2WORA

Co-structure of s100a7 with 1,8 ans
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords PROTEIN S100-A7
publication title Identification and Characterization of Binding Sites on S100A7, a Participant in Cancer and Inflammation Pathways.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2worA00
3DVEA 4PHMA 2BE6A 5KTYA 1BU3A 2H61A 3BQ3A 2LNKA 4TNCA 5PALA 1Q80A 1UHIA 2LCPA 3BUWB 3E3RA 3EK7A 3I5GC 5G08A 3FWBA 2OS8C 2LMUA 1YUTA 3SJSA 1KK7Z 1PALA 2KYFA 1QX7A 1CDMA 4OCIA 3VRPA 3TUYC 1AJ4A 2KFHA 5AFPA 2FCDA 2MA2A 1GGZA 1D1OA 1QS7A 1KFXL 3NSOA 1M39A 1UHKA 1JF2A 2BCXA 1LA0A 4YGAA 2EC6C 1RFJA 1IWQA 2QPTA 4Q04A 2BL0B 1QVIY 4E68A 3LL8B 1JUOA 1QLKA 1XK4A 5DKQA 1CDNA 1IH0A 1SL9A 3TDZA 2L50A 1RROA 1LXFC 3PLFB 1IG5A 1S26D 2MLEC 1QX2A 2H61C 2QACA 4A4BA 1OOJA 2O5GA 2LV7A 1G4YR 1RJVA 1DGUA 2AUCA 1MR8A 4ZCUA 1IJ6A 3SG4A 4AOMA 1AK8A 1B8CA 2K0JA 4ORBB 3CR2A 3I5IB 1XFVO 1DF0B 2A4JA 2GGZA 2KFGA 2LHIA 1KQMB 1ALVA 1SW8A 1XFXO 1NYAA 2L4HA 4HRHA 3C1VA 1G33A 3BYAA 4FQOA 4XJKA 3SG6A 1QIWA 2JNFA 3NSIA 4C0KA 1UUSA 4C0JA 5B8IB 3DVJA 3EVRA 4C0LA 4DCKA 2IS9A 3OHMB 2HPSA 2BKHB 2EHBA 4R1EA 3EKHA 3JVTB 2AAOA 4MN0A 4ZCVA 1U5IA 1A75A 1K93D 1XK4C 2BKIB 2MLFC 3D10A 2KGBC 4AQJA 2CT9A 3I5GB 3LCPC 5AERA 2JTZA 1FPWA 1XYDA 1BODA 3O78A 1H4BA 2PSRA 5ER4X 2LE9B 4JWQA 5F6TA 4MEWA 2PALA 3OP0A 5K89A 3BUXB 1FBVA 3TUYB 1UHHA 2CBLA 4GAOA 2HQWA 2JQ6A 4M2OA 1EJ3A 4CFRA 4MRYA 1A4PA 1W7IB 4NQGA 3NSLA 1N65A 5CSIA 1H8BA 1TNQA 2EC6B 4USLA 1QIVA 4CIDA 1UURA 1CM1A 1M63B 2Y1MA 4QJ5B 1FW4A 2LVJA 1S6IA 2WCEA 2D8NA 2NCOA 1ZUZA 1QX5B 1BMOA 2LLTA 1AJ5A 3AKAA 1J1EA 1OZOA 3DF0A 3LK1A 1Y0VH 1TRFA 5I2QA 4WRIA 3TZ1A 1CKKA 1F8HA 1G8IA 2JZIA 1XFZO 2MHHA 4NDBA 4PE4A 2E6WA 3WHTB 1WRZA 1SNLA 2F3YA 2M97A 4YRUA 2EGDA 2BECA 1JWDA 3GK4X 1L7ZA 4ETOA 4DRWA 4MZJA 2OPOA 2CCMA 3CWGA 1EH2A 2KAXA 1J7OA 2Q4UA 3PALA 1DJWA 3NSKA 2LVKA 1R2UA 4PHJA 4CLNA 1QASA 1TN4A 1KWOC 2H2KA 1BJFA 4DS7A 2JT0A 1OMVA 2G9BA 1SPYA 1JC2A 1RK9A 2O60A 1F71A 1BOCA 1EG4A 1A29A 3VRNA 1S36A 1KSMA 1SR6C 1TTXA 3SG7A 5I2OA 1AP4A 1TOPA 2WORA 1L2OC 2FJUB 2OTGC 1K94A 2R2IA 3QRXA 2VRGA 4FTGA 1LKJA 5I8NA 1KFUS 1LINA 4MRXA 4YI8A 2LMVA 4YGBB 2NZ0A 4XJKB 2CTNA 2ZN9A 4GUKA 5BPJA 4D1EA 2K7BA 1CFPA 1CDLA 1XO5A 2LC5A 2Y1NA 3EVUA 2M7NA 1MUXA 2L4IA 1J1DA 1KFUL 1U5IB 1A75B 2WCBA 1IRJA 3HX4A 3PFVA 1IJ5A 2M29A 4ORCB 4GNKB 4N1GA 4P5OE 1CDPA 1CLBA 1DVIA 2JNXA 2KYCA 1CMFA 4GGFA 2MBXA 1LA3A 3IQQA 5TNCA 3VRQA 5HYDA 3BUNB 1JFJA 2L51A 2AMIA 1YTZC 2M3WA 2B1UA 1Y1AA 1WRKA 1YUUA 1S6JA 3BUOB 2JC2A 3PN7C 1M45A 1R6PA 2LMTA 3PSRA 4PHNA 2L5XB 3KF9A 5AANA 5ER5A 1YURA 2WNDA 2M9GA 1K9UA 3I5FC 5D69A 2DOQA 1BLQA 2KGRA 1NUBA 1FI6A 1IGVA 1DJHA 2GV5A 4OVNF 1KWOB 1MQ1A 1S1EA 1SCMC 2JPTA 3RM1A 4YBHB 2KAYA 3AKBA 1B1GA 1SL8A 1EXRA 3K21A 2WC8A 1OMRA 2JTTA 2I18A 2PVBA 4GGFC 5JJGA 1Y1XA 3DF0B 1SR6B 1XFUO 1K2HA 3CR5X 2KFFA 5J3XA 1AHRA 1L2OB 2I2RE 2OTGB 1BF5A 2JT8A 1SCVA 1SL7A 3GOFA 2GGMA 4YGCB 1J55A 1SRAA 5D7FA 5DKRA 2CNPA 1ZMZA 3CTNA 2JXCA 2KHNA 1NP8A 1DT7B 1MXLC 1SY9A 2ZNDA 1JF0A 3BXKA 1CFFA 2WCFA 1MWNA 2K7OA 1ODBA 1YX8A 3CR4X 2K61A 4QJ3B 1SKTA 1TNWA 3TS5C 1UWOA 4PE7A 1JSAA 2BE4A 2I7AA 3AAKA 1J7QA 1TNPA 3CLNA 1CFDA 2G2BA 1YRTB 1E8AA 2LVIA 1S5GZ 3CS1A 2JU0A 2F33A 3PN7B 4MVFA 2NXQA 2V53A 3KEVA 4MSPA 2CXJA 1V1GA 2JULA 1J7PA 1LVCD 1YUSA 4BY4A 5CSNA 3I5FB 1B8LA 1QJTA 1BT6A 1F55A 1M46A 3IF7A 4HREE 1SCMB 1IKUA 3FIAA 3MSEB 1RECA 4GFTA 1F4OA 1WDCC 1QLSA 3TDIA 3KPXA 2F8PA 3CGAA 4PALA 3BOWA 1M31A 1V1FA 1CNPA 1IQ3A 2K7CA 1NCXA 1KCYA 5FYXA 4OV2A 1OMDA 5IBWA 3ICBA 1N0YA 1DMOA 2LUXA 4ORAB 1K8UA 1MF8B 5GQQC 2BCAA 1MHOA 5JOLA 2ISDA 1DJZA 1DJYA 2L0PA 2NCPA 3GK1A 4PCWA 1N2DA 1B7TZ 1NX1A 2K8MB 2SASA 1Y6WA 1ZACA 1OZSA 2NLNA 1NIWA 1PSRA 1MXEA 2MRDA 1PK0D 1KSOA 3HCMA 3WXAA 4AQIA 2KQYA 4CFQA 2LP3A 4I5LB 4MLWA 3TS5B 1K9PA 1QTXA 5AEQA 2K2FA 2M7LA 1SYMA 2BBMA 3DVMA 1WLZA 3A4UB 1S5GY 1ZOTB 3OX6A 3KHEA 4OR9B 1NCZA 2KNEA 4IL1A 4GPLB 4PE1A 2L2EA 2KI6D 3O6BA 1WRLA 2KI4C 2ZKMX 2BBNA 5HKZA 2Y5IA 1ZFSA 1OE9B 2ZRTA 1F4QA 4GBAA 2PRUA 2RGIA 4PE0A 1GQMA 2F3ZA 2FOTA 1KQVA 1CLLA 1B47A 3SG5A 2LLUA 1WDCB 3JTDC 4UPGA 1PRWA 1GGWA 1S6CA 2JXLA 2LUCA 2M49B 4PDZA 1K90D 1OQPA 3F45A 1KFXS 1UHJA 2ZRSA 2LM5A 1EG3A 1C7WA 2HETA 3EK8A 2M1KB 4PHKA 3RLZA 3OB1B 5HKYA 4HSZA 3BUMB 1W7JB 1XVJA 4NDCA 1DJGA 1KK8C 2KBIA 1VRKA 1J7RA 4I5NB 3O4YA 3VROA 1B7TY 1HQVA 2LAPA 4MZKA 5KU1A 3KO0A 1CLMA 2BCBA 1NWDA 2KDHA 1HT9A 2Q91A 4I5KA 1PULA 3AAJA 2FCEA 2KI6C 4JQ0D 2K2AA 3D0YA 3WHUB 3BOWB 1S3PA 1YRUB 2Y4QA 4MBEA 1TCOB 4A4CA 2MAZA 5HLOA 4DUQA 3EKJA 1F70A 1CMGA 1NX3A 4GGNA 1QV1A 3LK0A 3SG2A 1A2XA 1RWYA 4NDDA 5I2LA 3DVKA 2KI4B 3IQOA 1B9AA 3TDUA 4M2PA 3VGOA 4WQ3A 1F54A 2HQ8A 4N1FA 2M0RA 1EL4A 1CFCA 1FI5A 1JBAA 4HRGA 2L98A 3SIBA 3EK4A 1PVAA 2E30A 2WOSA 4OKHA 4F0ZB 2F2PA 1CTRA 1TIZA 1Y1UA 1NX0A 3JTDB 1BR4B 4QJ4B 2COLB 2OS8B 1KK7Y 2MJWB 2LVVA 3GK2A 1PVBA 2LANA 5KSZA 1YVHA 4CPVA 1C7VA 3I5HC 1NSHA 1K95A 1BR1B 1CM4A 1K96A 3CZTX 2JWWA 1TNXA 3VRRA 3DD4A 1IQ5A 4U8DA 1QATA 4N5XA 2LP2A 1AVSA 1KK8B 2JT3A 3FWCA 1A03A 1C07A 1OSAA 2JOJA 1DJXA 4L9MA 1NPQA 1CB1A 3ZNIA 1SBJA 5DKNA 4YI9A 4M2QA 2M8UA 2HF5A 1DF0A 2LHLA 2ZNEA 3EVVA 3A8RA 2KSPA 2KBMA 1YVLA 2KQ6A 3O2PA 5HKWA 1WY9A 2M1UA 1UP5A 5CSJA 1QXPA 2PASA 4WQ2A 5CSFA 1JFKA 1GJYA 1PSBA 1XFWO 1NCYA 2I94A 3LLEA 2KOTA 3OB2B 1DGVA 1SMGA 2KAVA 4BY5A 3WNXB 2BL0C 1XFYO 1ALWA 2PMYA 3H4SE 1YR5A 1QVIZ 2P6BB 3ZWHA 2TN4A 1B4CA 1K9KA 5HLVA 3NXAA 3PM8A 1TCFA 1DJIA 1RTP1 1AUIB 1WLMA 4I5JA 2SCPA 4YGDB 1DTLA 4XYNA 3I5IC 2ZFDA 4YGEB 2JRFA 3OX5A 3PATA 1KQMC 3M0WA 4DIRA 2ZN8A 3FS7A 1SK6D 3SG3A 2F2OA 3D0YB 1UHNA 4P2YB 1XA5A 3I5HB 1X02A 4ICBA 4MZLA 5CPVA 1FF1A 1NX2A 2LLSA 1QV0A 4JPZB 2K7DA 3SIAA 1B8RA 5AXIA 1YX7A 1BG1A 3JVTC
