1K8UA

Crystal structure of calcium-free (or apo) human s100a6; cys3met mutant (selenomethionine derivative)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
AMPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k8uA00
3DD4A 4NDBA 1YTZC 4E68A 5I8NA 3HX4A 4GNKB 4ZCUA 2LVVA 4MBEA 3DVEA 1S6JA 1XFYO 2MLFC 5I2LA 3DF0A 4ETOA 1CNPA 2KI4C 5AXIA 1S36A 2JPTA 2LLTA 2AAOA 1MXEA 2NXQA 1NCYA 1TCFA 2LVIA 1CM4A 1R2UA 2JT3A 4L9MA 1UHIA 3AKBA 2KSPA 3CGAA 4MSPA 1BOCA 4YGCB 3VRNA 2O60A 3KF9A 1RK9A 4MZKA 1A29A 5AFPA 1CFFA 1YUSA 4YBHB 1TN4A 1RWYA 1XFWO 1SPYA 2ZN9A 2M29A 1QVIY 4PE1A 2EC6B 2L2EA 2WORA 3NSKA 1XFVO 1PVAA 3GK4X 1SR6C 1SBJA 2EGDA 1AVSA 1YRTB 2KGRA 1PVBA 4YI9A 1SL9A 5CSJA 1FF1A 1DJGA 1QVIZ 1RTP1 1GJYA 2LHLA 3F45A 1J7OA 3AAKA 1EL4A 1CDLA 1VRKA 2LMTA 2LP3A 2KAYA 2LUCA 1KWOC 2PMYA 1C07A 2CXJA 1TNWA 2TN4A 1MF8B 2LV7A 1K94A 2QACA 2O5GA 3EK8A 1CDMA 4DCKA 1DJXA 2BCBA 1MUXA 4ORBB 1WDCC 5DKNA 1DJHA 1CTRA 1SNLA 1X02A 4GAOA 2NCOA 1NYAA 1PSBA 2Y1NA 5KTYA 4GPLB 2LM5A 1UHJA 4OVNF 1WRLA 2OTGC 1ZMZA 4GGFA 1CDNA 1RJVA 2JXLA 1OMDA 2KYFA 4AQJA 5DKQA 3HCMA 4YGEB 1JBAA 1U5IA 2MBXA 2I2RE 3BOWA 1CLLA 1W7IB 2K61A 4PHKA 1AJ4A 1DGVA 3FS7A 1TCOB 1OMRA 4PE7A 2AMIA 2K8MB 4MRYA 2ZFDA 5KU1A 5TNCA 4N1FA 2LAPA 1BJFA 3SG5A 2CCMA 2LMUA 3TS5C 1L7ZA 1WLMA 1ZOTB 3VRPA 1CMGA 1BU3A 3EK7A 2BL0C 3D0YA 2K2AA 2KQ6A 1A4PA 3JTDC 1SCMB 1S1EA 1TNPA 2HQWA 4MVFA 1GQMA 1QXPA 4C0JA 2MA2A 1EG3A 2BCAA 4OR9B 4M2QA 3EVUA 2K7DA 2LMVA 2V53A 1J1DA 2LNKA 1TNXA 1Y0VH 4I5LB 1OOJA 1YUUA 2CBLA 5J3XA 4WQ3A 1F55A 4MZJA 1SRAA 2WCBA 3GK2A 4R1EA 1IRJA 2JZIA 3PLFB 3VRQA 3BUNB 3SG4A 3PATA 2NLNA 4YRUA 2F2PA 1BT6A 4CPVA 1NIWA 1CM1A 2L4IA 3CWGA 2OS8C 3GOFA 5AEQA 1QV0A 2GV5A 1AP4A 1K96A 4MN0A 1A2XA 4D1EA 1OSAA 2Y4QA 1MHOA 1JF2A 1XA5A 3VROA 1FI5A 1B9AA 3SIAA 2WOSA 3PN7C 2D8NA 3KEVA 1QIVA 1N2DA 1YX7A 2I18A 2LVKA 4ORAB 1A75B 4WRIA 1TIZA 2F8PA 2L5XB 1MR8A 2F3ZA 1WRKA 3KPXA 4ZCVA 2PASA 3EKHA 1UUSA 1WRZA 2EHBA 3EVVA 4M2PA 3TDUA 3I5IB 4MLWA 2M8UA 1SYMA 4OV2A 3FIAA 