2WORA

Co-structure of s100a7 with 1,8 ans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
b'SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A7
publication title Identification and Characterization of Binding Sites on S100A7, a Participant in Cancer and Inflammation Pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 36
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2worA00
1SMGA 1B8LA 1QLKA 1YTZC 2M1KB 3I5GB 1SL7A 1DT7B 3VRQA 2BBMA 1NX2A 4PDZA 2H61A 1GGZA 2BE4A 1YR5A 1F70A 2KQYA 1TIZA 1B7TZ 4FTGA 3MSEB 2KNEA 2KI6C 2ZFDA 1IH0A 2GGMA 3I5HC 1OQPA 2JT3A 4MN0A 1X02A 1C7WA 2M1UA 3PFVA 1K8UA 2LHLA 4PE1A 2EC6C 1K94A 3OB1B 2LVVA 1EL4A 3EK8A 4N5XA 1QIWA 2LVIA 5I2OA 4C0KA 1QLSA 3I5HB 1F4OA 1XK4A 3LL8B 3SG3A 4ZCUA 1TNWA 4HSZA 4ETOA 4CFQA 3BUOB 1Q80A 1QX7A 2JT8A 1NYAA 4JPZB 5GQQC 3SG6A 4F0ZB 4I5JA 1B47A 5HKZA 1KWOC 1QIVA 5CSIA 3SIAA 1F71A 4D1EA 3HX4A 2G9BA 4NQGA 4QJ4B 1WDCC 1YVHA 1YX7A 1K2HA 1DF0A 1XO5A 3PATA 4JQ0D 3DVJA 4XJKB 1IQ3A 4WRIA 1DMOA 2LLUA 2ZRTA 3TUYC 1DTLA 4GAOA 1SW8A 1G4YR 2WCBA 2M8UA 3CZTX 3TZ1A 1KK8B 1WDCB 2KAXA 1M31A 2LMUA 3IQOA 1R2UA 2HPSA 1KFUS 2M0RA 2O5GA 3I5IC 1TTXA 2CXJA 3AKBA 2LUXA 1UHNA 1V1GA 2JXLA 2LV7A 2WC8A 2MAZA 2NCOA 3BUNB 1OSAA 2NZ0A 2SASA 1ZFSA 1NSHA 2L5XB 2L2EA 2Y1NA 2D8NA 1AUIB 1A03A 2HETA 2BCXA 1FI6A 2CT9A 1SRAA 4UPGA 2KQ6A 1RTP1 2KBMA 3LK1A 4CIDA 1NIWA 1KQMB 2JT0A 3ZWHA 1EXRA 5PALA 2BCBA 4MSPA 2KAYA 3CTNA 1QATA 2L0PA 4DCKA 3BUMB 3PALA 1DJXA 1NP8A 3FIAA 4MVFA 1BG1A 1A29A 3KHEA 1Y1AA 1LVCD 1MHOA 1U5IA 3PN7C 5I2LA 1OMDA 2E6WA 3EKHA 4DS7A 1CMGA 5AFPA 2FJUB 5J3XA 3A8RA 1CKKA 2M7LA 4GPLB 1SK6D 2MLEC 1G33A 1BJFA 1J7OA 4I5KA 2K2FA 2ZNDA 2K7BA 1QTXA 1K9PA 1JF2A 1IQ5A 1RECA 3ICBA 1SR6C 5AEQA 2E30A 2FCEA 2LHIA 2V53A 2LVJA 1WY9A 1XA5A 4GNKB 1M45A 1PULA 2BL0B 4OVNF 1IKUA 3BYAA 1C7VA 2FOTA 2BECA 1W7JB 2KSPA 3O2PA 2ZN8A 1IJ5A 3I5GC 3KF9A 1ZMZA 1BODA 3I5FB 2PSRA 1NUBA 1CLLA 2AMIA 1YUTA 3FWCA 4YGBB 1K93D 1NX0A 3VRRA 4ORBB 1QASA 2MA2A 4I5LB 1BOCA 4ZCVA 2JXCA 2JU0A 1XK4C 1RROA 1ALVA 1N2DA 2KGRA 2I7AA 3LLEA 1MWNA 1S3PA 3AKAA 4GUKA 1KFXL 5HKWA 1AVSA 3CLNA 2KBIA 1LXFC 3D10A 1S36A 1DGVA 2HQWA 1XVJA 1TCFA 3CS1A 4P5OE 1NX3A 3HCMA 1MR8A 1N0YA 3NSKA 4OCIA 2WORA 1RJVA 2Y1MA 1MQ1A 5I8NA 1M63B 4YI8A 4YGAA 1FPWA 3O78A 4YBHB 5CSJA 1XFZO 2JPTA 2LMTA 1XFXO 1QXPA 4GGFC 1FI5A 1A4PA 2OTGB 4N1GA 1DF0B 1HQVA 1DJIA 1R6PA 4L9MA 4MZKA 1QX5B 1TCOB 4FQOA 1OMVA 1SKTA 2M3WA 1B8RA 1A75B 1JUOA 1NCZA 4M2OA 4CPVA 1F4QA 2KI4C 3OP0A 3CR5X 4M2QA 1S5GY 5CSFA 5HLVA 4PALA 1KK7Z 2GGZA 5TNCA 3WHTB 1KK8C 5HLOA 1TNPA 1MXLC 4A4BA 1HT9A 3BUXB 1CDPA 2F33A 2KI4B 1SY9A 1MXEA 1N65A 1A75A 2JRFA 5G08A 1SCMB 2JOJA 4YGDB 1CMFA 1QVIZ 1JBAA 5F6TA 1F55A 1BMOA 2ZNEA 2L4IA 1CFCA 1J55A 2KYCA 3D0YA 4N1FA 4DUQA 1C07A 1G8IA 2PALA 1SCVA 1CDMA 2I94A 4YRUA 1B7TY 1CDNA 1J1EA 1DJZA 2LE9B 2K8MB 1K96A 1J7QA 3BQ3A 1H4BA 5BPJA 3OHMB 2KOTA 3DVKA 5IBWA 1KQMC 1QV1A 2NLNA 1EH2A 1H8BA 4WQ3A 1ALWA 1K95A 1EG4A 3BUWB 4OKHA 3JTDB 1KFXS 2MJWB 1XFWO 2JTZA 2G2BA 1SNLA 3PM8A 1SPYA 1U5IB 1CFPA 3TDUA 2F3ZA 1QJTA 1DJYA 2AUCA 1SL8A 1S6IA 3K21A 5ER4X 1K9UA 2LM5A 1WLZA 1B8CA 1NCXA 4CLNA 3BOWA 1IWQA 1GGWA 1DJHA 1YRUB 1Y6WA 2JC2A 2KGBC 5K89A 1Y1UA 4HRHA 5CSNA 2QPTA 3IF7A 1LINA 1OE9B 3IQQA 2K61A 1QVIY 1UHKA 2BL0C 2KFGA 2KI6D 4M2PA 1KQVA 1A2XA 2L50A 2M7NA 2LNKA 4YGEB 1FW4A 1CM4A 4BY5A 1TOPA 1ZUZA 3AAJA 3OX5A 3TS5B 1JWDA 4DIRA 2H61C 3I5FC 2P6BB 4PHKA 5HYDA 1PALA 4YGCB 5KTYA 1AJ4A 1WRLA 2LLTA 4PE0A 2KDHA 2NCPA 2MHHA 3DVEA 2WCFA 4JWQA 1GQMA 2PVBA 2JQ6A 4OV2A 2L51A 1M39A 3DVMA 3RM1A 1L2OB 2SCPA 1FF1A 5FYXA 2JNFA 1YRTB 2L4HA 3OX6A 3WXAA 3VRNA 4AOMA 4TNCA 3VRPA 2DOQA 2K0JA 2CBLA 4IL1A 2JNXA 1IJ6A 1B4CA 1PVBA 1CM1A 1WRZA 2LCPA 3PSRA 1YURA 5AERA 2LAPA 1FBVA 1K9KA 2LMVA 1SYMA 4OR9B 1J7RA 1V1FA 4PE4A 4MZJA 1EG3A 2ZN9A 3SG5A 1Y1XA 1WRKA 1PRWA 5CPVA 3DF0A 1PSRA 3EKJA 4E68A 2EGDA 2HF5A 2OTGC 4PHNA 5DKQA 2R2IA 2I2RE 3OB2B 4Q04A 1TN4A 2B1UA 3FWBA 4MLWA 2BKHB 2BBNA 1S6CA 2HQ8A 3JVTB 2Q4UA 3NXAA 3FS7A 1IG5A 4AQJA 1DJGA 1XFVO 2COLB 3CR4X 2I18A 2LC5A 2MRDA 1WLMA 1CLMA 1NCYA 2WOSA 3PLFB 1RWYA 2ZRSA 3EK4A 4DRWA 4U8DA 1PVAA 1K90D 5B8IB 2CCMA 1BLQA 1S1EA 2LP2A 4MRXA 5D7FA 2GV5A 1CFFA 1OMRA 2CTNA 2JWWA 3BXKA 1SCMC 1NWDA 1AHRA 3CGAA 3WHUB 3LK0A 1AP4A 1OZSA 3D0YB 3SG7A 1QX2A 3NSLA 2BCAA 4PE7A 2K7CA 4CFRA 5D69A 5DKNA 1KSOA 2LVKA 4GBAA 5KSZA 4C0JA 3TDZA 2A4JA 2F2PA 1DGUA 1RFJA 1ZOTB 1BR4B 2K7OA 2WNDA 4PHMA 4R1EA 1CDLA 1IRJA 2EC6B 4ORAB 2M29A 1PSBA 2VRGA 1YUUA 3F45A 2AAOA 3SG4A 3SJSA 2Y5IA 3JTDC 1KCYA 3RLZA 1CFDA 1QV0A 1TNXA 1XFYO 2ZKMX 2M49B 1UURA 1TNQA 1KWOB 4MZLA 3AAKA 2M9GA 1KSMA 2Y4QA 2O60A 4AQIA 4ORCB 1TRFA 3BOWB 1BU3A 1UP5A 1W7IB 2K7DA 3GK1A 4GGFA 5ER5A 3SIBA 5JJGA 2MLFC 2LLSA 5HKYA 1UHJA 1MUXA 4NDCA 1JF0A 3EK7A 3VGOA 3ZNIA 2Q91A 4GGNA 4PCWA 5DKRA 3TUYB 1UWOA 2BKIB 5AXIA 3WNXB 4A4CA 4XJKA 1ODBA 4NDBA 3H4SE 1J7PA 2LUCA 1CLBA 4ICBA 1PK0D 2F3YA 4C0LA 1CNPA 1KK7Y 1LA0A 1XYDA 1LA3A 3I5IB 4WQ2A 2KAVA 2OS8C 3GOFA 1QS7A 4BY4A 3DD4A 3KO0A 3NSIA 1YVLA 3C1VA 4I5NB 1B9AA 2L98A 2K2AA 4MBEA 3EVRA 1F8HA 1NPQA 2BE6A 3LCPC 3TS5C 1SBJA 2EHBA 3TDIA 2JULA 1RK9A 2CNPA 1SL9A 1E8AA 1ZACA 1MF8B 2OS8B 1YX8A 2ISDA 4PHJA 2JTTA 2KYFA 3CR2A 4NDDA 2WCEA 1S26D 4USLA 2LP3A 5I2QA 2PMYA 1YUSA 3QRXA 4HRGA 1CTRA 3EVVA 1L2OC 1JSAA 2F2OA 5KU1A 3SG2A 1BR1B 1IGVA 1BT6A 1UUSA 2RGIA 4MEWA 2TN4A 2M97A 1LKJA 2IS9A 2JZIA 2NXQA 3E3RA 5JOLA 2F8PA 1L7ZA 1OOJA 2KHNA 4QJ5B 2PRUA 3GK4X 5AANA 1J1DA 1M46A 2FCDA 4MRYA 2MBXA 3KPXA 1Y0VH 3PN7B 1BF5A 1DJWA 1UHHA 3DF0B 2KFFA 1GJYA 3GK2A 3NSOA 3KEVA 1XFUO 2OPOA 3A4UB 3O4YA 2H2KA 1NX1A 1D1OA 2KFHA 1OZOA 4HREE 2LANA 1CB1A 4GFTA 1UHIA 4QJ3B 3VROA 1F54A 1KFUL 3M0WA 1SR6B 1JFKA 1B1GA 2QACA 3EVUA 1JFJA 1VRKA 1DVIA 3JVTC 1S5GZ 1AK8A 1AJ5A 3CWGA 4XYNA 1EJ3A 1JC2A 1S6JA 3O6BA 4P2YB 2PASA 4YI9A
