1K8UA

Crystal structure of calcium-free (or apo) human s100a6; cys3met mutant (selenomethionine derivative)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
AMPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k8uA00
4PDZA 4U8DA 1TNQA 2NXQA 5DKNA 4JQ0D 1S36A 5D7FA 1QLKA 1B9AA 4PHNA 3NSKA 4CFRA 1PRWA 1J7QA 5I2LA 4E68A 1Y1UA 1X02A 2B1UA 1YURA 3CGAA 4WQ3A 1K8UA 2LVVA 3DVJA 2KFFA 3LK0A 2K7DA 4ETOA 5JJGA 2I18A 2CBLA 1AVSA 1K94A 1NUBA 1BG1A 1E8AA 1QVIY 2I7AA 2MLEC 3IF7A 1WY9A 4PALA 3H4SE 1J55A 4PHMA 2WCEA 2LC5A 3CLNA 1NP8A 1U5IB 4P5OE 1RJVA 2LAPA 1S5GY 2M97A 2L50A 3JTDC 3IQQA 1ALVA 2WCFA 5IBWA 1BOCA 1DVIA 1TIZA 4A4BA 1XK4C 4MRXA 2LCPA 5DKQA 1RTP1 1SR6C 1UHIA 2EC6B 1EJ3A 1BODA 1XFVO 1NX3A 2NLNA 2PALA 3EKJA 1F55A 2LV7A 2ZFDA 3WXAA 1ZOTB 4C0JA 5AFPA 2KBMA 1ZACA 1MF8B 1DMOA 3BQ3A 2MJWB 1NCZA 3SG3A 2F2PA 2LHIA 4NDDA 2KGBC 2LUCA 2G9BA 1SYMA 2AMIA 1XVJA 2WOSA 1IQ5A 1AHRA 3KHEA 2FOTA 4AQJA 4MLWA 2HETA 3PSRA 1YRTB 1YVLA 1CDPA 2FJUB 4ORBB 1G8IA 1KK7Y 1XK4A 2K7BA 3TDZA 1B4CA 1FI5A 1YTZC 4WQ2A 2MLFC 1OSAA 1B8RA 2HQ8A 2K0JA 3IQOA 1BF5A 5KTYA 1BR4B 1DJYA 1F4OA 2JXLA 1LXFC 2CT9A 5AERA 3MSEB 2KQYA 1J1DA 3DVEA 2JWWA 4XJKA 1MXLC 4OCIA 1UWOA 3VROA 1YX7A 5AEQA 3PN7B 1MWNA 3I5IB 5K89A 2M9GA 2NCOA 3KPXA 4XJKB 4MBEA 1CTRA 1MUXA 1KWOC 4GPLB 1F54A 2PRUA 3BYAA 1RFJA 2M49B 1OMRA 3TUYC 2BBNA 2KAXA 3KF9A 4MSPA 4CLNA 1JFJA 3CR5X 1DJHA 1UHJA 2K7OA 4YGBB 2M8UA 2DOQA 2NCPA 1IQ3A 2LVJA 3ICBA 4HSZA 3D0YA 1QX2A 1KQMB 2K8MB 1W7IB 1CDMA 1Y6WA 2HF5A 3VRPA 1ZMZA 1NWDA 2LLTA 1K93D 3D0YB 1BR1B 2OPOA 3FWCA 2OS8B 2Y1MA 1WDCB 4PE7A 3CR2A 4WRIA 1Y1XA 2BKHB 4XYNA 5HLOA 1TNWA 1CMFA 1H4BA 2I94A 5G08A 2Y5IA 2G2BA 5HKWA 3BUMB 1DJZA 1BLQA 1K90D 3E3RA 2F3ZA 2MRDA 2QPTA 2K7CA 4OVNF 1A4PA 1PK0D 2LLUA 1A03A 1TCFA 4QJ5B 1QV0A 4AQIA 4ORAB 1YUTA 1D1OA 1JBAA 2ZRTA 1YVHA 1SPYA 2LHLA 1QJTA 2MBXA 2ZNEA 2LMUA 1XFUO 1QX7A 1K96A 1DT7B 1DF0B 1IWQA 2LNKA 3VRRA 1RROA 2KHNA 3EVRA 1XYDA 3DVKA 2EC6C 1A75A 1L7ZA 2LVKA 1CMGA 1TNXA 3DVMA 2LLSA 1A75B 5JOLA 1N65A 1YUUA 1JSAA 5KU1A 3WHTB 4Q04A 5CSIA 2BKIB 1SCMC 4OV2A 3SIAA 1U5IA 2KFGA 2JU0A 1BT6A 1GGWA 3SG7A 1A2XA 5DKRA 3TS5B 2M3WA 1EG3A 2PVBA 2ISDA 1XO5A 2CNPA 2Y1NA 2H61A 2M1UA 1KFXS 1IH0A 1XFXO 1SBJA 5HYDA 1S1EA 2ZKMX 3SJSA 4D1EA 2F33A 5CSJA 3JVTC 4USLA 2KBIA 2L51A 1TNPA 1XFWO 1F70A 3BOWA 4I5JA 1K9UA 3A8RA 1L2OC 4GUKA 4IL1A 1OOJA 4GBAA 1M46A 1FI6A 4MN0A 2LMVA 1SL9A 3LCPC 3KO0A 4HRGA 3BOWB 4N5XA 3I5IC 1B7TY 1M45A 5HLVA 1SK6D 3NSOA 4YI9A 5BPJA 1QIWA 3O4YA 1ALWA 2K2FA 2JTZA 1QLSA 2E6WA 3ZWHA 2CTNA 4CFQA 2AAOA 3LLEA 1JWDA 1CFCA 3O78A 4M2PA 2KI6C 1DJIA 2F8PA 3NXAA 3EKHA 1IJ5A 1KFUS 2M7LA 1PVAA 1A29A 4M2QA 1UUSA 3TZ1A 1KQMC 3PLFB 1NIWA 1ZFSA 2JT3A 2L4HA 4UPGA 3OX6A 2L4IA 5HKYA 1GJYA 2BCXA 3EK7A 1NX0A 3CZTX 2JXCA 4GGNA 1S6IA 1B47A 1CFDA 1TN4A 2ZN8A 1FBVA 3OB1B 1YX8A 1M31A 2KI4B 2KDHA 2LVIA 2ZN9A 2O60A 3ZNIA 1B7TZ 1PSRA 2LP2A 4NDBA 4NQGA 1NSHA 2COLB 1QATA 3I5FC 3AKAA 5CPVA 1S3PA 1W7JB 2EHBA 5HKZA 1IKUA 2OTGB 2Q4UA 1EH2A 3GK2A 2JC2A 1CKKA 3I5GC 1CLMA 3RM1A 4OR9B 1IRJA 1WRKA 2AUCA 4FQOA 1YR5A 4HREE 2M29A 4ICBA 4DS7A 5PALA 4HRHA 4I5LB 4A4CA 1N2DA 2Q91A 1DJWA 1IG5A 4C0KA 2WCBA 1CFFA 2ZNDA 3EVUA 1K2HA 2HPSA 1MQ1A 1DJXA 5FYXA 2WORA 1WLZA 1B1GA 5I2QA 4I5KA 1RWYA 2FCDA 1LA0A 5F6TA 1JC2A 1OMDA 3FIAA 2JNXA 1KK8B 1K9KA 2LANA 3FWBA 4DUQA 4L9MA 1AP4A 2KGRA 5AANA 5ER4X 1LKJA 1SRAA 1B8CA 1QS7A 1JF0A 3QRXA 3TS5C 1DF0A 2Y4QA 4GFTA 2O5GA 1UP5A 2JZIA 2I2RE 5CSNA 1UHKA 2L98A 2V53A 1R6PA 3DF0B 4PCWA 5KSZA 4YGEB 1LVCD 1K9PA 3FS7A 1K95A 1SL8A 3GK4X 4CIDA 4DRWA 3C1VA 1Y0VH 3PALA 4MEWA 1EG4A 2M7NA 2H61C 3GK1A 4N1GA 5CSFA 4GNKB 4YRUA 1NX1A 4YBHB 3LK1A 2L2EA 1Q80A 1SKTA 1CLLA 1BU3A 1UHHA 4DCKA 3LL8B 3WHUB 4OKHA 1OQPA 2KI6D 1JUOA 4QJ4B 1V1GA 2BL0B 5GQQC 1IGVA 1XFYO 2BE6A 3BUOB 1FPWA 2BCBA 4PE4A 2BCAA 5J3XA 1S6JA 2BECA 3F45A 2MA2A 2GGMA 1J7RA 1ZUZA 2LMTA 2TN4A 3TDIA 3VRQA 4MZJA 1BJFA 3I5HB 2EGDA 2VRGA 1MHOA 1OE9B 1C7WA 3OB2B 1M39A 5TNCA 4NDCA 3BXKA 1QIVA 2PSRA 1PVBA 1C7VA 1NCXA 3EVVA 1NX2A 1QTXA 2KOTA 3CS1A 1CDLA 4PHKA 3EK8A 2BE4A 4GAOA 1J7PA 2KQ6A 2K2AA 1F71A 1F8HA 1TRFA 1SCVA 1DGUA 3K21A 4DIRA 3A4UB 1V1FA 1RK9A 2NZ0A 3PN7C 1QASA 2KI4C 2P6BB 2WNDA 4MVFA 2JT8A 4ORCB 4AOMA 2CCMA 1NCYA 3HX4A 2JPTA 1RECA 2M0RA 3SG5A 1WRZA 1AJ5A 1KSMA 2MHHA 1HT9A 1B8LA 4MZKA 1AK8A 2JNFA 2OTGC 1IJ6A 1MXEA 3M0WA 4F0ZB 1SNLA 1OMVA 2JULA 5I2OA 1DTLA 4C0LA 4MRYA 2L5XB 3PFVA 5D69A 1TCOB 2F3YA 1HQVA 3PATA 2FCEA 3RLZA 1CFPA 4TNCA 4R1EA 2HQWA 2KFHA 1FF1A 3TDUA 2M1KB 3BUXB 1DGVA 1GQMA 3CR4X 2PMYA 1GGZA 4MZLA 1QV1A 2BBMA 2JRFA 3SIBA 2OS8C 4I5NB 1WDCC 3SG2A 1SCMB 1SY9A 2KYFA 1UHNA 3AAKA 1QVIZ 1CLBA 3NSLA 1YRUB 1VRKA 3AKBA 4QJ3B 3SG4A 1SMGA 4PE0A 2LE9B 1N0YA 2PASA 1KK8C 2H2KA 1CM1A 1SL7A 1WLMA 2GV5A 3JTDB 1S5GZ 2QACA 1G33A 5I8NA 1C07A 4BY4A 3D10A 1QX5B 3OX5A 4CPVA 3CWGA 3PM8A 1S6CA 1JFKA 1SR6B 4FTGA 2SCPA 3JVTB 4PE1A 3BUWB 1G4YR 3VGOA 1LINA 2KYCA 1M63B 2KAVA 4GGFC 3HCMA 4PHJA 4ZCUA 1L2OB 1NPQA 1Y1AA 2SASA 4N1FA 3BUNB 1CDNA 1H8BA 1QXPA 3O2PA 3VRNA 2KSPA 4JWQA 1YUSA 1TTXA 1ODBA 1PALA 1DJGA 5B8IB 1UURA 1TOPA 3AAJA 1XFZO 1MR8A 4P2YB 2JTTA 3SG6A 1SW8A 2JOJA 1KK7Z 1LA3A 1PSBA 3OP0A 3OHMB 3GOFA 2A4JA 2R2IA 2L0PA 2BL0C 2MAZA 2E30A 1CNPA 2JT0A 4M2OA 1KFXL 3DF0A 2LP3A 1EXRA 2IS9A 2WC8A 1J1EA 4GGFA 3O6BA 2LM5A 3EK4A 1KSOA 1S26D 2D8NA 2K61A 1AUIB 2CXJA 3WNXB 3I5HC 4BY5A 3CTNA 2KNEA 2ZRSA 1KQVA 1J7OA 2JQ6A 1XA5A 2LUXA 3DD4A 1FW4A 1OZOA 1KCYA 1JF2A 4YGCB 1CB1A 4YGDB 1OZSA 1R2UA 1KWOB 4JPZB 1AJ4A 3I5FB 1PULA 1CM4A 1NYAA 2RGIA 3NSIA 1BMOA 5AXIA 3TUYB 1WRLA 2GGZA 3KEVA 5ER5A 3I5GB 1F4QA 2F2OA 4YI8A 4ZCVA 2KAYA 4YGAA 1KFUL 1EL4A
