YGAA 3SG6A 1CDPA 1NP8A 1XFVO 5IBWA 3C1VA 4GFTA 3PM8A 2HETA 4E68A 1LINA 1JSAA 5CSIA 1CDLA 3LLEA 2AMIA 1KFXL 3I5IB 1CKKA 4XYNA 3TUYB 2BE6A 2LVIA 2PVBA 1J55A 1JBAA 4OKHA 1UP5A 1WDCC 2KI6D 2Q4UA 3AAJA 1CFCA 3I5HC 1YTZC 3DF0B 5I2LA 1NX0A 3LCPC 5I2QA 1N0YA 5CSFA 2BECA 1FBVA 1QXPA 2L4IA 1TNXA 3D10A 3GK1A 3BQ3A 2OPOA 1CTRA 1F4QA 1L2OC 2EHBA 4MSPA 3PN7B 2KAXA 1U5IB 2BE4A 3OB1B 1SL7A 3DVKA 2M0RA 3LK1A 4I5LB 1DJHA 1NWDA 2F8PA 1K95A 3GOFA 1QTXA 1BMOA 3SIBA 4XJKA 1DT7B 1BOCA 4GAOA 2K2AA 1TOPA 1YRUB 3SG3A 2JNFA 1ZUZA 4HRHA 1BJFA 2JC2A 2JXCA 4NQGA 1CLBA 2KBIA 2MAZA 2K7BA 4YGEB 1FI5A 3KHEA 4PHJA 4YRUA 1CMGA 3I5FC 2Y1MA 1TNQA 1SNLA 1SW8A 3FS7A 2F33A 1OMDA 4CFQA 3LK0A 5HKZA 3MSEB 1WLMA 1B8RA 1MHOA 2HF5A 5KSZA 1TNWA 4USLA 2WCEA 2LVVA 5I2OA 4F0ZB 4M2QA 1PRWA 3OB2B 3PSRA 4PE1A 1RROA 4MRXA 3M0WA 1SBJA 2KFHA 1PALA 2QACA 4YI8A 5D7FA 1MUXA 1SK6D 1QATA 3VGOA 1CDMA 1B8LA 4DS7A 1KK8B 2KI4B 3AKAA 2DOQA 1XFXO 3VRRA 2BKIB 3WXAA 3TDZA 2L2EA 2EC6C 3OP0A 1PVAA 1JWDA 5ER5A 4PE7A 2KDHA 4MZLA 1L7ZA 2M9GA 2WC8A 2SCPA 1SMGA 5CPVA 1YUTA 3TS5B 5JJGA 1CMFA 1SCVA 1IG5A 1IJ5A 1XK4C 2HPSA 2MBXA 2LMTA 2Q91A 1J1EA 1SR6C 1NX2A 4PDZA 1Y0VH 1PSBA 1NYAA 1TNPA 1SCMB 1WDCB 1GGZA 3IF7A 1KQMC 3WHTB 1XK4A 4MRYA 1AJ4A 2M1UA 4IL1A 4MEWA 4WRIA 1UWOA 3ICBA 5TNCA 1QLSA 2O60A 2WNDA 1L2OB 5AANA 2WCBA 3NSIA 4MZJA 1EXRA 1TRFA 4ORCB 1KWOC 1S3PA 1XO5A 2CNPA 1S26D 4XJKB 4GNKB 1CFFA 4FTGA 3D0YA 1QX2A 2I2RE 1QV0A 1RFJA 4GGFC 1W7JB 1KSMA 2M8UA 3SG7A 1LXFC 1WRZA 4ZCUA 1IQ3A 2O5GA 2I7AA 2JOJA 3JTDC 1CFPA 4WQ3A 3SG5A 2LLUA 2BKHB 2KGBC 4A4BA 1Q80A 1QX7A 1HT9A 1JUOA 1G8IA 4GGFA 1N65A 1K90D 3DD4A 2E6WA 2BL0B 1C7VA 1M63B 3I5GB 1AHRA 3CS1A 1IQ5A 3OX5A 4NDBA 4YI9A 3ZNIA 1QASA 5GQQC 2MLFC 3FWCA 1YRTB 2BBMA 2F2PA 4N5XA 1KCYA 1ALVA 3PALA 2K7OA 3DVMA 3IQQA 2PSRA 1PULA 1YURA 4DCKA 3O6BA 2KGRA 1AK8A 4M2PA 3RM1A 3ZWHA 1JFKA 1MQ1A 2LC5A 4DUQA 2D8NA 1Y6WA 3VRQA 2L4HA 2EGDA 2KQYA 2KBMA 1EG4A 3EVVA 2MHHA 1BR1B 3OHMB 2FJUB 2IS9A 5BPJA 1J1DA 2AUCA 4MBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R2U A;  1F71 A;  1G33 A;  5CSN A;  2EC6 B;  1ODB A;  1F70 A;  2LHL A;  4JWQ A;  1SPY A;  2OS8 C;  4YBH B;  1B4C A;  4N1F A;  2KFG A;  1J7Q A;  4UPG A;  1UUS A;  4DRW A;  2LHI A;  3NXA A;  2KAV A;  1KK7 Y;  4P5O E;  2HQW A;  4CLN A;  4DIR A;  1CFD A;  2JQ6 A;  1WRK A;  3JVT C;  4JPZ B;  1SR6 B;  1AUI B;  3K21 A;  1UHH A;  1C07 A;  1XFZ O;  5PAL A;  3RLZ A;  1CM1 A;  4NDC A;  1JF0 A;  4QJ3 B;  1VRK A;  3FWB A;  2LLT A;  1UUR A;  4GGN A;  1NCX A;  3D0Y B;  4OCI A;  1YUU A;  2FOT A;  2CTN A;  5AEQ A;  1QIW A;  2ZN9 A;  3EVU A;  3HX4 A;  3CZT X;  1H4B A;  2M29 A;  2MJW B;  3AKB A;  3BYA A;  1KWO B;  3I5I C;  1KSO A;  4OV2 A;  3TDU A;  1BT6 A;  5AER A;  3TUY C;  1V1G A;  1BU3 A;  2JNX A;  1K93 D;  1DGV A;  1KFU S;  1XFW O;  2MLE C;  1XYD A;  3FIA A;  2LAN A;  1Y1A A;  3EK4 A;  2NZ0 A;  3PLF B;  1W7I B;  1QS7 A;  2NLN A;  2JT0 A;  3QRX A;  1JC2 A;  1ALW A;  2R2I A;  1SRA A;  2COL B;  3SG2 A;  2KAY A;  3JTD B;  4L9M A;  4A4C A;  1V1F A;  2ZRS A;  3BOW A;  4YGB B;  2ISD A;  3CR2 A;  1CM4 A;  2KI6 C;  1CLL A;  1KK7 Z;  2JU0 A;  3TZ1 A;  2PAL A;  3VRP A;  4MZK A;  3SJS A;  4AOM A;  1YUS A;  1PSR A;  2L50 A;  1OZO A;  1S6I A;  2LUC A;  2LCP A;  4R1E A;  1K2H A;  1G4Y R;  4U8D A;  1DJG A;  4OVN F;  1CNP A;  1MR8 A;  1OMV A;  1NX1 A;  1QVI Y;  1J7O A;  3IQO A;  3I5H B;  3VRO A;  1SL8 A;  3LL8 B;  1S1E A;  4QJ4 B;  1AJ5 A;  1DF0 