chains in the Genus database with same CATH superfamily
3DVEA 4PHMA 2BE6A 5KTYA 1BU3A 2H61A 3BQ3A 2LNKA 4TNCA 5PALA 1Q80A 1UHIA 2LCPA 3BUWB 3E3RA 3EK7A 3I5GC 5G08A 3FWBA 2OS8C 2LMUA 1YUTA 3SJSA 3PM2A 1KK7Z 1PALA 2KYFA 1QX7A 1CDMA 4OCIA 3VRPA 3TUYC 1AJ4A 2KFHA 3FE6A 5AFPA 2FCDA 2MA2A 1Z4HA 1GGZA 1D1OA 1QS7A 1KFXL 3NSOA 1M39A 1UHKA 1JF2A 2BCXA 1LA0A 4YGAA 2EC6C 1RFJA 3UNWA 1IWQA 1TUZA 2QPTA 2BL0B 1QVIY 2H8VA 4Q04A 3LL8B 1JUOA 1QLKA 1XK4A 4FQTA 5DKQA 1CDNA 1IH0A 1SL9A 3TDZA 2L50A 1RROA 1LXFC 3PLFB 1IG5A 1S26D 4JD9A 2MLEC 1QX2A 2H61C 2QACA 4A4BA 1OOJA 3VB1A 2O5GA 3S0GA 2LV7A 1DQEA 1G4YR 1RJVA 1DGUA 2AUCA 1MR8A 1XFRA 1IJ6A 4ZCUA 3SG4A 4AOMA 1AK8A 1B8CA 2K0JA 4ORBB 4INXA 3CR2A 3I5IB 1XFVO 1DF0B 2A4JA 2GGZA 2KFGA 1OW4A 1KQMB 2LHIA 1C3ZA 1ALVA 1SW8A 1XFXO 1NYAA 2L4HA 4HRHA 3C1VA 1G33A 3BYAA 3FE8A 4FQOA 4XJKA 1QIWA 2JNFA 3NSIA 3SG6A 1UUSA 4C0KA 4C0JA 5B8IB 3DVJA 3EVRA 4C0LA 1DC1A 3S0EA 4DCKA 2IS9A 3OHMB 2HPSA 2BKHB 2EHBA 4R1EA 2WC6A 2BNXA 2AAOA 3EKHA 3JVTB 1U5IA 1A75A 1K93D 4MN0A 4ZCVA 1XK4C 2BKIB 2MLFC 3D10A 3D76A 2KGBC 5I94A 4AQJA 2CT9A 3I5GB 3LCPC 5AERA 2JTZA 1FPWA 2L5YA 1XYDA 1BODA 3O78A 1H4BA 2PSRA 5ER4X 2LE9B 2WCKA 3L47A 4JWQA 4MEWA 2PALA 3OP0A 5F6TA 3BUXB 5K89A 1FBVA 3TUYB 1UHHA 2CBLA 4GAOA 2HQWA 2JQ6A 4M2OA 1EJ3A 4CFRA 4MRYA 1A4PA 1W7IB 4NQGA 3NSLA 1N65A 5CSIA 3O4XA 1TNQA 1H8BA 2EC6B 4USLA 1QIVA 4CIDA 1UURA 1CM1A 1M63B 2Y1MA 4QJ5B 2P70A 1FW4A 2LVJA 1S6IA 2WCEA 2D8NA 2NCOA 1ZUZA 3PJIA 1QX5B 1OOHA 1BMOA 3B6XA 2LLTA 1AJ5A 3AKAA 2PQLA 1J1EA 1OZOA 3DF0A 1QWVA 3RZSA 3LK1A 1Y0VH 1TRFA 5I2QA 4WRIA 3S0DA 3TZ1A 1CKKA 2JPOA 1F8HA 1G8IA 2JZIA 1XFZO 2MHHA 3CABA 4NDBA 4PE4A 2E6WA 3WHTB 1WRZA 1SNLA 2F3YA 2M97A 4YRUA 2EGDA 2BECA 1JWDA 4IJ7A 3GK4X 1L7ZA 4ETOA 4DRWA 4MZJA 2OPOA 2CCMA 3CWGA 1EH2A 2KAXA 1J7OA 3UO9A 2Q4UA 3PALA 1DJWA 3NSKA 2LVKA 3D78A 1R2UA 4PHJA 3L4AA 4CLNA 1QASA 1TN4A 1KWOC 2H2KA 1BJFA 4DS7A 2JT0A 1OMVA 2G9BA 3R1PA 1SPYA 1JC2A 1RK9A 2O60A 1F71A 3FE9A 1BOCA 1EG4A 4JKTA 1A29A 3VRNA 1S36A 1KSMA 1SR6C 1TTXA 3SG7A 5I2OA 1AP4A 1TOPA 2WORA 1L2OC 2FJUB 2OTGC 1K94A 2R2IA 3QRXA 2VRGA 4FTGA 1LKJA 5I8NA 1KFUS 1LINA 4MRXA 4YI8A 2LMVA 3S0FA 1TWOA 2NZ0A 4XJKB 4YGBB 2CTNA 2ZN9A 3B87A 3DY9A 3OBVA 4GUKA 5BPJA 3R1VA 2QEHA 4D1EA 2K7BA 1CFPA 1CDLA 1XO5A 2LC5A 2Y1NA 3EVUA 2M7NA 1MUXA 2L4IA 2PYQA 1J1DA 1KFUL 1U5IB 1A75B 2WCBA 1IRJA 3HX4A 3PFVA 1IJ5A 2M29A 4ORCB 4GNKB 4N1GA 4P5OE 1CDPA 1CLBA 1DVIA 2JNXA 2KYCA 1CMFA 4GGFA 2MBXA 1LA3A 3IQQA 5FI2A 5TNCA 3VRQA 5HYDA 3BUNB 1JFJA 3NHTA 2L51A 2AMIA 1YTZC 3V2LA 2M3WA 2B1UA 1Y1AA 1WRKA 1YUUA 1S6JA 1P28A 3BUOB 2QDIA 3R72A 2JC2A 3PN7C 1M45A 1R6PA 2LMTA 1OOFA 3PSRA 4PHNA 2L5XB 3KF9A 5AANA 5ER5A 1YURA 2WNDA 2M9GA 3B7AA 1K9UA 3I5FC 3K1EA 2DOQA 5D69A 1BLQA 2KGRA 1NUBA 2YGUA 1FI6A 1IGVA 1DJHA 2GV5A 4OVNF 3D73A 1KWOB 1MQ1A 1S1EA 1SCMC 2JPTA 3RM1A 4YBHB 2KAYA 3AKBA 1B1GA 1SL8A 1EXRA 4INWA 3K21A 2WC8A 3CDNA 1OOGA 1OMRA 1GM0A 3B86A 1DELA 2JTTA 2I18A 5DICA 1TUJA 2PVBA 4GGFC 5JJGA 1Y1XA 3DF0B 1SR6B 1XFUO 1OOIX 3CR5X 1K2HA 2KFFA 5J3XA 1AHRA 1L2OB 2I2RE 2OTGB 2K60A 1BF5A 2JT8A 1SCVA 1SL7A 3BFBA 3GOFA 1T14A 2GGMA 4YGCB 1J55A 1SRAA 5D7FA 5DKRA 2CNPA 1ZMZA 3CTNA 4E68A 2JXCA 2KHNA 1NP8A 1DT7B 1MXLC 1SY9A 2ZNDA 1JF0A 3BXKA 1CFFA 2WCFA 3EG5B 1MWNA 2K7OA 1ODBA 1YX8A 3CR4X 2K61A 4QJ3B 1SKTA 1TNWA 3DZTA 2QEBA 1UWOA 3TS5C 4PE7A 1JSAA 2BE4A 2I7AA 3AAKA 1J7QA 1TNPA 3CLNA 1CFDA 2G2BA 1YRTB 1E8AA 2LVIA 1S5GZ 3CS1A 2JU0A 2F33A 3PN7B 4MVFA 1W9ZA 2NXQA 2V53A 3KEVA 4MSPA 2CXJA 1V1GA 2JULA 1J7PA 2ERBA 1LVCD 1YUSA 4BY4A 5CSNA 3I5FB 1B8LA 1QJTA 1BT6A 2KPHA 1F55A 1M46A 3IF7A 4HREE 1SCMB 2FJYA 3FIAA 3MSEB 1IKUA 1RECA 4GFTA 1F4OA 1WDCC 1QLSA 3TDIA 3KPXA 2F8PA 3CGAA 4PALA 3BOWA 1M31A 1V1FA 1CNPA 1IQ3A 3S0BA 2K7CA 1NCXA 1KCYA 3D77A 5FYXA 4OV2A 4KYNA 1OMDA 5EL2A 5IBWA 3ICBA 2WCLA 1N0YA 3DYEA 2LUXA 1DMOA 4ORAB 1K8UA 1MF8B 5GQQC 2BCAA 1MHOA 5JOLA 2ISDA 1DJZA 1DJYA 2L0PA 2KLDA 2NCPA 3GK1A 4PCWA 1N2DA 1B7TZ 1NX1A 2K8MB 2SASA 1Y6WA 1ZACA 1OZSA 1DEKA 2NLNA 1NIWA 1PSRA 1MXEA 2MRDA 1PK0D 1KSOA 2P71A 3HCMA 3WXAA 4AQIA 2KQYA 4CFQA 2LP3A 4I5LB 4MLWA 3TS5B 1K9PA 1QTXA 3CZ1A 5AEQA 5HL1A 2K2FA 2M7LA 1SYMA 2BBMA 3DVMA 1WLZA 3A4UB 1S5GY 1ZOTB 3OX6A 3KHEA 4OR9B 1NCZA 2KNEA 4IL1A 4GPLB 4PE1A 2L2EA 2KI6D 3O6BA 1WRLA 2KI4C 2BAPA 2ZKMX 2BBNA 5HKZA 2Y5IA 1ZFSA 1OE9B 2ZRTA 1F4QA 3BJHA 2PRUA 2RGIA 4GBAA 3D75A 4PE0A 1GQMA 2F3ZA 2FOTA 1KQVA 1CLLA 1B47A 5FI6A 3SG5A 1ORGA 2LLUA 1WDCB 4OZDA 2WCJA 3JTDC 4UPGA 1PRWA 3OGNA 3N7HA 1GGWA 1S6CA 2JXLA 2LUCA 2M49B 4PDZA 1K90D 1OQPA 3F45A 1KFXS 1UHJA 2ZRSA 2LM5A 1EG3A 1C7WA 2HETA 3EK8A 3R1OA 2M1KB 4PHKA 3RLZA 3CZ0A 3OB1B 5HKYA 4HSZA 3BUMB 2GTEA 1W7JB 1XVJA 4NDCA 1DJGA 1KK8C 2KBIA 1VRKA 1J7RA 3D74A 4I5NB 3O4YA 3VROA 1B7TY 1HQVA 2LAPA 4MZKA 3S0AA 5KU1A 3KO0A 1CLMA 3QMEA 2BCBA 1NWDA 2KDHA 1HT9A 2Q91A 3CZ2A 4I5KA 3NGVA 1PULA 3AAJA 2FCEA 2KI6C 4JQ0D 2K2AA 3D0YA 3WHUB 3BOWB 1S3PA 1YRUB 2Y4QA 4MBEA 1TCOB 4A4CA 2MAZA 5HLOA 4DUQA 3EKJA 1F70A 1CMGA 1NX3A 1Z2CB 1QV1A 4GGNA 3LK0A 3SG2A 1A2XA 1RWYA 4NDDA 5I2LA 3DVKA 1IIOA 2KI4B 3IQOA 1B9AA 3TDUA 5FI7A 3SS4A 