chains in the Genus database with same CATH superfamily
1SMGA 1B8LA 1QLKA 1YTZC 2M1KB 5DICA 3I5GB 1SL7A 1DQEA 1DT7B 3VRQA 2BBMA 1GM0A 1NX2A 4PDZA 1T14A 2H61A 1GGZA 2BE4A 1YR5A 3D78A 5FI2A 1F70A 2BNXA 2KQYA 1LS8A 1TIZA 1B7TZ 4FTGA 3MSEB 2KNEA 2KI6C 2WCMA 2ZFDA 1IH0A 2GGMA 3I5HC 1OQPA 1ORGA 2JT3A 2PQLA 1X02A 4MN0A 1C7WA 2M1UA 3PFVA 1K8UA 3UO9A 2LHLA 4PE1A 2EC6C 1K94A 3L4LA 2LVVA 3OB1B 1EL4A 3EK8A 4N5XA 1QIWA 2LVIA 5I2OA 4C0KA 1P28A 1QLSA 3I5HB 1F4OA 3NHTA 1XK4A 3LL8B 3SG3A 2WCKA 4ZCUA 1TNWA 4HSZA 4ETOA 2P71A 4CFQA 4OZDA 3BUOB 1Q80A 1QX7A 2JT8A 1NYAA 4JPZB 4INXA 5GQQC 3SG6A 4I5JA 4F0ZB 1B47A 5HKZA 1KWOC 3NGVA 1QIVA 5CSIA 3SIAA 3K1EA 1F71A 4D1EA 3HX4A 2G9BA 4NQGA 4QJ4B 1WDCC 1YVHA 1YX7A 1K2HA 2L2CA 1DF0A 1XO5A 3PATA 4JQ0D 3DVJA 4XJKB 5FI7A 1IQ3A 4WRIA 1XFRA 1DMOA 2LLUA 2ZRTA 3TUYC 1DTLA 4GAOA 1SW8A 1G4YR 2WCBA 2M8UA 3R1PA 3CZTX 3TZ1A 1KK8B 1WDCB 2KAXA 1M31A 2LMUA 3IQOA 1R2UA 2HPSA 1KFUS 2M0RA 2O5GA 3I5IC 1TTXA 2CXJA 3AKBA 2LUXA 1UHNA 1V1GA 2JXLA 2LV7A 2WC8A 2MAZA 2NCOA 3BUNB 2QEBA 1OSAA 2NZ0A 3B6XA 2SASA 1ZFSA 1NSHA 2L5XB 2L2EA 2Y1NA 2D8NA 1AUIB 1A03A 2HETA 2BCXA 1FI6A 2CT9A 1SRAA 4UPGA 2KQ6A 1RTP1 3DZTA 4KYNA 2KBMA 3LK1A 4CIDA 1NIWA 1KQMB 2QEOA 5FI6A 2JT0A 3ZWHA 1EXRA 5PALA 4INWA 2BCBA 4MSPA 2KAYA 3CTNA 4IJ7A 1QATA 2L0PA 4DCKA 3BUMB 3PALA 1DJXA 1NP8A 3FIAA 4MVFA 1BG1A 1A29A 1QWVA 1Y1AA 1LVCD 3KHEA 1MHOA 1U5IA 3PN7C 5I2LA 1OMDA 2E6WA 3EKHA 4DS7A 1CMGA 5AFPA 2FJUB 5J3XA 3A8RA 1CKKA 3R72A 2M7LA 4GPLB 1SK6D 2MLEC 1G33A 1BJFA 1J7OA 4I5KA 2K2FA 2ZNDA 2K60A 2K7BA 1QTXA 1K9PA 1JF2A 1IQ5A 1RECA 3ICBA 2WCLA 5I94A 1SR6C 5AEQA 2E30A 2FCEA 2LHIA 3OBVA 2V53A 2LVJA 1WY9A 1XA5A 1IIOA 4GNKB 1M45A 1PULA 2BL0B 4OVNF 3FE8A 1IKUA 3BYAA 1C7VA 2FOTA 2BECA 1W7JB 2KSPA 3O2PA 2ZN8A 1IJ5A 3I5GC 3KF9A 1ZMZA 2H8VA 1BODA 3I5FB 2PSRA 1NUBA 1CLLA 2AMIA 1YUTA 2QDIA 3FWCA 4YGBB 1K93D 1NX0A 3VRRA 4ORBB 1QASA 2MA2A 4I5LB 3CABA 1BOCA 4ZCVA 2JXCA 1SSEB 2JU0A 1XK4C 1RROA 1ALVA 3S0BA 1N2DA 2KGRA 2I7AA 3LLEA 1MWNA 1S3PA 3AKAA 4GUKA 1KFXL 5HKWA 1AVSA 3CLNA 2KBIA 1LXFC 3D77A 3R1OA 3D10A 1S36A 1DGVA 2HQWA 3CZ1A 1XVJA 1TCFA 3CS1A 4P5OE 1NX3A 3HCMA 1MR8A 1N0YA 3NSKA 5HL1A 1OOGA 2QEHA 4OCIA 2WORA 1RJVA 2Y1MA 1MQ1A 5I8NA 1M63B 3B86A 4YI8A 4YGAA 1FPWA 2KLEA 3D76A 3O78A 1DELA 4YBHB 5CSJA 1C3ZA 1XFZO 2JPTA 2LMTA 1XFXO 1QXPA 4GGFC 3S0GA 3SS4A 1A4PA 2OTGB 4N1GA 1DF0B 1FI5A 1HQVA 1DJIA 1R6PA 4L9MA 4MZKA 1QX5B 1TCOB 4FQOA 1OMVA 1SKTA 1Z2CB 3BFBA 2M3WA 1B8RA 1A75B 1JUOA 1NCZA 4M2OA 4CPVA 1F4QA 2KI4C 3OP0A 3CR5X 4M2QA 1S5GY 5CSFA 5HLVA 4PALA 1KK7Z 2GGZA 3CDNA 5TNCA 1KK8C 5HLOA 3WHTB 4F7FA 1TNPA 1MXLC 3BFAA 4A4BA 1HT9A 3BUXB 1CDPA 2F33A 3OGNA 2KI4B 1TUJA 1SY9A 1MXEA 1N65A 1A75A 2JRFA 5G08A 1SCMB 2JOJA 4YGDB 1CMFA 1QVIZ 1JBAA 5F6TA 1F55A 1BMOA 2ZNEA 2L4IA 2FJYA 1DC1A 1CFCA 1J55A 2KYCA 3D0YA 3DXLA 4N1FA 4DUQA 3PJIA 1C07A 1G8IA 2PALA 3DYEA 1SCVA 1CDMA 2I94A 4YRUA 1B7TY 1CDNA 1J1EA 3CZ2A 1DJZA 2LE9B 3O4XA 2K8MB 2ERBA 1K96A 1J7QA 5EL2A 3BQ3A 1H4BA 5BPJA 3OHMB 2KOTA 1C3YA 3DVKA 5IBWA 2PYQA 1KQMC 1QV1A 2NLNA 1EH2A 1H8BA 4WQ3A 3DY9A 1ALWA 1K95A 1EG4A 3BUWB 4OKHA 3JTDB 1KFXS 2GTEA 2MJWB 1XFWO 2JTZA 2G2BA 1SNLA 3PM8A 1SPYA 1U5IB 4PT1A 1CFPA 3TDUA 2F3ZA 1QJTA 1DJYA 3QMEA 2AUCA 3S0FA 1SL8A 1S6IA 3K21A 5ER4X 1K9UA 2LM5A 1WLZA 3Q8IA 1B8CA 1NCXA 4CLNA 3BOWA 1IWQA 1GGWA 4JKTA 3D73A 1DJHA 1YRUB 1Y6WA 2JC2A 2KGBC 5K89A 1Y1UA 4HRHA 5CSNA 2QPTA 3IF7A 1LINA 1OE9B 3IQQA 1DEKA 2K61A 1QVIY 1UHKA 2BL0C 2KFGA 2KI6D 3CZ0A 4M2PA 1A2XA 1KQVA 2L50A 2M7NA 3VB1A 2LNKA 4YGEB 1FW4A 1CM4A 4BY5A 1TOPA 1ZUZA 3AAJA 3OX5A 3TS5B 1JWDA 4DIRA 2H61C 3I5FC 2P6BB 4PHKA 5HYDA 1PALA 4YGCB 5KTYA 1AJ4A 1WRLA 2LLTA 4PE0A 2KDHA 1OW4A 2MHHA 2NCPA 3DVEA 2WCFA 1W9ZA 4JWQA 3RZSA 1GQMA 2PVBA 2JQ6A 3BFHA 2L51A 1M39A 3B7AA 4OV2A 1Z4HA 3DVMA 3RM1A 1L2OB 2SCPA 1FF1A 5FYXA 2JNFA 1YRTB 2L4HA 3OX6A 3WXAA 3VRNA 4AOMA 4TNCA 3VRPA 2DOQA 2KPHA 2K0JA 2WCHA 3UNWA 2CBLA 4IL1A 2JNXA 1IJ6A 1B4CA 1PVBA 1CM1A 1WRZA 2LCPA 3PSRA 5D3OA 1YURA 3SS5A 5AERA 2LAPA 1FBVA 1K9KA 2LMVA 1SYMA 3D75A 1J7RA 1V1FA 4OR9B 4PE4A 4MZJA 1EG3A 2ZN9A 4FQTA 1OOIX 1Y1XA 3SG5A 1WRKA 1PRWA 1OOFA 5CPVA 3DF0A 1PSRA 3EKJA 4E68A 2EGDA 2HF5A 2OTGC 4PHNA 3NHIA 5DKQA 3S0EA 2R2IA 2I2RE 3OB2B 4Q04A 3L4AA 1TN4A 2B1UA 3FWBA 4MLWA 3SS3A 2BKHB 2BBNA 1S6CA 2HQ8A 3JVTB 2Q4UA 3L47A 3FS7A 1IG5A 2P70A 3NXAA 4AQJA 1DJGA 1XFVO 2COLB 3CR4X 2I18A 2LC5A 2MRDA 1WLMA 1CLMA 1NCYA 2WOSA 3PLFB 3R1VA 1RWYA 2ZRSA 3EK4A 4DRWA 3IVTA 3PM2A 1PVAA 4U8DA 1K90D 5B8IB 2CCMA 1BLQA 1S1EA 2LP2A 4MRXA 5D7FA 2GV5A 1CFFA 1OMRA 2CTNA 2JWWA 3BXKA 1SCMC 1NWDA 1AHRA 2KLDA 2WC6A 3CGAA 3LK0A 3WHUB 1AP4A 1OZSA 3D0YB 3SG7A 1QX2A 3NSLA 2BCAA 4PE7A 2K7CA 4CFRA 5D69A 5DKNA 3FE6A 1KSOA 2LVKA 4GBAA 5KSZA 4C0JA 3B87A 3TDZA 2A4JA 2F2PA 1DGUA 1RFJA 1ZOTB 1BR4B 2K7OA 2WNDA 4PHMA 4R1EA 1CDLA 1IRJA 1TWOA 2EC6B 4ORAB 2M29A 1PSBA 2VRGA 1YUUA 3F45A 2AAOA 3SG4A 3SJSA 3BJHA 2Y5IA 3B88A 3S0DA 3JTDC 2YGUA 1KCYA 3RLZA 1CFDA 1QV0A 1TNXA 1XFYO 2WCJA 2ZKMX 2M49B 1UURA 1TNQA 1KWOB 4MZLA 3AAKA 2M9GA 