2BE4A 3TDZA 4PDZA 1B4CA 1EH2A 2JNXA 2CTNA 2L0PA 3MSEB 1DT7B 1Y1UA 3BOWB 3SG2A 1F71A 1SW8A 4F0ZB 1K8UA 2Y1MA 3CR2A 3PALA 1DF0A 1UHHA 2L50A 3A8RA 1QS7A 1RECA 1KQVA 1EXRA 3M0WA 2LE9B 4Q04A 1K9KA 4CIDA 1FBVA 4GUKA 2BBMA 4MZLA 2QPTA 1IQ5A 1M39A 3BUMB 1K2HA 4JWQA 3JVTC 1JUOA 5KSZA 3NSLA 1AHRA 1SY9A 1IQ3A 1SL8A 3D0YB 1LA0A 2WCFA 2ZNEA 3TUYB 1F54A 1KSOA 3FWBA 2MAZA 2LVJA 2K0JA 2K7OA 3E3RA 5CSFA 3SG7A 2KI4B 2KI6D 4TNCA 1K9UA 1UP5A 2ZRTA 3IQOA 3NXAA 1E8AA 2NCPA 1J55A 4PE4A 1XK4A 5G08A 1JFKA 5JJGA 3BUOB 3EKJA 1NSHA 2F3YA 3I5FC 1TNQA 4A4BA 2JT8A 3LK0A 5HKWA 1PSRA 1KK7Y 3PSRA 2KBIA 1YVHA 1NX1A 4ICBA 1PRWA 2ZRSA 3O78A 1OZSA 3I5GC 2JQ6A 3TDIA 1KK8B 2LANA 1KFXS 3DVKA 5DKRA 5FYXA 1CLMA 3DVMA 1YURA 1SR6B 2L4HA 2LP2A 3TZ1A 2KNEA 3PM8A 4I5NB 1NCXA 4N1GA 4PE0A 5HLVA 3BYAA 4MEWA 2MJWB 1NX3A 2MLEC 3C1VA 1KFUS 1CFPA 2VRGA 4GFTA 5AANA 1B7TY 2G2BA 2KDHA 1Q80A 4I5KA 1UURA 5I2OA 2M1KB 1LA3A 4NQGA 1YUTA 3SG6A 3GK1A 1KWOB 1IG5A 5IBWA 2GGMA 5I2QA 2HPSA 4AOMA 1W7JB 2FCDA 2PSRA 2KHNA 1B7TZ 1WDCB 1SMGA 5F6TA 3K21A 1BLQA 1B47A 3OB1B 3SJSA 3RM1A 1XO5A 2H61C 3DF0B 1XVJA 1PULA 1BMOA 5CSNA 1L2OB 2G9BA 2BE6A 1HT9A 3I5HC 4NDDA 5ER4X 1DF0B 5PALA 2KAXA 1IH0A 1KSMA 2LC5A 2ZN8A 2L98A 3NSIA 1NWDA 1ODBA 2KFHA 4UPGA 1Y1AA 4DS7A 3ZNIA 4CLNA 4PALA 2JTZA 1TRFA 5K89A 4IL1A 2K2FA 1SKTA 2F2OA 1JWDA 1DGUA 2BCXA 1OMVA 1J1EA 4MRXA 2JNFA 2WNDA 1F4OA 3IF7A 3TS5B 4P2YB 2PRUA 3DVJA 2BKHB 1JF0A 1M46A 1MXLC 1S5GY 2BL0B 1RROA 1MQ1A 2BKIB 4OCIA 1RFJA 1R6PA 1CMFA 1NUBA 1ALWA 1NX0A 1ZACA 1S6CA 1Y6WA 1B8LA 3EVRA 3WNXB 2F33A 1J7RA 1EG4A 2ZNDA 4HRGA 1N65A 1S5GZ 2M49B 1XFZO 1QX5B 4USLA 1MWNA 1NP8A 4C0LA 1ZFSA 2HETA 2I94A 2JU0A 4QJ3B 4WQ2A 3LCPC 5HKZA 5JOLA 3OX5A 2E6WA 2KBMA 1TTXA 4FQOA 4NDCA 4BY4A 2COLB 3NSOA 1C7VA 2IS9A 3KO0A 1LXFC 1IJ5A 1KQMB 3OHMB 4XJKA 2I7AA 2M7NA 1F4QA 4YI8A 1H4BA 1U5IB 3H4SE 2SCPA 2H2KA 3CR5X 3SG3A 5HYDA 4JPZB 1QX2A 1Y1XA 2Q91A 4I5JA 1YRUB 3PN7B 2KFGA 1G8IA 4FTGA 1F8HA 1CFDA 1H8BA 3TUYC 3CR4X 2EC6C 4C0KA 3CS1A 1K90D 1XYDA 4GBAA 