A;  2BCA A;  1RTP 1;  1TCF A;  3F45 A;  2CBL A;  3A4U B;  2ZND A;  1REC A;  4M2O A;  1A03 A;  5FYX A;  3TDI A;  1TN4 A;  1D1O A;  2CCM A;  3HCM A;  1WRL A;  3EK8 A;  5J3X A;  3EVR A;  2M97 A;  1YX7 A;  2ZRT A;  1PVB A;  1CB1 A;  1FI6 A;  3WHU B;  2KYF A;  2LM5 A;  4P2Y B;  1GJY A;  1S6J A;  4ICB A;  4YGC B;  1XVJ A;  3WNX B;  4D1E A;  1RWY A;  2JT3 A;  3CLN A;  1ZFS A;  1B7T Z;  1K96 A;  1RJV A;  4HSZ A;  1J7R A;  1DGU A;  2VRG A;  5DKQ A;  1BR4 B;  2LVJ A;  2A4J A;  5AXI A;  2LUX A;  1IKU A;  1ZMZ A;  2V53 A;  1MXL C;  1DJI A;  4FQO A;  2M7L A;  1J7P A;  2ZFD A;  2KYC A;  2KHN A;  3A8R A;  1IRJ A;  3BUW B;  2M3W A;  1F8H A;  2JZI A;  2JXL A;  2KNE A;  5D69 A;  2L5X B;  1F55 A;  2JTZ A;  1KK8 C;  2H2K A;  2NCO A;  4GPL B;  1FF1 A;  4HRE E;  3I5F B;  4I5K A;  1AP4 A;  4AQJ A;  1QVI Z;  1DTL A;  2OTG C;  1S6C A;  4CPV A;  2JWW A;  2LMV A;  1NX3 A;  1GGW A;  2K8M B;  2LE9 B;  2RGI A;  3CGA A;  3GK4 X;  3TS5 C;  3PAT A;  4C0J A;  3BUM B;  4Q04 A;  1MWN A;  2Y5I A;  2E30 A;  3BUO B;  1XFU O;  1EH2 A;  1UHI A;  3H4S E;  5G08 A;  2JPT A;  1TIZ A;  1NIW A;  2ZNE A;  4I5J A;  1SYM A;  1TTX A;  1BG1 A;  1FPW A;  1QX5 B;  3BOW B;  1EG3 A;  4I5N B;  3BUX B;  4PCW A;  5KTY A;  2JRF A;  1SCM C;  2LLS A;  2NCP A;  3GK2 A;  1SKT A;  2LVK A;  4QJ5 B;  3E3R A;  1K9U A;  1UHJ A;  2H61 C;  4TNC A;  1M45 A;  1KFU L;  1SL9 A;  1DJX A;  1MXE A;  2M7N A;  3SG4 A;  2L98 A;  2K7C A;  2Y4Q A;  1K9K A;  3DVE A;  4GBA A;  1PK0 D;  1JF2 A;  2LP3 A;  1XA5 A;  5AFP A;  4PHM A;  3KEV A;  4MN0 A;  2H61 A;  3EK7 A;  3VRN A;  1A75 A;  1UHN A;  1BF5 A;  2MRD A;  3KO0 A;  2WOR A;  2HQ8 A;  3CR5 X;  1K8U A;  1IJ6 A;  1DF0 B;  3AAK A;  3NSO A;  1F54 A;  4OR9 B;  2KFF A;  2BCX A;  4ETO A;  1OZS A;  1QV1 A;  1ZAC A;  4HRG A;  5DKN A;  1C7W A;  2LMU A;  1NCZ A;  2LNK A;  1DVI A;  1KQM B;  1YX8 A;  3EKJ A;  1DJY A;  1S36 A;  2SAS A;  1KFX S;  2JUL A;  2I18 A;  1K9P A;  4ORB B;  5F6T A;  2BL0 C;  1OMR A;  1F4O A;  3I5G C;  1ZOT B;  1H8B A;  1NPQ A;  2PMY A;  5HYD A;  2I94 A;  5CSJ A;  3KF9 A;  1B9A A;  1A2X A;  2M1K B;  2F3Y A;  4C0L A;  1YVL A;  1CLM A;  2BCB A;  1IGV A;  1QIV A;  4YGD B;  1B7T Y;  1BLQ A;  4JQ0 D;  5KU1 A;  1FW4 A;  2KQ6 A;  2G9B A;  3PN7 C;  1B47 A;  2KOT A;  2GGZ A;  2JT8 A;  2FCD A;  3DF0 A;  2ZN8 A;  1E8A A;  1OOJ A;  3NSK A;  5DKR A;  4MLW A;  1OQP A;  4C0K A;  2Y1N A;  1OSA A;  4N1G A;  1S5G Y;  3CWG A;  4GUK A;  3BXK A;  3NSL A;  2MA2 A;  4PHN A;  2GV5 A;  1YR5 A;  2NXQ A;  1K94 A;  2BBN A;  2G2B A;  3EKH A;  1M46 A;  2WCF A;  1DJZ A;  1U5I A;  1GQM A;  2F2O A;  1M31 A;  1B8C A;  1NSH A;  2K2F A;  2OTG B;  4PHK A;  5K89 A;  2CT9 A;  1QJT A;  1XFY O;  2WOS A;  4PAL A;  5HKW A;  4PE4 A;  4PE0 A;  4BY5 A;  1SY9 A;  3DVJ A;  1X02 A;  4CFR A;  2KSP A;  4ORA B;  1LA3 A;  2CXJ A;  1AVS A;  2PRU A;  2L0P A;  2F3Z A;  1M39 A;  1WY9 A;  5HKY A;  4AQI A;  1LKJ A;  2FCE A;  2LAP A;  4NDD A;  1A4P A;  4ZCV A;  1WLZ A;  5I8N A;  1EJ3 A;  2L51 A;  2K61 A;  4CID A;  1Y1X A;  1LVC D;  1QLK A;  1A75 B;  1DMO A;  1CDN A;  3CTN A;  2PAS A;  1HQV A;  3KPX A;  1DJW A;  4WQ2 A;  5ER4 X;  5HLV A;  2JTT A;  1B1G A;  3O2P A;  2OS8 B;  3BUN B;  2LP2 A;  1YVH A;  2QPT A;  2LV7 A;  5B8I B;  1LA0 A;  2TN4 A;  2GGM A;  1IWQ A;  3OX6 A;  3CR4 X;  3O78 A;  1TCO B;  1BOD A;  1S5G Z;  1Y1U A;  2M49 B;  3JVT B;  2KI4 C;  5JOL A;  4BY4 A;  1KQV A;  1OE9 B;  1EL4 A;  2P6B B;  3O4Y