1KSMA 2Y4QA 2O60A 4AQIA 4ORCB 1TRFA 3BOWB 1BU3A 1UP5A 1W7IB 2K7DA 3GK1A 4GGFA 5ER5A 3SIBA 5JJGA 2MLFC 2LLSA 5HKYA 1UHJA 1MUXA 4NDCA 1JF0A 3EK7A 3VGOA 3ZNIA 2Q91A 4GGNA 3FE9A 4PCWA 5DKRA 3TUYB 1UWOA 2BKIB 5AXIA 3WNXB 3V2LA 4XJKA 4A4CA 1ODBA 4NDBA 3H4SE 1J7PA 2LUCA 1CLBA 4ICBA 1PK0D 2F3YA 4C0LA 1CNPA 1KK7Y 1LA0A 1XYDA 1LA3A 3I5IB 4JD9A 4WQ2A 2KAVA 2OS8C 3GOFA 3D74A 1QS7A 4BY4A 3DD4A 3KO0A 3NSIA 1YVLA 3C1VA 4I5NB 1B9AA 2L98A 2K2AA 4MBEA 3EVRA 1F8HA 1NPQA 2BE6A 3LCPC 3TS5C 1SBJA 2EHBA 3TDIA 2JULA 1RK9A 2CNPA 1SL9A 1E8AA 1ZACA 1MF8B 2OS8B 1YX8A 2ISDA 4PHJA 2JTTA 2KYFA 3CR2A 4NDDA 2WCEA 1S26D 3EG5B 2LP3A 4USLA 5I2QA 2PMYA 1YUSA 3QRXA 4HRGA 1CTRA 3EVVA 3N7HA 1L2OC 1JSAA 2QEVA 2F2OA 5KU1A 3SG2A 1BR1B 1IGVA 1BT6A 1UUSA 2RGIA 4MEWA 2TN4A 2M97A 1LKJA 2IS9A 2JZIA 2NXQA 3CYZA 3E3RA 2F8PA 5JOLA 1L7ZA 1OOJA 2KHNA 4QJ5B 2PRUA 2WC5A 1OOHA 3GK4X 5AANA 1J1DA 1M46A 2FCDA 4MRYA 2MBXA 3KPXA 1Y0VH 3PN7B 1BF5A 1DJWA 1UHHA 3DF0B 1TUZA 2KFFA 1GJYA 2BAPA 3GK2A 3NSOA 3KEVA 1XFUO 2OPOA 3A4UB 3O4YA 2H2KA 1NX1A 1D1OA 2L5YA 2KFHA 1OZOA 4HREE 2LANA 1CB1A 4GFTA 1UHIA 4QJ3B 3VROA 1F54A 1KFUL 3M0WA 1SR6B 1JFKA 1B1GA 2QACA 3EVUA 1JFJA 1VRKA 1DVIA 3JVTC 1S5GZ 1AK8A 1AJ5A 3CWGA 4XYNA 1EJ3A 1JC2A 1S6JA 3O6BA 3S0AA 4P2YB 2JPOA 2PASA 4YI9A
chains in the Genus database with same CATH topology
1SMGA 1B8LA 1QLKA 1YTZC 2M1KB 3I5GB 1SL7A 1DT7B 3VRQA 2BBMA 1NX2A 4PDZA 2H61A 1GGZA 2BE4A 1YR5A 1F70A 2KQYA 1TIZA 1B7TZ 4FTGA 3MSEB 2KNEA 2KI6C 2ZFDA 1IH0A 2GGMA 3I5HC 1OQPA 2JT3A 4MN0A 1X02A 1C7WA 2M1UA 3PFVA 1K8UA 2LHLA 4PE1A 2EC6C 1K94A 3OB1B 2LVVA 1EL4A 3EK8A 4N5XA 1QIWA 2LVIA 5I2OA 4C0KA 1QLSA 3I5HB 1F4OA 1XK4A 3LL8B 3SG3A 4ZCUA 1TNWA 4HSZA 4ETOA 4CFQA 3BUOB 1Q80A 1QX7A 2JT8A 1NYAA 4JPZB 5GQQC 3SG6A 4F0ZB 4I5JA 1B47A 5HKZA 1KWOC 1QIVA 5CSIA 3SIAA 1F71A 4D1EA 3HX4A 2G9BA 4NQGA 4QJ4B 1WDCC 1YVHA 1YX7A 1K2HA 1DF0A 1XO5A 3PATA 4JQ0D 3DVJA 4XJKB 1IQ3A 4WRIA 1DMOA 2LLUA 2ZRTA 3TUYC 1DTLA 4GAOA 1SW8A 1G4YR 2WCBA 2M8UA 3CZTX 3TZ1A 1KK8B 1WDCB 2KAXA 1M31A 2LMUA 3IQOA 1R2UA 2HPSA 1KFUS 2M0RA 2O5GA 3I5IC 1TTXA 2CXJA 3AKBA 2LUXA 1UHNA 1V1GA 2JXLA 2LV7A 2WC8A 2MAZA 2NCOA 3BUNB 1OSAA 2NZ0A 2SASA 1ZFSA 1NSHA 2L5XB 2L2EA 2Y1NA 2D8NA 1AUIB 1A03A 2HETA 2BCXA 1FI6A 2CT9A 1SRAA 4UPGA 2KQ6A 1RTP1 2KBMA 3LK1A 4CIDA 1NIWA 1KQMB 2JT0A 3ZWHA 1EXRA 5PALA 2BCBA 4MSPA 2KAYA 3CTNA 1QATA 2L0PA 4DCKA 3BUMB 3PALA 1DJXA 1NP8A 3FIAA 4MVFA 1BG1A 1A29A 3KHEA 1Y1AA 1LVCD 1MHOA 1U5IA 3PN7C 5I2LA 1OMDA 2E6WA 3EKHA 4DS7A 1CMGA 5AFPA 2FJUB 5J3XA 3A8RA 1CKKA 2M7LA 4GPLB 1SK6D 2MLEC 1G33A 1BJFA 1J7OA 4I5KA 2K2FA 2ZNDA 2K7BA 1QTXA 1K9PA 1JF2A 1IQ5A 1RECA 3ICBA 1SR6C 5AEQA 2E30A 2FCEA 2LHIA 2V53A 2LVJA 1WY9A 1XA5A 4GNKB 1M45A 1PULA 2BL0B 4OVNF 1IKUA 3BYAA 1C7VA 2FOTA 2BECA 1W7JB 2KSPA 3O2PA 2ZN8A 1IJ5A 3I5GC 3KF9A 1ZMZA 1BODA 3I5FB 2PSRA 1NUBA 1CLLA 2AMIA 1YUTA 3FWCA 4YGBB 1K93D 1NX0A 3VRRA 4ORBB 1QASA 2MA2A 4I5LB 1BOCA 4ZCVA 2JXCA 2JU0A 1XK4C 1RROA 1ALVA 1N2DA 2KGRA 2I7AA 3LLEA 1MWNA 1S3PA 3AKAA 4GUKA 1KFXL 5HKWA 1AVSA 3CLNA 2KBIA 1LXFC 3D10A 1S36A 1DGVA 2HQWA 1XVJA 1TCFA 3CS1A 4P5OE 1NX3A 3HCMA 1MR8A 1N0YA 3NSKA 4OCIA 2WORA 1RJVA 2Y1MA 1MQ1A 5I8NA 1M63B 4YI8A 4YGAA 1FPWA 3O78A 4YBHB 5CSJA 1XFZO 2JPTA 2LMTA 1XFXO 1QXPA 4GGFC 1FI5A 1A4PA 2OTGB 4N1GA 1DF0B 1HQVA 1DJIA 1R6PA 4L9MA 4MZKA 1QX5B 1TCOB 4FQOA 1OMVA 1SKTA 2M3WA 1B8RA 1A75B 1JUOA 1NCZA 4M2OA 4CPVA 1F4QA 2KI4C 3OP0A 3CR5X 4M2QA 1S5GY 5CSFA 5HLVA 4PALA 1KK7Z 2GGZA 5TNCA 3WHTB 1KK8C 5HLOA 1TNPA 1MXLC 4A4BA 1HT9A 3BUXB 1CDPA 2F33A 2KI4B 1SY9A 1MXEA 1N65A 1A75A 2JRFA 5G08A 1SCMB 2JOJA 4YGDB 1CMFA 1QVIZ 1JBAA 5F6TA 1F55A 1BMOA 2ZNEA 2L4IA 1CFCA 1J55A 2KYCA 3D0YA 4N1FA 4DUQA 1C07A 1G8IA 2PALA 1SCVA 1CDMA 2I94A 4YRUA 1B7TY 1CDNA 1J1EA 1DJZA 2LE9B 2K8MB 1K96A 1J7QA 3BQ3A 1H4BA 5BPJA 3OHMB 2KOTA 3DVKA 5IBWA 1KQMC 1QV1A 2NLNA 1EH2A 1H8BA 4WQ3A 1ALWA 1K95A 1EG4A 3BUWB 4OKHA 3JTDB 1KFXS 2MJWB 1XFWO 2JTZA 2G2BA 1SNLA 3PM8A 1SPYA 1U5IB 1CFPA 3TDUA 2F3ZA 1QJTA 1DJYA 2AUCA 1SL8A 1S6IA 3K21A 5ER4X 1K9UA 2LM5A 1WLZA 1B8CA 1NCXA 4CLNA 3BOWA 1IWQA 1GGWA 1DJHA 1YRUB 1Y6WA 2JC2A 2KGBC 5K89A 1Y1UA 4HRHA 5CSNA 2QPTA 3IF7A 1LINA 1OE9B 3IQQA 2K61A 1QVIY 1UHKA 2BL0C 2KFGA 2KI6D 4M2PA 1KQVA 1A2XA 2L50A 2M7NA 2LNKA 4YGEB 1FW4A 1CM4A 4BY5A 1TOPA 1ZUZA 3AAJA 3OX5A 3TS5B 1JWDA 4DIRA 2H61C 3I5FC 2P6BB 4PHKA 5HYDA 1PALA 4YGCB 5KTYA 1AJ4A 1WRLA 2LLTA 4PE0A 2KDHA 2NCPA 2MHHA 3DVEA 2WCFA 4JWQA 1GQMA 2PVBA 2JQ6A 4OV2A 2L51A 1M39A 3DVMA 3RM1A 1L2OB 2SCPA 1FF1A 5FYXA 2JNFA 1YRTB 2L4HA 3OX6A 3WXAA 3VRNA 4AOMA 4TNCA 3VRPA 2DOQA 2K0JA 2CBLA 4IL1A 2JNXA 1IJ6A 1B4CA 1PVBA 1CM1A 1WRZA 2LCPA 3PSRA 1YURA 5AERA 2LAPA 1FBVA 1K9KA 2LMVA 1SYMA 4OR9B 1J7RA 1V1FA 4PE4A 4MZJA 1EG3A 2ZN9A 3SG5A 1Y1XA 1WRKA 1PRWA 5CPVA 3DF0A 1PSRA 3EKJA 4E68A 2EGDA 2HF5A 2OTGC 4PHNA 5DKQA 2R2IA 2I2RE 3OB2B 4Q04A 1TN4A 2B1UA 3FWBA 4MLWA 2BKHB 2BBNA 1S6CA 2HQ8A 3JVTB 2Q4UA 3NXAA 3FS7A 1IG5A 4AQJA 1DJGA 1XFVO 2COLB 3CR4X 2I18A 2LC5A 2MRDA 1WLMA 1CLMA 1NCYA 2WOSA 3PLFB 1RWYA 2ZRSA 3EK4A 4DRWA 4U8DA 1PVAA 1K90D 5B8IB 2CCMA 1BLQA 1S1EA 2LP2A 4MRXA 5D7FA 2GV5A 1CFFA 1OMRA 2CTNA 2JWWA 3BXKA 1SCMC 1NWDA 1AHRA 3CGAA 3WHUB 3LK0A 1AP4A 1OZSA 3D0YB 3SG7A 1QX2A 3NSLA 2BCAA 4PE7A 2K7CA 4CFRA 5D69A 5DKNA 1KSOA 2LVKA 4GBAA 5KSZA 4C0JA 3TDZA 2A4JA 2F2PA 1DGUA 1RFJA 1ZOTB 1BR4B 2K7OA 2WNDA 4PHMA 4R1EA 1CDLA 1IRJA 2EC6B 4ORAB 2M29A 1PSBA 2VRGA 1YUUA 3F45A 