3SS3A 4M2PA 3VGOA 4WQ3A 1F54A 2HQ8A 4N1FA 2M0RA 1EL4A 1CFCA 1FI5A 3NHIA 1JBAA 4HRGA 2L98A 3SIBA 3EK4A 3Q8IA 1PVAA 2E30A 2WOSA 3B88A 4OKHA 3IVTA 4F0ZB 2F2PA 1CTRA 1TIZA 1Y1UA 1NX0A 3JTDB 1BR4B 4F7FA 4QJ4B 2COLB 2WCMA 3BFHA 2OS8B 1KK7Y 2MJWB 1SSEB 2LVVA 3GK2A 1PVBA 2LANA 5KSZA 1YVHA 4CPVA 1C7VA 3I5HC 1NSHA 1K95A 3BFAA 2WC5A 1BR1B 1CM4A 1K96A 3CZTX 2JWWA 1TNXA 3VRRA 3DD4A 1IQ5A 1LS8A 1QATA 4U8DA 4N5XA 2LP2A 1AVSA 1KK8B 2JT3A 3FWCA 1A03A 1C07A 1OSAA 2JOJA 1DJXA 2KLEA 4L9MA 1NPQA 1CB1A 3ZNIA 1SBJA 5DKNA 4YI9A 3DXLA 4M2QA 2M8UA 2HF5A 1DF0A 2QEVA 2LHLA 2ZNEA 3EVVA 3A8RA 2KSPA 2KBMA 1YVLA 2KQ6A 3O2PA 5HKWA 1WY9A 2M1UA 1UP5A 5CSJA 1QXPA 2PASA 4WQ2A 5CSFA 1JFKA 1GJYA 1PSBA 1XFWO 1NCYA 2I94A 3LLEA 2KOTA 3OB2B 1DGVA 1SMGA 2L2CA 2KAVA 4BY5A 3WNXB 2BL0C 1XFYO 1ALWA 2PMYA 3H4SE 1YR5A 1C3YA 1QVIZ 2P6BB 3ZWHA 2TN4A 1B4CA 1K9KA 5HLVA 3NXAA 3PM8A 1TCFA 1DJIA 1RTP1 1AUIB 1WLMA 2WCHA 4I5JA 2SCPA 4YGDB 1DTLA 4XYNA 3I5IC 2ZFDA 4YGEB 2JRFA 3OX5A 3PATA 3SS5A 1KQMC 3M0WA 4DIRA 2ZN8A 3FS7A 1SK6D 3SG3A 4PT1A 2F2OA 3D0YB 1UHNA 3L4LA 4P2YB 1XA5A 3I5HB 1X02A 4ICBA 4MZLA 5CPVA 1FF1A 1NX2A 2LLSA 3CYZA 1QV0A 5D3OA 2QEOA 4JPZB 2K7DA 3SIAA 1B8RA 5AXIA 1YX7A 1BG1A 3JVTC
chains in the Genus database with same CATH topology
3DVEA 4PHMA 2BE6A 5KTYA 1BU3A 2H61A 3BQ3A 2LNKA 4TNCA 5PALA 1Q80A 1UHIA 2LCPA 3BUWB 3E3RA 3EK7A 3I5GC 5G08A 3FWBA 2OS8C 2LMUA 1YUTA 3SJSA 1KK7Z 1PALA 2KYFA 1QX7A 1CDMA 4OCIA 3VRPA 3TUYC 1AJ4A 2KFHA 5AFPA 2FCDA 2MA2A 1GGZA 1D1OA 1QS7A 1KFXL 3NSOA 1M39A 1UHKA 1JF2A 2BCXA 1LA0A 4YGAA 2EC6C 1RFJA 1IWQA 2QPTA 4Q04A 2BL0B 1QVIY 4E68A 3LL8B 1JUOA 1QLKA 1XK4A 5DKQA 1CDNA 1IH0A 1SL9A 3TDZA 2L50A 1RROA 1LXFC 3PLFB 1IG5A 1S26D 2MLEC 1QX2A 2H61C 2QACA 4A4BA 1OOJA 2O5GA 2LV7A 1G4YR 1RJVA 1DGUA 2AUCA 1MR8A 4ZCUA 1IJ6A 3SG4A 4AOMA 1AK8A 1B8CA 2K0JA 4ORBB 3CR2A 3I5IB 1XFVO 1DF0B 2A4JA 2GGZA 2KFGA 2LHIA 1KQMB 1ALVA 1SW8A 1XFXO 1NYAA 2L4HA 4HRHA 3C1VA 1G33A 3BYAA 4FQOA 4XJKA 3SG6A 1QIWA 2JNFA 3NSIA 4C0KA 1UUSA 4C0JA 5B8IB 3DVJA 3EVRA 4C0LA 4DCKA 2IS9A 3OHMB 2HPSA 2BKHB 2EHBA 4R1EA 3EKHA 3JVTB 2AAOA 4MN0A 4ZCVA 1U5IA 1A75A 1K93D 1XK4C 2BKIB 2MLFC 3D10A 2KGBC 4AQJA 2CT9A 3I5GB 3LCPC 5AERA 2JTZA 1FPWA 1XYDA 1BODA 3O78A 1H4BA 2PSRA 5ER4X 2LE9B 4JWQA 5F6TA 4MEWA 2PALA 3OP0A 5K89A 3BUXB 1FBVA 3TUYB 1UHHA 2CBLA 4GAOA 2HQWA 2JQ6A 4M2OA 1EJ3A 4CFRA 4MRYA 1A4PA 1W7IB 4NQGA 3NSLA 1N65A 5CSIA 1H8BA 1TNQA 2EC6B 4USLA 1QIVA 4CIDA 1UURA 1CM1A 1M63B 2Y1MA 4QJ5B 1FW4A 2LVJA 1S6IA 2WCEA 2D8NA 2NCOA 1ZUZA 1QX5B 1BMOA 2LLTA 1AJ5A 3AKAA 1J1EA 1OZOA 3DF0A 3LK1A 1Y0VH 1TRFA 5I2QA 4WRIA 3TZ1A 1CKKA 1F8HA 1G8IA 2JZIA 1XFZO 2MHHA 4NDBA 4PE4A 2E6WA 3WHTB 1WRZA 1SNLA 2F3YA 2M97A 4YRUA 2EGDA 2BECA 1JWDA 3GK4X 1L7ZA 4ETOA 4DRWA 4MZJA 2OPOA 2CCMA 3CWGA 1EH2A 2KAXA 1J7OA 2Q4UA 3PALA 1DJWA 3NSKA 2LVKA 1R2UA 4PHJA 4CLNA 1QASA 1TN4A 1KWOC 2H2KA 1BJFA 4DS7A 2JT0A 1OMVA 2G9BA 1SPYA 1JC2A 1RK9A 2O60A 1F71A 1BOCA 1EG4A 1A29A 3VRNA 1S36A 1KSMA 1SR6C 1TTXA 3SG7A 5I2OA 1AP4A 1TOPA 2WORA 1L2OC 2FJUB 2OTGC 1K94A 2R2IA 3QRXA 2VRGA 4FTGA 1LKJA 5I8NA 1KFUS 1LINA 4MRXA 4YI8A 2LMVA 4YGBB 2NZ0A 4XJKB 2CTNA 2ZN9A 4GUKA 5BPJA 4D1EA 2K7BA 1CFPA 1CDLA 1XO5A 2LC5A 2Y1NA 3EVUA 2M7NA 1MUXA 2L4IA 1J1DA 1KFUL 1U5IB 1A75B 2WCBA 1IRJA 3HX4A 3PFVA 1IJ5A 2M29A 4ORCB 4GNKB 4N1GA 4P5OE 1CDPA 1CLBA 1DVIA 2JNXA 2KYCA 1CMFA 4GGFA 2MBXA 1LA3A 3IQQA 5TNCA 3VRQA 5HYDA 3BUNB 1JFJA 2L51A 2AMIA 1YTZC 2M3WA 2B1UA 1Y1AA 1WRKA 1YUUA 1S6JA 3BUOB 2JC2A 3PN7C 1M45A 1R6PA 2LMTA 3PSRA 4PHNA 2L5XB 3KF9A 5AANA 5ER5A 1YURA 2WNDA 2M9GA 1K9UA 3I5FC 5D69A 2DOQA 1BLQA 2KGRA 1NUBA 1FI6A 1IGVA 1DJHA 2GV5A 4OVNF 1KWOB 1MQ1A 1S1EA 1SCMC 2JPTA 3RM1A 4YBHB 2KAYA 3AKBA 1B1GA 1SL8A 1EXRA 3K21A 2WC8A 1OMRA 2JTTA 2I18A 2PVBA 4GGFC 5JJGA 1Y1XA 3DF0B 1SR6B 1XFUO 1K2HA 3CR5X 2KFFA 5J3XA 1AHRA 1L2OB 2I2RE 2OTGB 1BF5A 2JT8A 1SCVA 1SL7A 3GOFA 2GGMA 4YGCB 1J55A 1SRAA 5D7FA 5DKRA 2CNPA 1ZMZA 3CTNA 2JXCA 2KHNA 1NP8A 1DT7B 1MXLC 1SY9A 2ZNDA 1JF0A 3BXKA 1CFFA 2WCFA 1MWNA 2K7OA 1ODBA 1YX8A 3CR4X 2K61A 4QJ3B 1SKTA 1TNWA 3TS5C 1UWOA 4PE7A 1JSAA 2BE4A 2I7AA 3AAKA 1J7QA 1TNPA 3CLNA 1CFDA 2G2BA 1YRTB 1E8AA 2LVIA 1S5GZ 3CS1A 2JU0A 2F33A 3PN7B 4MVFA 2NXQA 2V53A 3KEVA 4MSPA 2CXJA 1V1GA 2JULA 1J7PA 1LVCD 1YUSA 4BY4A 5CSNA 3I5FB 1B8LA 1QJTA 1BT6A 1F55A 1M46A 3IF7A 4HREE 1SCMB 1IKUA 3FIAA 3MSEB 1RECA 4GFTA 1F4OA 1WDCC 1QLSA 3TDIA 3KPXA 2F8PA 3CGAA 4PALA 3BOWA 1M31A 1V1FA 1CNPA 1IQ3A 2K7CA 1NCXA 1KCYA 5FYXA 4OV2A 1OMDA 5IBWA 3ICBA 1N0YA 1DMOA 2LUXA 4ORAB 1K8UA 1MF8B 5GQQC 2BCAA 1MHOA 5JOLA 2ISDA 1DJZA 1DJYA 2L0PA 2NCPA 3GK1A 4PCWA 1N2DA 1B7TZ 1NX1A 2K8MB 2SASA 1Y6WA 1ZACA 1OZSA 2NLNA 1NIWA 1PSRA 1MXEA 2MRDA 1PK0D 1KSOA 3HCMA 3WXAA 4AQIA 2KQYA 4CFQA 2LP3A 4I5LB 4MLWA 3TS5B 1K9PA 1QTXA 5AEQA 2K2FA 2M7LA 1SYMA 2BBMA 3DVMA 1WLZA 3A4UB 1S5GY 1ZOTB 3OX6A 3KHEA 4OR9B 1NCZA 2KNEA 4IL1A 4GPLB 4PE1A 2L2EA 2KI6D 3O6BA 1WRLA 2KI4C 2ZKMX 2BBNA 5HKZA 2Y5IA 1ZFSA 1OE9B 2ZRTA 1F4QA 4GBAA 2PRUA 2RGIA 4PE0A 1GQMA 2F3ZA 2FOTA 1KQVA 1CLLA 1B47A 3SG5A 2LLUA 1WDCB 3JTDC 4UPGA 1PRWA 1GGWA 1S6CA 2JXLA 2LUCA 2M49B 4PDZA 1K90D 1OQPA 3F45A 1KFXS 1UHJA 2ZRSA 2LM5A 1EG3A 1C7WA 2HETA 3EK8A 2M1KB 4PHKA 3RLZA 3OB1B 5HKYA 4HSZA 3BUMB 1W7JB 1XVJA 4NDCA 1DJGA 1KK8C 2KBIA 1VRKA 1J7RA 4I5NB 3O4YA 3VROA 1B7TY 1HQVA 2LAPA 4MZKA 5KU1A 3KO0A 1CLMA 2BCBA 1NWDA 2KDHA 1HT9A 2Q91A 4I5KA 1PULA 3AAJA 2FCEA 2KI6C 4JQ0D 