3D10A 2JRFA 1UHNA 2JTTA 3VGOA 3LL8B 1OZOA 1CDPA 2K7BA 2H61A 3FWCA 2JWWA 4A4CA 2L51A 1BF5A 2M3WA 1CLBA 1JFJA 1HQVA 3PFVA 2M1UA 2JOJA 1NX2A 3OP0A 2LUXA 1M45A 2ZKMX 3BUXB 1IWQA 2M97A 1NPQA 1G33A 2GGZA 2KQYA 3LK1A 1BR4B 1KK8C 1IJ6A 1DJYA 1M31A 3BXKA 3JVTB 1GGWA 2FCEA 4GGNA 1JSAA 1YR5A 4U8DA 1K9PA 2M7LA 2B1UA 4P5OE 5CPVA 1YVLA 1ALVA 4DRWA 1QV1A 2HQ8A 1KK7Z 1J7QA 3QRXA 4XYNA 3A4UB 4CFRA 4DUQA 1JC2A 4YGDB 3KHEA 1CFCA 1SK6D 5HLOA 3CTNA 1A03A 2LLUA 5CSIA 1M63B 5AERA 5HKYA 4N5XA 3RLZA 1YX8A 3EK4A 5D7FA 3SIBA 4HREE 4BY5A 3I5FB 1QATA 2BECA 4YGBB 3O4YA 2Y5IA 4M2OA 3BQ3A 1SCVA 4QJ4B 5GQQC 1QASA 1A75A 3I5GB 5BPJA 2JT0A 1V1GA 3ZWHA 4XJKB 1BR1B 1QLSA 2MRDA 3LLEA 1D1OA 1DJZA 1AJ5A 1L2OC 4QJ5B 1SCMC 4ORCB 2R2IA 1QJTA 1K95A 2DOQA 4HSZA 1N0YA 3VRRA 1XFUO 5ER5A 4DIRA 2SASA 2E30A 2OTGB 1CB1A 2ISDA 4PHNA 1DTLA 3O2PA 1KFXL 1IGVA 1C7WA 2M9GA 1OE9B 2LHIA 3WXAA 2FJUB 2A4JA 3O6BA 2K7CA 2LCPA 1FW4A 3OX6A 1SL7A 2CT9A 2JXCA 2PVBA 5D69A 2KFFA 1KFUL 1LVCD 2LLSA 4PHJA 1B8CA 1V1FA 4HRHA 1AUIB 1DVIA 1NCZA 1XK4C 2AUCA 4JQ0D 2JULA 4OKHA 1TOPA 2RGIA 1K93D 2MHHA 2JC2A 3JTDB 2KOTA 3I5HB 1LINA 2P6BB 1DMOA 3ICBA 2WC8A 1ZUZA 1B1GA 1QLKA 1IKUA 3CZTX 2KYCA 4AQIA 2BBNA 2PALA 2KAVA 4PHMA 1F70A 2HF5A 1KCYA 4YGAA 1PALA 4PCWA 1LKJA 2CNPA 2M0RA 1G4YR 1QX7A 1WLZA 1UWOA 1BG1A 1XFXO 1AK8A 3OB2B 3WHUB 1KQMC 3I5IC 4GGFC 1UHKA 1EJ3A 2FOTA 1FI6A 5B8IB 1S3PA 2Q4UA 1WY9A 2WCEA 3AAJA 2KI6C 1OQPA 2OS8B 3AKAA 2NZ0A 2OPOA 1DJWA 2KGBC 1PK0D 4CFQA 3BUWB 1GGZA 3CLNA 1QIWA 3WHTB 1BODA 1S6IA 1FPWA 1S26D 3IQQA 1QTXA 1B8RA 1J7PA 1DJIA 1CKKA
chains in the Genus database with same CATH superfamily
3DD4A 4NDBA 1YTZC 4E68A 5I8NA 3HX4A 4GNKB 4ZCUA 2LVVA 4MBEA 3DVEA 1S6JA 1XFYO 2MLFC 5I2LA 3DF0A 4ETOA 1CNPA 2QEOA 2KI4C 5AXIA 1S36A 2JPTA 2LLTA 2AAOA 1MXEA 2NXQA 1NCYA 1TCFA 2LVIA 1CM4A 1R2UA 2JT3A 3B6XA 4L9MA 3NHIA 1UHIA 2WCJA 3AKBA 2KSPA 3CGAA 3BFBA 4MSPA 1BOCA 4YGCB 3VRNA 2O60A 3KF9A 1RK9A 4MZKA 1A29A 5AFPA 1CFFA 1YUSA 4YBHB 3B7AA 1TN4A 1RWYA 1XFWO 1SPYA 2ZN9A 