2AAOA 3SG4A 3SJSA 2Y5IA 3JTDC 1KCYA 3RLZA 1CFDA 1QV0A 1TNXA 1XFYO 2ZKMX 2M49B 1UURA 1TNQA 1KWOB 4MZLA 3AAKA 2M9GA 1KSMA 2Y4QA 2O60A 4AQIA 4ORCB 1TRFA 3BOWB 1BU3A 1UP5A 1W7IB 2K7DA 3GK1A 4GGFA 5ER5A 3SIBA 5JJGA 2MLFC 2LLSA 5HKYA 1UHJA 1MUXA 4NDCA 1JF0A 3EK7A 3VGOA 3ZNIA 2Q91A 4GGNA 4PCWA 5DKRA 3TUYB 1UWOA 2BKIB 5AXIA 3WNXB 4A4CA 4XJKA 1ODBA 4NDBA 3H4SE 1J7PA 2LUCA 1CLBA 4ICBA 1PK0D 2F3YA 4C0LA 1CNPA 1KK7Y 1LA0A 1XYDA 1LA3A 3I5IB 4WQ2A 2KAVA 2OS8C 3GOFA 1QS7A 4BY4A 3DD4A 3KO0A 3NSIA 1YVLA 3C1VA 4I5NB 1B9AA 2L98A 2K2AA 4MBEA 3EVRA 1F8HA 1NPQA 2BE6A 3LCPC 3TS5C 1SBJA 2EHBA 3TDIA 2JULA 1RK9A 2CNPA 1SL9A 1E8AA 1ZACA 1MF8B 2OS8B 1YX8A 2ISDA 4PHJA 2JTTA 2KYFA 3CR2A 4NDDA 2WCEA 1S26D 4USLA 2LP3A 5I2QA 2PMYA 1YUSA 3QRXA 4HRGA 1CTRA 3EVVA 1L2OC 1JSAA 2F2OA 5KU1A 3SG2A 1BR1B 1IGVA 1BT6A 1UUSA 2RGIA 4MEWA 2TN4A 2M97A 1LKJA 2IS9A 2JZIA 2NXQA 3E3RA 5JOLA 2F8PA 1L7ZA 1OOJA 2KHNA 4QJ5B 2PRUA 3GK4X 5AANA 1J1DA 1M46A 2FCDA 4MRYA 2MBXA 3KPXA 1Y0VH 3PN7B 1BF5A 1DJWA 1UHHA 3DF0B 2KFFA 1GJYA 3GK2A 3NSOA 3KEVA 1XFUO 2OPOA 3A4UB 3O4YA 2H2KA 1NX1A 1D1OA 2KFHA 1OZOA 4HREE 2LANA 1CB1A 4GFTA 1UHIA 4QJ3B 3VROA 1F54A 1KFUL 3M0WA 1SR6B 1JFKA 1B1GA 2QACA 3EVUA 1JFJA 1VRKA 1DVIA 3JVTC 1S5GZ 1AK8A 1AJ5A 3CWGA 4XYNA 1EJ3A 1JC2A 1S6JA 3O6BA 4P2YB 2PASA 4YI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMG A;  1B8L A;  1QLK A;  1YTZ C;  2M1K B;  3I5G B;  1SL7 A;  1DT7 B;  3VRQ A;  2BBM A;  1NX2 A;  4PDZ A;  2H61 A;  1GGZ A;  2BE4 A;  1YR5 A;  1F70 A;  2KQY A;  1TIZ A;  1B7T Z;  4FTG A;  3MSE B;  2KNE A;  2KI6 C;  2ZFD A;  1IH0 A;  2GGM A;  3I5H C;  1OQP A;  2JT3 A;  4MN0 A;  1X02 A;  1C7W A;  2M1U A;  3PFV A;  1K8U A;  2LHL A;  4PE1 A;  2EC6 C;  1K94 A;  3OB1 B;  2LVV A;  1EL4 A;  3EK8 A;  4N5X A;  1QIW A;  2LVI A;  5I2O A;  4C0K A;  1QLS A;  3I5H B;  1F4O A;  1XK4 A;  3LL8 B;  3SG3 A;  4ZCU A;  1TNW A;  4HSZ A;  4ETO A;  4CFQ A;  3BUO B;  1Q80 A;  1QX7 A;  2JT8 A;  1NYA A;  4JPZ B;  5GQQ C;  3SG6 A;  4F0Z B;  4I5J A;  1B47 A;  5HKZ A;  1KWO C;  1QIV A;  5CSI A;  3SIA A;  1F71 A;  4D1E A;  3HX4 A;  2G9B A;  4NQG A;  4QJ4 B;  1WDC C;  1YVH A;  1YX7 A;  1K2H A;  1DF0 A;  1XO5 A;  3PAT A;  4JQ0 D;  3DVJ A;  4XJK B;  1IQ3 A;  4WRI A;  1DMO A;  2LLU A;  2ZRT A;  3TUY C;  1DTL A;  4GAO A;  1SW8 A;  1G4Y R;  2WCB A;  2M8U A;  3CZT X;  3TZ1 A;  1KK8 B;  1WDC B;  2KAX A;  1M31 A;  2LMU A;  3IQO A;  1R2U A;  2HPS A;  1KFU S;  2M0R A;  2O5G A;  3I5I C;  1TTX A;  2CXJ A;  3AKB A;  2LUX A;  1UHN A;  1V1G A;  2JXL A;  2LV7 A;  2WC8 A;  2MAZ A;  2NCO A;  3BUN B;  1OSA A;  2NZ0 A;  2SAS A;  1ZFS A;  1NSH A;  2L5X B;  2L2E A;  2Y1N A;  2D8N A;  1AUI B;  1A03 A;  2HET A;  2BCX A;  1FI6 A;  2CT9 A;  1SRA A;  4UPG A;  2KQ6 A;  1RTP 1;  2KBM A;  3LK1 A;  4CID A;  1NIW A;  1KQM B;  2JT0 A;  3ZWH A;  1EXR A;  5PAL A;  2BCB A;  4MSP A;  2KAY A;  3CTN A;  1QAT A;  2L0P A;  4DCK A;  3BUM B;  3PAL A;  1DJX A;  1NP8 A;  3FIA A;  4MVF A;  1BG1 A;  1A29 A;  3KHE A;  1Y1A A;  1LVC D;  1MHO A;  1U5I A;  3PN7 C;  5I2L A;  1OMD A;  2E6W A;  3EKH A;  4DS7 A;  1CMG A;  5AFP A;  2FJU B;  5J3X A;  3A8R A;  1CKK A;  2M7L A;  4GPL B;  1SK6 D;  2MLE C;  1G33 A;  1BJF A;  1J7O A;  4I5K A;  2K2F A;  2ZND A;  2K7B A;  1QTX A;  1K9P A;  1JF2 A;  1IQ5 A;  1REC A;  3ICB A;  1SR6 C;  5AEQ A;  2E30 A;  2FCE A;  2LHI A;  2V53 A;  2LVJ A;  1WY9 A;  1XA5 A;  4GNK B;  1M45 A;  1PUL A;  2BL0 B;  4OVN F;  1IKU A;  3BYA A;  1C7V A;  2FOT A;  2BEC A;  1W7J B;  2KSP A;  3O2P A;  2ZN8 A;  1IJ5 A;  3I5G C;  3KF9 A;  1ZMZ A;  1BOD A;  3I5F B;  2PSR A;  1NUB A;  1CLL A;  2AMI A;  1YUT A;  3FWC A;  4YGB B;  1K93 D;  1NX0 A;  3VRR A;  4ORB B;  1QAS A;  2MA2 A;  4I5L B;  1BOC A;  4ZCV A;  2JXC A;  2JU0 A;  1XK4 C;  1RRO A;  1ALV A;  1N2D A;  2KGR A;  2I7A A;  3LLE A;  1MWN A;  1S3P A;  3AKA A;  4GUK A;  1KFX L;  5HKW A;  1AVS A;  3CLN A;  2KBI A;  1LXF C;  3D10 A;  1S36 A;  1DGV A;  2HQW A;  1XVJ A;  1TCF A;  3CS1 A;  4P5O E;  1NX3 A;  3HCM A;  1MR8 A;  1N0Y A;  3NSK A;  4OCI A;  2WOR A;  1RJV A;  2Y1M A;  1MQ1 A;  5I8N A;  1M63 B;  4YI8 A;  4YGA A;  1FPW A;  3O78 A;  4YBH B;  5CSJ A;  1XFZ O;  2JPT A;  2LMT A;  1XFX O;  1QXP A;  4GGF C;  1FI5 A;  1A4P A;  2OTG B;  4N1G A;  1DF0 B;  1HQV A;  1DJI A;  1R6P A;  4L9M A;  4MZK A;  1QX5 B;  1TCO B;  4FQO A;  1OMV A;  1SKT A;  2M3W A;  1B8R A;  1A75 B;  1JUO A;  1NCZ A;  4M2O A;  4CPV A;  1F4Q A;  2KI4 C;  3OP0 A;  3CR5 X;  4M2Q A;  1S5G Y;  5CSF A;  5HLV A;  4PAL A;  1KK7 Z;  2GGZ A;  5TNC A;  3WHT B;  1KK8 C;  5HLO A;  1TNP A;  1MXL C;  4A4B A;  1HT9 A;  3BUX B;  1CDP A;  2F33 A;  2KI4 B;  1SY9 A;  1MXE A;  1N65 A;  1A75 A;  2JRF A;  5G08 A;  1SCM B;  2JOJ A;  4YGD B;  1CMF A;  1QVI Z;  1JBA A;  5F6T A;  1F55 A;  1BMO A;  2ZNE A;  2L4I A;  1CFC A;  1J55 A;  2KYC A;  3D0Y A;  4N1F A;  4DUQ A;  1C07 A;  1G8I A;  2PAL A;  1SCV A;  1CDM A;  2I94 A;  4YRU A;  1B7T Y;  1CDN A;  1J1E A;  1DJZ A;  2LE9 B;  2K8M B;  1K96 A;  1J7Q A;  3BQ3 A;  1H4B A;  5BPJ A;  3OHM B;  2KOT A;  3DVK A;  5IBW A;  1KQM C;  1QV1 A;  2NLN A;  1EH2 A;  1H8B A;  4WQ3 A;  1ALW A;  1K95 A;  1EG4 A;  3BUW B;  4OKH A;  3JTD B;  1KFX S;  2MJW B;  1XFW O;  2JTZ A;  2G2B A;  1SNL A;  3PM8 A;  1SPY A;  1U5I B;  1CFP A;  3TDU A;  2F3Z A;  1QJT A;  1DJY A;  2AUC A;  1SL8 A;  1S6I A;  3K21 A;  5ER4 X;  1K9U A;  2LM5 