2K2AA 3D0YA 3WHUB 3BOWB 1S3PA 1YRUB 2Y4QA 4MBEA 1TCOB 4A4CA 2MAZA 5HLOA 4DUQA 3EKJA 1F70A 1CMGA 1NX3A 4GGNA 1QV1A 3LK0A 3SG2A 1A2XA 1RWYA 4NDDA 5I2LA 3DVKA 2KI4B 3IQOA 1B9AA 3TDUA 4M2PA 3VGOA 4WQ3A 1F54A 2HQ8A 4N1FA 2M0RA 1EL4A 1CFCA 1FI5A 1JBAA 4HRGA 2L98A 3SIBA 3EK4A 1PVAA 2E30A 2WOSA 4OKHA 4F0ZB 2F2PA 1CTRA 1TIZA 1Y1UA 1NX0A 3JTDB 1BR4B 4QJ4B 2COLB 2OS8B 1KK7Y 2MJWB 2LVVA 3GK2A 1PVBA 2LANA 5KSZA 1YVHA 4CPVA 1C7VA 3I5HC 1NSHA 1K95A 1BR1B 1CM4A 1K96A 3CZTX 2JWWA 1TNXA 3VRRA 3DD4A 1IQ5A 4U8DA 1QATA 4N5XA 2LP2A 1AVSA 1KK8B 2JT3A 3FWCA 1A03A 1C07A 1OSAA 2JOJA 1DJXA 4L9MA 1NPQA 1CB1A 3ZNIA 1SBJA 5DKNA 4YI9A 4M2QA 2M8UA 2HF5A 1DF0A 2LHLA 2ZNEA 3EVVA 3A8RA 2KSPA 2KBMA 1YVLA 2KQ6A 3O2PA 5HKWA 1WY9A 2M1UA 1UP5A 5CSJA 1QXPA 2PASA 4WQ2A 5CSFA 1JFKA 1GJYA 1PSBA 1XFWO 1NCYA 2I94A 3LLEA 2KOTA 3OB2B 1DGVA 1SMGA 2KAVA 4BY5A 3WNXB 2BL0C 1XFYO 1ALWA 2PMYA 3H4SE 1YR5A 1QVIZ 2P6BB 3ZWHA 2TN4A 1B4CA 1K9KA 5HLVA 3NXAA 3PM8A 1TCFA 1DJIA 1RTP1 1AUIB 1WLMA 4I5JA 2SCPA 4YGDB 1DTLA 4XYNA 3I5IC 2ZFDA 4YGEB 2JRFA 3OX5A 3PATA 1KQMC 3M0WA 4DIRA 2ZN8A 3FS7A 1SK6D 3SG3A 2F2OA 3D0YB 1UHNA 4P2YB 1XA5A 3I5HB 1X02A 4ICBA 4MZLA 5CPVA 1FF1A 1NX2A 2LLSA 1QV0A 4JPZB 2K7DA 3SIAA 1B8RA 5AXIA 1YX7A 1BG1A 3JVTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVE A;  4PHM A;  2BE6 A;  5KTY A;  1BU3 A;  2H61 A;  3BQ3 A;  2LNK A;  4TNC A;  5PAL A;  1Q80 A;  1UHI A;  2LCP A;  3BUW B;  3E3R A;  3EK7 A;  3I5G C;  5G08 A;  3FWB A;  2OS8 C;  2LMU A;  1YUT A;  3SJS A;  1KK7 Z;  1PAL A;  2KYF A;  1QX7 A;  1CDM A;  4OCI A;  3VRP A;  3TUY C;  1AJ4 A;  2KFH A;  5AFP A;  2FCD A;  2MA2 A;  1GGZ A;  1D1O A;  1QS7 A;  1KFX L;  3NSO A;  1M39 A;  1UHK A;  1JF2 A;  2BCX A;  1LA0 A;  4YGA A;  2EC6 C;  1RFJ A;  1IWQ A;  2QPT A;  4Q04 A;  2BL0 B;  1QVI Y;  4E68 A;  3LL8 B;  1JUO A;  1QLK A;  1XK4 A;  5DKQ A;  1CDN A;  1IH0 A;  1SL9 A;  3TDZ A;  2L50 A;  1RRO A;  1LXF C;  3PLF B;  1IG5 A;  1S26 D;  2MLE C;  1QX2 A;  2H61 C;  2QAC A;  4A4B A;  1OOJ A;  2O5G A;  2LV7 A;  1G4Y R;  1RJV A;  1DGU A;  2AUC A;  1MR8 A;  4ZCU A;  1IJ6 A;  3SG4 A;  4AOM A;  1AK8 A;  1B8C A;  2K0J A;  4ORB B;  3CR2 A;  3I5I B;  1XFV O;  1DF0 B;  2A4J A;  2GGZ A;  2KFG A;  2LHI A;  1KQM B;  1ALV A;  1SW8 A;  1XFX O;  1NYA A;  2L4H A;  4HRH A;  3C1V A;  1G33 A;  3BYA A;  4FQO A;  4XJK A;  3SG6 A;  1QIW A;  2JNF A;  3NSI A;  4C0K A;  1UUS A;  4C0J A;  5B8I B;  3DVJ A;  3EVR A;  4C0L A;  4DCK A;  2IS9 A;  3OHM B;  2HPS A;  2BKH B;  2EHB A;  4R1E A;  3EKH A;  3JVT B;  2AAO A;  4MN0 A;  4ZCV A;  1U5I A;  1A75 A;  1K93 D;  1XK4 C;  2BKI B;  2MLF C;  3D10 A;  2KGB C;  4AQJ A;  2CT9 A;  3I5G B;  3LCP C;  5AER A;  2JTZ A;  1FPW A;  1XYD A;  1BOD A;  3O78 A;  1H4B A;  2PSR A;  5ER4 X;  2LE9 B;  4JWQ A;  5F6T A;  4MEW A;  2PAL A;  3OP0 A;  5K89 A;  3BUX B;  1FBV A;  3TUY B;  1UHH A;  2CBL A;  4GAO A;  2HQW A;  2JQ6 A;  4M2O A;  1EJ3 A;  4CFR A;  4MRY A;  1A4P A;  1W7I B;  4NQG A;  3NSL A;  1N65 A;  5CSI A;  1H8B A;  1TNQ A;  2EC6 B;  4USL A;  1QIV A;  4CID A;  1UUR A;  1CM1 A;  1M63 B;  2Y1M A;  4QJ5 B;  1FW4 A;  2LVJ A;  1S6I A;  2WCE A;  2D8N A;  2NCO A;  1ZUZ A;  1QX5 B;  1BMO A;  2LLT A;  1AJ5 A;  3AKA A;  1J1E A;  1OZO A;  3DF0 A;  3LK1 A;  1Y0V H;  1TRF A;  5I2Q A;  4WRI A;  3TZ1 A;  1CKK A;  1F8H A;  1G8I A;  2JZI A;  1XFZ O;  2MHH A;  4NDB A;  4PE4 A;  2E6W A;  3WHT B;  1WRZ A;  1SNL A;  2F3Y A;  2M97 A;  4YRU A;  2EGD A;  2BEC A;  1JWD A;  3GK4 X;  1L7Z A;  4ETO A;  4DRW A;  4MZJ A;  2OPO A;  2CCM A;  3CWG A;  1EH2 A;  2KAX A;  1J7O A;  2Q4U A;  3PAL A;  1DJW A;  3NSK A;  2LVK A;  1R2U A;  4PHJ A;  4CLN A;  1QAS A;  1TN4 A;  1KWO C;  2H2K A;  1BJF A;  4DS7 A;  2JT0 A;  1OMV A;  2G9B A;  1SPY A;  1JC2 A;  1RK9 A;  2O60 A;  1F71 A;  1BOC A;  1EG4 A;  1A29 A;  3VRN A;  1S36 A;  1KSM A;  1SR6 C;  1TTX A;  3SG7 A;  5I2O A;  1AP4 A;  1TOP A;  2WOR A;  1L2O C;  2FJU B;  2OTG C;  1K94 A;  2R2I A;  3QRX A;  2VRG A;  4FTG A;  1LKJ A;  5I8N A;  1KFU S;  1LIN A;  4MRX A;  4YI8 A;  2LMV A;  4YGB B;  2NZ0 A;  4XJK B;  2CTN A;  2ZN9 A;  4GUK A;  5BPJ A;  4D1E A;  2K7B A;  1CFP A;  1CDL A;  1XO5 A;  2LC5 A;  2Y1N A;  3EVU A;  2M7N A;  1MUX A;  2L4I A;  1J1D A;  1KFU L;  1U5I B;  1A75 B;  2WCB A;  1IRJ A;  3HX4 A;  3PFV A;  1IJ5 A;  2M29 A;  4ORC B;  4GNK B;  4N1G A;  4P5O E;  1CDP A;  1CLB A;  1DVI A;  2JNX A;  2KYC A;  1CMF A;  4GGF A;  2MBX A;  1LA3 A;  3IQQ A;  5TNC A;  3VRQ A;  5HYD A;  3BUN B;  1JFJ A;  2L51 A;  2AMI A;  1YTZ C;  2M3W A;  2B1U A;  1Y1A A;  1WRK A;  1YUU A;  1S6J A;  3BUO B;  2JC2 A;  3PN7 C;  1M45 A;  1R6P A;  2LMT A;  3PSR A;  4PHN A;  2L5X B;  3KF9 A;  5AAN A;  5ER5 A;  1YUR A;  2WND A;  2M9G A;  1K9U A;  3I5F C;  5D69 A;  2DOQ A;  1BLQ A;  2KGR A;  1NUB A;  1FI6 A;  1IGV A;  1DJH A;  2GV5 A;  4OVN F;  1KWO B;  1MQ1 A;  1S1E A;  1SCM C;  2JPT A;  3RM1 A;  4YBH B;  2KAY A;  3AKB A;  1B1G A;  1SL8 A;  1EXR A;  3K21 A;  2WC8 A;  1OMR A;  2JTT A;  2I18 A;  2PVB A;  4GGF C;  5JJG A;  1Y1X A;  3DF0 B;  1SR6 B;  1XFU O;  1K2H A;  3CR5 X;  2KFF A;  5J3X A;  1AHR A;  1L2O B;  2I2R E;  2OTG B;  1BF5 A;  2JT8 A;  1SCV A;  1SL7 A;  3GOF A;  2GGM A;  4YGC B;  1J55 A;  1SRA A;  5D7F A;  5DKR A;  2CNP A;  1ZMZ A;  3CTN A;  2JXC A;  2KHN A;  1NP8 A;  1DT7 B;  1MXL C;  1SY9 A;  2ZND A;  1JF0 A;  3BXK A;  1CFF A;  