2M29A 1QVIY 2L2CA 4PE1A 2EC6B 2L2EA 2WORA 3NSKA 1XFVO 3S0EA 1PVAA 3GK4X 1SR6C 1SBJA 2EGDA 1AVSA 1YRTB 2KGRA 1PVBA 4YI9A 1SL9A 5CSJA 1FF1A 1DJGA 1QVIZ 4INXA 1RTP1 1GJYA 2LHLA 3F45A 1J7OA 3AAKA 1EL4A 1CDLA 1VRKA 2LMTA 3CYZA 2PYQA 2LP3A 2KAYA 2LUCA 1KWOC 2PMYA 1C07A 2CXJA 1TNWA 1DEKA 2TN4A 1MF8B 2LV7A 1K94A 2QACA 2O5GA 3EK8A 1CDMA 4DCKA 1DJXA 2BCBA 1MUXA 4ORBB 1WDCC 5DKNA 1DJHA 1CTRA 1SNLA 1X02A 4GAOA 2NCOA 1NYAA 5HL1A 1PSBA 2Y1NA 3D77A 5KTYA 4GPLB 2LM5A 1XFRA 1UHJA 4OVNF 1WRLA 1OOGA 2OTGC 1ZMZA 4GGFA 1CDNA 1RJVA 2JXLA 1OMDA 2KYFA 2JPOA 4AQJA 5DKQA 3HCMA 4YGEB 1JBAA 1U5IA 2MBXA 3CZ2A 2I2RE 3BOWA 1CLLA 1W7IB 2K61A 3D76A 4PHKA 1AJ4A 1DGVA 3FS7A 1TCOB 1OMRA 4PE7A 2AMIA 5FI6A 2K8MB 4MRYA 1LS8A 2ZFDA 5TNCA 5KU1A 4N1FA 2LAPA 3DYEA 1BJFA 3SG5A 2CCMA 2LMUA 3TS5C 1L7ZA 1WLMA 1ZOTB 3VRPA 1CMGA 1BU3A 3EK7A 2BL0C 3D0YA 2K2AA 2KQ6A 5I94A 1A4PA 3JTDC 1SCMB 1S1EA 1TNPA 2HQWA 2WCHA 4MVFA 1GQMA 1QXPA 3S0DA 4C0JA 2MA2A 1EG3A 2BCAA 4OR9B 4M2QA 2GTEA 3EVUA 2K7DA 2LMVA 2V53A 1J1DA 2LNKA 1TNXA 1Y0VH 4I5LB 1OOJA 1YUUA 2CBLA 4OZDA 5J3XA 4WQ3A 1F55A 4JKTA 4MZJA 1SRAA 2WCBA 3GK2A 4R1EA 1IRJA 2JZIA 3N7HA 1P28A 3PLFB 2P71A 3VRQA 3BUNB 3BFHA 2WCKA 3O4XA 3PATA 1C3ZA 2NLNA 2F2PA 3SG4A 1BT6A 4CPVA 4YRUA 1NIWA 1CM1A 2L4IA 3CWGA 2OS8C 3GOFA 5AEQA 1QV0A 2GV5A 1AP4A 1K96A 4MN0A 3IVTA 1A2XA 4D1EA 1OSAA 2Y4QA 1MHOA 1JF2A 2H8VA 1XA5A 3VROA 1FI5A 1B9AA 3D74A 3SIAA 1T14A 2WOSA 3D73A 3PN7C 2D8NA 2WC6A 3KEVA 1DC1A 1QIVA 1N2DA 1YX7A 2I18A 2LVKA 2WCLA 4ORAB 1A75B 4WRIA 1DELA 1TIZA 2F8PA 2L5XB 1MR8A 4IJ7A 2F3ZA 3DXLA 1WRKA 3KPXA 4ZCVA 2PASA 3EKHA 1UUSA 1WRZA 2EHBA 3EVVA 4M2PA 3TDUA 3I5IB 4MLWA 2M8UA 1SYMA 4OV2A 3FIAA 2BE4A 3TDZA 4PDZA 1B4CA 1EH2A 2JNXA 2CTNA 2L0PA 3FE6A 3MSEB 1DT7B 1Y1UA 3BOWB 3SG2A 1F71A 1SW8A 4F0ZB 1K8UA 3UNWA 2Y1MA 3B88A 3CR2A 3PALA 1DF0A 1UHHA 2L50A 3A8RA 1QS7A 1RECA 1KQVA 1EXRA 3M0WA 2LE9B 4Q04A 1K9KA 5FI2A 4CIDA 1FBVA 4GUKA 3FE9A 2BBMA 4MZLA 2QPTA 1IQ5A 1M39A 2KPHA 3BUMB 1K2HA 4JWQA 3JVTC 1JUOA 5KSZA 3NSLA 