A;  1WLZ A;  1B8C A;  1NCX A;  4CLN A;  3BOW A;  1IWQ A;  1GGW A;  1DJH A;  1YRU B;  1Y6W A;  2JC2 A;  2KGB C;  5K89 A;  1Y1U A;  4HRH A;  5CSN A;  2QPT A;  3IF7 A;  1LIN A;  1OE9 B;  3IQQ A;  2K61 A;  1QVI Y;  1UHK A;  2BL0 C;  2KFG A;  2KI6 D;  4M2P A;  1KQV A;  1A2X A;  2L50 A;  2M7N A;  2LNK A;  4YGE B;  1FW4 A;  1CM4 A;  4BY5 A;  1TOP A;  1ZUZ A;  3AAJ A;  3OX5 A;  3TS5 B;  1JWD A;  4DIR A;  2H61 C;  3I5F C;  2P6B B;  4PHK A;  5HYD A;  1PAL A;  4YGC B;  5KTY A;  1AJ4 A;  1WRL A;  2LLT A;  4PE0 A;  2KDH A;  2NCP A;  2MHH A;  3DVE A;  2WCF A;  4JWQ A;  1GQM A;  2PVB A;  2JQ6 A;  4OV2 A;  2L51 A;  1M39 A;  3DVM A;  3RM1 A;  1L2O B;  2SCP A;  1FF1 A;  5FYX A;  2JNF A;  1YRT B;  2L4H A;  3OX6 A;  3WXA A;  3VRN A;  4AOM A;  4TNC A;  3VRP A;  2DOQ A;  2K0J A;  2CBL A;  4IL1 A;  2JNX A;  1IJ6 A;  1B4C A;  1PVB A;  1CM1 A;  1WRZ A;  2LCP A;  3PSR A;  1YUR A;  5AER A;  2LAP A;  1FBV A;  1K9K A;  2LMV A;  1SYM A;  4OR9 B;  1J7R A;  1V1F A;  4PE4 A;  4MZJ A;  1EG3 A;  2ZN9 A;  3SG5 A;  1Y1X A;  1WRK A;  1PRW A;  5CPV A;  3DF0 A;  1PSR A;  3EKJ A;  4E68 A;  2EGD A;  2HF5 A;  2OTG C;  4PHN A;  5DKQ A;  2R2I A;  2I2R E;  3OB2 B;  4Q04 A;  1TN4 A;  2B1U A;  3FWB A;  4MLW A;  2BKH B;  2BBN A;  1S6C A;  2HQ8 A;  3JVT B;  2Q4U A;  3NXA A;  3FS7 A;  1IG5 A;  4AQJ A;  1DJG A;  1XFV O;  2COL B;  3CR4 X;  2I18 A;  2LC5 A;  2MRD A;  1WLM A;  1CLM A;  1NCY A;  2WOS A;  3PLF B;  1RWY A;  2ZRS A;  3EK4 A;  4DRW A;  4U8D A;  1PVA A;  1K90 D;  5B8I B;  2CCM A;  1BLQ A;  1S1E A;  2LP2 A;  4MRX A;  5D7F A;  2GV5 A;  1CFF A;  1OMR A;  2CTN A;  2JWW A;  3BXK A;  1SCM C;  1NWD A;  1AHR A;  3CGA A;  3WHU B;  3LK0 A;  1AP4 A;  1OZS A;  3D0Y B;  3SG7 A;  1QX2 A;  3NSL A;  2BCA A;  4PE7 A;  2K7C A;  4CFR A;  5D69 A;  5DKN A;  1KSO A;  2LVK A;  4GBA A;  5KSZ A;  4C0J A;  3TDZ A;  2A4J A;  2F2P A;  1DGU A;  1RFJ A;  1ZOT B;  1BR4 B;  2K7O A;  2WND A;  4PHM A;  4R1E A;  1CDL A;  1IRJ A;  2EC6 B;  4ORA B;  2M29 A;  1PSB A;  2VRG A;  1YUU A;  3F45 A;  2AAO A;  3SG4 A;  3SJS A;  2Y5I A;  3JTD C;  1KCY A;  3RLZ A;  1CFD A;  1QV0 A;  1TNX A;  1XFY O;  2ZKM X;  2M49 B;  1UUR A;  1TNQ A;  1KWO B;  4MZL A;  3AAK A;  2M9G A;  1KSM A;  2Y4Q A;  2O60 A;  4AQI A;  4ORC B;  1TRF A;  3BOW B;  1BU3 A;  1UP5 A;  1W7I B;  2K7D A;  3GK1 A;  4GGF A;  5ER5 A;  3SIB A;  5JJG A;  2MLF C;  2LLS A;  5HKY A;  1UHJ A;  1MUX A;  4NDC A;  1JF0 A;  3EK7 A;  3VGO A;  3ZNI A;  2Q91 A;  4GGN A;  4PCW A;  5DKR A;  3TUY B;  1UWO A;  2BKI B;  5AXI A;  3WNX B;  4A4C A;  4XJK A;  1ODB A;  4NDB A;  3H4S E;  1J7P A;  2LUC A;  1CLB A;  4ICB A;  1PK0 D;  2F3Y A;  4C0L A;  1CNP A;  1KK7 Y;  1LA0 A;  1XYD A;  1LA3 A;  3I5I B;  4WQ2 A;  2KAV A;  2OS8 C;  3GOF A;  1QS7 A;  4BY4 A;  3DD4 A;  3KO0 A;  3NSI A;  1YVL A;  3C1V A;  4I5N B;  1B9A A;  2L98 A;  2K2A A;  4MBE A;  3EVR A;  1F8H A;  1NPQ A;  2BE6 A;  3LCP C;  3TS5 C;  1SBJ A;  2EHB A;  3TDI A;  2JUL A;  1RK9 A;  2CNP A;  1SL9 A;  1E8A A;  1ZAC A;  1MF8 B;  2OS8 B;  1YX8 A;  2ISD A;  4PHJ A;  2JTT A;  2KYF A;  3CR2 A;  4NDD A;  2WCE A;  1S26 D;  4USL A;  2LP3 A;  5I2Q A;  2PMY A;  1YUS A;  3QRX A;  4HRG A;  1CTR A;  3EVV A;  1L2O C;  1JSA A;  2F2O A;  5KU1 A;  3SG2 A;  1BR1 B;  1IGV A;  1BT6 A;  1UUS A;  2RGI A;  4MEW A;  2TN4 A;  2M97 A;  1LKJ A;  2IS9 A;  2JZI A;  2NXQ A;  3E3R A;  5JOL A;  2F8P A;  1L7Z A;  1OOJ A;  2KHN A;  4QJ5 B;  2PRU A;  3GK4 X;  5AAN A;  1J1D A;  1M46 A;  2FCD A;  4MRY A;  2MBX A;  3KPX A;  1Y0V H;  3PN7 B;  1BF5 A;  1DJW A;  1UHH A;  3DF0 B;  2KFF A;  1GJY A;  3GK2 A;  3NSO A;  3KEV A;  1XFU O;  2OPO A;  3A4U B;  3O4Y A;  2H2K A;  1NX1 A;  1D1O A;  2KFH A;  1OZO A;  4HRE E;  2LAN A;  1CB1 A;  4GFT A;  1UHI A;  4QJ3 B;  3VRO A;  1F54 A;  1KFU L;  3M0W A;  1SR6 B;  1JFK A;  1B1G A;  2QAC A;  3EVU A;  1JFJ A;  1VRK A;  1DVI A;  3JVT C;  1S5G Z;  1AK8 A;  1AJ5 A;  3CWG A;  4XYN A;  1EJ3 A;  1JC2 A;  1S6J A;  3O6B A;  4P2Y B;  2PAS A;  4YI9 A; 
#chains in the Genus database with same CATH topology
 1SMG A;  1B8L A;  1QLK A;  1YTZ C;  2M1K B;  5DIC A;  3I5G B;  1SL7 A;  1DQE A;  1DT7 B;  3VRQ A;  2BBM A;  1GM0 A;  1NX2 A;  4PDZ A;  1T14 A;  2H61 A;  1GGZ A;  2BE4 A;  1YR5 A;  3D78 A;  5FI2 A;  1F70 A;  2BNX A;  2KQY A;  1LS8 A;  1TIZ A;  1B7T Z;  4FTG A;  3MSE B;  2KNE A;  2KI6 C;  2WCM A;  2ZFD A;  1IH0 A;  2GGM A;  3I5H C;  1OQP A;  1ORG A;  2JT3 A;  2PQL A;  1X02 A;  4MN0 A;  1C7W A;  2M1U A;  3PFV A;  1K8U A;  3UO9 A;  2LHL A;  4PE1 A;  2EC6 C;  1K94 A;  3L4L A;  2LVV A;  3OB1 B;  1EL4 A;  3EK8 A;  4N5X A;  1QIW A;  2LVI A;  5I2O A;  4C0K A;  1P28 A;  1QLS A;  3I5H B;  1F4O A;  3NHT A;  1XK4 A;  3LL8 B;  3SG3 A;  2WCK A;  4ZCU A;  1TNW A;  4HSZ A;  4ETO A;  2P71 A;  4CFQ A;  4OZD A;  3BUO B;  1Q80 A;  1QX7 A;  2JT8 A;  1NYA A;  4JPZ B;  4INX A;  5GQQ C;  3SG6 A;  4I5J A;  4F0Z B;  1B47 A;  5HKZ A;  1KWO C;  3NGV A;  1QIV A;  5CSI A;  3SIA A;  3K1E A;  1F71 A;  4D1E A;  3HX4 A;  2G9B A;  4NQG A;  4QJ4 B;  1WDC C;  1YVH A;  1YX7 A;  1K2H A;  2L2C A;  1DF0 A;  1XO5 A;  3PAT A;  4JQ0 D;  3DVJ A;  4XJK B;  5FI7 A;  1IQ3 A;  4WRI A;  1XFR A;  1DMO A;  2LLU A;  2ZRT A;  3TUY C;  1DTL A;  4GAO A;  1SW8 A;  1G4Y R;  2WCB A;  2M8U A;  3R1P A;  3CZT X;  3TZ1 A;  1KK8 B;  1WDC B;  2KAX A;  1M31 A;  2LMU A;  3IQO A;  1R2U A;  2HPS A;  1KFU