chains in the Genus database with same CATH superfamily
4PDZA 4U8DA 1TNQA 2NXQA 5DKNA 4JQ0D 1S36A 5D7FA 1QLKA 1B9AA 4PHNA 3NSKA 3BFHA 1PRWA 4CFRA 1J7QA 1XFRA 5I2LA 4E68A 3D76A 1Y1UA 1X02A 3FE8A 2B1UA 1TWOA 1YURA 3CGAA 4WQ3A 1K8UA 2LVVA 3DVJA 2KFFA 3LK0A 3S0FA 1DC1A 2K7DA 4ETOA 5JJGA 3B86A 2I18A 2CBLA 1AVSA 1K94A 1NUBA 1BG1A 1E8AA 2JPOA 1QVIY 2I7AA 2MLEC 3IF7A 1WY9A 4PALA 3H4SE 1J55A 4PHMA 2WCEA 5DICA 2LC5A 3CLNA 1NP8A 1U5IB 1DELA 4P5OE 1RJVA 2LAPA 1S5GY 2M97A 2L50A 3JTDC 3IQQA 1ALVA 2WCFA 5IBWA 1BOCA 1DVIA 1TIZA 4A4BA 1XK4C 4MRXA 2LCPA 2WC6A 5DKQA 1RTP1 1SR6C 1UHIA 2EC6B 1EJ3A 1BODA 1XFVO 1NX3A 2NLNA 2PALA 2PYQA 3EKJA 2LV7A 2ZFDA 1F55A 1Z2CB 3WXAA 1ZOTB 4C0JA 5AFPA 2KBMA 1ZACA 1MF8B 1DMOA 3BQ3A 2MJWB 1NCZA 3SG3A 2F2PA 3EG5B 2LHIA 4NDDA 2KGBC 2LUCA 2G9BA 1SYMA 2AMIA 1XVJA 2WOSA 5I94A 1IQ5A 1AHRA 3KHEA 2FOTA 4AQJA 4MLWA 2HETA 3PSRA 1YRTB 1YVLA 1CDPA 2FJUB 4ORBB 1G8IA 1KK7Y 1XK4A 2K7BA 3TDZA 1B4CA 2L2CA 1FI5A 1YTZC 4WQ2A 2MLFC 1OSAA 3UO9A 1B8RA 2HQ8A 2K0JA 3IQOA 1BF5A 5KTYA 1BR4B 1DJYA 3OBVA 1F4OA 2JXLA 1LXFC 2CT9A 5AERA 3MSEB 2KQYA 1J1DA 3DVEA 2JWWA 4XJKA 1MXLC 4OCIA 1UWOA 3VROA 1YX7A 5AEQA 3PN7B 1MWNA 3I5IB 5K89A 1ORGA 2M9GA 2NCOA 3KPXA 4XJKB 2K60A 4MBEA 1CTRA 1MUXA 1KWOC 4GPLB 4OZDA 1F54A 2PRUA 2QDIA 1RFJA 3BYAA 1OOFA 2M49B 1OMRA 3TUYC 2BBNA 2KAXA 3KF9A 3SS5A 3D74A 4MSPA 4CLNA 1JFJA 3CR5X 1DJHA 1UHJA 3DY9A 2K7OA 3QMEA 4YGBB 2M8UA 2DOQA 2NCPA 3VB1A 1IQ3A 3S0AA 2LVJA 3ICBA 4HSZA 3D0YA 1QX2A 1KQMB 2K8MB 1W7IB 1CDMA 1Y6WA 2HF5A 3VRPA 1ZMZA 1NWDA 3OGNA 2LLTA 1K93D 3D0YB 1BR1B 2OPOA 3FWCA 2OS8B 2Y1MA 1WDCB 4PE7A 3CR2A 4WRIA 1Y1XA 2BKHB 4XYNA 5HLOA 1TNWA 1CMFA 1H4BA 2I94A 5G08A 2Y5IA 3IVTA 2G2BA 5HKWA 3BUMB 1DJZA 1BLQA 1K90D 3E3RA 2F3ZA 2MRDA 2QPTA 2K7CA 4OVNF 1A4PA 1PK0D 2LLUA 2WCKA 1A03A 1TCFA 4QJ5B 1QV0A 4AQIA 4ORAB 1YUTA 1D1OA 1JBAA 2ZRTA 1YVHA 1SPYA 2LHLA 1QJTA 3DYEA 2ZNEA 2MBXA 1GM0A 2LMUA 1XFUO 1QX7A 1K96A 1DT7B 1DF0B 1IWQA 2LNKA 3CDNA 3VRRA 1RROA 2KHNA 3EVRA 1XYDA 3DVKA 2EC6C 1A75A 1L7ZA 2LVKA 3R1VA 1TNXA 2WCHA 1CMGA 1IIOA 3DVMA 2LLSA 2FJYA 3V2LA 1A75B 5JOLA 1N65A 1YUUA 4INXA 1JSAA 2KLEA 4JD9A 5KU1A 3WHTB 4Q04A 5CSIA 2BKIB 5FI7A 1SCMC 4OV2A 3SIAA 1U5IA 3S0BA 2KFGA 2JU0A 1BT6A 1GGWA 3SG7A 1A2XA 4INWA 5DKRA 3TS5B 2M3WA 1EG3A 2PVBA 2ISDA 1XO5A 2CNPA 3UNWA 3L4LA 2Y1NA 2H61A 2M1UA 1KFXS 2L5YA 1IH0A 1XFXO 1SBJA 5HYDA 1S1EA 2ZKMX 3D73A 3D77A 3SJSA 4D1EA 2F33A 5CSJA 3JVTC 4USLA 2KBIA 2L51A 1TNPA 1XFWO 1F70A 3BOWA 4I5JA 1K9UA 3A8RA 4FQTA 4JKTA 3S0EA 1L2OC 4GUKA 4IL1A 1OOJA 4GBAA 1M46A 1FI6A 4MN0A 2LMVA 1SL9A 3LCPC 3KO0A 1OOIX 3BOWB 4HRGA 3I5IC 4N5XA 1B7TY 1M45A 5HLVA 1SK6D 3NSOA 4YI9A 5BPJA 1QIWA 3O4YA 1ALWA 2K2FA 2JTZA 1QLSA 2E6WA 3ZWHA 2CTNA 4CFQA 2AAOA 3LLEA 1JWDA 1P28A 1CFCA 3O78A 4M2PA 2KI6C 1DJIA 2F8PA 2ERBA 3PM2A 3NXAA 3EKHA 1IJ5A 1KFUS 2QEOA 2M7LA 1PVAA 1A29A 2GTEA 4M2QA 1UUSA 3TZ1A 1KQMC 3PLFB 1NIWA 1ZFSA 2JT3A 2L4HA 4UPGA 3OX6A 2L4IA 5HKYA 1GJYA 1OOHA 2BCXA 3EK7A 1NX0A 3CZTX 2JXCA 4GGNA 2QEHA 5FI6A 1S6IA 1B47A 1CFDA 1TN4A 2ZN8A 1FBVA 3OB1B 2H8VA 1YX8A 3PJIA 1M31A 2KI4B 2KDHA 2LVIA 2ZN9A 2O60A 3ZNIA 1B7TZ 1PSRA 2KLDA 2LP2A 4NDBA 4NQGA 2YGUA 1NSHA 3B6XA 2COLB 1QATA 3I5FC 3AKAA 2PQLA 5CPVA 1S3PA 1W7JB 2EHBA 5HKZA 1IKUA 2OTGB 2Q4UA 1EH2A 3GK2A 2JC2A 3CYZA 1CKKA 3I5GC 1CLMA 1OW4A 3BFBA 1IRJA 4OR9B 3RM1A 3D75A 1WRKA 2AUCA 4FQOA 1YR5A 4HREE 2M29A 4ICBA 4DS7A 3BFAA 5PALA 4HRHA 4I5LB 4A4CA 1N2DA 2Q91A 1DJWA 1IG5A 4C0KA 2WCBA 1CFFA 2ZNDA 3EVUA 1K2HA 2HPSA 1MQ1A 1DJXA 5FYXA 3R1OA 2WORA 1WLZA 1B1GA 5I2QA 3CZ2A 4I5KA 3BJHA 1RWYA 2FCDA 1LA0A 5F6TA 1JC2A 1OMDA 1T14A 3FIAA 2JNXA 1KK8B 1K9KA 2LANA 3FWBA 4DUQA 4L9MA 1AP4A 2KGRA 5AANA 5ER4X 5HL1A 3B7AA 1LKJA 3SS4A 1SRAA 2KPHA 3FE6A 1B8CA 1QS7A 1JF0A 3QRXA 3TS5C 1DF0A 2Y4QA 4GFTA 2O5GA 1UP5A 2JZIA 2I2RE 2WCMA 3NHTA 3NHIA 5CSNA 1UHKA 2L98A 2QEBA 2V53A 1R6PA 3DF0B 4PCWA 5KSZA 4YGEB 1LVCD 1K9PA 3CZ0A 3FS7A 1K95A 1SL8A 3GK4X 4CIDA 4DRWA 3C1VA 1Y0VH 3PALA 4MEWA 1TUZA 1EG4A 2M7NA 2H61C 2QEVA 3GK1A 4N1GA 5CSFA 4GNKB 1W9ZA 4YRUA 1NX1A 4YBHB 3LK1A 3S0GA 2L2EA 1Q80A 1SKTA 1CLLA 1LS8A 1BU3A 1UHHA 4DCKA 3LL8B 3WHUB 4OKHA 1OQPA 3FE9A 2KI6D 1JUOA 4QJ4B 1V1GA 2BL0B 5GQQC 1IGVA 1XFYO 2BE6A 3BUOB 1FPWA 2BCBA 4PE4A 2BCAA 5J3XA 1S6JA 2BECA 3F45A 2MA2A 2GGMA 1J7RA 1ZUZA 2LMTA 2TN4A 3TDIA 3VRQA 4MZJA 1BJFA 3I5HB 2EGDA 2VRGA 3L4AA 1MHOA 1OE9B 1C7WA 3RZSA 3OB2B 1M39A 5TNCA 4NDCA 3BXKA 1QIVA 2PSRA 1PVBA 1C7VA 1NCXA 3EVVA 1NX2A 2BAPA 1QTXA 2KOTA 3CS1A 1CDLA 4PHKA 5EL2A 3EK8A 2BE4A 4GAOA 1J7PA 2KQ6A 2K2AA 1F71A 1F8HA 1TRFA 1SCVA 3B88A 1DGUA 3K21A 4DIRA 3A4UB 3K1EA 1V1FA 1RK9A 3NGVA 2NZ0A 3PN7C 1QASA 2KI4C 2P6BB 2WNDA 4MVFA 2JT8A 4ORCB 4AOMA 2CCMA 1NCYA 3HX4A 2JPTA 1RECA 2M0RA 4IJ7A 1WRZA 3SG5A 1AJ5A 1KSMA 2MHHA 1HT9A 1B8LA 1Z4HA 1OOGA 4MZKA 1AK8A 2JNFA 2OTGC 1IJ6A 1MXEA 3B87A 3M0WA 4F0ZB 1SNLA 1C3YA 1OMVA 2JULA 5I2OA 1DTLA 4C0LA 4MRYA 2L5XB 3PFVA 5D69A 1TCOB 2F3YA 1HQVA 3PATA 2FCEA 3RLZA 1CFPA 4TNCA 4R1EA 2HQWA 2KFHA 1FF1A 3TDUA 2M1KB 3BUXB 3DXLA 1DGVA 1GQMA 3CR4X 3O4XA 2PMYA 1GGZA 4MZLA 1QV1A 2BBMA 2JRFA 3SIBA 2OS8C 4I5NB 1WDCC 3SG2A 1SCMB 1SY9A 2KYFA 1UHNA 3AAKA 1QVIZ 3DZTA 2BNXA 