2WCF A;  1MWN A;  2K7O A;  1ODB A;  1YX8 A;  3CR4 X;  2K61 A;  4QJ3 B;  1SKT A;  1TNW A;  3TS5 C;  1UWO A;  4PE7 A;  1JSA A;  2BE4 A;  2I7A A;  3AAK A;  1J7Q A;  1TNP A;  3CLN A;  1CFD A;  2G2B A;  1YRT B;  1E8A A;  2LVI A;  1S5G Z;  3CS1 A;  2JU0 A;  2F33 A;  3PN7 B;  4MVF A;  2NXQ A;  2V53 A;  3KEV A;  4MSP A;  2CXJ A;  1V1G A;  2JUL A;  1J7P A;  1LVC D;  1YUS A;  4BY4 A;  5CSN A;  3I5F B;  1B8L A;  1QJT A;  1BT6 A;  1F55 A;  1M46 A;  3IF7 A;  4HRE E;  1SCM B;  1IKU A;  3FIA A;  3MSE B;  1REC A;  4GFT A;  1F4O A;  1WDC C;  1QLS A;  3TDI A;  3KPX A;  2F8P A;  3CGA A;  4PAL A;  3BOW A;  1M31 A;  1V1F A;  1CNP A;  1IQ3 A;  2K7C A;  1NCX A;  1KCY A;  5FYX A;  4OV2 A;  1OMD A;  5IBW A;  3ICB A;  1N0Y A;  1DMO A;  2LUX A;  4ORA B;  1K8U A;  1MF8 B;  5GQQ C;  2BCA A;  1MHO A;  5JOL A;  2ISD A;  1DJZ A;  1DJY A;  2L0P A;  2NCP A;  3GK1 A;  4PCW A;  1N2D A;  1B7T Z;  1NX1 A;  2K8M B;  2SAS A;  1Y6W A;  1ZAC A;  1OZS A;  2NLN A;  1NIW A;  1PSR A;  1MXE A;  2MRD A;  1PK0 D;  1KSO A;  3HCM A;  3WXA A;  4AQI A;  2KQY A;  4CFQ A;  2LP3 A;  4I5L B;  4MLW A;  3TS5 B;  1K9P A;  1QTX A;  5AEQ A;  2K2F A;  2M7L A;  1SYM A;  2BBM A;  3DVM A;  1WLZ A;  3A4U B;  1S5G Y;  1ZOT B;  3OX6 A;  3KHE A;  4OR9 B;  1NCZ A;  2KNE A;  4IL1 A;  4GPL B;  4PE1 A;  2L2E A;  2KI6 D;  3O6B A;  1WRL A;  2KI4 C;  2ZKM X;  2BBN A;  5HKZ A;  2Y5I A;  1ZFS A;  1OE9 B;  2ZRT A;  1F4Q A;  4GBA A;  2PRU A;  2RGI A;  4PE0 A;  1GQM A;  2F3Z A;  2FOT A;  1KQV A;  1CLL A;  1B47 A;  3SG5 A;  2LLU A;  1WDC B;  3JTD C;  4UPG A;  1PRW A;  1GGW A;  1S6C A;  2JXL A;  2LUC A;  2M49 B;  4PDZ A;  1K90 D;  1OQP A;  3F45 A;  1KFX S;  1UHJ A;  2ZRS A;  2LM5 A;  1EG3 A;  1C7W A;  2HET A;  3EK8 A;  2M1K B;  4PHK A;  3RLZ A;  3OB1 B;  5HKY A;  4HSZ A;  3BUM B;  1W7J B;  1XVJ A;  4NDC A;  1DJG A;  1KK8 C;  2KBI A;  1VRK A;  1J7R A;  4I5N B;  3O4Y A;  3VRO A;  1B7T Y;  1HQV A;  2LAP A;  4MZK A;  5KU1 A;  3KO0 A;  1CLM A;  2BCB A;  1NWD A;  2KDH A;  1HT9 A;  2Q91 A;  4I5K A;  1PUL A;  3AAJ A;  2FCE A;  2KI6 C;  4JQ0 D;  2K2A A;  3D0Y A;  3WHU B;  3BOW B;  1S3P A;  1YRU B;  2Y4Q A;  4MBE A;  1TCO B;  4A4C A;  2MAZ A;  5HLO A;  4DUQ A;  3EKJ A;  1F70 A;  1CMG A;  1NX3 A;  4GGN A;  1QV1 A;  3LK0 A;  3SG2 A;  1A2X A;  1RWY A;  4NDD A;  5I2L A;  3DVK A;  2KI4 B;  3IQO A;  1B9A A;  3TDU A;  4M2P A;  3VGO A;  4WQ3 A;  1F54 A;  2HQ8 A;  4N1F A;  2M0R A;  1EL4 A;  1CFC A;  1FI5 A;  1JBA A;  4HRG A;  2L98 A;  3SIB A;  3EK4 A;  1PVA A;  2E30 A;  2WOS A;  4OKH A;  4F0Z B;  2F2P A;  1CTR A;  1TIZ A;  1Y1U A;  1NX0 A;  3JTD B;  1BR4 B;  4QJ4 B;  2COL B;  2OS8 B;  1KK7 Y;  2MJW B;  2LVV A;  3GK2 A;  1PVB A;  2LAN A;  5KSZ A;  1YVH A;  4CPV A;  1C7V A;  3I5H C;  1NSH A;  1K95 A;  1BR1 B;  1CM4 A;  1K96 A;  3CZT X;  2JWW A;  1TNX A;  3VRR A;  3DD4 A;  1IQ5 A;  4U8D A;  1QAT A;  4N5X A;  2LP2 A;  1AVS A;  1KK8 B;  2JT3 A;  3FWC A;  1A03 A;  1C07 A;  1OSA A;  2JOJ A;  1DJX A;  4L9M A;  1NPQ A;  1CB1 A;  3ZNI A;  1SBJ A;  5DKN A;  4YI9 A;  4M2Q A;  2M8U A;  2HF5 A;  1DF0 A;  2LHL A;  2ZNE A;  3EVV A;  3A8R A;  2KSP A;  2KBM A;  1YVL A;  2KQ6 A;  3O2P A;  5HKW A;  1WY9 A;  2M1U A;  1UP5 A;  5CSJ A;  1QXP A;  2PAS A;  4WQ2 A;  5CSF A;  1JFK A;  1GJY A;  1PSB A;  1XFW O;  1NCY A;  2I94 A;  3LLE A;  2KOT A;  3OB2 B;  1DGV A;  1SMG A;  2KAV A;  4BY5 A;  3WNX B;  2BL0 C;  1XFY O;  1ALW A;  2PMY A;  3H4S E;  1YR5 A;  1QVI Z;  2P6B B;  3ZWH A;  2TN4 A;  1B4C A;  1K9K A;  5HLV A;  3NXA A;  3PM8 A;  1TCF A;  1DJI A;  1RTP 1;  1AUI B;  1WLM A;  4I5J A;  2SCP A;  4YGD B;  1DTL A;  4XYN A;  3I5I C;  2ZFD A;  4YGE B;  2JRF A;  3OX5 A;  3PAT A;  1KQM C;  3M0W A;  4DIR A;  2ZN8 A;  3FS7 A;  1SK6 D;  3SG3 A;  2F2O A;  3D0Y B;  1UHN A;  4P2Y B;  1XA5 A;  3I5H B;  1X02 A;  4ICB A;  4MZL A;  5CPV A;  1FF1 A;  1NX2 A;  2LLS A;  1QV0 A;  4JPZ B;  2K7D A;  3SIA A;  1B8R A;  5AXI A;  1YX7 A;  1BG1 A;  3JVT C; 
#chains in the Genus database with same CATH topology
 3DVE A;  4PHM A;  2BE6 A;  5KTY A;  1BU3 A;  2H61 A;  3BQ3 A;  2LNK A;  4TNC A;  5PAL A;  1Q80 A;  1UHI A;  2LCP A;  3BUW B;  3E3R A;  3EK7 A;  3I5G C;  5G08 A;  3FWB A;  2OS8 C;  2LMU A;  1YUT A;  3SJS A;  3PM2 A;  1KK7 Z;  1PAL A;  2KYF A;  1QX7 A;  1CDM A;  4OCI A;  3VRP A;  3TUY C;  1AJ4 A;  2KFH A;  3FE6 A;  5AFP A;  2FCD A;  2MA2 A;  1Z4H A;  1GGZ A;  1D1O A;  1QS7 A;  1KFX L;  3NSO A;  1M39 A;  1UHK A;  1JF2 A;  2BCX A;  1LA0 A;  4YGA A;  2EC6 C;  1RFJ A;  3UNW A;  1IWQ A;  1TUZ A;  2QPT A;  2BL0 B;  1QVI Y;  2H8V A;  4Q04 A;  3LL8 B;  1JUO A;  1QLK A;  1XK4 A;  4FQT A;  5DKQ A;  1CDN A;  1IH0 A;  1SL9 A;  3TDZ A;  2L50 A;  1RRO A;  1LXF C;  3PLF B;  1IG5 A;  1S26 D;  4JD9 A;  2MLE C;  1QX2 A;  2H61 C;  2QAC A;  4A4B A;  1OOJ A;  3VB1 A;  2O5G A;  3S0G A;  2LV7 A;  1DQE A;  1G4Y R;  1RJV A;  1DGU A;  2AUC A;  1MR8 A;  1XFR A;  1IJ6 A;  4ZCU A;  3SG4 A;  4AOM A;  1AK8 A;  1B8C A;  2K0J A;  4ORB B;  4INX A;  3CR2 A;  3I5I B;  1XFV O;  1DF0 B;  2A4J A;  2GGZ A;  2KFG A;  1OW4 A;  1KQM B;  2LHI A;  1C3Z A;  1ALV A;  1SW8 A;  1XFX O;  1NYA A;  2L4H A;  4HRH A;  3C1V A;  1G33 A;  3BYA A;  3FE8 A;  4FQO A;  4XJK A;  1QIW A;  2JNF A;  3NSI A;  3SG6 A;  1UUS A;  4C0K A;  4C0J A;  5B8I B;  3DVJ A;  3EVR A;  4C0L A;  1DC1 A;  3S0E A;  4DCK A;  2IS9 A;  3OHM B;  2HPS A;  