A;  2K7D A;  1UHK A;  1N2D A;  1R6P A;  2B1U A;  1A29 A;  3SIA A;  2ZKM X;  1MF8 B;  5HLO A;  1IH0 A;  3PFV A;  2AAO A;  1NCY A;  1JFJ A;  2K0J A;  4MVF A;  1NUB A;  1RK9 A;  4YGA A;  3SG6 A;  1CDP A;  1NP8 A;  1XFV O;  5IBW A;  3C1V A;  4GFT A;  3PM8 A;  2HET A;  4E68 A;  1LIN A;  1JSA A;  5CSI A;  1CDL A;  3LLE A;  2AMI A;  1KFX L;  3I5I B;  1CKK A;  4XYN A;  3TUY B;  2BE6 A;  2LVI A;  2PVB A;  1J55 A;  1JBA A;  4OKH A;  1UP5 A;  1WDC C;  2KI6 D;  2Q4U A;  3AAJ A;  1CFC A;  3I5H C;  1YTZ C;  3DF0 B;  5I2L A;  1NX0 A;  3LCP C;  5I2Q A;  1N0Y A;  5CSF A;  2BEC A;  1FBV A;  1QXP A;  2L4I A;  1TNX A;  3D10 A;  3GK1 A;  3BQ3 A;  2OPO A;  1CTR A;  1F4Q A;  1L2O C;  2EHB A;  4MSP A;  3PN7 B;  2KAX A;  1U5I B;  2BE4 A;  3OB1 B;  1SL7 A;  3DVK A;  2M0R A;  3LK1 A;  4I5L B;  1DJH A;  1NWD A;  2F8P A;  1K95 A;  3GOF A;  1QTX A;  1BMO A;  3SIB A;  4XJK A;  1DT7 B;  1BOC A;  4GAO A;  2K2A A;  1TOP A;  1YRU B;  3SG3 A;  2JNF A;  1ZUZ A;  4HRH A;  1BJF A;  2JC2 A;  2JXC A;  4NQG A;  1CLB A;  2KBI A;  2MAZ A;  2K7B A;  4YGE B;  1FI5 A;  3KHE A;  4PHJ A;  4YRU A;  1CMG A;  3I5F C;  2Y1M A;  1TNQ A;  1SNL A;  1SW8 A;  3FS7 A;  2F33 A;  1OMD A;  4CFQ A;  3LK0 A;  5HKZ A;  3MSE B;  1WLM A;  1B8R A;  1MHO A;  2HF5 A;  5KSZ A;  1TNW A;  4USL A;  2WCE A;  2LVV A;  5I2O A;  4F0Z B;  4M2Q A;  1PRW A;  3OB2 B;  3PSR A;  4PE1 A;  1RRO A;  4MRX A;  3M0W A;  1SBJ A;  2KFH A;  1PAL A;  2QAC A;  4YI8 A;  5D7F A;  1MUX A;  1SK6 D;  1QAT A;  3VGO A;  1CDM A;  1B8L A;  4DS7 A;  1KK8 B;  2KI4 B;  3AKA A;  2DOQ A;  1XFX O;  3VRR A;  2BKI B;  3WXA A;  3TDZ A;  2L2E A;  2EC6 C;  3OP0 A;  1PVA A;  1JWD A;  5ER5 A;  4PE7 A;  2KDH A;  4MZL A;  1L7Z A;  2M9G A;  2WC8 A;  2SCP A;  1SMG A;  5CPV A;  1YUT A;  3TS5 B;  5JJG A;  1CMF A;  1SCV A;  1IG5 A;  1IJ5 A;  1XK4 C;  2HPS A;  2MBX A;  2LMT A;  2Q91 A;  1J1E A;  1SR6 C;  1NX2 A;  4PDZ A;  1Y0V H;  1PSB A;  1NYA A;  1TNP A;  1SCM B;  1WDC B;  1GGZ A;  3IF7 A;  1KQM C;  3WHT B;  1XK4 A;  4MRY A;  1AJ4 A;  2M1U A;  4IL1 A;  4MEW A;  4WRI A;  1UWO A;  3ICB A;  5TNC A;  1QLS A;  2O60 A;  2WND A;  1L2O B;  5AAN A;  2WCB A;  3NSI A;  4MZJ A;  1EXR A;  1TRF A;  4ORC B;  1KWO C;  1S3P A;  1XO5 A;  2CNP A;  1S26 D;  4XJK B;  4GNK B;  1CFF A;  4FTG A;  3D0Y A;  1QX2 A;  2I2R E;  1QV0 A;  1RFJ A;  4GGF C;  1W7J B;  1KSM A;  2M8U A;  3SG7 A;  1LXF C;  1WRZ A;  4ZCU A;  1IQ3 A;  2O5G A;  2I7A A;  2JOJ A;  3JTD C;  1CFP A;  4WQ3 A;  3SG5 A;  2LLU A;  2BKH B;  2KGB C;  4A4B A;  1Q80 A;  1QX7 A;  1HT9 A;  1JUO A;  1G8I A;  4GGF A;  1N65 A;  1K90 D;  3DD4 A;  2E6W A;  2BL0 B;  1C7V A;  1M63 B;  3I5G B;  1AHR A;  3CS1 A;  1IQ5 A;  3OX5 A;  4NDB A;  4YI9 A;  3ZNI A;  1QAS A;  5GQQ C;  2MLF C;  3FWC A;  1YRT B;  2BBM A;  2F2P A;  4N5X A;  1KCY A;  1ALV A;  3PAL A;  2K7O A;  3DVM A;  3IQQ A;  2PSR A;  1PUL A;  1YUR A;  4DCK A;  3O6B A;  2KGR A;  1AK8 A;  4M2P A;  3RM1 A;  3ZWH A;  1JFK A;  1MQ1 A;  2LC5 A;  4DUQ A;  2D8N A;  1Y6W A;  3VRQ A;  2L4H A;  2EGD A;  2KQY A;  2KBM A;  1EG4 A;  3EVV A;  2MHH A;  1BR1 B;  3OHM B;  2FJU B;  2IS9 A;  5BPJ A;  1J1D A;  2AUC A;  4MBE A; 
#chains in the Genus database with same CATH topology