3NSLA 1CLBA 1YRUB 1VRKA 3AKBA 4QJ3B 3D78A 5FI2A 3SG4A 1DQEA 1SMGA 4PE0A 2LE9B 1N0YA 2PASA 1KK8C 2H2KA 1CM1A 1SL7A 1WLMA 2GV5A 3JTDB 1S5GZ 2QACA 4F7FA 1G33A 5I8NA 1C07A 4BY4A 3D10A 1QX5B 3OX5A 4CPVA 3CWGA 3PM8A 1S6CA 1JFKA 1SR6B 4FTGA 2SCPA 3JVTB 3R1PA 2WCLA 4PE1A 3BUWB 1G4YR 3VGOA 1LINA 2P70A 2KYCA 1M63B 2KAVA 4GGFC 3HCMA 4PHJA 4ZCUA 1L2OB 1NPQA 1Y1AA 2SASA 4N1FA 3BUNB 1CDNA 1H8BA 1QXPA 3O2PA 3VRNA 2KSPA 4JWQA 1TUJA 1YUSA 1TTXA 1ODBA 1PALA 1DJGA 5B8IB 1UURA 1TOPA 1QWVA 3AAJA 4PT1A 3CABA 1XFZO 1MR8A 1C3ZA 4P2YB 2JTTA 3SG6A 1SW8A 2JOJA 1KK7Z 1LA3A 1PSBA 3OP0A 3OHMB 3GOFA 2A4JA 2R2IA 2L0PA 2BL0C 2MAZA 2E30A 1CNPA 2JT0A 4M2OA 2P71A 1KFXL 3DF0A 2LP3A 1EXRA 2IS9A 2WC8A 3R72A 1J1EA 4GGFA 3O6BA 2LM5A 3EK4A 1KSOA 1S26D 2D8NA 2K61A 3CZ1A 1AUIB 2CXJA 3WNXB 3I5HC 4BY5A 3CTNA 4KYNA 2KNEA 3SS3A 2ZRSA 1KQVA 1J7OA 1DEKA 2JQ6A 1XA5A 2LUXA 3DD4A 1FW4A 1OZOA 1KCYA 1JF2A 3Q8IA 4YGCB 1CB1A 4YGDB 1OZSA 1R2UA 1KWOB 4JPZB 1AJ4A 3I5FB 1PULA 1CM4A 1NYAA 2RGIA 2WCJA 1BMOA 3NSIA 5AXIA 3TUYB 2WC5A 1WRLA 2GGZA 5D3OA 3KEVA 5ER5A 3I5GB 1F4QA 2F2OA 3L47A 4YI8A 3N7HA 3S0DA 4ZCVA 2KAYA 4YGAA 1SSEB 1KFUL 1EL4A
chains in the Genus database with same CATH topology
4PDZA 4U8DA 1TNQA 2NXQA 5DKNA 4JQ0D 1S36A 5D7FA 1QLKA 1B9AA 4PHNA 3NSKA 4CFRA 1PRWA 1J7QA 5I2LA 4E68A 1Y1UA 1X02A 2B1UA 1YURA 3CGAA 4WQ3A 1K8UA 2LVVA 3DVJA 2KFFA 3LK0A 2K7DA 4ETOA 5JJGA 2I18A 2CBLA 1AVSA 1K94A 1NUBA 1BG1A 1E8AA 1QVIY 2I7AA 2MLEC 3IF7A 1WY9A 4PALA 3H4SE 1J55A 4PHMA 2WCEA 2LC5A 3CLNA 1NP8A 1U5IB 4P5OE 1RJVA 2LAPA 1S5GY 2M97A 2L50A 3JTDC 3IQQA 1ALVA 2WCFA 5IBWA 1BOCA 1DVIA 1TIZA 4A4BA 1XK4C 4MRXA 2LCPA 5DKQA 1RTP1 1SR6C 1UHIA 2EC6B 1EJ3A 1BODA 1XFVO 1NX3A 2NLNA 2PALA 3EKJA 1F55A 2LV7A 2ZFDA 3WXAA 1ZOTB 4C0JA 5AFPA 2KBMA 1ZACA 1MF8B 1DMOA 3BQ3A 2MJWB 1NCZA 3SG3A 2F2PA 2LHIA 4NDDA 2KGBC 2LUCA 2G9BA 1SYMA 2AMIA 1XVJA 2WOSA 1IQ5A 1AHRA 3KHEA 2FOTA 4AQJA 4MLWA 2HETA 3PSRA 1YRTB 1YVLA 1CDPA 2FJUB 4ORBB 1G8IA 1KK7Y 1XK4A 2K7BA 3TDZA 1B4CA 1FI5A 1YTZC 4WQ2A 2MLFC 1OSAA 1B8RA 2HQ8A 2K0JA 3IQOA 1BF5A 5KTYA 1BR4B 1DJYA 1F4OA 2JXLA 1LXFC 2CT9A 5AERA 3MSEB 2KQYA 1J1DA 3DVEA 2JWWA 4XJKA 1MXLC 4OCIA 1UWOA 3VROA 1YX7A 5AEQA 3PN7B 1MWNA 3I5IB 5K89A 2M9GA 2NCOA 3KPXA 4XJKB 4MBEA 1CTRA 1MUXA 1KWOC 4GPLB 1F54A 2PRUA 3BYAA 1RFJA 2M49B 1OMRA 3TUYC 2BBNA 2KAXA 3KF9A 4MSPA 4CLNA 1JFJA 3CR5X 1DJHA 1UHJA 2K7OA 4YGBB 2M8UA 2DOQA 2NCPA 1IQ3A 2LVJA 3ICBA 4HSZA 3D0YA 1QX2A 1KQMB 2K8MB 1W7IB 1CDMA 1Y6WA 2HF5A 3VRPA 1ZMZA 1NWDA 2LLTA 1K93D 3D0YB 1BR1B 2OPOA 3FWCA 2OS8B 2Y1MA 1WDCB 4PE7A 3CR2A 4WRIA 1Y1XA 2BKHB 4XYNA 5HLOA 1TNWA 1CMFA 1H4BA 2I94A 5G08A 2Y5IA 2G2BA 5HKWA 3BUMB 1DJZA 1BLQA 1K90D 3E3RA 2F3ZA 2MRDA 2QPTA 2K7CA 4OVNF 1A4PA 1PK0D 2LLUA 1A03A 1TCFA 4QJ5B 1QV0A 4AQIA 4ORAB 1YUTA 1D1OA 1JBAA 2ZRTA 1YVHA 1SPYA 2LHLA 1QJTA 2MBXA 2ZNEA 2LMUA 1XFUO 1QX7A 1K96A 1DT7B 1DF0B 1IWQA 2LNKA 3VRRA 1RROA 2KHNA 3EVRA 1XYDA 3DVKA 2EC6C 1A75A 1L7ZA 2LVKA 1CMGA 1TNXA 3DVMA 2LLSA 1A75B 5JOLA 1N65A 1YUUA 1JSAA 5KU1A 3WHTB 4Q04A 5CSIA 2BKIB 1SCMC 4OV2A 3SIAA 1U5IA 2KFGA 2JU0A 1BT6A 1GGWA 3SG7A 1A2XA 5DKRA 3TS5B 2M3WA 1EG3A 2PVBA 2ISDA 1XO5A 2CNPA 2Y1NA 2H61A 2M1UA 1KFXS 1IH0A 1XFXO 1SBJA 5HYDA 1S1EA 2ZKMX 3SJSA 4D1EA 2F33A 5CSJA 3JVTC 4USLA 2KBIA 2L51A 1TNPA 1XFWO 1F70A 3BOWA 4I5JA 1K9UA 3A8RA 1L2OC 4GUKA 4IL1A 1OOJA 4GBAA 1M46A 1FI6A 4MN0A 2LMVA 1SL9A 3LCPC 3KO0A 4HRGA 3BOWB 4N5XA 3I5IC 1B7TY 1M45A 5HLVA 1SK6D 3NSOA 4YI9A 5BPJA 1QIWA 3O4YA 1ALWA 2K2FA 2JTZA 1QLSA 2E6WA 3ZWHA 2CTNA 4CFQA 2AAOA 3LLEA 1JWDA 1CFCA 3O78A 4M2PA 2KI6C 1DJIA 2F8PA 3NXAA 3EKHA 1IJ5A 1KFUS 2M7LA 1PVAA 1A29A 4M2QA 1UUSA 3TZ1A 1KQMC 3PLFB 1NIWA 1ZFSA 2JT3A 2L4HA 4UPGA 3OX6A 2L4IA 5HKYA 1GJYA 2BCXA 3EK7A 1NX0A 3CZTX 2JXCA 4GGNA 1S6IA 1B47A 1CFDA 1TN4A 2ZN8A 1FBVA 3OB1B 1YX8A 1M31A 2KI4B 2KDHA 2LVIA 2ZN9A 2O60A 3ZNIA 1B7TZ 1PSRA 2LP2A 4NDBA 4NQGA 1NSHA 2COLB 1QATA 3I5FC 3AKAA 5CPVA 1S3PA 1W7JB 2EHBA 5HKZA 1IKUA 2OTGB 2Q4UA 1EH2A 3GK2A 2JC2A 1CKKA 3I5GC 1CLMA 3RM1A 4OR9B 1IRJA 1WRKA 2AUCA 4FQOA 1YR5A 4HREE 2M29A 4ICBA 4DS7A 5PALA 4HRHA 4I5LB 4A4CA 1N2DA 2Q91A 1DJWA 1IG5A 4C0KA 2WCBA 1CFFA 2ZNDA 3EVUA 1K2HA 2HPSA 1MQ1A 1DJXA 5FYXA 2WORA 1WLZA 1B1GA 5I2QA 4I5KA 1RWYA 2FCDA 1LA0A 5F6TA 1JC2A 1OMDA 3FIAA 2JNXA 1KK8B 1K9KA 2LANA 3FWBA 4DUQA 4L9MA 1AP4A 2KGRA 5AANA 5ER4X 1LKJA 1SRAA 1B8CA 1QS7A 1JF0A 3QRXA 3TS5C 1DF0A 2Y4QA 4GFTA 2O5GA 1UP5A 2JZIA 2I2RE 5CSNA 1UHKA 2L98A 2V53A 1R6PA 3DF0B 4PCWA 5KSZA 4YGEB 1LVCD 1K9PA 3FS7A 1K95A 1SL8A 3GK4X 4CIDA 4DRWA 3C1VA 1Y0VH 3PALA 4MEWA 1EG4A 2M7NA 2H61C 3GK1A 4N1GA 5CSFA 4GNKB 4YRUA 1NX1A 4YBHB 3LK1A 2L2EA 1Q80A 1SKTA 1CLLA 1BU3A 1UHHA 4DCKA 3LL8B 3WHUB 4OKHA 1OQPA 2KI6D 1JUOA 4QJ4B 1V1GA 2BL0B 5GQQC 1IGVA 1XFYO 2BE6A 3BUOB 1FPWA 2BCBA 4PE4A 2BCAA 5J3XA 1S6JA 2BECA 3F45A 2MA2A 2GGMA 1J7RA 1ZUZA 2LMTA 2TN4A 3TDIA 3VRQA 4MZJA 1BJFA 3I5HB 2EGDA 2VRGA 1MHOA 1OE9B 1C7WA 3OB2B 1M39A 5TNCA 4NDCA 3BXKA 1QIVA 2PSRA 1PVBA 1C7VA 1NCXA 3EVVA 1NX2A 1QTXA 2KOTA 3CS1A 1CDLA 4PHKA 3EK8A 2BE4A 4GAOA 1J7PA 2KQ6A 2K2AA 1F71A 1F8HA 1TRFA 1SCVA 1DGUA 3K21A 4DIRA 3A4UB 1V1FA 1RK9A 2NZ0A 3PN7C 1QASA 2KI4C 2P6BB 2WNDA 4MVFA 2JT8A 4ORCB 4AOMA 2CCMA 1NCYA 3HX4A 2JPTA 1RECA 2M0RA 3SG5A 1WRZA 1AJ5A 1KSMA 2MHHA 1HT9A 1B8LA 4MZKA 1AK8A 2JNFA 2OTGC 1IJ6A 1MXEA 3M0WA 4F0ZB 1SNLA 1OMVA 2JULA 5I2OA 1DTLA 4C0LA 4MRYA 2L5XB 3PFVA 5D69A 1TCOB 