2BKH B;  2EHB A;  4R1E A;  2WC6 A;  2BNX A;  2AAO A;  3EKH A;  3JVT B;  1U5I A;  1A75 A;  1K93 D;  4MN0 A;  4ZCV A;  1XK4 C;  2BKI B;  2MLF C;  3D10 A;  3D76 A;  2KGB C;  5I94 A;  4AQJ A;  2CT9 A;  3I5G B;  3LCP C;  5AER A;  2JTZ A;  1FPW A;  2L5Y A;  1XYD A;  1BOD A;  3O78 A;  1H4B A;  2PSR A;  5ER4 X;  2LE9 B;  2WCK A;  3L47 A;  4JWQ A;  4MEW A;  2PAL A;  3OP0 A;  5F6T A;  3BUX B;  5K89 A;  1FBV A;  3TUY B;  1UHH A;  2CBL A;  4GAO A;  2HQW A;  2JQ6 A;  4M2O A;  1EJ3 A;  4CFR A;  4MRY A;  1A4P A;  1W7I B;  4NQG A;  3NSL A;  1N65 A;  5CSI A;  3O4X A;  1TNQ A;  1H8B A;  2EC6 B;  4USL A;  1QIV A;  4CID A;  1UUR A;  1CM1 A;  1M63 B;  2Y1M A;  4QJ5 B;  2P70 A;  1FW4 A;  2LVJ A;  1S6I A;  2WCE A;  2D8N A;  2NCO A;  1ZUZ A;  3PJI A;  1QX5 B;  1OOH A;  1BMO A;  3B6X A;  2LLT A;  1AJ5 A;  3AKA A;  2PQL A;  1J1E A;  1OZO A;  3DF0 A;  1QWV A;  3RZS A;  3LK1 A;  1Y0V H;  1TRF A;  5I2Q A;  4WRI A;  3S0D A;  3TZ1 A;  1CKK A;  2JPO A;  1F8H A;  1G8I A;  2JZI A;  1XFZ O;  2MHH A;  3CAB A;  4NDB A;  4PE4 A;  2E6W A;  3WHT B;  1WRZ A;  1SNL A;  2F3Y A;  2M97 A;  4YRU A;  2EGD A;  2BEC A;  1JWD A;  4IJ7 A;  3GK4 X;  1L7Z A;  4ETO A;  4DRW A;  4MZJ A;  2OPO A;  2CCM A;  3CWG A;  1EH2 A;  2KAX A;  1J7O A;  3UO9 A;  2Q4U A;  3PAL A;  1DJW A;  3NSK A;  2LVK A;  3D78 A;  1R2U A;  4PHJ A;  3L4A A;  4CLN A;  1QAS A;  1TN4 A;  1KWO C;  2H2K A;  1BJF A;  4DS7 A;  2JT0 A;  1OMV A;  2G9B A;  3R1P A;  1SPY A;  1JC2 A;  1RK9 A;  2O60 A;  1F71 A;  3FE9 A;  1BOC A;  1EG4 A;  4JKT A;  1A29 A;  3VRN A;  1S36 A;  1KSM A;  1SR6 C;  1TTX A;  3SG7 A;  5I2O A;  1AP4 A;  1TOP A;  2WOR A;  1L2O C;  2FJU B;  2OTG C;  1K94 A;  2R2I A;  3QRX A;  2VRG A;  4FTG A;  1LKJ A;  5I8N A;  1KFU S;  1LIN A;  4MRX A;  4YI8 A;  2LMV A;  3S0F A;  1TWO A;  2NZ0 A;  4XJK B;  4YGB B;  2CTN A;  2ZN9 A;  3B87 A;  3DY9 A;  3OBV A;  4GUK A;  5BPJ A;  3R1V A;  2QEH A;  4D1E A;  2K7B A;  1CFP A;  1CDL A;  1XO5 A;  2LC5 A;  2Y1N A;  3EVU A;  2M7N A;  1MUX A;  2L4I A;  2PYQ A;  1J1D A;  1KFU L;  1U5I B;  1A75 B;  2WCB A;  1IRJ A;  3HX4 A;  3PFV A;  1IJ5 A;  2M29 A;  4ORC B;  4GNK B;  4N1G A;  4P5O E;  1CDP A;  1CLB A;  1DVI A;  2JNX A;  2KYC A;  1CMF A;  4GGF A;  2MBX A;  1LA3 A;  3IQQ A;  5FI2 A;  5TNC A;  3VRQ A;  5HYD A;  3BUN B;  1JFJ A;  3NHT A;  2L51 A;  2AMI A;  1YTZ C;  3V2L A;  2M3W A;  2B1U A;  1Y1A A;  1WRK A;  1YUU A;  1S6J A;  1P28 A;  3BUO B;  2QDI A;  3R72 A;  2JC2 A;  3PN7 C;  1M45 A;  1R6P A;  2LMT A;  1OOF A;  3PSR A;  4PHN A;  2L5X B;  3KF9 A;  5AAN A;  5ER5 A;  1YUR A;  2WND A;  2M9G A;  3B7A A;  1K9U A;  3I5F C;  3K1E A;  2DOQ A;  5D69 A;  1BLQ A;  2KGR A;  1NUB A;  2YGU A;  1FI6 A;  1IGV A;  1DJH A;  2GV5 A;  4OVN F;  3D73 A;  1KWO B;  1MQ1 A;  1S1E A;  1SCM C;  2JPT A;  3RM1 A;  4YBH B;  2KAY A;  3AKB A;  1B1G A;  1SL8 A;  1EXR A;  4INW A;  3K21 A;  2WC8 A;  3CDN A;  1OOG A;  1OMR A;  1GM0 A;  3B86 A;  1DEL A;  2JTT A;  2I18 A;  5DIC A;  1TUJ A;  2PVB A;  4GGF C;  5JJG A;  1Y1X A;  3DF0 B;  1SR6 B;  1XFU O;  1OOI X;  3CR5 X;  1K2H A;  2KFF A;  5J3X A;  1AHR A;  1L2O B;  2I2R E;  2OTG B;  2K60 A;  1BF5 A;  2JT8 A;  1SCV A;  1SL7 A;  3BFB A;  3GOF A;  1T14 A;  2GGM A;  4YGC B;  1J55 A;  1SRA A;  5D7F A;  5DKR A;  2CNP A;  1ZMZ A;  3CTN A;  4E68 A;  2JXC A;  2KHN A;  1NP8 A;  1DT7 B;  1MXL C;  1SY9 A;  2ZND A;  1JF0 A;  3BXK A;  1CFF A;  2WCF A;  3EG5 B;  1MWN A;  2K7O A;  1ODB A;  1YX8 A;  3CR4 X;  2K61 A;  4QJ3 B;  1SKT A;  1TNW A;  3DZT A;  2QEB A;  1UWO A;  3TS5 C;  4PE7 A;  1JSA A;  2BE4 A;  2I7A A;  3AAK A;  1J7Q A;  1TNP A;  3CLN A;  1CFD A;  2G2B A;  1YRT B;  1E8A A;  2LVI A;  1S5G Z;  3CS1 A;  2JU0 A;  2F33 A;  3PN7 B;  4MVF A;  1W9Z A;  2NXQ A;  2V53 A;  3KEV A;  4MSP A;  2CXJ A;  1V1G A;  2JUL A;  1J7P A;  2ERB A;  1LVC D;  1YUS A;  4BY4 A;  5CSN A;  3I5F B;  1B8L A;  1QJT A;  1BT6 A;  2KPH A;  1F55 A;  1M46 A;  3IF7 A;  4HRE E;  1SCM B;  2FJY A;  3FIA A;  3MSE B;  1IKU A;  1REC A;  4GFT A;  1F4O A;  1WDC C;  1QLS A;  3TDI A;  3KPX A;  2F8P A;  3CGA A;  4PAL A;  3BOW A;  1M31 A;  1V1F A;  1CNP A;  1IQ3 A;  3S0B A;  2K7C A;  1NCX A;  1KCY A;  3D77 A;  5FYX A;  4OV2 A;  4KYN A;  1OMD A;  5EL2 A;  5IBW A;  3ICB A;  2WCL A;  1N0Y A;  3DYE A;  2LUX A;  1DMO A;  4ORA B;  1K8U A;  1MF8 B;  5GQQ C;  2BCA A;  1MHO A;  5JOL A;  2ISD A;  1DJZ A;  1DJY A;  2L0P A;  2KLD A;  2NCP A;  3GK1 A;  4PCW A;  1N2D A;  1B7T Z;  1NX1 A;  2K8M B;  2SAS A;  1Y6W A;  1ZAC A;  1OZS A;  1DEK A;  2NLN A;  1NIW A;  1PSR A;  1MXE A;  2MRD A;  1PK0 D;  1KSO A;  2P71 A;  3HCM A;  3WXA A;  4AQI A;  2KQY A;  4CFQ A;  2LP3 A;  4I5L B;  4MLW A;  3TS5 B;  1K9P A;  1QTX A;  3CZ1 A;  5AEQ A;  5HL1 A;  2K2F A;  2M7L A;  1SYM A;  2BBM A;  3DVM A;  1WLZ A;  3A4U B;  1S5G Y;  1ZOT B;  3OX6 A;  3KHE A;  4OR9 B;  1NCZ A;  2KNE A;  4IL1 A;  4GPL B;  4PE1 A;  2L2E A;  2KI6 D;  3O6B A;  1WRL A;  2KI4 C;  2BAP A;  2ZKM X;  2BBN A;  5HKZ A;  2Y5I A;  1ZFS A;  1OE9 B;  2ZRT A;  1F4Q A;  3BJH A;  2PRU A;  2RGI A;  4GBA A;  3D75 A;  4PE0 A;  1GQM A;  2F3Z A;  2FOT A;  1KQV A;  1CLL A;  1B47 A;  5FI6 A;  3SG5 A;  1ORG A;  2LLU A;  1WDC B;  4OZD A;  2WCJ A;  3JTD C;  4UPG A;  1PRW A;  3OGN A;  3N7H A;  1GGW A;  1S6C A;  2JXL A;  2LUC A;  2M49 B;  4PDZ A;  1K90 D;  1OQP A;  3F45 A;  1KFX S;  1UHJ A;  2ZRS A;  