 1R2U A;  1F71 A;  1G33 A;  5CSN A;  5EL2 A;  3NGV A;  2EC6 B;  1ODB A;  1F70 A;  2LHL A;  4JWQ A;  1SPY A;  2OS8 C;  4YBH B;  1B4C A;  4N1F A;  2KFG A;  1J7Q A;  4UPG A;  1UUS A;  4DRW A;  2LHI A;  3NXA A;  2KAV A;  1KK7 Y;  3L4L A;  2HQW A;  4P5O E;  4CLN A;  4DIR A;  1CFD A;  2JQ6 A;  1WRK A;  3JVT C;  4JPZ B;  1SR6 B;  1AUI B;  3K21 A;  1UHH A;  3R1V A;  1C07 A;  1XFZ O;  5PAL A;  3RLZ A;  1QWV A;  1CM1 A;  4NDC A;  1JF0 A;  4QJ3 B;  1VRK A;  3FWB A;  2LLT A;  1UUR A;  4GGN A;  1NCX A;  3D0Y B;  3B86 A;  4OCI A;  1YUU A;  2FOT A;  2CTN A;  5AEQ A;  1QIW A;  2ZN9 A;  3EVU A;  3HX4 A;  2WCK A;  3Q8I A;  3S0F A;  3CZT X;  1H4B A;  2M29 A;  2MJW B;  3AKB A;  3BYA A;  1KWO B;  3I5I C;  1KSO A;  2QEO A;  4OV2 A;  1BT6 A;  3TDU A;  3TUY C;  1V1G A;  1BU3 A;  2JNX A;  1K93 D;  1DGV A;  1KFU S;  1XFW O;  2MLE C;  1XYD A;  3FIA A;  2LAN A;  1Y1A A;  3EK4 A;  2NZ0 A;  3PLF B;  1W7I B;  1QS7 A;  2NLN A;  2JT0 A;  2P70 A;  3QRX A;  1JC2 A;  1ALW A;  2R2I A;  1SRA A;  2COL B;  3SG2 A;  2KAY A;  3JTD B;  2FJY A;  4L9M A;  4A4C A;  1V1F A;  2ZRS A;  3BOW A;  4YGB B;  1C3Z A;  2ISD A;  3CR2 A;  3EG5 B;  1CM4 A;  2KI6 C;  1CLL A;  1KK7 Z;  2JU0 A;  2QEB A;  3TZ1 A;  2PAL A;  3VRP A;  4MZK A;  3SJS A;  4AOM A;  1YUS A;  1PSR A;  2L50 A;  1OOG A;  1OZO A;  1S6I A;  1TUZ A;  2LUC A;  2LCP A;  4R1E A;  5DIC A;  1K2H A;  1G4Y R;  4U8D A;  1DJG A;  4OVN F;  1CNP A;  1MR8 A;  5AER A;  1OMV A;  1NX1 A;  1QVI Y;  1J7O A;  3IQO A;  3I5H B;  3VRO A;  1SL8 A;  3LL8 B;  1S1E A;  4QJ4 B;  4IJ7 A;  1AJ5 A;  1DF0 A;  2K60 A;  2BCA A;  3CZ2 A;  1RTP 1;  1TCF A;  3F45 A;  2CBL A;  3A4U B;  2ZND A;  1REC A;  4M2O A;  1A03 A;  5FYX A;  3TDI A;  1TN4 A;  1D1O A;  2CCM A;  3HCM A;  1WRL A;  3EK8 A;  5J3X A;  3PM2 A;  3EVR A;  2M97 A;  1YX7 A;  2ZRT A;  1PVB A;  1CB1 A;  1FI6 A;  3WHU B;  2KYF A;  2LM5 A;  4P2Y B;  1GJY A;  1S6J A;  2WCM A;  4ICB A;  1XVJ A;  3CDN A;  1TUJ A;  4YGC B;  3WNX B;  4D1E A;  1RWY A;  2JT3 A;  3CLN A;  4ETO A;  1ZFS A;  1B7T Z;  1K96 A;  1RJV A;  3B6X A;  1J7R A;  4HSZ A;  1IIO A;  1DGU A;  2VRG A;  5DKQ A;  1BR4 B;  2LVJ A;  2A4J A;  5AXI A;  2LUX A;  1IKU A;  1ZMZ A;  2V53 A;  1DEK A;  1MXL C;  1DJI A;  4FQO A;  2M7L A;  1J7P A;  3BJH A;  2ZFD A;  2KYC A;  2KHN A;  3A8R A;  1IRJ A;  3BUW B;  2M3W A;  1F8H A;  2JZI A;  3CZ0 A;  2JXL A;  2KNE A;  5D69 A;  2L5X B;  1F55 A;  2JTZ A;  2WC5 A;  1KK8 C;  2H2K A;  2NCO A;  4GPL B;  1FF1 A;  4HRE E;  1W9Z A;  3I5F B;  3OGN A;  4I5K A;  1AP4 A;  4AQJ A;  3O4X A;  1QVI Z;  1DTL A;  3R1O A;  2OTG C;  3B87 A;  3PJI A;  1S6C A;  4CPV A;  2JWW A;  2LMV A;  1NX3 A;  1GGW A;  2K8M B;  2LE9 B;  2RGI A;  3CYZ A;  3CGA A;  3GK4 X;  3TS5 C;  3PAT A;  4C0J A;  3BUM B;  3CZ1 A;  1MWN A;  2GTE A;  2Y5I A;  4Q04 A;  2E30 A;  3BUO B;  1XFU O;  1EH2 A;  1UHI A;  3H4S E;  5G08 A;  2JPT A;  2KLD A;  1TIZ A;  1NIW A;  2ZNE A;  3K1E A;  4I5J A;  1ORG A;  1SYM A;  1TTX A;  1BG1 A;  1FPW A;  1QX5 B;  3BOW B;  1EG3 A;  4I5N B;  3D73 A;  3BUX B;  4PCW A;  5KTY A;  2JRF A;  1SCM C;  2LLS A;  2NCP A;  3GK2 A;  1SKT A;  2LVK A;  4QJ5 B;  3E3R A;  1K9U A;  1UHJ A;  2H61 C;  4TNC A;  1M45 A;  1KFU L;  1OOI X;  1DJX A;  1MXE A;  1SL9 A;  2M7N A;  3SG4 A;  2L98 A;  2K7C A;  2Y4Q A;  1K9K A;  3DVE A;  4GBA A;  1PK0 D;  3D74 A;  1JF2 A;  2LP3 A;  1XA5 A;  5AFP A;  4PHM A;  3KEV A;  4MN0 A;  2H61 A;  3EK7 A;  3VRN A;  1A75 A;  1UHN A;  1BF5 A;  2MRD A;  1XFR A;  3D77 A;  2WOR A;  2HQ8 A;  3KO0 A;  3CR5 X;  1K8U A;  1IJ6 A;  1DF0 B;  3AAK A;  3NSO A;  1F54 A;  4OR9 B;  2KFF A;  2BCX A;  3D75 A;  1OZS A;  1QV1 A;  1TWO A;  1ZAC