1AHRA 1SY9A 1IQ3A 1SL8A 3D0YB 1LA0A 2WCFA 2ZNEA 3TUYB 1F54A 3NGVA 3S0FA 1KSOA 3FWBA 2MAZA 2LVJA 2K0JA 3L4LA 3B87A 3S0AA 2K7OA 3E3RA 5CSFA 3SG7A 2KI4B 2KI6D 4TNCA 1K9UA 1UP5A 2ZRTA 3IQOA 3NXAA 1E8AA 2NCPA 1J55A 4PE4A 1XK4A 3PJIA 1JFKA 3SS3A 5JJGA 3BUOB 3EKJA 3DY9A 1NSHA 2F3YA 3I5FC 1TNQA 4A4BA 2JT8A 3LK0A 5HKWA 1PSRA 1KK7Y 2KLDA 3FE8A 3PSRA 2KBIA 1YVHA 1NX1A 4ICBA 1PRWA 2ZRSA 3O78A 1OZSA 3I5GC 2JQ6A 3TDIA 1KK8B 2LANA 3R1PA 1KFXS 3DVKA 5DKRA 5FYXA 1CLMA 1OW4A 2QEHA 3DVMA 1DQEA 1YURA 1SR6B 2L4HA 2LP2A 3TZ1A 2KNEA 3PM8A 4I5NB 1NCXA 4N1GA 4PE0A 1TUZA 5HLVA 3UO9A 3BYAA 4MEWA 2MJWB 1NX3A 2MLEC 3C1VA 1KFUS 3R72A 5G08A 1CFPA 2VRGA 4GFTA 4INWA 1B7TY 5AANA 2G2BA 2KDHA 1Q80A 4I5KA 1UURA 1IIOA 5I2OA 2M1KB 1LA3A 4NQGA 1YUTA 1OOIX 3SG6A 3RZSA 3CZ1A 1KWOB 3GK1A 1IG5A 5IBWA 2GGMA 5I2QA 2HPSA 3S0BA 4AOMA 1W7JB 2FCDA 2PSRA 2KHNA 1B7TZ 1WDCB 1SMGA 5F6TA 3K21A 1BLQA 1B47A 3OB1B 3SJSA 3RM1A 3D75A 1XO5A 2H61C 3DF0B 1XVJA 1PULA 1BMOA 5CSNA 1L2OB 2G9BA 2BE6A 1HT9A 2WC5A 3I5HC 4NDDA 5ER4X 1DF0B 5PALA 2KAXA 1IH0A 2QDIA 1KSMA 2LC5A 2ZN8A 2L98A 3NSIA 1NWDA 1ODBA 2KFHA 4UPGA 1Y1AA 4DS7A 3ZNIA 1OOFA 4CLNA 4PALA 2JTZA 1TRFA 3DZTA 5K89A 4IL1A 2K2FA 1SKTA 2F2OA 1JWDA 1DGUA 2BCXA 1OMVA 1J1EA 4MRXA 2JNFA 2WNDA 1F4OA 2K60A 3IF7A 3TS5B 4P2YB 2PRUA 3DVJA 2BKHB 1JF0A 1M46A 1MXLC 1S5GY 2BKIB 1RROA 1MQ1A 2BL0B 4OCIA 1RFJA 1R6PA 3CABA 1CMFA 2QEBA 1NUBA 1ALWA 1NX0A 1ZACA 1S6CA 1Y6WA 1B8LA 3EVRA 1GM0A 3WNXB 2F33A 1J7RA 4QJ5B 1EG4A 2ZNDA 4HRGA 1N65A 1S5GZ 2M49B 1XFZO 1QX5B 4USLA 3OGNA 1MWNA 1NP8A 3L4AA 4C0LA 1ZFSA 2HETA 2I94A 2JU0A 4QJ3B 4WQ2A 3LCPC 5HKZA 5JOLA 3OX5A 2E6WA 2KBMA 1TTXA 4FQOA 4NDCA 4BY4A 2COLB 3L47A 3NSOA 1C7VA 2IS9A 3EG5B 3KO0A 1LXFC 1IJ5A 1KQMB 3OHMB 4XJKA 3VB1A 2I7AA 2M7NA 1F4QA 4YI8A 1H4BA 1U5IB 3H4SE 3R1OA 3NHTA 2SCPA 2H2KA 3CR5X 1Z2CB 3SG3A 5HYDA 4JPZB 1QX2A 1Y1XA 2Q91A 4I5JA 1YRUB 3PN7B 2KFGA 1G8IA 4FTGA 1F8HA 1CFDA 1H8BA 3TUYC 3CR4X 2EC6C 4C0KA 3CS1A 1K90D 1XYDA 4GBAA 3D10A 2BAPA 2JRFA 1UHNA 2JTTA 3VGOA 