2F3YA 1HQVA 3PATA 2FCEA 3RLZA 1CFPA 4TNCA 4R1EA 2HQWA 2KFHA 1FF1A 3TDUA 2M1KB 3BUXB 1DGVA 1GQMA 3CR4X 2PMYA 1GGZA 4MZLA 1QV1A 2BBMA 2JRFA 3SIBA 2OS8C 4I5NB 1WDCC 3SG2A 1SCMB 1SY9A 2KYFA 1UHNA 3AAKA 1QVIZ 1CLBA 3NSLA 1YRUB 1VRKA 3AKBA 4QJ3B 3SG4A 1SMGA 4PE0A 2LE9B 1N0YA 2PASA 1KK8C 2H2KA 1CM1A 1SL7A 1WLMA 2GV5A 3JTDB 1S5GZ 2QACA 1G33A 5I8NA 1C07A 4BY4A 3D10A 1QX5B 3OX5A 4CPVA 3CWGA 3PM8A 1S6CA 1JFKA 1SR6B 4FTGA 2SCPA 3JVTB 4PE1A 3BUWB 1G4YR 3VGOA 1LINA 2KYCA 1M63B 2KAVA 4GGFC 3HCMA 4PHJA 4ZCUA 1L2OB 1NPQA 1Y1AA 2SASA 4N1FA 3BUNB 1CDNA 1H8BA 1QXPA 3O2PA 3VRNA 2KSPA 4JWQA 1YUSA 1TTXA 1ODBA 1PALA 1DJGA 5B8IB 1UURA 1TOPA 3AAJA 1XFZO 1MR8A 4P2YB 2JTTA 3SG6A 1SW8A 2JOJA 1KK7Z 1LA3A 1PSBA 3OP0A 3OHMB 3GOFA 2A4JA 2R2IA 2L0PA 2BL0C 2MAZA 2E30A 1CNPA 2JT0A 4M2OA 1KFXL 3DF0A 2LP3A 1EXRA 2IS9A 2WC8A 1J1EA 4GGFA 3O6BA 2LM5A 3EK4A 1KSOA 1S26D 2D8NA 2K61A 1AUIB 2CXJA 3WNXB 3I5HC 4BY5A 3CTNA 2KNEA 2ZRSA 1KQVA 1J7OA 2JQ6A 1XA5A 2LUXA 3DD4A 1FW4A 1OZOA 1KCYA 1JF2A 4YGCB 1CB1A 4YGDB 1OZSA 1R2UA 1KWOB 4JPZB 1AJ4A 3I5FB 1PULA 1CM4A 1NYAA 2RGIA 3NSIA 1BMOA 5AXIA 3TUYB 1WRLA 2GGZA 3KEVA 5ER5A 3I5GB 1F4QA 2F2OA 4YI8A 4ZCVA 2KAYA 4YGAA 1KFUL 1EL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDZ A;  4U8D A;  1TNQ A;  2NXQ A;  5DKN A;  4JQ0 D;  1S36 A;  5D7F A;  1QLK A;  1B9A A;  4PHN A;  3NSK A;  4CFR A;  1PRW A;  1J7Q A;  5I2L A;  4E68 A;  1Y1U A;  1X02 A;  2B1U A;  1YUR A;  3CGA A;  4WQ3 A;  1K8U A;  2LVV A;  3DVJ A;  2KFF A;  3LK0 A;  2K7D A;  4ETO A;  5JJG A;  2I18 A;  2CBL A;  1AVS A;  1K94 A;  1NUB A;  1BG1 A;  1E8A A;  1QVI Y;  2I7A A;  2MLE C;  3IF7 A;  1WY9 A;  4PAL A;  3H4S E;  1J55 A;  4PHM A;  2WCE A;  2LC5 A;  3CLN A;  1NP8 A;  1U5I B;  4P5O E;  1RJV A;  2LAP A;  1S5G Y;  2M97 A;  2L50 A;  3JTD C;  3IQQ A;  1ALV A;  2WCF A;  5IBW A;  1BOC A;  1DVI A;  1TIZ A;  4A4B A;  1XK4 C;  4MRX A;  2LCP A;  5DKQ A;  1RTP 1;  1SR6 C;  1UHI A;  2EC6 B;  1EJ3 A;  1BOD A;  1XFV O;  1NX3 A;  2NLN A;  2PAL A;  3EKJ A;  1F55 A;  2LV7 A;  2ZFD A;  3WXA A;  1ZOT B;  4C0J A;  5AFP A;  2KBM A;  1ZAC A;  1MF8 B;  1DMO A;  3BQ3 A;  2MJW B;  1NCZ A;  3SG3 A;  2F2P A;  2LHI A;  4NDD A;  2KGB C;  2LUC A;  2G9B A;  1SYM A;  2AMI A;  1XVJ A;  2WOS A;  1IQ5 A;  1AHR A;  3KHE A;  2FOT A;  4AQJ A;  4MLW A;  2HET A;  3PSR A;  1YRT B;  1YVL A;  1CDP A;  2FJU B;  4ORB B;  1G8I A;  1KK7 Y;  1XK4 A;  2K7B A;  3TDZ A;  1B4C A;  1FI5 A;  1YTZ C;  4WQ2 A;  2MLF C;  1OSA A;  1B8R A;  2HQ8 A;  2K0J A;  3IQO A;  1BF5 A;  5KTY A;  1BR4 B;  1DJY A;  1F4O A;  2JXL A;  1LXF C;  2CT9 A;  5AER A;  3MSE B;  2KQY A;  1J1D A;  3DVE A;  2JWW A;  4XJK A;  1MXL C;  4OCI A;  1UWO A;  3VRO A;  1YX7 A;  5AEQ A;  3PN7 B;  1MWN A;  3I5I B;  5K89 A;  2M9G A;  2NCO A;  3KPX A;  4XJK B;  4MBE A;  1CTR A;  1MUX A;  1KWO C;  4GPL B;  1F54 A;  2PRU A;  3BYA A;  1RFJ A;  2M49 B;  1OMR A;  3TUY C;  2BBN A;  2KAX A;  3KF9 A;  4MSP A;  4CLN A;  1JFJ A;  3CR5 X;  1DJH A;  1UHJ A;  2K7O A;  4YGB B;  2M8U A;  2DOQ A;  2NCP A;  1IQ3 A;  2LVJ A;  3ICB A;  4HSZ A;  3D0Y A;  1QX2 A;  1KQM B;  2K8M B;  1W7I B;  1CDM A;  1Y6W A;  2HF5 A;  3VRP A;  1ZMZ A;  1NWD A;  2LLT A;  1K93 D;  3D0Y B;  1BR1 B;  2OPO A;  3FWC A;  2OS8 B;  2Y1M A;  1WDC B;  4PE7 A;  3CR2 A;  4WRI A;  1Y1X A;  2BKH B;  4XYN A;  5HLO A;  1TNW A;  1CMF A;  1H4B A;  2I94 A;  5G08 A;  2Y5I A;  2G2B A;  5HKW A;  3BUM B;  1DJZ A;  1BLQ A;  1K90 D;  3E3R A;  2F3Z A;  2MRD A;  2QPT A;  2K7C A;  4OVN F;  1A4P A;  1PK0 D;  2LLU A;  1A03 A;  1TCF A;  4QJ5 B;  1QV0 A;  4AQI A;  4ORA B;  1YUT A;  1D1O A;  1JBA A;  2ZRT A;  1YVH A;  1SPY A;  2LHL A;  1QJT A;  2MBX A;  2ZNE A;  2LMU A;  1XFU O;  1QX7 A;  1K96 A;  1DT7 B;  1DF0 B;  1IWQ A;  2LNK A;  3VRR A;  1RRO A;  2KHN A;  3EVR A;  1XYD A;  3DVK A;  2EC6 C;  1A75 A;  1L7Z A;  2LVK A;  1CMG A;  1TNX A;  3DVM A;  2LLS A;  1A75 B;  5JOL A;  1N65 A;  1YUU A;  1JSA A;  5KU1 A;  3WHT B;  4Q04 A;  5CSI A;  2BKI B;  1SCM C;  4OV2 A;  3SIA A;  1U5I A;  2KFG A;  2JU0 A;  1BT6 A;  1GGW A;  3SG7 A;  1A2X A;  5DKR A;  3TS5 B;  2M3W A;  1EG3 A;  2PVB A;  2ISD A;  1XO5 A;  2CNP A;  2Y1N A;  2H61 A;  2M1U A;  1KFX S;  1IH0 A;  1XFX O;  1SBJ A;  5HYD A;  1S1E A;  2ZKM X;  3SJS A;  4D1E A;  2F33 A;  5CSJ A;  3JVT C;  4USL A;  2KBI A;  2L51 A;  1TNP A;  1XFW O;  1F70 A;  3BOW A;  4I5J A;  1K9U A;  3A8R A;  1L2O C;  4GUK A;  4IL1 A;  1OOJ A;  4GBA A;  1M46 A;  1FI6 A;  4MN0 A;  2LMV A;  1SL9 A;  3LCP C;  3KO0 A;  4HRG A;  3BOW B;  4N5X A;  3I5I C;  1B7T Y;  1M45 A;  5HLV A;  1SK6 D;  3NSO A;  4YI9 A;  5BPJ A;  1QIW A;  3O4Y A;  1ALW A;  2K2F A;  2JTZ A;  1QLS A;  2E6W A;  3ZWH A;  2CTN A;  4CFQ A;  2AAO A;  3LLE A;  1JWD A;  1CFC A;  3O78 A;  4M2P A;  2KI6 C;  1DJI A;  2F8P A;  3NXA A;  3EKH A;  1IJ5 A;  1KFU S;  2M7L A;  1PVA A;  1A29 A;  4M2Q A;  1UUS A;  3TZ1 A;  1KQM C;  3PLF B;  1NIW A;  1ZFS A;  2JT3 A;  2L4H A;  4UPG A;  3OX6 A;  2L4I A;  5HKY A;  1GJY A;  2BCX A;  3EK7 A;  1NX0 A;  3CZT X;  2JXC A;  4GGN A;  1S6I A;  1B47 A;  1CFD A;  1TN4 A;  2ZN8 A;  1FBV A;  3OB1 B;  1YX8 A;  1M31 A;  2KI4 B;  2KDH A;  2LVI A;  2ZN9 A;  2O60 A;  3ZNI A;  1B7T Z;  1PSR A;  2LP2 A;  4NDB A;  4NQG A;  1NSH A;  2COL B;  1QAT A;  3I5F C;  3AKA A;  5CPV A;  1S3P A;  1W7J B;  2EHB A;  5HKZ A;  1IKU A;  2OTG B;  2Q4U A;  