A;  4HRG A;  1C7W A;  5DKN A;  2QEV A;  2LMU A;  1NCZ A;  2LNK A;  1DVI A;  1KQM B;  1YX8 A;  3EKJ A;  1DJY A;  1S36 A;  2SAS A;  1KFX S;  3SS3 A;  2JUL A;  2I18 A;  1K9P A;  4ORB B;  3DY9 A;  5F6T A;  2BL0 C;  1OMR A;  1F4O A;  2KLE A;  3I5G C;  1ZOT B;  1H8B A;  1NPQ A;  2PMY A;  5HYD A;  2I94 A;  5CSJ A;  3KF9 A;  1B9A A;  1A2X A;  2M1K B;  2F3Y A;  4C0L A;  1YVL A;  1CLM A;  1IGV A;  1QIV A;  2BCB A;  4YGD B;  1B7T Y;  1BLQ A;  4JQ0 D;  5KU1 A;  1FW4 A;  1LS8 A;  2KQ6 A;  3FE6 A;  4JD9 A;  2G9B A;  3PN7 C;  1B47 A;  2KOT A;  2GGZ A;  2JT8 A;  2FCD A;  3DZT A;  3DF0 A;  2ZN8 A;  1E8A A;  1OOJ A;  3CAB A;  3NSK A;  4MLW A;  1OQP A;  5DKR A;  2Y1N A;  3VB1 A;  3B88 A;  4C0K A;  1OSA A;  4N1G A;  1S5G Y;  3CWG A;  4GUK A;  3BXK A;  3NSL A;  2MA2 A;  4PHN A;  2GV5 A;  1YR5 A;  2NXQ A;  1K94 A;  2BBN A;  2G2B A;  5FI7 A;  3EKH A;  1M46 A;  2WCF A;  1DJZ A;  1U5I A;  1GQM A;  2F2O A;  3NHT A;  1M31 A;  1B8C A;  1NSH A;  2K2F A;  2OTG B;  3D78 A;  4PHK A;  3UNW A;  5K89 A;  2CT9 A;  1QJT A;  1XFY O;  2WOS A;  4PAL A;  5HKW A;  4PE4 A;  4PE0 A;  4BY5 A;  5HL1 A;  1SY9 A;  3DVJ A;  1X02 A;  3B7A A;  2KSP A;  2KPH A;  2WC6 A;  4ORA B;  4CFR A;  1LA3 A;  2CXJ A;  1AVS A;  2PRU A;  2L0P A;  3S0G A;  1GM0 A;  2F3Z A;  1M39 A;  1WY9 A;  2PQL A;  5HKY A;  4AQI A;  1LKJ A;  2FCE A;  2LAP A;  4JKT A;  1A4P A;  4NDD A;  1WLZ A;  4ZCV A;  5I8N A;  1EJ3 A;  2L51 A;  2K61 A;  4PT1 A;  1Y1X A;  4CID A;  1LVC D;  1QLK A;  1A75 B;  1DMO A;  1CDN A;  3CTN A;  2PAS A;  1HQV A;  3KPX A;  1DJW A;  4WQ2 A;  5ER4 X;  5HLV A;  2JTT A;  1B1G A;  3O2P A;  2OS8 B;  3BUN B;  2LP2 A;  1YVH A;  2QPT A;  2LV7 A;  3S0D A;  1LA0 A;  5B8I B;  2TN4 A;  2GGM A;  1IWQ A;  3OX6 A;  3CR4 X;  2WCL A;  1OOF A;  3O78 A;  1TCO B;  1BOD A;  1S5G Z;  1Y1U A;  2M49 B;  3JVT B;  2KI4 C;  5JOL A;  4BY4 A;  1KQV A;  1OE9 B;  1T14 A;  1EL4 A;  2P6B B;  3O4Y A;  2K7D A;  1UHK A;  1N2D A;  1DQE A;  1R6P A;  1A29 A;  2B1U A;  3SIA A;  2ZKM X;  1MF8 B;  2QDI A;  5HLO A;  1IH0 A;  3PFV A;  2AAO A;  3BFB A;  1NCY A;  3R1P A;  3RZS A;  1JFJ A;  2K0J A;  4MVF A;  1NUB A;  1RK9 A;  4YGA A;  3SG6 A;  1CDP A;  1NP8 A;  1XFV O;  5IBW A;  3C1V A;  4GFT A;  5I94 A;  3PM8 A;  2HET A;  4E68 A;  1LIN A;  1JSA A;  5CSI A;  1CDL A;  3LLE A;  2AMI A;  1KFX L;  3I5I B;  1CKK A;  2L2C A;  4XYN A;  3TUY B;  2BE6 A;  2LVI A;  2PVB A;  1J55 A;  1JBA A;  4OKH A;  1UP5 A;  1WDC C;  2KI6 D;  2Q4U A;  3AAJ A;  1CFC A;  1DC1 A;  3I5H C;  1YTZ C;  3DF0 B;  5I2L A;  3FE9 A;  1NX0 A;  3LCP C;  5I2Q A;  1N0Y A;  5CSF A;  2BEC A;  1FBV A;  1QXP A;  2L4I A;  1TNX A;  3D10 A;  3GK1 A;  3BQ3 A;  2OPO A;  1CTR A;  1OOH A;  1F4Q A;  1L2O C;  4FQT A;  2EHB A;  4MSP A;  3PN7 B;  2KAX A;  1U5I B;  2BE4 A;  3OB1 B;  4INW A;  1SSE B;  1SL7 A;  3DVK A;  2M0R A;  3LK1 A;  4I5L B;  1DJH A;  1NWD A;  2F8P A;  1K95 A;  1DEL A;  3GOF A;  1QTX A;  3R72 A;  3OBV A;  1BMO A;  3SIB A;  4XJK A;  2L5Y A;  1DT7 B;  1BOC A;  4GAO A;  2K2A A;  1TOP A;  4INX A;  2YGU A;  3N7H A;  1YRU B;  3SG3 A;  2JNF A;  1ZUZ A;  4HRH A;  1BJF A;  2JC2 A;  2JXC A;  4NQG A;  1CLB A;  2KBI A;  2MAZ A;  2K7B A;  3L47 A;  4YGE B;  1FI5 A;  3KHE A;  4PHJ A;  4YRU A;  1CMG A;  3FE8 A;  3I5F C;  2Y1M A;  1TNQ A;  1SNL A;  1SW8 A;  3FS7 A;  2F33 A;  1OMD A;  4CFQ A;  3LK0 A;  2ERB A;  5HKZ A;  3MSE B;  1WLM A;  3DXL A;  1B8R A;  1MHO A;  2HF5 A;  5KSZ A;  1TNW