1QWVA 3LL8B 1SSEB 1OZOA 1CDPA 2K7BA 4PT1A 2H61A 3FWCA 2JWWA 4A4CA 2FJYA 2L51A 1C3YA 4KYNA 1BF5A 2M3WA 1CLBA 1JFJA 1HQVA 3PFVA 2M1UA 2JOJA 1NX2A 3OP0A 2LUXA 4F7FA 3QMEA 1M45A 2ZKMX 3BUXB 1IWQA 2M97A 1NPQA 1G33A 2GGZA 2KLEA 2KQYA 1BR4B 1KK8C 1IJ6A 1DJYA 1M31A 3BXKA 3CZ0A 3LK1A 3JVTB 1GGWA 2FCEA 1W9ZA 3OBVA 4GGNA 1JSAA 1YR5A 4U8DA 1K9PA 2M7LA 2B1UA 4P5OE 5CPVA 1YVLA 1ALVA 4DRWA 1QV1A 2HQ8A 1KK7Z 1J7QA 3QRXA 4XYNA 3A4UB 4CFRA 4DUQA 1JC2A 2YGUA 3KHEA 4YGDB 1SK6D 1CFCA 5HLOA 3CTNA 1A03A 2LLUA 5CSIA 1M63B 5AERA 5HKYA 4N5XA 3RLZA 1YX8A 3EK4A 5D7FA 3SIBA 4HREE 4BY5A 3I5FB 1QATA 2BECA 4YGBB 3O4YA 2Y5IA 2ERBA 3BQ3A 1SCVA 4M2OA 4QJ4B 5GQQC 1QASA 3PM2A 3SS5A 1A75A 3I5GB 5BPJA 2JT0A 1V1GA 3ZWHA 4XJKB 1BR1B 1QLSA 2MRDA 3LLEA 1D1OA 3K1EA 1DJZA 1AJ5A 1L2OC 1Z4HA 2WCMA 3Q8IA 1SCMC 4ORCB 2R2IA 5FI7A 1QJTA 1K95A 2DOQA 4HSZA 1N0YA 3VRRA 1XFUO 1ORGA 5ER5A 3R1VA 4DIRA 2SASA 2E30A 2OTGB 1CB1A 2ISDA 4PHNA 1DTLA 3O2PA 1KFXL 1IGVA 1C7WA 2M9GA 1OE9B 2LHIA 3WXAA 2FJUB 2A4JA 3O6BA 2K7CA 2LCPA 1FW4A 3OX6A 1SL7A 2CT9A 2JXCA 4JD9A 2PVBA 5D69A 2KFFA 1KFUL 1LVCD 2LLSA 4PHJA 1TWOA 1B8CA 1V1FA 2QEVA 1AUIB 3BFAA 1DVIA 1NCZA 1XK4C 2AUCA 4HRHA 2JULA 4JQ0D 1TOPA 4OKHA 2RGIA 3S0GA 1K93D 2MHHA 1TUJA 2JC2A 3JTDB 2KOTA 3I5HB 1LINA 3SS4A 2P6BB 1DMOA 3ICBA 2WC8A 5DICA 1ZUZA 1B1GA 1QLKA 1IKUA 3CZTX 2KYCA 3V2LA 4AQIA 4FQTA 2BBNA 2PALA 2KAVA 5D3OA 4PHMA 1F70A 2HF5A 1KCYA 4YGAA 1PALA 4PCWA 1LKJA 2CNPA 2M0RA 2P70A 1G4YR 3B86A 1QX7A 1WLZA 1UWOA 1BG1A 1XFXO 1AK8A 3OB2B 3WHUB 1KQMC 3I5IC 4GGFC 1UHKA 1EJ3A 2FOTA 1FI6A 5B8IB 1S3PA 2Q4UA 1WY9A 2WCEA 3AAJA 2KI6C 3BJHA 1OQPA 1OOHA 2OS8B 3D78A 5EL2A 3AKAA 2NZ0A 2OPOA 1DJWA 2KGBC 2PQLA 1PK0D 4CFQA 3BUWB 1GGZA 3CLNA 1QIWA 2L5YA 2BNXA 3WHTB 1BODA 1S6IA 1FPWA 1S26D 3IQQA 1QTXA 1B8RA 3CDNA 1J7PA 1DJIA 1CKKA
chains in the Genus database with same CATH topology