S;  2M0R A;  2O5G A;  3I5I C;  1TTX A;  2CXJ A;  3AKB A;  2LUX A;  1UHN A;  1V1G A;  2JXL A;  2LV7 A;  2WC8 A;  2MAZ A;  2NCO A;  3BUN B;  2QEB A;  1OSA A;  2NZ0 A;  3B6X A;  2SAS A;  1ZFS A;  1NSH A;  2L5X B;  2L2E A;  2Y1N A;  2D8N A;  1AUI B;  1A03 A;  2HET A;  2BCX A;  1FI6 A;  2CT9 A;  1SRA A;  4UPG A;  2KQ6 A;  1RTP 1;  3DZT A;  4KYN A;  2KBM A;  3LK1 A;  4CID A;  1NIW A;  1KQM B;  2QEO A;  5FI6 A;  2JT0 A;  3ZWH A;  1EXR A;  5PAL A;  4INW A;  2BCB A;  4MSP A;  2KAY A;  3CTN A;  4IJ7 A;  1QAT A;  2L0P A;  4DCK A;  3BUM B;  3PAL A;  1DJX A;  1NP8 A;  3FIA A;  4MVF A;  1BG1 A;  1A29 A;  1QWV A;  1Y1A A;  1LVC D;  3KHE A;  1MHO A;  1U5I A;  3PN7 C;  5I2L A;  1OMD A;  2E6W A;  3EKH A;  4DS7 A;  1CMG A;  5AFP A;  2FJU B;  5J3X A;  3A8R A;  1CKK A;  3R72 A;  2M7L A;  4GPL B;  1SK6 D;  2MLE C;  1G33 A;  1BJF A;  1J7O A;  4I5K A;  2K2F A;  2ZND A;  2K60 A;  2K7B A;  1QTX A;  1K9P A;  1JF2 A;  1IQ5 A;  1REC A;  3ICB A;  2WCL A;  5I94 A;  1SR6 C;  5AEQ A;  2E30 A;  2FCE A;  2LHI A;  3OBV A;  2V53 A;  2LVJ A;  1WY9 A;  1XA5 A;  1IIO A;  4GNK B;  1M45 A;  1PUL A;  2BL0 B;  4OVN F;  3FE8 A;  1IKU A;  3BYA A;  1C7V A;  2FOT A;  2BEC A;  1W7J B;  2KSP A;  3O2P A;  2ZN8 A;  1IJ5 A;  3I5G C;  3KF9 A;  1ZMZ A;  2H8V A;  1BOD A;  3I5F B;  2PSR A;  1NUB A;  1CLL A;  2AMI A;  1YUT A;  2QDI A;  3FWC A;  4YGB B;  1K93 D;  1NX0 A;  3VRR A;  4ORB B;  1QAS A;  2MA2 A;  4I5L B;  3CAB A;  1BOC A;  4ZCV A;  2JXC A;  1SSE B;  2JU0 A;  1XK4 C;  1RRO A;  1ALV A;  3S0B A;  1N2D A;  2KGR A;  2I7A A;  3LLE A;  1MWN A;  1S3P A;  3AKA A;  4GUK A;  1KFX L;  5HKW A;  1AVS A;  3CLN A;  2KBI A;  1LXF C;  3D77 A;  3R1O A;  3D10 A;  1S36 A;  1DGV A;  2HQW A;  3CZ1 A;  1XVJ A;  1TCF A;  3CS1 A;  4P5O E;  1NX3 A;  3HCM A;  1MR8 A;  1N0Y A;  3NSK A;  5HL1 A;  1OOG A;  2QEH A;  4OCI A;  2WOR A;  1RJV A;  2Y1M A;  1MQ1 A;  5I8N A;  1M63 B;  3B86 A;  4YI8 A;  4YGA A;  1FPW A;  2KLE A;  3D76 A;  3O78 A;  1DEL A;  4YBH B;  5CSJ A;  1C3Z A;  1XFZ O;  2JPT A;  2LMT A;  1XFX O;  1QXP A;  4GGF C;  3S0G A;  3SS4 A;  1A4P A;  2OTG B;  4N1G A;  1DF0 B;  1FI5 A;  1HQV A;  1DJI A;  1R6P A;  4L9M A;  4MZK A;  1QX5 B;  1TCO B;  4FQO A;  1OMV A;  1SKT A;  1Z2C B;  3BFB A;  2M3W A;  1B8R A;  1A75 B;  1JUO A;  1NCZ A;  4M2O A;  4CPV A;  1F4Q A;  2KI4 C;  3OP0 A;  3CR5 X;  4M2Q A;  1S5G Y;  5CSF A;  5HLV A;  4PAL A;  1KK7 Z;  2GGZ A;  3CDN A;  5TNC A;  1KK8 C;  5HLO A;  3WHT B;  4F7F A;  1TNP A;  1MXL C;  3BFA A;  4A4B A;  1HT9 A;  3BUX B;  1CDP A;  2F33 A;  3OGN A;  2KI4 B;  1TUJ A;  1SY9 A;  1MXE A;  1N65 A;  1A75 A;  2JRF A;  5G08 A;  1SCM B;  2JOJ A;  4YGD B;  1CMF A;  1QVI Z;  1JBA A;  5F6T A;  1F55 A;  1BMO A;  2ZNE A;  2L4I A;  2FJY A;  1DC1 A;  1CFC A;  1J55 A;  2KYC A;  3D0Y A;  3DXL A;  4N1F A;  4DUQ A;  3PJI A;  1C07 A;  1G8I A;  2PAL A;  3DYE A;  1SCV A;  1CDM A;  2I94 A;  4YRU A;  1B7T Y;  1CDN A;  1J1E A;  3CZ2 A;  1DJZ A;  2LE9 B;  3O4X A;  2K8M B;  2ERB A;  1K96 A;  1J7Q A;  5EL2 A;  3BQ3 A;  1H4B A;  5BPJ A;  3OHM B;  2KOT A;  1C3Y A;  3DVK A;  5IBW A;  2PYQ A;  1KQM C;  1QV1 A;  2NLN A;  1EH2 A;  1H8B A;  4WQ3 A;  3DY9 A;  1ALW A;  1K95 A;  1EG4 A;  3BUW B;  4OKH A;  3JTD B;  1KFX S;  2GTE A;  2MJW B;  1XFW O;  2JTZ A;  2G2B A;  1SNL A;  3PM8 A;  1SPY A;  1U5I B;  4PT1 A;  1CFP A;  3TDU A;  2F3Z A;  1QJT A;  1DJY A;  3QME A;  2AUC A;  3S0F A;  1SL8 A;  1S6I A;  3K21 A;  5ER4 X;  1K9U A;  2LM5 A;  1WLZ A;  3Q8I A;  1B8C A;  1NCX A;  4CLN A;  3BOW A;  1IWQ A;  1GGW A;  4JKT A;  3D73 A;  1DJH A;  1YRU B;  1Y6W A;  2JC2 A;  2KGB C;  5K89 A;  1Y1U A;  4HRH A;  5CSN A;  2QPT A;  3IF7 A;  1LIN A;  1OE9 B;  3IQQ A;  1DEK A;  2K61 A;  1QVI Y;  1UHK A;  2BL0 C;  2KFG A;  2KI6 D;  3CZ0 A;  4M2P A;  1A2X A;  1KQV A;  2L50 A;  2M7N A;  3VB1 A;  2LNK A;  4YGE B;  1FW4 A;  1CM4 A;  4BY5 A;  1TOP A;  1ZUZ A;  3AAJ A;  3OX5 A;  3TS5 B;  1JWD A;  4DIR A;  2H61 C;  3I5F C;  2P6B B;  4PHK A;  5HYD A;  1PAL A;  4YGC B;  5KTY A;  1AJ4 A;  1WRL A;  2LLT A;  4PE0 A;  2KDH A;  1OW4 A;  2MHH A;  2NCP A;  3DVE A;  2WCF A;  1W9Z A;  4JWQ A;  3RZS A;  1GQM A;  2PVB A;  2JQ6 A;  3BFH A;  2L51 A;  1M39 A;  3B7A A;  4OV2 A;  1Z4H A;  3DVM A;  3RM1 A;  1L2O B;  2SCP A;  1FF1 A;  5FYX A;  2JNF A;  1YRT B;  2L4H A;  3OX6 A;  3WXA A;  3VRN A;  4AOM A;  4TNC A;  3VRP A;  2DOQ A;  2KPH A;  2K0J A;  2WCH A;  3UNW A;  2CBL A;  4IL1 A;  2JNX A;  1IJ6 A;  1B4C A;  1PVB A;  1CM1 A;  1WRZ A;  2LCP A;  3PSR A;  5D3O A;  1YUR A;  3SS5 A;  5AER A;  2LAP A;  1FBV A;  1K9K A;  2LMV A;  1SYM A;  3D75 A;  1J7R A;  1V1F A;  4OR9 B;  4PE4 A;  4MZJ A;  1EG3 A;  2ZN9 A;  4FQT A;  1OOI X;  1Y1X A;  3SG5 A;  1WRK A;  1PRW A;  1OOF A;  5CPV A;  3DF0 A;  1PSR A;  3EKJ A;  4E68 A;  2EGD A;  2HF5 A;  2OTG C;  4PHN A;  3NHI A;  5DKQ A;  3S0E A;  2R2I A;  2I2R E;  3OB2 B;  4Q04 A;  3L4A A;  1TN4 A;  2B1U A;  3FWB A;  4MLW A;  3SS3 A;  2BKH B;  2BBN A;  1S6C A;  2HQ8 A;  3JVT B;  2Q4U A;  3L47 A;  3FS7 A;  1IG5 A;  2P70 A;  3NXA A;  4AQJ A;  1DJG A;  1XFV O;  2COL B;  3CR4 X;  2I18 A;  2LC5 A;  2MRD A;  1WLM A;  1CLM A;  1NCY A;  2WOS A;  3PLF B;  3R1V A;  1RWY A;  2ZRS A;  3EK4 A;  4DRW A;  3IVT A;  3PM2 A;  1PVA A;  4U8D A;  1K90 D;  5B8I B;  2CCM A;  1BLQ A;  1S1E A;  2LP2 A;  4MRX A;  5D7F A;  2GV5 A;  1CFF A;  1OMR A;  2CTN