1EH2 A;  3GK2 A;  2JC2 A;  1CKK A;  3I5G C;  1CLM A;  3RM1 A;  4OR9 B;  1IRJ A;  1WRK A;  2AUC A;  4FQO A;  1YR5 A;  4HRE E;  2M29 A;  4ICB A;  4DS7 A;  5PAL A;  4HRH A;  4I5L B;  4A4C A;  1N2D A;  2Q91 A;  1DJW A;  1IG5 A;  4C0K A;  2WCB A;  1CFF A;  2ZND A;  3EVU A;  1K2H A;  2HPS A;  1MQ1 A;  1DJX A;  5FYX A;  2WOR A;  1WLZ A;  1B1G A;  5I2Q A;  4I5K A;  1RWY A;  2FCD A;  1LA0 A;  5F6T A;  1JC2 A;  1OMD A;  3FIA A;  2JNX A;  1KK8 B;  1K9K A;  2LAN A;  3FWB A;  4DUQ A;  4L9M A;  1AP4 A;  2KGR A;  5AAN A;  5ER4 X;  1LKJ A;  1SRA A;  1B8C A;  1QS7 A;  1JF0 A;  3QRX A;  3TS5 C;  1DF0 A;  2Y4Q A;  4GFT A;  2O5G A;  1UP5 A;  2JZI A;  2I2R E;  5CSN A;  1UHK A;  2L98 A;  2V53 A;  1R6P A;  3DF0 B;  4PCW A;  5KSZ A;  4YGE B;  1LVC D;  1K9P A;  3FS7 A;  1K95 A;  1SL8 A;  3GK4 X;  4CID A;  4DRW A;  3C1V A;  1Y0V H;  3PAL A;  4MEW A;  1EG4 A;  2M7N A;  2H61 C;  3GK1 A;  4N1G A;  5CSF A;  4GNK B;  4YRU A;  1NX1 A;  4YBH B;  3LK1 A;  2L2E A;  1Q80 A;  1SKT A;  1CLL A;  1BU3 A;  1UHH A;  4DCK A;  3LL8 B;  3WHU B;  4OKH A;  1OQP A;  2KI6 D;  1JUO A;  4QJ4 B;  1V1G A;  2BL0 B;  5GQQ C;  1IGV A;  1XFY O;  2BE6 A;  3BUO B;  1FPW A;  2BCB A;  4PE4 A;  2BCA A;  5J3X A;  1S6J A;  2BEC A;  3F45 A;  2MA2 A;  2GGM A;  1J7R A;  1ZUZ A;  2LMT A;  2TN4 A;  3TDI A;  3VRQ A;  4MZJ A;  1BJF A;  3I5H B;  2EGD A;  2VRG A;  1MHO A;  1OE9 B;  1C7W A;  3OB2 B;  1M39 A;  5TNC A;  4NDC A;  3BXK A;  1QIV A;  2PSR A;  1PVB A;  1C7V A;  1NCX A;  3EVV A;  1NX2 A;  1QTX A;  2KOT A;  3CS1 A;  1CDL A;  4PHK A;  3EK8 A;  2BE4 A;  4GAO A;  1J7P A;  2KQ6 A;  2K2A A;  1F71 A;  1F8H A;  1TRF A;  1SCV A;  1DGU A;  3K21 A;  4DIR A;  3A4U B;  1V1F A;  1RK9 A;  2NZ0 A;  3PN7 C;  1QAS A;  2KI4 C;  2P6B B;  2WND A;  4MVF A;  2JT8 A;  4ORC B;  4AOM A;  2CCM A;  1NCY A;  3HX4 A;  2JPT A;  1REC A;  2M0R A;  3SG5 A;  1WRZ A;  1AJ5 A;  1KSM A;  2MHH A;  1HT9 A;  1B8L A;  4MZK A;  1AK8 A;  2JNF A;  2OTG C;  1IJ6 A;  1MXE A;  3M0W A;  4F0Z B;  1SNL A;  1OMV A;  2JUL A;  5I2O A;  1DTL A;  4C0L A;  4MRY A;  2L5X B;  3PFV A;  5D69 A;  1TCO B;  2F3Y A;  1HQV A;  3PAT A;  2FCE A;  3RLZ A;  1CFP A;  4TNC A;  4R1E A;  2HQW A;  2KFH A;  1FF1 A;  3TDU A;  2M1K B;  3BUX B;  1DGV A;  1GQM A;  3CR4 X;  2PMY A;  1GGZ A;  4MZL A;  1QV1 A;  2BBM A;  2JRF A;  3SIB A;  2OS8 C;  4I5N B;  1WDC C;  3SG2 A;  1SCM B;  1SY9 A;  2KYF A;  1UHN A;  3AAK A;  1QVI Z;  1CLB A;  3NSL A;  1YRU B;  1VRK A;  3AKB A;  4QJ3 B;  3SG4 A;  1SMG A;  4PE0 A;  2LE9 B;  1N0Y A;  2PAS A;  1KK8 C;  2H2K A;  1CM1 A;  1SL7 A;  1WLM A;  2GV5 A;  3JTD B;  1S5G Z;  2QAC A;  1G33 A;  5I8N A;  1C07 A;  4BY4 A;  3D10 A;  1QX5 B;  3OX5 A;  4CPV A;  3CWG A;  3PM8 A;  1S6C A;  1JFK A;  1SR6 B;  4FTG A;  2SCP A;  3JVT B;  4PE1 A;  3BUW B;  1G4Y R;  3VGO A;  1LIN A;  2KYC A;  1M63 B;  2KAV A;  4GGF C;  3HCM A;  4PHJ A;  4ZCU A;  1L2O B;  1NPQ A;  1Y1A A;  2SAS A;  4N1F A;  3BUN B;  1CDN A;  1H8B A;  1QXP A;  3O2P A;  3VRN A;  2KSP A;  4JWQ A;  1YUS A;  1TTX A;  1ODB A;  1PAL A;  1DJG A;  5B8I B;  1UUR A;  1TOP A;  3AAJ A;  1XFZ O;  1MR8 A;  4P2Y B;  2JTT A;  3SG6 A;  1SW8 A;  2JOJ A;  1KK7 Z;  1LA3 A;  1PSB A;  3OP0 A;  3OHM B;  3GOF A;  2A4J A;  2R2I A;  2L0P A;  2BL0 C;  2MAZ A;  2E30 A;  1CNP A;  2JT0 A;  4M2O A;  1KFX L;  3DF0 A;  2LP3 A;  1EXR A;  2IS9 A;  2WC8 A;  1J1E A;  4GGF A;  3O6B A;  2LM5 A;  3EK4 A;  1KSO A;  1S26 D;  2D8N A;  2K61 A;  1AUI B;  2CXJ A;  3WNX B;  3I5H C;  4BY5 A;  3CTN A;  2KNE A;  2ZRS A;  1KQV A;  1J7O A;  2JQ6 A;  1XA5 A;  2LUX A;  3DD4 A;  1FW4 A;  1OZO A;  1KCY A;  1JF2 A;  4YGC B;  1CB1 A;  4YGD B;  1OZS A;  1R2U A;  1KWO B;  4JPZ B;  1AJ4 A;  3I5F B;  1PUL A;  1CM4 A;  1NYA A;  2RGI A;  3NSI A;  1BMO A;  5AXI A;  3TUY B;  1WRL A;  2GGZ A;  3KEV A;  5ER5 A;  3I5G B;  1F4Q A;  2F2O A;  4YI8 A;  4ZCV A;  2KAY A;  4YGA A;  1KFU L;  1EL4 A; 
#chains in the Genus database with same CATH topology
 4PDZ A;  4U8D A;  1TNQ A;  2NXQ A;  5DKN A;  4JQ0 D;  1S36 A;  5D7F A;  1QLK A;  1B9A A;  4PHN A;  3NSK A;  3BFH A;  1PRW A;  4CFR A;  1J7Q A;  1XFR A;  5I2L A;  4E68 A;  3D76 A;  1Y1U A;  1X02 A;  3FE8 A;  2B1U A;  1TWO A;  1YUR A;  3CGA A;  4WQ3 A;  1K8U A;  2LVV A;  3DVJ A;  2KFF A;  3LK0 A;  3S0F A;  1DC1 A;  2K7D A;  4ETO A;  5JJG A;  3B86 A;  2I18 A;  2CBL A;  1AVS A;  1K94 A;  1NUB A;  1BG1 A;  1E8A A;  2JPO A;  1QVI Y;  2I7A A;  2MLE C;  3IF7 A;  1WY9 A;  4PAL A;  3H4S E;  1J55 A;  4PHM A;  2WCE A;  5DIC A;  2LC5 A;  3CLN A;  1NP8 A;  1U5I B;  1DEL A;  4P5O E;  1RJV A;  2LAP A;  1S5G Y;  2M97 A;  2L50 A;  3JTD C;  3IQQ A;  1ALV A;  2WCF A;  5IBW A;  1BOC A;  1DVI A;  1TIZ A;  4A4B A;  1XK4 C;  4MRX A;  2LCP A;  2WC6 A;  5DKQ A;  1RTP 1;  1SR6 C;  1UHI A;  2EC6 B;  1EJ3 A;  1BOD A;  1XFV O;  1NX3 A;  2NLN A;  2PAL A;  2PYQ A;  3EKJ A;  2LV7 A;  2ZFD A;  1F55 A;  1Z2C B;  3WXA A;  1ZOT B;  4C0J A;  5AFP A;  2KBM A;  1ZAC A;  1MF8 B;  1DMO A;  3BQ3 A;  2MJW B;  1NCZ A;  3SG3 A;  2F2P A;  3EG5 B;  2LHI A;  4NDD A;  2KGB C;  2LUC A;  2G9B A;  1SYM A;  2AMI A;  1XVJ A;  2WOS A;  5I94 A;  1IQ5 A;  1AHR A;  3KHE A;  2FOT A;  4AQJ A;  4MLW A;  2HET A;  3PSR A;  1YRT B;  1YVL A;  1CDP A;  2FJU B;  4ORB B;  1G8I A;  1KK7 Y;  1XK4 A;  2K7B A;  3TDZ A;  1B4C A;  2L2C A;  1FI5 A;  1YTZ C;  4WQ2 A;  2MLF