2LM5 A;  1EG3 A;  1C7W A;  2HET A;  3EK8 A;  3R1O A;  2M1K B;  4PHK A;  3RLZ A;  3CZ0 A;  3OB1 B;  5HKY A;  4HSZ A;  3BUM B;  2GTE A;  1W7J B;  1XVJ A;  4NDC A;  1DJG A;  1KK8 C;  2KBI A;  1VRK A;  1J7R A;  3D74 A;  4I5N B;  3O4Y A;  3VRO A;  1B7T Y;  1HQV A;  2LAP A;  4MZK A;  3S0A A;  5KU1 A;  3KO0 A;  1CLM A;  3QME A;  2BCB A;  1NWD A;  2KDH A;  1HT9 A;  2Q91 A;  3CZ2 A;  4I5K A;  3NGV A;  1PUL A;  3AAJ A;  2FCE A;  2KI6 C;  4JQ0 D;  2K2A A;  3D0Y A;  3WHU B;  3BOW B;  1S3P A;  1YRU B;  2Y4Q A;  4MBE A;  1TCO B;  4A4C A;  2MAZ A;  5HLO A;  4DUQ A;  3EKJ A;  1F70 A;  1CMG A;  1NX3 A;  1Z2C B;  1QV1 A;  4GGN A;  3LK0 A;  3SG2 A;  1A2X A;  1RWY A;  4NDD A;  5I2L A;  3DVK A;  1IIO A;  2KI4 B;  3IQO A;  1B9A A;  3TDU A;  5FI7 A;  3SS4 A;  3SS3 A;  4M2P A;  3VGO A;  4WQ3 A;  1F54 A;  2HQ8 A;  4N1F A;  2M0R A;  1EL4 A;  1CFC A;  1FI5 A;  3NHI A;  1JBA A;  4HRG A;  2L98 A;  3SIB A;  3EK4 A;  3Q8I A;  1PVA A;  2E30 A;  2WOS A;  3B88 A;  4OKH A;  3IVT A;  4F0Z B;  2F2P A;  1CTR A;  1TIZ A;  1Y1U A;  1NX0 A;  3JTD B;  1BR4 B;  4F7F A;  4QJ4 B;  2COL B;  2WCM A;  3BFH A;  2OS8 B;  1KK7 Y;  2MJW B;  1SSE B;  2LVV A;  3GK2 A;  1PVB A;  2LAN A;  5KSZ A;  1YVH A;  4CPV A;  1C7V A;  3I5H C;  1NSH A;  1K95 A;  3BFA A;  2WC5 A;  1BR1 B;  1CM4 A;  1K96 A;  3CZT X;  2JWW A;  1TNX A;  3VRR A;  3DD4 A;  1IQ5 A;  1LS8 A;  1QAT A;  4U8D A;  4N5X A;  2LP2 A;  1AVS A;  1KK8 B;  2JT3 A;  3FWC A;  1A03 A;  1C07 A;  1OSA A;  2JOJ A;  1DJX A;  2KLE A;  4L9M A;  1NPQ A;  1CB1 A;  3ZNI A;  1SBJ A;  5DKN A;  4YI9 A;  3DXL A;  4M2Q A;  2M8U A;  2HF5 A;  1DF0 A;  2QEV A;  2LHL A;  2ZNE A;  3EVV A;  3A8R A;  2KSP A;  2KBM A;  1YVL A;  2KQ6 A;  3O2P A;  5HKW A;  1WY9 A;  2M1U A;  1UP5 A;  5CSJ A;  1QXP A;  2PAS A;  4WQ2 A;  5CSF A;  1JFK A;  1GJY A;  1PSB A;  1XFW O;  1NCY A;  2I94 A;  3LLE A;  2KOT A;  3OB2 B;  1DGV A;  1SMG A;  2L2C A;  2KAV A;  4BY5 A;  3WNX B;  2BL0 C;  1XFY O;  1ALW A;  2PMY A;  3H4S E;  1YR5 A;  1C3Y A;  1QVI Z;  2P6B B;  3ZWH A;  2TN4 A;  1B4C A;  1K9K A;  5HLV A;  3NXA A;  3PM8 A;  1TCF A;  1DJI A;  1RTP 1;  1AUI B;  1WLM A;  2WCH A;  4I5J A;  2SCP A;  4YGD B;  1DTL A;  4XYN A;  3I5I C;  2ZFD A;  4YGE B;  2JRF A;  3OX5 A;  3PAT A;  3SS5 A;  1KQM C;  3M0W A;  4DIR A;  2ZN8 A;  3FS7 A;  1SK6 D;  3SG3 A;  4PT1 A;  2F2O A;  3D0Y B;  1UHN A;  3L4L A;  4P2Y B;  1XA5 A;  3I5H B;  1X02 A;  4ICB A;  4MZL A;  5CPV A;  1FF1 A;  1NX2 A;  2LLS A;  3CYZ A;  1QV0 A;  5D3O A;  2QEO A;  4JPZ B;  2K7D A;  3SIA A;  1B8R A;  5AXI A;  1YX7 A;  1BG1 A;  3JVT C; 
#chains in the Genus database with same CATH homology
 3DVE A;  4PHM A;  2BE6 A;  5KTY A;  1BU3 A;  2H61 A;  3BQ3 A;  2LNK A;  4TNC A;  5PAL A;  1Q80 A;  1UHI A;  2LCP A;  3BUW B;  3E3R A;  3EK7 A;  3I5G C;  5G08 A;  3FWB A;  2OS8 C;  2LMU A;  1YUT A;  3SJS A;  1KK7 Z;  1PAL A;  2KYF A;  1QX7 A;  1CDM A;  4OCI A;  3VRP A;  3TUY C;  1AJ4 A;  2KFH A;  5AFP A;  2FCD A;  2MA2 A;  1GGZ A;  1D1O A;  1QS7 A;  1KFX L;  3NSO A;  1M39 A;  1UHK A;  1JF2 A;  2BCX A;  1LA0 A;  4YGA A;  2EC6 C;  1RFJ A;  1IWQ A;  2QPT A;  4Q04 A;  2BL0 B;  1QVI Y;  4E68 A;  3LL8 B;  1JUO A;  1QLK A;  1XK4 A;  5DKQ A;  1CDN A;  1IH0 A;  1SL9 A;  3TDZ A;  2L50 A;  1RRO A;  1LXF C;  3PLF B;  1IG5 A;  1S26 D;  2MLE C;  1QX2 A;  2H61 C;  2QAC A;  4A4B A;  1OOJ A;  2O5G A;  2LV7 A;  1G4Y R;  1RJV A;  1DGU A;  2AUC A;  1MR8 A;  4ZCU A;  1IJ6 A;  3SG4 A;  4AOM A;  1AK8 A;  1B8C A;  2K0J A;  4ORB B;  3CR2 A;  3I5I B;  1XFV O;  1DF0 B;  2A4J A;  2GGZ A;  2KFG A;  2LHI A;  1KQM B;  1ALV A;  1SW8 A;  1XFX O;  1NYA A;  2L4H A;  4HRH A;  3C1V A;  1G33 A;  3BYA A;  4FQO A;  4XJK A;  3SG6 A;  1QIW A;  2JNF A;  3NSI A;  4C0K A;  1UUS A;  4C0J A;  5B8I B;  3DVJ A;  3EVR A;  4C0L A;  4DCK A;  2IS9 A;  3OHM B;  2HPS A;  2BKH B;  2EHB A;  4R1E A;  3EKH A;  3JVT B;  2AAO A;  4MN0 A;  4ZCV A;  1U5I A;  1A75 A;  1K93 D;  1XK4 C;  2BKI B;  2MLF C;  3D10 A;  2KGB C;  4AQJ A;  2CT9 A;  3I5G B;  3LCP C;  5AER A;  2JTZ A;  1FPW A;  1XYD A;  1BOD A;  3O78 A;  1H4B A;  2PSR A;  5ER4 X;  2LE9 B;  4JWQ A;  5F6T A;  4MEW A;  2PAL A;  3OP0 A;  5K89 A;  3BUX B;  1FBV A;  3TUY B;  1UHH A;  2CBL A;  4GAO A;  2HQW A;  2JQ6 A;  4M2O A;  1EJ3 A;  4CFR A;  4MRY A;  1A4P A;  1W7I B;  4NQG A;  3NSL A;  1N65 A;  5CSI A;  1H8B A;  1TNQ A;  2EC6 B;  4USL A;  1QIV A;  4CID A;  1UUR A;  1CM1 A;  1M63 B;  2Y1M A;  4QJ5 B;  1FW4 A;  2LVJ A;  1S6I A;  2WCE A;  2D8N A;  2NCO A;  1ZUZ A;  1QX5 B;  1BMO A;  2LLT A;  1AJ5 A;  3AKA A;  1J1E A;  1OZO A;  3DF0 A;  3LK1 A;  1Y0V H;  1TRF A;  5I2Q A;  4WRI A;  3TZ1 A;  1CKK A;  1F8H A;  1G8I A;  2JZI A;  1XFZ O;  2MHH A;  4NDB A;  4PE4 A;  2E6W A;  3WHT B;  1WRZ A;  1SNL A;  2F3Y A;  2M97 A;  4YRU A;  2EGD A;  2BEC A;  1JWD A;  3GK4 X;  1L7Z A;  4ETO A;  4DRW A;  4MZJ A;  2OPO A;  2CCM A;  3CWG A;  1EH2 A;  2KAX A;  1J7O A;  2Q4U A;  3PAL A;  1DJW A;  3NSK A;  2LVK A;  1R2U A;  4PHJ A;  4CLN A;  1QAS A;  1TN4 A;  1KWO C;  2H2K A;  1BJF A;  4DS7 A;  2JT0 A;  1OMV A;  2G9B A;  1SPY A;  1JC2 A;  1RK9 A;  2O60 A;  1F71 A;  1BOC A;  1EG4 A;  1A29 A;  3VRN A;  1S36 A;  1KSM A;  1SR6 C;  1TTX A;  3SG7 A;  5I2O A;  1AP4 A;  1TOP A;  2WOR A;  1L2O C;  2FJU B;  2OTG C;  1K94 A;  2R2I A;  3QRX A;  2VRG A;  4FTG A;  1LKJ A;  5I8N A;  1KFU