A;  2JWW A;  3BXK A;  1SCM C;  1NWD A;  1AHR A;  2KLD A;  2WC6 A;  3CGA A;  3LK0 A;  3WHU B;  1AP4 A;  1OZS A;  3D0Y B;  3SG7 A;  1QX2 A;  3NSL A;  2BCA A;  4PE7 A;  2K7C A;  4CFR A;  5D69 A;  5DKN A;  3FE6 A;  1KSO A;  2LVK A;  4GBA A;  5KSZ A;  4C0J A;  3B87 A;  3TDZ A;  2A4J A;  2F2P A;  1DGU A;  1RFJ A;  1ZOT B;  1BR4 B;  2K7O A;  2WND A;  4PHM A;  4R1E A;  1CDL A;  1IRJ A;  1TWO A;  2EC6 B;  4ORA B;  2M29 A;  1PSB A;  2VRG A;  1YUU A;  3F45 A;  2AAO A;  3SG4 A;  3SJS A;  3BJH A;  2Y5I A;  3B88 A;  3S0D A;  3JTD C;  2YGU A;  1KCY A;  3RLZ A;  1CFD A;  1QV0 A;  1TNX A;  1XFY O;  2WCJ A;  2ZKM X;  2M49 B;  1UUR A;  1TNQ A;  1KWO B;  4MZL A;  3AAK A;  2M9G A;  1KSM A;  2Y4Q A;  2O60 A;  4AQI A;  4ORC B;  1TRF A;  3BOW B;  1BU3 A;  1UP5 A;  1W7I B;  2K7D A;  3GK1 A;  4GGF A;  5ER5 A;  3SIB A;  5JJG A;  2MLF C;  2LLS A;  5HKY A;  1UHJ A;  1MUX A;  4NDC A;  1JF0 A;  3EK7 A;  3VGO A;  3ZNI A;  2Q91 A;  4GGN A;  3FE9 A;  4PCW A;  5DKR A;  3TUY B;  1UWO A;  2BKI B;  5AXI A;  3WNX B;  3V2L A;  4XJK A;  4A4C A;  1ODB A;  4NDB A;  3H4S E;  1J7P A;  2LUC A;  1CLB A;  4ICB A;  1PK0 D;  2F3Y A;  4C0L A;  1CNP A;  1KK7 Y;  1LA0 A;  1XYD A;  1LA3 A;  3I5I B;  4JD9 A;  4WQ2 A;  2KAV A;  2OS8 C;  3GOF A;  3D74 A;  1QS7 A;  4BY4 A;  3DD4 A;  3KO0 A;  3NSI A;  1YVL A;  3C1V A;  4I5N B;  1B9A A;  2L98 A;  2K2A A;  4MBE A;  3EVR A;  1F8H A;  1NPQ A;  2BE6 A;  3LCP C;  3TS5 C;  1SBJ A;  2EHB A;  3TDI A;  2JUL A;  1RK9 A;  2CNP A;  1SL9 A;  1E8A A;  1ZAC A;  1MF8 B;  2OS8 B;  1YX8 A;  2ISD A;  4PHJ A;  2JTT A;  2KYF A;  3CR2 A;  4NDD A;  2WCE A;  1S26 D;  3EG5 B;  2LP3 A;  4USL A;  5I2Q A;  2PMY A;  1YUS A;  3QRX A;  4HRG A;  1CTR A;  3EVV A;  3N7H A;  1L2O C;  1JSA A;  2QEV A;  2F2O A;  5KU1 A;  3SG2 A;  1BR1 B;  1IGV A;  1BT6 A;  1UUS A;  2RGI A;  4MEW A;  2TN4 A;  2M97 A;  1LKJ A;  2IS9 A;  2JZI A;  2NXQ A;  3CYZ A;  3E3R A;  2F8P A;  5JOL A;  1L7Z A;  1OOJ A;  2KHN A;  4QJ5 B;  2PRU A;  2WC5 A;  1OOH A;  3GK4 X;  5AAN A;  1J1D A;  1M46 A;  2FCD A;  4MRY A;  2MBX A;  3KPX A;  1Y0V H;  3PN7 B;  1BF5 A;  1DJW A;  1UHH A;  3DF0 B;  1TUZ A;  2KFF A;  1GJY A;  2BAP A;  3GK2 A;  3NSO A;  3KEV A;  1XFU O;  2OPO A;  3A4U B;  3O4Y A;  2H2K A;  1NX1 A;  1D1O A;  2L5Y A;  2KFH A;  1OZO A;  4HRE E;  2LAN A;  1CB1 A;  4GFT A;  1UHI A;  4QJ3 B;  3VRO A;  1F54 A;  1KFU L;  3M0W A;  1SR6 B;  1JFK A;  1B1G A;  2QAC A;  3EVU A;  1JFJ A;  1VRK A;  1DVI A;  3JVT C;  1S5G Z;  1AK8 A;  1AJ5 A;  3CWG A;  4XYN A;  1EJ3 A;  1JC2 A;  1S6J A;  3O6B A;  3S0A A;  4P2Y B;  2JPO A;  2PAS A;  4YI9 A; 
#chains in the Genus database with same CATH homology
 1SMG A;  1B8L A;  1QLK A;  1YTZ C;  2M1K B;  3I5G B;  1SL7 A;  1DT7 B;  3VRQ A;  2BBM A;  1NX2 A;  4PDZ A;  2H61 A;  1GGZ A;  2BE4 A;  1YR5 A;  1F70 A;  2KQY A;  1TIZ A;  1B7T Z;  4FTG A;  3MSE B;  2KNE A;  2KI6 C;  2ZFD A;  1IH0 A;  2GGM A;  3I5H C;  1OQP A;  2JT3 A;  4MN0 A;  1X02 A;  1C7W A;  2M1U A;  3PFV A;  1K8U A;  2LHL A;  4PE1 A;  2EC6 C;  1K94 A;  3OB1 B;  2LVV A;  1EL4 A;  3EK8 A;  4N5X A;  1QIW A;  2LVI A;  5I2O A;  4C0K A;  1QLS A;  3I5H B;  1F4O A;  1XK4 A;  3LL8 B;  3SG3 A;  4ZCU A;  1TNW A;  4HSZ A;  4ETO A;  4CFQ A;  3BUO B;  1Q80 A;  1QX7 A;  2JT8 A;  1NYA A;  4JPZ B;  5GQQ C;  3SG6 A;  4F0Z B;  4I5J A;  1B47 A;  5HKZ A;  1KWO C;  1QIV A;  5CSI A;  3SIA A;  1F71 A;  4D1E A;  3HX4 A;  2G9B A;  4NQG A;  4QJ4 B;  1WDC C;  1YVH A;  1YX7 A;  1K2H A;  1DF0 A;  1XO5 A;  3PAT A;  4JQ0 D;  3DVJ A;  4XJK B;  1IQ3 A;  4WRI A;  1DMO A;  2LLU A;  2ZRT A;  3TUY C;  1DTL A;  4GAO A;  1SW8 A;  1G4Y R;  2WCB A;  2M8U A;  3CZT X;  3TZ1 A;  1KK8 B;  1WDC B;  2KAX A;  1M31 A;  2LMU A;  3IQO A;  1R2U A;  2HPS A;  1KFU S;  2M0R A;  2O5G A;  3I5I C;  1TTX A;  2CXJ A;  3AKB A;  2LUX A;  1UHN A;  1V1G A;  2JXL A;  2LV7 A;  2WC8 A;  2MAZ A;  2NCO A;  3BUN B;  1OSA A;  2NZ0 A;  2SAS A;  1ZFS A;  1NSH A;  2L5X B;  2L2E A;  2Y1N A;  2D8N A;  1AUI B;  1A03 A;  2HET A;  2BCX A;  1FI6 A;  2CT9 A;  1SRA A;  4UPG A;  2KQ6 A;  1RTP 1;  2KBM A;  3LK1 A;  4CID A;  1NIW A;  1KQM B;  2JT0 A;  3ZWH A;  1EXR A;  5PAL A;  2BCB A;  4MSP A;  2KAY A;  3CTN A;  1QAT A;  2L0P A;  4DCK A;  3BUM B;  3PAL A;  1DJX A;  1NP8 A;  3FIA A;  4MVF A;  1BG1 A;  1A29 A;  3KHE A;  1Y1A A;  1LVC D;  1MHO A;  1U5I A;  3PN7 C;  5I2L A;  1OMD A;  2E6W A;  3EKH A;  4DS7 A;  1CMG A;  5AFP A;  2FJU B;  5J3X A;  3A8R A;  1CKK A;  2M7L A;  4GPL B;  1SK6 D;  2MLE C;  1G33 A;  1BJF A;  1J7O A;  4I5K A;  2K2F A;  2ZND A;  2K7B A;  1QTX A;  1K9P A;  1JF2 A;  1IQ5 A;  1REC A;  3ICB A;  1SR6 C;  5AEQ A;  2E30 A;  2FCE A;  2LHI A;  2V53 A;  2LVJ A;  1WY9 A;  1XA5 A;  4GNK B;  1M45 A;  1PUL A;  2BL0 B;  4OVN F;  1IKU A;  3BYA A;  1C7V A;  2FOT A;  2BEC A;  1W7J B;  2KSP A;  3O2P A;  2ZN8 A;  1IJ5 A;  3I5G C;  3KF9 A;  1ZMZ A;  1BOD A;  3I5F B;  2PSR A;  1NUB A;  1CLL A;  2AMI A;  1YUT A;  3FWC A;  4YGB B;  1K93 D;  1NX0 A;  3VRR A;  4ORB B;  1QAS A;  2MA2 A;  4I5L B;  1BOC A;  4ZCV A;  2JXC A;  2JU0 A;  1XK4 C;  1RRO A;  1ALV A;  1N2D A;  2KGR A;  2I7A A;  3LLE A;  1MWN A;  1S3P A;  3AKA A;  4GUK A;  1KFX L;  5HKW A;  1AVS A;  3CLN A;  2KBI A;  1LXF C;  3D10 A;  1S36 A;  1DGV A;  2HQW A;  1XVJ A;  1TCF A;  3CS1 A;  4P5O E;  1NX3 A;  3HCM A;  1MR8 A;  1N0Y A;  3NSK A;  4OCI A;  2WOR