A;  4USL A;  2WCE A;  2LVV A;  2QEH A;  5I2O A;  4F0Z B;  4M2Q A;  1PRW A;  3OB2 B;  3PSR A;  3BFH A;  4PE1 A;  1RRO A;  4MRX A;  3M0W A;  1SBJ A;  2KFH A;  1PAL A;  3L4A A;  2QAC A;  4YI8 A;  5D7F A;  3NHI A;  3IVT A;  1MUX A;  1SK6 D;  1QAT A;  3VGO A;  2JPO A;  1CDM A;  3S0B A;  1B8L A;  3S0E A;  4DS7 A;  1KK8 B;  2KI4 B;  3AKA A;  3D76 A;  2DOQ A;  2P71 A;  1XFX O;  3VRR A;  2BKI B;  3WXA A;  3TDZ A;  2L2E A;  2EC6 C;  3OP0 A;  1PVA A;  1JWD A;  5ER5 A;  4PE7 A;  2KDH A;  4MZL A;  1L7Z A;  2M9G A;  2WC8 A;  2BAP A;  2SCP A;  1SMG A;  5CPV A;  1YUT A;  3TS5 B;  5JJG A;  1CMF A;  1SCV A;  1IG5 A;  1IJ5 A;  1XK4 C;  2HPS A;  2MBX A;  2LMT A;  2Q91 A;  1J1E A;  1SR6 C;  3BFA A;  2BNX A;  1NX2 A;  4PDZ A;  1Y0V H;  1P28 A;  2H8V A;  3DYE A;  4OZD A;  1PSB A;  1NYA A;  1TNP A;  1SCM B;  1WDC B;  1GGZ A;  3IF7 A;  1KQM C;  3WHT B;  1XK4 A;  4MRY A;  1AJ4 A;  2M1U A;  4IL1 A;  4MEW A;  4WRI A;  4F7F A;  1UWO A;  3ICB A;  5TNC A;  1QLS A;  2O60 A;  2WND A;  1L2O B;  5AAN A;  2WCB A;  3NSI A;  4MZJ A;  1EXR A;  1TRF A;  4ORC B;  1KWO C;  1S3P A;  1XO5 A;  2CNP A;  1S26 D;  5FI6 A;  4XJK B;  4GNK B;  1CFF A;  4FTG A;  3D0Y A;  1QX2 A;  3SS5 A;  2I2R E;  1QV0 A;  1RFJ A;  4GGF C;  1W7J B;  1Z2C B;  1KSM A;  2M8U A;  3UO9 A;  3SG7 A;  1LXF C;  1WRZ A;  4ZCU A;  1IQ3 A;  2O5G A;  2I7A A;  2JOJ A;  3JTD C;  1CFP A;  4WQ3 A;  3SG5 A;  3S0A A;  2LLU A;  2BKH B;  2KGB C;  5D3O A;  4A4B A;  1Q80 A;  1QX7 A;  3SS4 A;  1HT9 A;  1JUO A;  1G8I A;  4GGF A;  1N65 A;  1K90 D;  3DD4 A;  1OW4 A;  2E6W A;  2BL0 B;  1C7V A;  1M63 B;  3I5G B;  1AHR A;  3CS1 A;  1IQ5 A;  3OX5 A;  4NDB A;  4YI9 A;  3ZNI A;  1QAS A;  5GQQ C;  2MLF C;  3FWC A;  1YRT B;  5FI2 A;  3V2L A;  2BBM A;  2F2P A;  4N5X A;  1KCY A;  1ALV A;  3PAL A;  2K7O A;  2WCH A;  3DVM A;  3IQQ A;  2PSR A;  1PUL A;  1YUR A;  4KYN A;  4DCK A;  3O6B A;  2KGR A;  1AK8 A;  4M2P A;  3RM1 A;  3ZWH A;  1JFK A;  1MQ1 A;  3QME A;  2LC5 A;  4DUQ A;  2D8N A;  1Y6W A;  3VRQ A;  2L4H A;  1C3Y A;  2EGD A;  2KQY A;  2KBM A;  2WCJ A;  2PYQ A;  1EG4 A;  3EVV A;  2MHH A;  1Z4H A;  1BR1 B;  3OHM B;  2FJU B;  2IS9 A;  5BPJ A;  1J1D A;  2AUC A;  4MBE A; 
#chains in the Genus database with same CATH homology
 1R2U A;  1F71 A;  1G33 A;  5CSN A;  2EC6 B;  1ODB A;  1F70 A;  2LHL A;  4JWQ A;  1SPY A;  2OS8 C;  4YBH B;  1B4C A;  4N1F A;  2KFG A;  1J7Q A;  4UPG A;  1UUS A;  4DRW A;  2LHI A;  3NXA A;  2KAV A;  1KK7 Y;  4P5O E;  2HQW A;  4CLN A;  4DIR A;  1CFD A;  2JQ6 A;  1WRK A;  3JVT C;  4JPZ B;  1SR6 B;  1AUI B;  3K21 A;  1UHH A;  1C07 A;  1XFZ O;  5PAL A;  3RLZ A;  1CM1 A;  4NDC A;  1JF0 A;  4QJ3 B;  1VRK A;  3FWB A;  2LLT A;  1UUR A;  4GGN A;  1NCX A;  3D0Y B;  4OCI A;  1YUU A;  2FOT A;  2CTN A;  5AEQ A;  1QIW A;  2ZN9 A;  3EVU A;  3HX4 A;  3CZT X;  1H4B A;  2M29 A;  2MJW B;  3AKB A;  3BYA A;  1KWO B;  3I5I C;  1KSO A;  4OV2 A;  3TDU A;  1BT6 A;  5AER A;  3TUY C;  1V1G A;  1BU3 A;  2JNX A;  1K93 D;  1DGV A;  1KFU S;  1XFW O;  2MLE C;  1XYD A;  3FIA A;  2LAN A;  1Y1A A;  3EK4 A;  2NZ0 A;  3PLF B;  1W7I B;  1QS7 A;  2NLN A;  2JT0 A;  3QRX A;  1JC2 A;  1ALW A;  2R2I A;  1SRA A;  2COL B;  3SG2 A;  2KAY A;  3JTD B;  4L9M A;  4A4C A;  1V1F A;  2ZRS A;  3BOW A;  4YGB B;  2ISD A;  3CR2 A;  1CM4 A;  2KI6 C;  1CLL A;  1KK7 Z;  2JU0 A;  3TZ1 A;  2PAL A;  3VRP A;  4MZK A;  3SJS A;  4AOM A;  1YUS A;  1PSR A;  2L50 A;  1OZO A;  