C;  1OSA A;  3UO9 A;  1B8R A;  2HQ8 A;  2K0J A;  3IQO A;  1BF5 A;  5KTY A;  1BR4 B;  1DJY A;  3OBV A;  1F4O A;  2JXL A;  1LXF C;  2CT9 A;  5AER A;  3MSE B;  2KQY A;  1J1D A;  3DVE A;  2JWW A;  4XJK A;  1MXL C;  4OCI A;  1UWO A;  3VRO A;  1YX7 A;  5AEQ A;  3PN7 B;  1MWN A;  3I5I B;  5K89 A;  1ORG A;  2M9G A;  2NCO A;  3KPX A;  4XJK B;  2K60 A;  4MBE A;  1CTR A;  1MUX A;  1KWO C;  4GPL B;  4OZD A;  1F54 A;  2PRU A;  2QDI A;  1RFJ A;  3BYA A;  1OOF A;  2M49 B;  1OMR A;  3TUY C;  2BBN A;  2KAX A;  3KF9 A;  3SS5 A;  3D74 A;  4MSP A;  4CLN A;  1JFJ A;  3CR5 X;  1DJH A;  1UHJ A;  3DY9 A;  2K7O A;  3QME A;  4YGB B;  2M8U A;  2DOQ A;  2NCP A;  3VB1 A;  1IQ3 A;  3S0A A;  2LVJ A;  3ICB A;  4HSZ A;  3D0Y A;  1QX2 A;  1KQM B;  2K8M B;  1W7I B;  1CDM A;  1Y6W A;  2HF5 A;  3VRP A;  1ZMZ A;  1NWD A;  3OGN A;  2LLT A;  1K93 D;  3D0Y B;  1BR1 B;  2OPO A;  3FWC A;  2OS8 B;  2Y1M A;  1WDC B;  4PE7 A;  3CR2 A;  4WRI A;  1Y1X A;  2BKH B;  4XYN A;  5HLO A;  1TNW A;  1CMF A;  1H4B A;  2I94 A;  5G08 A;  2Y5I A;  3IVT A;  2G2B A;  5HKW A;  3BUM B;  1DJZ A;  1BLQ A;  1K90 D;  3E3R A;  2F3Z A;  2MRD A;  2QPT A;  2K7C A;  4OVN F;  1A4P A;  1PK0 D;  2LLU A;  2WCK A;  1A03 A;  1TCF A;  4QJ5 B;  1QV0 A;  4AQI A;  4ORA B;  1YUT A;  1D1O A;  1JBA A;  2ZRT A;  1YVH A;  1SPY A;  2LHL A;  1QJT A;  3DYE A;  2ZNE A;  2MBX A;  1GM0 A;  2LMU A;  1XFU O;  1QX7 A;  1K96 A;  1DT7 B;  1DF0 B;  1IWQ A;  2LNK A;  3CDN A;  3VRR A;  1RRO A;  2KHN A;  3EVR A;  1XYD A;  3DVK A;  2EC6 C;  1A75 A;  1L7Z A;  2LVK A;  3R1V A;  1TNX A;  2WCH A;  1CMG A;  1IIO A;  3DVM A;  2LLS A;  2FJY A;  3V2L A;  1A75 B;  5JOL A;  1N65 A;  1YUU A;  4INX A;  1JSA A;  2KLE A;  4JD9 A;  5KU1 A;  3WHT B;  4Q04 A;  5CSI A;  2BKI B;  5FI7 A;  1SCM C;  4OV2 A;  3SIA A;  1U5I A;  3S0B A;  2KFG A;  2JU0 A;  1BT6 A;  1GGW A;  3SG7 A;  1A2X A;  4INW A;  5DKR A;  3TS5 B;  2M3W A;  1EG3 A;  2PVB A;  2ISD A;  1XO5 A;  2CNP A;  3UNW A;  3L4L A;  2Y1N A;  2H61 A;  2M1U A;  1KFX S;  2L5Y A;  1IH0 A;  1XFX O;  1SBJ A;  5HYD A;  1S1E A;  2ZKM X;  3D73 A;  3D77 A;  3SJS A;  4D1E A;  2F33 A;  5CSJ A;  3JVT C;  4USL A;  2KBI A;  2L51 A;  1TNP A;  1XFW O;  1F70 A;  3BOW A;  4I5J A;  1K9U A;  3A8R A;  4FQT A;  4JKT A;  3S0E A;  1L2O C;  4GUK A;  4IL1 A;  1OOJ A;  4GBA A;  1M46 A;  1FI6 A;  4MN0 A;  2LMV A;  1SL9 A;  3LCP C;  3KO0 A;  1OOI X;  3BOW B;  4HRG A;  3I5I C;  4N5X A;  1B7T Y;  1M45 A;  5HLV A;  1SK6 D;  3NSO A;  4YI9 A;  5BPJ A;  1QIW A;  3O4Y A;  1ALW A;  2K2F A;  2JTZ A;  1QLS A;  2E6W A;  3ZWH A;  2CTN A;  4CFQ A;  2AAO A;  3LLE A;  1JWD A;  1P28 A;  1CFC A;  3O78 A;  4M2P A;  2KI6 C;  1DJI A;  2F8P A;  2ERB A;  3PM2 A;  3NXA A;  3EKH A;  1IJ5 A;  1KFU S;  2QEO A;  2M7L A;  1PVA A;  1A29 A;  2GTE A;  4M2Q A;  1UUS A;  3TZ1 A;  1KQM C;  3PLF B;  1NIW A;  1ZFS A;  2JT3 A;  2L4H A;  4UPG A;  3OX6 A;  2L4I A;  5HKY A;  1GJY A;  1OOH A;  2BCX A;  3EK7 A;  1NX0 A;  3CZT X;  2JXC A;  4GGN A;  2QEH A;  5FI6 A;  1S6I A;  1B47 A;  1CFD A;  1TN4 A;  2ZN8 A;  1FBV A;  3OB1 B;  2H8V A;  1YX8 A;  3PJI A;  1M31 A;  2KI4 B;  2KDH A;  2LVI A;  2ZN9 A;  2O60 A;  3ZNI A;  1B7T Z;  1PSR A;  2KLD A;  2LP2 A;  4NDB A;  4NQG A;  2YGU A;  1NSH A;  3B6X A;  2COL B;  1QAT A;  3I5F C;  3AKA A;  2PQL A;  5CPV A;  1S3P A;  1W7J B;  2EHB A;  5HKZ A;  1IKU A;  2OTG B;  2Q4U A;  1EH2 A;  3GK2 A;  2JC2 A;  3CYZ A;  1CKK A;  3I5G C;  1CLM A;  1OW4 A;  3BFB A;  1IRJ A;  4OR9 B;  3RM1 A;  3D75 A;  1WRK A;  2AUC A;  4FQO A;  1YR5 A;  4HRE E;  2M29 A;  4ICB A;  4DS7 A;  3BFA A;  5PAL A;  4HRH A;  4I5L B;  4A4C A;  1N2D A;  2Q91 A;  1DJW A;  1IG5 A;  4C0K A;  2WCB A;  1CFF A;  2ZND A;  3EVU A;  1K2H A;  2HPS A;  1MQ1 A;  1DJX A;  5FYX A;  3R1O A;  2WOR A;  1WLZ A;  1B1G A;  5I2Q A;  3CZ2 A;  4I5K A;  3BJH A;  1RWY A;  2FCD A;  1LA0 A;  5F6T A;  1JC2 A;  1OMD A;  1T14 A;  3FIA A;  2JNX A;  1KK8 B;  1K9K A;  2LAN A;  3FWB A;  4DUQ A;  4L9M A;  1AP4 A;  2KGR A;  5AAN A;  5ER4 X;  5HL1 A;  3B7A A;  1LKJ A;  3SS4 A;  1SRA A;  2KPH A;  3FE6 A;  1B8C A;  1QS7 A;  1JF0 A;  3QRX A;  3TS5 C;  1DF0 A;  2Y4Q A;  4GFT A;  2O5G A;  1UP5 A;  2JZI A;  2I2R E;  2WCM A;  3NHT A;  3NHI A;  5CSN A;  1UHK A;  2L98 A;  2QEB A;  2V53 A;  1R6P A;  3DF0 B;  4PCW A;  5KSZ A;  4YGE B;  1LVC D;  1K9P A;  3CZ0 A;  3FS7 A;  1K95 A;  1SL8 A;  3GK4 X;  4CID A;  4DRW A;  3C1V A;  1Y0V H;  3PAL A;  4MEW A;  1TUZ A;  1EG4 A;  2M7N A;  2H61 C;  2QEV A;  3GK1 A;  4N1G A;  5CSF A;  4GNK B;  1W9Z A;  4YRU A;  1NX1 A;  4YBH B;  3LK1 A;  3S0G A;  2L2E A;  1Q80 A;  1SKT A;  1CLL A;  1LS8 A;  1BU3 A;  1UHH A;  4DCK A;  3LL8 B;  3WHU B;  4OKH A;  1OQP A;  3FE9 A;  2KI6 D;  1JUO A;  4QJ4 B;  1V1G A;  2BL0 B;  5GQQ C;  1IGV A;  1XFY O;  2BE6 A;  3BUO B;  1FPW A;  2BCB A;  4PE4 A;  2BCA A;  5J3X A;  1S6J A;  2BEC A;  3F45 A;  2MA2 A;  2GGM A;  1J7R A;  1ZUZ A;  2LMT A;  2TN4 A;  3TDI A;  3VRQ A;  4MZJ A;  1BJF A;  3I5H B;  2EGD A;  2VRG A;  3L4A A;  1MHO A;  1OE9 B;  1C7W A;  3RZS A;  3OB2 B;  1M39 A;  5TNC A;  4NDC A;  3BXK A;  1QIV A;  2PSR A;  1PVB A;  1C7V A;  1NCX A;  3EVV A;  1NX2 A;  2BAP A;  1QTX A;  2KOT A;  3CS1 A;  1CDL A;  4PHK A;  5EL2 A;  3EK8 A;  2BE4 A;  4GAO A;  1J7P A;  2KQ6 A;  2K2A A;  1F71 A;  1F8H A;  1TRF A;  1SCV A;  3B88 A;  1DGU A;  3K21 A;  