A;  1RJV A;  2Y1M A;  1MQ1 A;  5I8N A;  1M63 B;  4YI8 A;  4YGA A;  1FPW A;  3O78 A;  4YBH B;  5CSJ A;  1XFZ O;  2JPT A;  2LMT A;  1XFX O;  1QXP A;  4GGF C;  1FI5 A;  1A4P A;  2OTG B;  4N1G A;  1DF0 B;  1HQV A;  1DJI A;  1R6P A;  4L9M A;  4MZK A;  1QX5 B;  1TCO B;  4FQO A;  1OMV A;  1SKT A;  2M3W A;  1B8R A;  1A75 B;  1JUO A;  1NCZ A;  4M2O A;  4CPV A;  1F4Q A;  2KI4 C;  3OP0 A;  3CR5 X;  4M2Q A;  1S5G Y;  5CSF A;  5HLV A;  4PAL A;  1KK7 Z;  2GGZ A;  5TNC A;  3WHT B;  1KK8 C;  5HLO A;  1TNP A;  1MXL C;  4A4B A;  1HT9 A;  3BUX B;  1CDP A;  2F33 A;  2KI4 B;  1SY9 A;  1MXE A;  1N65 A;  1A75 A;  2JRF A;  5G08 A;  1SCM B;  2JOJ A;  4YGD B;  1CMF A;  1QVI Z;  1JBA A;  5F6T A;  1F55 A;  1BMO A;  2ZNE A;  2L4I A;  1CFC A;  1J55 A;  2KYC A;  3D0Y A;  4N1F A;  4DUQ A;  1C07 A;  1G8I A;  2PAL A;  1SCV A;  1CDM A;  2I94 A;  4YRU A;  1B7T Y;  1CDN A;  1J1E A;  1DJZ A;  2LE9 B;  2K8M B;  1K96 A;  1J7Q A;  3BQ3 A;  1H4B A;  5BPJ A;  3OHM B;  2KOT A;  3DVK A;  5IBW A;  1KQM C;  1QV1 A;  2NLN A;  1EH2 A;  1H8B A;  4WQ3 A;  1ALW A;  1K95 A;  1EG4 A;  3BUW B;  4OKH A;  3JTD B;  1KFX S;  2MJW B;  1XFW O;  2JTZ A;  2G2B A;  1SNL A;  3PM8 A;  1SPY A;  1U5I B;  1CFP A;  3TDU A;  2F3Z A;  1QJT A;  1DJY A;  2AUC A;  1SL8 A;  1S6I A;  3K21 A;  5ER4 X;  1K9U A;  2LM5 A;  1WLZ A;  1B8C A;  1NCX A;  4CLN A;  3BOW A;  1IWQ A;  1GGW A;  1DJH A;  1YRU B;  1Y6W A;  2JC2 A;  2KGB C;  5K89 A;  1Y1U A;  4HRH A;  5CSN A;  2QPT A;  3IF7 A;  1LIN A;  1OE9 B;  3IQQ A;  2K61 A;  1QVI Y;  1UHK A;  2BL0 C;  2KFG A;  2KI6 D;  4M2P A;  1KQV A;  1A2X A;  2L50 A;  2M7N A;  2LNK A;  4YGE B;  1FW4 A;  1CM4 A;  4BY5 A;  1TOP A;  1ZUZ A;  3AAJ A;  3OX5 A;  3TS5 B;  1JWD A;  4DIR A;  2H61 C;  3I5F C;  2P6B B;  4PHK A;  5HYD A;  1PAL A;  4YGC B;  5KTY A;  1AJ4 A;  1WRL A;  2LLT A;  4PE0 A;  2KDH A;  2NCP A;  2MHH A;  3DVE A;  2WCF A;  4JWQ A;  1GQM A;  2PVB A;  2JQ6 A;  4OV2 A;  2L51 A;  1M39 A;  3DVM A;  3RM1 A;  1L2O B;  2SCP A;  1FF1 A;  5FYX A;  2JNF A;  1YRT B;  2L4H A;  3OX6 A;  3WXA A;  3VRN A;  4AOM A;  4TNC A;  3VRP A;  2DOQ A;  2K0J A;  2CBL A;  4IL1 A;  2JNX A;  1IJ6 A;  1B4C A;  1PVB A;  1CM1 A;  1WRZ A;  2LCP A;  3PSR A;  1YUR A;  5AER A;  2LAP A;  1FBV A;  1K9K A;  2LMV A;  1SYM A;  4OR9 B;  1J7R A;  1V1F A;  4PE4 A;  4MZJ A;  1EG3 A;  2ZN9 A;  3SG5 A;  1Y1X A;  1WRK A;  1PRW A;  5CPV A;  3DF0 A;  1PSR A;  3EKJ A;  4E68 A;  2EGD A;  2HF5 A;  2OTG C;  4PHN A;  5DKQ A;  2R2I A;  2I2R E;  3OB2 B;  4Q04 A;  1TN4 A;  2B1U A;  3FWB A;  4MLW A;  2BKH B;  2BBN A;  1S6C A;  2HQ8 A;  3JVT B;  2Q4U A;  3NXA A;  3FS7 A;  1IG5 A;  4AQJ A;  1DJG A;  1XFV O;  2COL B;  3CR4 X;  2I18 A;  2LC5 A;  2MRD A;  1WLM A;  1CLM A;  1NCY A;  2WOS A;  3PLF B;  1RWY A;  2ZRS A;  3EK4 A;  4DRW A;  4U8D A;  1PVA A;  1K90 D;  5B8I B;  2CCM A;  1BLQ A;  1S1E A;  2LP2 A;  4MRX A;  5D7F A;  2GV5 A;  1CFF A;  1OMR A;  2CTN A;  2JWW A;  3BXK A;  1SCM C;  1NWD A;  1AHR A;  3CGA A;  3WHU B;  3LK0 A;  1AP4 A;  1OZS A;  3D0Y B;  3SG7 A;  1QX2 A;  3NSL A;  2BCA A;  4PE7 A;  2K7C A;  4CFR A;  5D69 A;  5DKN A;  1KSO A;  2LVK A;  4GBA A;  5KSZ A;  4C0J A;  3TDZ A;  2A4J A;  2F2P A;  1DGU A;  1RFJ A;  1ZOT B;  1BR4 B;  2K7O A;  2WND A;  4PHM A;  4R1E A;  1CDL A;  1IRJ A;  2EC6 B;  4ORA B;  2M29 A;  1PSB A;  2VRG A;  1YUU A;  3F45 A;  2AAO A;  3SG4 A;  3SJS A;  2Y5I A;  3JTD C;  1KCY A;  3RLZ A;  1CFD A;  1QV0 A;  1TNX A;  1XFY O;  2ZKM X;  2M49 B;  1UUR A;  1TNQ A;  1KWO B;  4MZL A;  3AAK A;  2M9G A;  1KSM A;  2Y4Q A;  2O60 A;  4AQI A;  4ORC B;  1TRF A;  3BOW B;  1BU3 A;  1UP5 A;  1W7I B;  2K7D A;  3GK1 A;  4GGF A;  5ER5 A;  3SIB A;  5JJG A;  2MLF C;  2LLS A;  5HKY A;  1UHJ A;  1MUX A;  4NDC A;  1JF0 A;  3EK7 A;  3VGO A;  3ZNI A;  2Q91 A;  4GGN A;  4PCW A;  5DKR A;  3TUY B;  1UWO A;  2BKI B;  5AXI A;  3WNX B;  4A4C A;  4XJK A;  1ODB A;  4NDB A;  3H4S E;  1J7P A;  2LUC A;  1CLB A;  4ICB A;  1PK0 D;  2F3Y A;  4C0L A;  1CNP A;  1KK7 Y;  1LA0 A;  1XYD A;  1LA3 A;  3I5I B;  4WQ2 A;  2KAV A;  2OS8 C;  3GOF A;  1QS7 A;  4BY4 A;  3DD4 A;  3KO0 A;  3NSI A;  1YVL A;  3C1V A;  4I5N B;  1B9A A;  2L98 A;  2K2A A;  4MBE A;  3EVR A;  1F8H A;  1NPQ A;  2BE6 A;  3LCP C;  3TS5 C;  1SBJ A;  2EHB A;  3TDI A;  2JUL A;  1RK9 A;  2CNP A;  1SL9 A;  1E8A A;  1ZAC A;  1MF8 B;  2OS8 B;  1YX8 A;  2ISD A;  4PHJ A;  2JTT A;  2KYF A;  3CR2 A;  4NDD A;  2WCE A;  1S26 D;  4USL A;  2LP3 A;  5I2Q A;  2PMY A;  1YUS A;  3QRX A;  4HRG A;  1CTR A;  3EVV A;  1L2O C;  1JSA A;  2F2O A;  5KU1 A;  3SG2 A;  1BR1 B;  1IGV A;  1BT6 A;  1UUS A;  2RGI A;  4MEW A;  2TN4 A;  2M97 A;  1LKJ A;  2IS9 A;  2JZI A;  2NXQ A;  3E3R A;  5JOL A;  2F8P A;  1L7Z A;  1OOJ A;  2KHN A;  4QJ5 B;  2PRU A;  3GK4 X;  5AAN A;  1J1D A;  1M46 A;  2FCD A;  4MRY A;  2MBX A;  3KPX A;  1Y0V H;  3PN7 B;  1BF5 A;  1DJW A;  1UHH A;  3DF0 B;  2KFF A;  1GJY A;  3GK2 A;  3NSO A;  3KEV A;  1XFU O;  2OPO A;  3A4U B;  3O4Y A;  2H2K A;  1NX1 A;  1D1O A;  2KFH A;  1OZO A;  4HRE E;  2LAN A;  1CB1 A;  4GFT A;  1UHI A;  4QJ3 B;  3VRO A;  1F54 A;  1KFU L;  3M0W A;  1SR6 B;  1JFK A;  1B1G A;  2QAC A;  3EVU A;  1JFJ A;  1VRK A;  1DVI A;  3JVT C;  1S5G Z;  1AK8 A;  1AJ5 A;  3CWG A;  4XYN A;  1EJ3 A;  1JC2 A;  1S6J A;  3O6B A;  4P2Y B;  2PAS A;  4YI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...