1S6I A;  2LUC A;  2LCP A;  4R1E A;  1K2H A;  1G4Y R;  4U8D A;  1DJG A;  4OVN F;  1CNP A;  1MR8 A;  1OMV A;  1NX1 A;  1QVI Y;  1J7O A;  3IQO A;  3I5H B;  3VRO A;  1SL8 A;  3LL8 B;  1S1E A;  4QJ4 B;  1AJ5 A;  1DF0 A;  2BCA A;  1RTP 1;  1TCF A;  3F45 A;  2CBL A;  3A4U B;  2ZND A;  1REC A;  4M2O A;  1A03 A;  5FYX A;  3TDI A;  1TN4 A;  1D1O A;  2CCM A;  3HCM A;  1WRL A;  3EK8 A;  5J3X A;  3EVR A;  2M97 A;  1YX7 A;  2ZRT A;  1PVB A;  1CB1 A;  1FI6 A;  3WHU B;  2KYF A;  2LM5 A;  4P2Y B;  1GJY A;  1S6J A;  4ICB A;  4YGC B;  1XVJ A;  3WNX B;  4D1E A;  1RWY A;  2JT3 A;  3CLN A;  1ZFS A;  1B7T Z;  1K96 A;  1RJV A;  4HSZ A;  1J7R A;  1DGU A;  2VRG A;  5DKQ A;  1BR4 B;  2LVJ A;  2A4J A;  5AXI A;  2LUX A;  1IKU A;  1ZMZ A;  2V53 A;  1MXL C;  1DJI A;  4FQO A;  2M7L A;  1J7P A;  2ZFD A;  2KYC A;  2KHN A;  3A8R A;  1IRJ A;  3BUW B;  2M3W A;  1F8H A;  2JZI A;  2JXL A;  2KNE A;  5D69 A;  2L5X B;  1F55 A;  2JTZ A;  1KK8 C;  2H2K A;  2NCO A;  4GPL B;  1FF1 A;  4HRE E;  3I5F B;  4I5K A;  1AP4 A;  4AQJ A;  1QVI Z;  1DTL A;  2OTG C;  1S6C A;  4CPV A;  2JWW A;  2LMV A;  1NX3 A;  1GGW A;  2K8M B;  2LE9 B;  2RGI A;  3CGA A;  3GK4 X;  3TS5 C;  3PAT A;  4C0J A;  3BUM B;  4Q04 A;  1MWN A;  2Y5I A;  2E30 A;  3BUO B;  1XFU O;  1EH2 A;  1UHI A;  3H4S E;  5G08 A;  2JPT A;  1TIZ A;  1NIW A;  2ZNE A;  4I5J A;  1SYM A;  1TTX A;  1BG1 A;  1FPW A;  1QX5 B;  3BOW B;  1EG3 A;  4I5N B;  3BUX B;  4PCW A;  5KTY A;  2JRF A;  1SCM C;  2LLS A;  2NCP A;  3GK2 A;  1SKT A;  2LVK A;  4QJ5 B;  3E3R A;  1K9U A;  1UHJ A;  2H61 C;  4TNC A;  1M45 A;  1KFU L;  1SL9 A;  1DJX A;  1MXE A;  2M7N A;  3SG4 A;  2L98 A;  2K7C A;  2Y4Q A;  1K9K A;  3DVE A;  4GBA A;  1PK0 D;  1JF2 A;  2LP3 A;  1XA5 A;  5AFP A;  4PHM A;  3KEV A;  4MN0 A;  2H61 A;  3EK7 A;  3VRN A;  1A75 A;  1UHN A;  1BF5 A;  2MRD A;  3KO0 A;  2WOR A;  2HQ8 A;  3CR5 X;  1K8U A;  1IJ6 A;  1DF0 B;  3AAK A;  3NSO A;  1F54 A;  4OR9 B;  2KFF A;  2BCX A;  4ETO A;  1OZS A;  1QV1 A;  1ZAC A;  4HRG A;  5DKN A;  1C7W A;  2LMU A;  1NCZ A;  2LNK A;  1DVI A;  1KQM B;  1YX8 A;  3EKJ A;  1DJY A;  1S36 A;  2SAS A;  1KFX S;  2JUL A;  2I18 A;  1K9P A;  4ORB B;  5F6T A;  2BL0 C;  1OMR A;  1F4O A;  3I5G C;  1ZOT B;  1H8B A;  1NPQ A;  2PMY A;  5HYD A;  2I94 A;  5CSJ A;  3KF9 A;  1B9A A;  1A2X A;  2M1K B;  2F3Y A;  4C0L A;  1YVL A;  1CLM A;  2BCB A;  1IGV A;  1QIV A;  4YGD B;  1B7T Y;  1BLQ A;  4JQ0 D;  5KU1 A;  1FW4 A;  2KQ6 A;  2G9B A;  3PN7 C;  1B47 A;  2KOT A;  2GGZ A;  2JT8 A;  2FCD A;  3DF0 A;  2ZN8 A;  1E8A A;  1OOJ A;  3NSK A;  5DKR A;  4MLW A;  1OQP A;  4C0K A;  2Y1N A;  1OSA A;  4N1G A;  1S5G Y;  3CWG A;  4GUK A;  3BXK A;  3NSL A;  2MA2 A;  4PHN A;  2GV5 A;  1YR5 A;  2NXQ A;  1K94 A;  2BBN A;  2G2B A;  3EKH A;  1M46 A;  2WCF A;  1DJZ A;  1U5I A;  1GQM A;  2F2O A;  1M31 A;  1B8C A;  1NSH A;  2K2F A;  2OTG B;  4PHK A;  5K89 A;  2CT9 A;  1QJT A;  1XFY O;  2WOS A;  4PAL A;  5HKW A;  4PE4 A;  4PE0 A;  4BY5 A;  1SY9 A;  3DVJ A;  1X02 A;  4CFR A;  2KSP A;  4ORA B;  1LA3 A;  2CXJ A;  1AVS A;  2PRU A;  2L0P A;  2F3Z A;  1M39 A;  1WY9 A;  5HKY A;  4AQI A;  1LKJ A;  2FCE A;  2LAP A;  4NDD A;  1A4P A;  4ZCV A;  1WLZ A;  5I8N A;  1EJ3 A;  2L51 A;  2K61 A;  4CID A;  1Y1X A;  1LVC D;  1QLK A;  1A75 B;  1DMO A;  1CDN A;  3CTN A;  2PAS A;  1HQV A;  3KPX A;  1DJW A;  4WQ2 A;  5ER4 X;  5HLV A;  2JTT A;  1B1G A;  3O2P A;  2OS8 B;  3BUN B;  2LP2 A;  1YVH A;  