4DIR A;  3A4U B;  3K1E A;  1V1F A;  1RK9 A;  3NGV A;  2NZ0 A;  3PN7 C;  1QAS A;  2KI4 C;  2P6B B;  2WND A;  4MVF A;  2JT8 A;  4ORC B;  4AOM A;  2CCM A;  1NCY A;  3HX4 A;  2JPT A;  1REC A;  2M0R A;  4IJ7 A;  1WRZ A;  3SG5 A;  1AJ5 A;  1KSM A;  2MHH A;  1HT9 A;  1B8L A;  1Z4H A;  1OOG A;  4MZK A;  1AK8 A;  2JNF A;  2OTG C;  1IJ6 A;  1MXE A;  3B87 A;  3M0W A;  4F0Z B;  1SNL A;  1C3Y A;  1OMV A;  2JUL A;  5I2O A;  1DTL A;  4C0L A;  4MRY A;  2L5X B;  3PFV A;  5D69 A;  1TCO B;  2F3Y A;  1HQV A;  3PAT A;  2FCE A;  3RLZ A;  1CFP A;  4TNC A;  4R1E A;  2HQW A;  2KFH A;  1FF1 A;  3TDU A;  2M1K B;  3BUX B;  3DXL A;  1DGV A;  1GQM A;  3CR4 X;  3O4X A;  2PMY A;  1GGZ A;  4MZL A;  1QV1 A;  2BBM A;  2JRF A;  3SIB A;  2OS8 C;  4I5N B;  1WDC C;  3SG2 A;  1SCM B;  1SY9 A;  2KYF A;  1UHN A;  3AAK A;  1QVI Z;  3DZT A;  2BNX A;  3NSL A;  1CLB A;  1YRU B;  1VRK A;  3AKB A;  4QJ3 B;  3D78 A;  5FI2 A;  3SG4 A;  1DQE A;  1SMG A;  4PE0 A;  2LE9 B;  1N0Y A;  2PAS A;  1KK8 C;  2H2K A;  1CM1 A;  1SL7 A;  1WLM A;  2GV5 A;  3JTD B;  1S5G Z;  2QAC A;  4F7F A;  1G33 A;  5I8N A;  1C07 A;  4BY4 A;  3D10 A;  1QX5 B;  3OX5 A;  4CPV A;  3CWG A;  3PM8 A;  1S6C A;  1JFK A;  1SR6 B;  4FTG A;  2SCP A;  3JVT B;  3R1P A;  2WCL A;  4PE1 A;  3BUW B;  1G4Y R;  3VGO A;  1LIN A;  2P70 A;  2KYC A;  1M63 B;  2KAV A;  4GGF C;  3HCM A;  4PHJ A;  4ZCU A;  1L2O B;  1NPQ A;  1Y1A A;  2SAS A;  4N1F A;  3BUN B;  1CDN A;  1H8B A;  1QXP A;  3O2P A;  3VRN A;  2KSP A;  4JWQ A;  1TUJ A;  1YUS A;  1TTX A;  1ODB A;  1PAL A;  1DJG A;  5B8I B;  1UUR A;  1TOP A;  1QWV A;  3AAJ A;  4PT1 A;  3CAB A;  1XFZ O;  1MR8 A;  1C3Z A;  4P2Y B;  2JTT A;  3SG6 A;  1SW8 A;  2JOJ A;  1KK7 Z;  1LA3 A;  1PSB A;  3OP0 A;  3OHM B;  3GOF A;  2A4J A;  2R2I A;  2L0P A;  2BL0 C;  2MAZ A;  2E30 A;  1CNP A;  2JT0 A;  4M2O A;  2P71 A;  1KFX L;  3DF0 A;  2LP3 A;  1EXR A;  2IS9 A;  2WC8 A;  3R72 A;  1J1E A;  4GGF A;  3O6B A;  2LM5 A;  3EK4 A;  1KSO A;  1S26 D;  2D8N A;  2K61 A;  3CZ1 A;  1AUI B;  2CXJ A;  3WNX B;  3I5H C;  4BY5 A;  3CTN A;  4KYN A;  2KNE A;  3SS3 A;  2ZRS A;  1KQV A;  1J7O A;  1DEK A;  2JQ6 A;  1XA5 A;  2LUX A;  3DD4 A;  1FW4 A;  1OZO A;  1KCY A;  1JF2 A;  3Q8I A;  4YGC B;  1CB1 A;  4YGD B;  1OZS A;  1R2U A;  1KWO B;  4JPZ B;  1AJ4 A;  3I5F B;  1PUL A;  1CM4 A;  1NYA A;  2RGI A;  2WCJ A;  1BMO A;  3NSI A;  5AXI A;  3TUY B;  2WC5 A;  1WRL A;  2GGZ A;  5D3O A;  3KEV A;  5ER5 A;  3I5G B;  1F4Q A;  2F2O A;  3L47 A;  4YI8 A;  3N7H A;  3S0D A;  4ZCV A;  2KAY A;  4YGA A;  1SSE B;  1KFU L;  1EL4 A; 
#chains in the Genus database with same CATH homology
 4PDZ A;  4U8D A;  1TNQ A;  2NXQ A;  5DKN A;  4JQ0 D;  1S36 A;  5D7F A;  1QLK A;  1B9A A;  4PHN A;  3NSK A;  4CFR A;  1PRW A;  1J7Q A;  5I2L A;  4E68 A;  1Y1U A;  1X02 A;  2B1U A;  1YUR A;  3CGA A;  4WQ3 A;  1K8U A;  2LVV A;  3DVJ A;  2KFF A;  3LK0 A;  2K7D A;  4ETO A;  5JJG A;  2I18 A;  2CBL A;  1AVS A;  1K94 A;  1NUB A;  1BG1 A;  1E8A A;  1QVI Y;  2I7A A;  2MLE C;  3IF7 A;  1WY9 A;  4PAL A;  3H4S E;  1J55 A;  4PHM A;  2WCE A;  2LC5 A;  3CLN A;  1NP8 A;  1U5I B;  4P5O E;  1RJV A;  2LAP A;  1S5G Y;  2M97 A;  2L50 A;  3JTD C;  3IQQ A;  1ALV A;  2WCF A;  5IBW A;  1BOC A;  1DVI A;  1TIZ A;  4A4B A;  1XK4 C;  4MRX A;  2LCP A;  5DKQ A;  1RTP 1;  1SR6 C;  1UHI A;  2EC6 B;  1EJ3 A;  1BOD A;  1XFV O;  1NX3 A;  2NLN A;  2PAL A;  3EKJ A;  1F55 A;  2LV7 A;  2ZFD A;  3WXA A;  1ZOT B;  4C0J A;  5AFP A;  2KBM A;  1ZAC A;  1MF8 B;  1DMO A;  3BQ3 A;  2MJW B;  1NCZ A;  3SG3 A;  2F2P A;  2LHI A;  4NDD A;  2KGB C;  2LUC A;  2G9B A;  1SYM A;  2AMI A;  1XVJ A;  2WOS A;  1IQ5 A;  1AHR A;  3KHE A;  2FOT A;  4AQJ A;  4MLW A;  2HET A;  3PSR A;  1YRT B;  1YVL A;  1CDP A;  2FJU B;  4ORB B;  1G8I A;  1KK7 Y;  1XK4 A;  2K7B A;  3TDZ A;  1B4C A;  1FI5 A;  1YTZ C;  4WQ2 A;  2MLF C;  1OSA A;  1B8R A;  2HQ8 A;  2K0J A;  3IQO A;  1BF5 A;  5KTY A;  1BR4 B;  1DJY A;  1F4O A;  2JXL A;  1LXF C;  2CT9 A;  5AER A;  3MSE B;  2KQY A;  1J1D A;  3DVE A;  2JWW A;  4XJK A;  1MXL C;  4OCI A;  1UWO A;  3VRO A;  1YX7 A;  5AEQ A;  3PN7 B;  1MWN A;  3I5I B;  5K89 A;  2M9G A;  2NCO A;  3KPX A;  4XJK B;  4MBE A;  1CTR A;  1MUX A;  1KWO C;  4GPL B;  1F54 A;  2PRU A;  3BYA A;  1RFJ A;  2M49 B;  1OMR A;  3TUY C;  2BBN A;  2KAX A;  3KF9 A;  4MSP A;  4CLN A;  1JFJ A;  3CR5 X;  1DJH A;  1UHJ A;  2K7O A;  4YGB B;  2M8U A;  2DOQ A;  2NCP A;  1IQ3 A;  2LVJ A;  3ICB A;  4HSZ A;  3D0Y A;  1QX2 A;  1KQM B;  2K8M B;  1W7I B;  1CDM A;  1Y6W A;  2HF5 A;  3VRP A;  1ZMZ A;  1NWD A;  2LLT A;  1K93 D;  3D0Y B;  1BR1 B;  2OPO A;  3FWC A;  2OS8 B;  2Y1M A;  1WDC B;  4PE7 A;  3CR2 A;  4WRI A;  1Y1X A;  2BKH B;  4XYN A;  5HLO A;  1TNW A;  1CMF A;  1H4B A;  2I94 A;  5G08 A;  2Y5I A;  2G2B A;  5HKW A;  3BUM B;  1DJZ A;  1BLQ A;  1K90 D;  3E3R A;  2F3Z A;  2MRD A;  2QPT A;  2K7C A;  4OVN F;  1A4P A;  1PK0 D;  2LLU A;  1A03 A;  1TCF A;  4QJ5 B;  1QV0 A;  4AQI A;  4ORA B;  1YUT A;  1D1O A;  1JBA A;  2ZRT A;  1YVH A;  1SPY A;  2LHL A;  1QJT A;  2MBX A;  2ZNE A;  2LMU A;  1XFU O;  1QX7 A;  1K96 A;  1DT7 B;  1DF0 B;  1IWQ A;  2LNK A;  3VRR A;  1RRO A;  2KHN A;  3EVR A;  1XYD A;  3DVK A;  2EC6 C;  1A75 A;  1L7Z A;  2LVK A;  1CMG A;  1TNX A;  3DVM A;  2LLS A;  1A75 B;  5JOL A;  1N65 A;  1YUU A;  1JSA A;  5KU1 A;  3WHT B;  4Q04 A;  