3DD4A 4NDBA 1YTZC 4E68A 5I8NA 3HX4A 4GNKB 4ZCUA 2LVVA 4MBEA 3DVEA 1S6JA 1XFYO 2MLFC 5I2LA 3DF0A 4ETOA 1CNPA 2KI4C 5AXIA 1S36A 2JPTA 2LLTA 2AAOA 1MXEA 2NXQA 1NCYA 1TCFA 2LVIA 1CM4A 1R2UA 2JT3A 4L9MA 1UHIA 3AKBA 2KSPA 3CGAA 4MSPA 1BOCA 4YGCB 3VRNA 2O60A 3KF9A 1RK9A 4MZKA 1A29A 5AFPA 1CFFA 1YUSA 4YBHB 1TN4A 1RWYA 1XFWO 1SPYA 2ZN9A 2M29A 1QVIY 4PE1A 2EC6B 2L2EA 2WORA 3NSKA 1XFVO 1PVAA 3GK4X 1SR6C 1SBJA 2EGDA 1AVSA 1YRTB 2KGRA 1PVBA 4YI9A 1SL9A 5CSJA 1FF1A 1DJGA 1QVIZ 1RTP1 1GJYA 2LHLA 3F45A 1J7OA 3AAKA 1EL4A 1CDLA 1VRKA 2LMTA 2LP3A 2KAYA 2LUCA 1KWOC 2PMYA 1C07A 2CXJA 1TNWA 2TN4A 1MF8B 2LV7A 1K94A 2QACA 2O5GA 3EK8A 1CDMA 4DCKA 1DJXA 2BCBA 1MUXA 4ORBB 1WDCC 5DKNA 1DJHA 1CTRA 1SNLA 1X02A 4GAOA 2NCOA 1NYAA 1PSBA 2Y1NA 5KTYA 4GPLB 2LM5A 1UHJA 4OVNF 1WRLA 2OTGC 1ZMZA 4GGFA 1CDNA 1RJVA 2JXLA 1OMDA 2KYFA 4AQJA 5DKQA 3HCMA 4YGEB 1JBAA 1U5IA 2MBXA 2I2RE 3BOWA 1CLLA 1W7IB 2K61A 4PHKA 1AJ4A 1DGVA 3FS7A 1TCOB 1OMRA 4PE7A 2AMIA 2K8MB 4MRYA 2ZFDA 5KU1A 5TNCA 4N1FA 2LAPA 1BJFA 3SG5A 2CCMA 2LMUA 3TS5C 1L7ZA 1WLMA 1ZOTB 3VRPA 1CMGA 1BU3A 3EK7A 2BL0C 3D0YA 2K2AA 2KQ6A 1A4PA 3JTDC 1SCMB 1S1EA 1TNPA 2HQWA 4MVFA 1GQMA 1QXPA 4C0JA 2MA2A 1EG3A 2BCAA 4OR9B 4M2QA 3EVUA 2K7DA 2LMVA 2V53A 1J1DA 2LNKA 1TNXA 1Y0VH 4I5LB 1OOJA 1YUUA 2CBLA 5J3XA 4WQ3A 1F55A 4MZJA 1SRAA 2WCBA 3GK2A 4R1EA 1IRJA 2JZIA 3PLFB 3VRQA 3BUNB 3SG4A 3PATA 2NLNA 4YRUA 2F2PA 1BT6A 4CPVA 1NIWA 1CM1A 2L4IA 3CWGA 2OS8C 3GOFA 5AEQA 1QV0A 2GV5A 1AP4A 1K96A 4MN0A 1A2XA 4D1EA 1OSAA 2Y4QA 1MHOA 1JF2A 1XA5A 3VROA 1FI5A 1B9AA 3SIAA 2WOSA 3PN7C 2D8NA 3KEVA 1QIVA 1N2DA 1YX7A 2I18A 2LVKA 4ORAB 1A75B 4WRIA 1TIZA 2F8PA 2L5XB 1MR8A 2F3ZA 1WRKA 3KPXA 4ZCVA 2PASA 3EKHA 1UUSA 1WRZA 2EHBA 3EVVA 4M2PA 3TDUA 3I5IB 4MLWA 2M8UA 1SYMA 4OV2A 3FIAA 2BE4A 3TDZA 4PDZA 1B4CA 1EH2A 2JNXA 2CTNA 2L0PA 3MSEB 1DT7B 1Y1UA 3BOWB 3SG2A 1F71A 1SW8A 4F0ZB 1K8UA 2Y1MA 3CR2A 3PALA 1DF0A 1UHHA 2L50A 3A8RA 1QS7A 1RECA 1KQVA 1EXRA 3M0WA 2LE9B 4Q04A 1K9KA 4CIDA 1FBVA 4GUKA 2BBMA 4MZLA 2QPTA 1IQ5A 1M39A 3BUMB 1K2HA 4JWQA 3JVTC 1JUOA 5KSZA 3NSLA 1AHRA 1SY9A 1IQ3A 1SL8A 3D0YB 1LA0A 2WCFA 2ZNEA 3TUYB 1F54A 1KSOA 3FWBA 2MAZA 2LVJA 