S;  1LIN A;  4MRX A;  4YI8 A;  2LMV A;  4YGB B;  2NZ0 A;  4XJK B;  2CTN A;  2ZN9 A;  4GUK A;  5BPJ A;  4D1E A;  2K7B A;  1CFP A;  1CDL A;  1XO5 A;  2LC5 A;  2Y1N A;  3EVU A;  2M7N A;  1MUX A;  2L4I A;  1J1D A;  1KFU L;  1U5I B;  1A75 B;  2WCB A;  1IRJ A;  3HX4 A;  3PFV A;  1IJ5 A;  2M29 A;  4ORC B;  4GNK B;  4N1G A;  4P5O E;  1CDP A;  1CLB A;  1DVI A;  2JNX A;  2KYC A;  1CMF A;  4GGF A;  2MBX A;  1LA3 A;  3IQQ A;  5TNC A;  3VRQ A;  5HYD A;  3BUN B;  1JFJ A;  2L51 A;  2AMI A;  1YTZ C;  2M3W A;  2B1U A;  1Y1A A;  1WRK A;  1YUU A;  1S6J A;  3BUO B;  2JC2 A;  3PN7 C;  1M45 A;  1R6P A;  2LMT A;  3PSR A;  4PHN A;  2L5X B;  3KF9 A;  5AAN A;  5ER5 A;  1YUR A;  2WND A;  2M9G A;  1K9U A;  3I5F C;  5D69 A;  2DOQ A;  1BLQ A;  2KGR A;  1NUB A;  1FI6 A;  1IGV A;  1DJH A;  2GV5 A;  4OVN F;  1KWO B;  1MQ1 A;  1S1E A;  1SCM C;  2JPT A;  3RM1 A;  4YBH B;  2KAY A;  3AKB A;  1B1G A;  1SL8 A;  1EXR A;  3K21 A;  2WC8 A;  1OMR A;  2JTT A;  2I18 A;  2PVB A;  4GGF C;  5JJG A;  1Y1X A;  3DF0 B;  1SR6 B;  1XFU O;  1K2H A;  3CR5 X;  2KFF A;  5J3X A;  1AHR A;  1L2O B;  2I2R E;  2OTG B;  1BF5 A;  2JT8 A;  1SCV A;  1SL7 A;  3GOF A;  2GGM A;  4YGC B;  1J55 A;  1SRA A;  5D7F A;  5DKR A;  2CNP A;  1ZMZ A;  3CTN A;  2JXC A;  2KHN A;  1NP8 A;  1DT7 B;  1MXL C;  1SY9 A;  2ZND A;  1JF0 A;  3BXK A;  1CFF A;  2WCF A;  1MWN A;  2K7O A;  1ODB A;  1YX8 A;  3CR4 X;  2K61 A;  4QJ3 B;  1SKT A;  1TNW A;  3TS5 C;  1UWO A;  4PE7 A;  1JSA A;  2BE4 A;  2I7A A;  3AAK A;  1J7Q A;  1TNP A;  3CLN A;  1CFD A;  2G2B A;  1YRT B;  1E8A A;  2LVI A;  1S5G Z;  3CS1 A;  2JU0 A;  2F33 A;  3PN7 B;  4MVF A;  2NXQ A;  2V53 A;  3KEV A;  4MSP A;  2CXJ A;  1V1G A;  2JUL A;  1J7P A;  1LVC D;  1YUS A;  4BY4 A;  5CSN A;  3I5F B;  1B8L A;  1QJT A;  1BT6 A;  1F55 A;  1M46 A;  3IF7 A;  4HRE E;  1SCM B;  1IKU A;  3FIA A;  3MSE B;  1REC A;  4GFT A;  1F4O A;  1WDC C;  1QLS A;  3TDI A;  3KPX A;  2F8P A;  3CGA A;  4PAL A;  3BOW A;  1M31 A;  1V1F A;  1CNP A;  1IQ3 A;  2K7C A;  1NCX A;  1KCY A;  5FYX A;  4OV2 A;  1OMD A;  5IBW A;  3ICB A;  1N0Y A;  1DMO A;  2LUX A;  4ORA B;  1K8U A;  1MF8 B;  5GQQ C;  2BCA A;  1MHO A;  5JOL A;  2ISD A;  1DJZ A;  1DJY A;  2L0P A;  2NCP A;  3GK1 A;  4PCW A;  1N2D A;  1B7T Z;  1NX1 A;  2K8M B;  2SAS A;  1Y6W A;  1ZAC A;  1OZS A;  2NLN A;  1NIW A;  1PSR A;  1MXE A;  2MRD A;  1PK0 D;  1KSO A;  3HCM A;  3WXA A;  4AQI A;  2KQY A;  4CFQ A;  2LP3 A;  4I5L B;  4MLW A;  3TS5 B;  1K9P A;  1QTX A;  5AEQ A;  2K2F A;  2M7L A;  1SYM A;  2BBM A;  3DVM A;  1WLZ A;  3A4U B;  1S5G Y;  1ZOT B;  3OX6 A;  3KHE A;  4OR9 B;  1NCZ A;  2KNE A;  4IL1 A;  4GPL B;  4PE1 A;  2L2E A;  2KI6 D;  3O6B A;  1WRL A;  2KI4 C;  2ZKM X;  2BBN A;  5HKZ A;  2Y5I A;  1ZFS A;  1OE9 B;  2ZRT A;  1F4Q A;  4GBA A;  2PRU A;  2RGI A;  4PE0 A;  1GQM A;  2F3Z A;  2FOT A;  1KQV A;  1CLL A;  1B47 A;  3SG5 A;  2LLU A;  1WDC B;  3JTD C;  4UPG A;  1PRW A;  1GGW A;  1S6C A;  2JXL A;  2LUC A;  2M49 B;  4PDZ A;  1K90 D;  1OQP A;  3F45 A;  1KFX S;  1UHJ A;  2ZRS A;  2LM5 A;  1EG3 A;  1C7W A;  2HET A;  3EK8 A;  2M1K B;  4PHK A;  3RLZ A;  3OB1 B;  5HKY A;  4HSZ A;  3BUM B;  1W7J B;  1XVJ A;  4NDC A;  1DJG A;  1KK8 C;  2KBI A;  1VRK A;  1J7R A;  4I5N B;  3O4Y A;  3VRO A;  1B7T Y;  1HQV A;  2LAP A;  4MZK A;  5KU1 A;  3KO0 A;  1CLM A;  2BCB A;  1NWD A;  2KDH A;  1HT9 A;  2Q91 A;  4I5K A;  1PUL A;  3AAJ A;  2FCE A;  2KI6 C;  4JQ0 D;  2K2A A;  3D0Y A;  3WHU B;  3BOW B;  1S3P A;  1YRU B;  2Y4Q A;  4MBE A;  1TCO B;  4A4C A;  2MAZ A;  5HLO A;  4DUQ A;  3EKJ A;  1F70 A;  1CMG A;  1NX3 A;  4GGN A;  1QV1 A;  3LK0 A;  3SG2 A;  1A2X A;  1RWY A;  4NDD A;  5I2L A;  3DVK A;  2KI4 B;  3IQO A;  1B9A A;  3TDU A;  4M2P A;  3VGO A;  4WQ3 A;  1F54 A;  2HQ8 A;  4N1F A;  2M0R A;  1EL4 A;  1CFC A;  1FI5 A;  1JBA A;  4HRG A;  2L98 A;  3SIB A;  3EK4 A;  1PVA A;  2E30 A;  2WOS A;  4OKH A;  4F0Z B;  2F2P A;  1CTR A;  1TIZ A;  1Y1U A;  1NX0 A;  3JTD B;  1BR4 B;  4QJ4 B;  2COL B;  2OS8 B;  1KK7 Y;  2MJW B;  2LVV A;  3GK2 A;  1PVB A;  2LAN A;  5KSZ A;  1YVH A;  4CPV A;  1C7V A;  3I5H C;  1NSH A;  1K95 A;  1BR1 B;  1CM4 A;  1K96 A;  3CZT X;  2JWW A;  1TNX A;  3VRR A;  3DD4 A;  1IQ5 A;  4U8D A;  1QAT A;  4N5X A;  2LP2 A;  1AVS A;  1KK8 B;  2JT3 A;  3FWC A;  1A03 A;  1C07 A;  1OSA A;  2JOJ A;  1DJX A;  4L9M A;  1NPQ A;  1CB1 A;  3ZNI A;  1SBJ A;  5DKN A;  4YI9 A;  4M2Q A;  2M8U A;  2HF5 A;  1DF0 A;  2LHL A;  2ZNE A;  3EVV A;  3A8R A;  2KSP A;  2KBM A;  1YVL A;  2KQ6 A;  3O2P A;  5HKW A;  1WY9 A;  2M1U A;  1UP5 A;  5CSJ A;  1QXP A;  2PAS A;  4WQ2 A;  5CSF A;  1JFK A;  1GJY A;  1PSB A;  1XFW O;  1NCY A;  2I94 A;  3LLE A;  2KOT A;  3OB2 B;  1DGV A;  1SMG A;  2KAV A;  4BY5 A;  3WNX B;  2BL0 C;  1XFY O;  1ALW A;  2PMY A;  3H4S E;  1YR5 A;  1QVI Z;  2P6B B;  3ZWH A;  2TN4 A;  1B4C A;  1K9K A;  5HLV A;  3NXA A;  3PM8 A;  1TCF A;  1DJI A;  1RTP 1;  1AUI B;  1WLM A;  4I5J A;  2SCP A;  4YGD B;  1DTL A;  4XYN A;  3I5I C;  2ZFD A;  4YGE B;  2JRF A;  3OX5 A;  3PAT A;  1KQM C;  3M0W A;  4DIR A;  2ZN8 A;  3FS7 A;  1SK6 D;  3SG3 A;  2F2O A;  3D0Y B;  1UHN A;  4P2Y B;  1XA5 A;  3I5H B;  1X02 A;  4ICB A;  4MZL A;  5CPV A;  1FF1 A;  1NX2 A;  2LLS A;  1QV0 A;  4JPZ B;  2K7D A;  3SIA A;  1B8R A;  5AXI A;  1YX7 A;  1BG1 A;  3JVT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...