2QPT A;  2LV7 A;  5B8I B;  1LA0 A;  2TN4 A;  2GGM A;  1IWQ A;  3OX6 A;  3CR4 X;  3O78 A;  1TCO B;  1BOD A;  1S5G Z;  1Y1U A;  2M49 B;  3JVT B;  2KI4 C;  5JOL A;  4BY4 A;  1KQV A;  1OE9 B;  1EL4 A;  2P6B B;  3O4Y A;  2K7D A;  1UHK A;  1N2D A;  1R6P A;  2B1U A;  1A29 A;  3SIA A;  2ZKM X;  1MF8 B;  5HLO A;  1IH0 A;  3PFV A;  2AAO A;  1NCY A;  1JFJ A;  2K0J A;  4MVF A;  1NUB A;  1RK9 A;  4YGA A;  3SG6 A;  1CDP A;  1NP8 A;  1XFV O;  5IBW A;  3C1V A;  4GFT A;  3PM8 A;  2HET A;  4E68 A;  1LIN A;  1JSA A;  5CSI A;  1CDL A;  3LLE A;  2AMI A;  1KFX L;  3I5I B;  1CKK A;  4XYN A;  3TUY B;  2BE6 A;  2LVI A;  2PVB A;  1J55 A;  1JBA A;  4OKH A;  1UP5 A;  1WDC C;  2KI6 D;  2Q4U A;  3AAJ A;  1CFC A;  3I5H C;  1YTZ C;  3DF0 B;  5I2L A;  1NX0 A;  3LCP C;  5I2Q A;  1N0Y A;  5CSF A;  2BEC A;  1FBV A;  1QXP A;  2L4I A;  1TNX A;  3D10 A;  3GK1 A;  3BQ3 A;  2OPO A;  1CTR A;  1F4Q A;  1L2O C;  2EHB A;  4MSP A;  3PN7 B;  2KAX A;  1U5I B;  2BE4 A;  3OB1 B;  1SL7 A;  3DVK A;  2M0R A;  3LK1 A;  4I5L B;  1DJH A;  1NWD A;  2F8P A;  1K95 A;  3GOF A;  1QTX A;  1BMO A;  3SIB A;  4XJK A;  1DT7 B;  1BOC A;  4GAO A;  2K2A A;  1TOP A;  1YRU B;  3SG3 A;  2JNF A;  1ZUZ A;  4HRH A;  1BJF A;  2JC2 A;  2JXC A;  4NQG A;  1CLB A;  2KBI A;  2MAZ A;  2K7B A;  4YGE B;  1FI5 A;  3KHE A;  4PHJ A;  4YRU A;  1CMG A;  3I5F C;  2Y1M A;  1TNQ A;  1SNL A;  1SW8 A;  3FS7 A;  2F33 A;  1OMD A;  4CFQ A;  3LK0 A;  5HKZ A;  3MSE B;  1WLM A;  1B8R A;  1MHO A;  2HF5 A;  5KSZ A;  1TNW A;  4USL A;  2WCE A;  2LVV A;  5I2O A;  4F0Z B;  4M2Q A;  1PRW A;  3OB2 B;  3PSR A;  4PE1 A;  1RRO A;  4MRX A;  3M0W A;  1SBJ A;  2KFH A;  1PAL A;  2QAC A;  4YI8 A;  5D7F A;  1MUX A;  1SK6 D;  1QAT A;  3VGO A;  1CDM A;  1B8L A;  4DS7 A;  1KK8 B;  2KI4 B;  3AKA A;  2DOQ A;  1XFX O;  3VRR A;  2BKI B;  3WXA A;  3TDZ A;  2L2E A;  2EC6 C;  3OP0 A;  1PVA A;  1JWD A;  5ER5 A;  4PE7 A;  2KDH A;  4MZL A;  1L7Z A;  2M9G A;  2WC8 A;  2SCP A;  1SMG A;  5CPV A;  1YUT A;  3TS5 B;  5JJG A;  1CMF A;  1SCV A;  1IG5 A;  1IJ5 A;  1XK4 C;  2HPS A;  2MBX A;  2LMT A;  2Q91 A;  1J1E A;  1SR6 C;  1NX2 A;  4PDZ A;  1Y0V H;  1PSB A;  1NYA A;  1TNP A;  1SCM B;  1WDC B;  1GGZ A;  3IF7 A;  1KQM C;  3WHT B;  1XK4 A;  4MRY A;  1AJ4 A;  2M1U A;  4IL1 A;  4MEW A;  4WRI A;  1UWO A;  3ICB A;  5TNC A;  1QLS A;  2O60 A;  2WND A;  1L2O B;  5AAN A;  2WCB A;  3NSI A;  4MZJ A;  1EXR A;  1TRF A;  4ORC B;  1KWO C;  1S3P A;  1XO5 A;  2CNP A;  1S26 D;  4XJK B;  4GNK B;  1CFF A;  4FTG A;  3D0Y A;  1QX2 A;  2I2R E;  1QV0 A;  1RFJ A;  4GGF C;  1W7J B;  1KSM A;  2M8U A;  3SG7 A;  1LXF C;  1WRZ A;  4ZCU A;  1IQ3 A;  2O5G A;  2I7A A;  2JOJ A;  3JTD C;  1CFP A;  4WQ3 A;  3SG5 A;  2LLU A;  2BKH B;  2KGB C;  4A4B A;  1Q80 A;  1QX7 A;  1HT9 A;  1JUO A;  1G8I A;  4GGF A;  1N65 A;  1K90 D;  3DD4 A;  2E6W A;  2BL0 B;  1C7V A;  1M63 B;  3I5G B;  1AHR A;  3CS1 A;  1IQ5 A;  3OX5 A;  4NDB A;  4YI9 A;  3ZNI A;  1QAS A;  5GQQ C;  2MLF C;  3FWC A;  1YRT B;  2BBM A;  2F2P A;  4N5X A;  1KCY A;  1ALV A;  3PAL A;  2K7O A;  3DVM A;  3IQQ A;  2PSR A;  1PUL A;  1YUR A;  4DCK A;  3O6B A;  2KGR A;  1AK8 A;  4M2P A;  3RM1 A;  3ZWH A;  1JFK A;  1MQ1 A;  2LC5 A;  4DUQ A;  2D8N A;  1Y6W A;  3VRQ A;  2L4H A;  2EGD A;  2KQY A;  2KBM A;  1EG4 A;  3EVV A;  2MHH A;  1BR1 B;  3OHM B;  2FJU B;  2IS9 A;  5BPJ A;  1J1D A;  2AUC A;  4MBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...