5CSI A;  2BKI B;  1SCM C;  4OV2 A;  3SIA A;  1U5I A;  2KFG A;  2JU0 A;  1BT6 A;  1GGW A;  3SG7 A;  1A2X A;  5DKR A;  3TS5 B;  2M3W A;  1EG3 A;  2PVB A;  2ISD A;  1XO5 A;  2CNP A;  2Y1N A;  2H61 A;  2M1U A;  1KFX S;  1IH0 A;  1XFX O;  1SBJ A;  5HYD A;  1S1E A;  2ZKM X;  3SJS A;  4D1E A;  2F33 A;  5CSJ A;  3JVT C;  4USL A;  2KBI A;  2L51 A;  1TNP A;  1XFW O;  1F70 A;  3BOW A;  4I5J A;  1K9U A;  3A8R A;  1L2O C;  4GUK A;  4IL1 A;  1OOJ A;  4GBA A;  1M46 A;  1FI6 A;  4MN0 A;  2LMV A;  1SL9 A;  3LCP C;  3KO0 A;  4HRG A;  3BOW B;  4N5X A;  3I5I C;  1B7T Y;  1M45 A;  5HLV A;  1SK6 D;  3NSO A;  4YI9 A;  5BPJ A;  1QIW A;  3O4Y A;  1ALW A;  2K2F A;  2JTZ A;  1QLS A;  2E6W A;  3ZWH A;  2CTN A;  4CFQ A;  2AAO A;  3LLE A;  1JWD A;  1CFC A;  3O78 A;  4M2P A;  2KI6 C;  1DJI A;  2F8P A;  3NXA A;  3EKH A;  1IJ5 A;  1KFU S;  2M7L A;  1PVA A;  1A29 A;  4M2Q A;  1UUS A;  3TZ1 A;  1KQM C;  3PLF B;  1NIW A;  1ZFS A;  2JT3 A;  2L4H A;  4UPG A;  3OX6 A;  2L4I A;  5HKY A;  1GJY A;  2BCX A;  3EK7 A;  1NX0 A;  3CZT X;  2JXC A;  4GGN A;  1S6I A;  1B47 A;  1CFD A;  1TN4 A;  2ZN8 A;  1FBV A;  3OB1 B;  1YX8 A;  1M31 A;  2KI4 B;  2KDH A;  2LVI A;  2ZN9 A;  2O60 A;  3ZNI A;  1B7T Z;  1PSR A;  2LP2 A;  4NDB A;  4NQG A;  1NSH A;  2COL B;  1QAT A;  3I5F C;  3AKA A;  5CPV A;  1S3P A;  1W7J B;  2EHB A;  5HKZ A;  1IKU A;  2OTG B;  2Q4U A;  1EH2 A;  3GK2 A;  2JC2 A;  1CKK A;  3I5G C;  1CLM A;  3RM1 A;  4OR9 B;  1IRJ A;  1WRK A;  2AUC A;  4FQO A;  1YR5 A;  4HRE E;  2M29 A;  4ICB A;  4DS7 A;  5PAL A;  4HRH A;  4I5L B;  4A4C A;  1N2D A;  2Q91 A;  1DJW A;  1IG5 A;  4C0K A;  2WCB A;  1CFF A;  2ZND A;  3EVU A;  1K2H A;  2HPS A;  1MQ1 A;  1DJX A;  5FYX A;  2WOR A;  1WLZ A;  1B1G A;  5I2Q A;  4I5K A;  1RWY A;  2FCD A;  1LA0 A;  5F6T A;  1JC2 A;  1OMD A;  3FIA A;  2JNX A;  1KK8 B;  1K9K A;  2LAN A;  3FWB A;  4DUQ A;  4L9M A;  1AP4 A;  2KGR A;  5AAN A;  5ER4 X;  1LKJ A;  1SRA A;  1B8C A;  1QS7 A;  1JF0 A;  3QRX A;  3TS5 C;  1DF0 A;  2Y4Q A;  4GFT A;  2O5G A;  1UP5 A;  2JZI A;  2I2R E;  5CSN A;  1UHK A;  2L98 A;  2V53 A;  1R6P A;  3DF0 B;  4PCW A;  5KSZ A;  4YGE B;  1LVC D;  1K9P A;  3FS7 A;  1K95 A;  1SL8 A;  3GK4 X;  4CID A;  4DRW A;  3C1V A;  1Y0V H;  3PAL A;  4MEW A;  1EG4 A;  2M7N A;  2H61 C;  3GK1 A;  4N1G A;  5CSF A;  4GNK B;  4YRU A;  1NX1 A;  4YBH B;  3LK1 A;  2L2E A;  1Q80 A;  1SKT A;  1CLL A;  1BU3 A;  1UHH A;  4DCK A;  3LL8 B;  3WHU B;  4OKH A;  1OQP A;  2KI6 D;  1JUO A;  4QJ4 B;  1V1G A;  2BL0 B;  5GQQ C;  1IGV A;  1XFY O;  2BE6 A;  3BUO B;  1FPW A;  2BCB A;  4PE4 A;  2BCA A;  5J3X A;  1S6J A;  2BEC A;  3F45 A;  2MA2 A;  2GGM A;  1J7R A;  1ZUZ A;  2LMT A;  2TN4 A;  3TDI A;  3VRQ A;  4MZJ A;  1BJF A;  3I5H B;  2EGD A;  2VRG A;  1MHO A;  1OE9 B;  1C7W A;  3OB2 B;  1M39 A;  5TNC A;  4NDC A;  3BXK A;  1QIV A;  2PSR A;  1PVB A;  1C7V A;  1NCX A;  3EVV A;  1NX2 A;  1QTX A;  2KOT A;  3CS1 A;  1CDL A;  4PHK A;  3EK8 A;  2BE4 A;  4GAO A;  1J7P A;  2KQ6 A;  2K2A A;  1F71 A;  1F8H A;  1TRF A;  1SCV A;  1DGU A;  3K21 A;  4DIR A;  3A4U B;  1V1F A;  1RK9 A;  2NZ0 A;  3PN7 C;  1QAS A;  2KI4 C;  2P6B B;  2WND A;  4MVF A;  2JT8 A;  4ORC B;  4AOM A;  2CCM A;  1NCY A;  3HX4 A;  2JPT A;  1REC A;  2M0R A;  3SG5 A;  1WRZ A;  1AJ5 A;  1KSM A;  2MHH A;  1HT9 A;  1B8L A;  4MZK A;  1AK8 A;  2JNF A;  2OTG C;  1IJ6 A;  1MXE A;  3M0W A;  4F0Z B;  1SNL A;  1OMV A;  2JUL A;  5I2O A;  1DTL A;  4C0L A;  4MRY A;  2L5X B;  3PFV A;  5D69 A;  1TCO B;  2F3Y A;  1HQV A;  3PAT A;  2FCE A;  3RLZ A;  1CFP A;  4TNC A;  4R1E A;  2HQW A;  2KFH A;  1FF1 A;  3TDU A;  2M1K B;  3BUX B;  1DGV A;  1GQM A;  3CR4 X;  2PMY A;  1GGZ A;  4MZL A;  1QV1 A;  2BBM A;  2JRF A;  3SIB A;  2OS8 C;  4I5N B;  1WDC C;  3SG2 A;  1SCM B;  1SY9 A;  2KYF A;  1UHN A;  3AAK A;  1QVI Z;  1CLB A;  3NSL A;  1YRU B;  1VRK A;  3AKB A;  4QJ3 B;  3SG4 A;  1SMG A;  4PE0 A;  2LE9 B;  1N0Y A;  2PAS A;  1KK8 C;  2H2K A;  1CM1 A;  1SL7 A;  1WLM A;  2GV5 A;  3JTD B;  1S5G Z;  2QAC A;  1G33 A;  5I8N A;  1C07 A;  4BY4 A;  3D10 A;  1QX5 B;  3OX5 A;  4CPV A;  3CWG A;  3PM8 A;  1S6C A;  1JFK A;  1SR6 B;  4FTG A;  2SCP A;  3JVT B;  4PE1 A;  3BUW B;  1G4Y R;  3VGO A;  1LIN A;  2KYC A;  1M63 B;  2KAV A;  4GGF C;  3HCM A;  4PHJ A;  4ZCU A;  1L2O B;  1NPQ A;  1Y1A A;  2SAS A;  4N1F A;  3BUN B;  1CDN A;  1H8B A;  1QXP A;  3O2P A;  3VRN A;  2KSP A;  4JWQ A;  1YUS A;  1TTX A;  1ODB A;  1PAL A;  1DJG A;  5B8I B;  1UUR A;  1TOP A;  3AAJ A;  1XFZ O;  1MR8 A;  4P2Y B;  2JTT A;  3SG6 A;  1SW8 A;  2JOJ A;  1KK7 Z;  1LA3 A;  1PSB A;  3OP0 A;  3OHM B;  3GOF A;  2A4J A;  2R2I A;  2L0P A;  2BL0 C;  2MAZ A;  2E30 A;  1CNP A;  2JT0 A;  4M2O A;  1KFX L;  3DF0 A;  2LP3 A;  1EXR A;  2IS9 A;  2WC8 A;  1J1E A;  4GGF A;  3O6B A;  2LM5 A;  3EK4 A;  1KSO A;  1S26 D;  2D8N A;  2K61 A;  1AUI B;  2CXJ A;  3WNX B;  3I5H C;  4BY5 A;  3CTN A;  2KNE A;  2ZRS A;  1KQV A;  1J7O A;  2JQ6 A;  1XA5 A;  2LUX A;  3DD4 A;  1FW4 A;  1OZO A;  1KCY A;  1JF2 A;  4YGC B;  1CB1 A;  4YGD B;  1OZS A;  1R2U A;  1KWO B;  4JPZ B;  1AJ4 A;  3I5F B;  1PUL A;  1CM4 A;  1NYA A;  2RGI A;  3NSI A;  1BMO A;  5AXI A;  3TUY B;  1WRL A;  2GGZ A;  3KEV A;  5ER5 A;  3I5G B;  1F4Q A;  2F2O A;  4YI8 A;  4ZCV A;  2KAY A;  4YGA A;  1KFU L;  1EL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...