2K0JA 2K7OA 3E3RA 5CSFA 3SG7A 2KI4B 2KI6D 4TNCA 1K9UA 1UP5A 2ZRTA 3IQOA 3NXAA 1E8AA 2NCPA 1J55A 4PE4A 1XK4A 5G08A 1JFKA 5JJGA 3BUOB 3EKJA 1NSHA 2F3YA 3I5FC 1TNQA 4A4BA 2JT8A 3LK0A 5HKWA 1PSRA 1KK7Y 3PSRA 2KBIA 1YVHA 1NX1A 4ICBA 1PRWA 2ZRSA 3O78A 1OZSA 3I5GC 2JQ6A 3TDIA 1KK8B 2LANA 1KFXS 3DVKA 5DKRA 5FYXA 1CLMA 3DVMA 1YURA 1SR6B 2L4HA 2LP2A 3TZ1A 2KNEA 3PM8A 4I5NB 1NCXA 4N1GA 4PE0A 5HLVA 3BYAA 4MEWA 2MJWB 1NX3A 2MLEC 3C1VA 1KFUS 1CFPA 2VRGA 4GFTA 5AANA 1B7TY 2G2BA 2KDHA 1Q80A 4I5KA 1UURA 5I2OA 2M1KB 1LA3A 4NQGA 1YUTA 3SG6A 3GK1A 1KWOB 1IG5A 5IBWA 2GGMA 5I2QA 2HPSA 4AOMA 1W7JB 2FCDA 2PSRA 2KHNA 1B7TZ 1WDCB 1SMGA 5F6TA 3K21A 1BLQA 1B47A 3OB1B 3SJSA 3RM1A 1XO5A 2H61C 3DF0B 1XVJA 1PULA 1BMOA 5CSNA 1L2OB 2G9BA 2BE6A 1HT9A 3I5HC 4NDDA 5ER4X 1DF0B 5PALA 2KAXA 1IH0A 1KSMA 2LC5A 2ZN8A 2L98A 3NSIA 1NWDA 1ODBA 2KFHA 4UPGA 1Y1AA 4DS7A 3ZNIA 4CLNA 4PALA 2JTZA 1TRFA 5K89A 4IL1A 2K2FA 1SKTA 2F2OA 1JWDA 1DGUA 2BCXA 1OMVA 1J1EA 4MRXA 2JNFA 2WNDA 1F4OA 3IF7A 3TS5B 4P2YB 2PRUA 3DVJA 2BKHB 1JF0A 1M46A 1MXLC 1S5GY 2BL0B 1RROA 1MQ1A 2BKIB 4OCIA 1RFJA 1R6PA 1CMFA 1NUBA 1ALWA 1NX0A 1ZACA 1S6CA 1Y6WA 1B8LA 3EVRA 3WNXB 2F33A 1J7RA 1EG4A 2ZNDA 4HRGA 1N65A 1S5GZ 2M49B 1XFZO 1QX5B 4USLA 1MWNA 1NP8A 4C0LA 1ZFSA 2HETA 2I94A 2JU0A 4QJ3B 4WQ2A 3LCPC 5HKZA 5JOLA 3OX5A 2E6WA 2KBMA 1TTXA 4FQOA 4NDCA 4BY4A 2COLB 3NSOA 1C7VA 2IS9A 3KO0A 1LXFC 1IJ5A 1KQMB 3OHMB 4XJKA 2I7AA 2M7NA 1F4QA 4YI8A 1H4BA 1U5IB 3H4SE 2SCPA 2H2KA 3CR5X 3SG3A 5HYDA 4JPZB 1QX2A 1Y1XA 2Q91A 4I5JA 1YRUB 3PN7B 2KFGA 1G8IA 4FTGA 1F8HA 1CFDA 1H8BA 3TUYC 3CR4X 2EC6C 4C0KA 3CS1A 1K90D 1XYDA 4GBAA 3D10A 2JRFA 1UHNA 2JTTA 3VGOA 3LL8B 1OZOA 1CDPA 2K7BA 2H61A 3FWCA 2JWWA 4A4CA 2L51A 1BF5A 2M3WA 1CLBA 1JFJA 1HQVA 3PFVA 2M1UA 2JOJA 1NX2A 3OP0A 2LUXA 1M45A 2ZKMX 3BUXB 1IWQA 2M97A 1NPQA 1G33A 2GGZA 2KQYA 3LK1A 1BR4B 1KK8C 1IJ6A 1DJYA 1M31A 3BXKA 3JVTB 1GGWA 2FCEA 4GGNA 1JSAA 1YR5A 4U8DA 1K9PA 2M7LA 2B1UA 4P5OE 5CPVA 1YVLA 1ALVA 4DRWA 1QV1A 2HQ8A 1KK7Z 1J7QA 3QRXA 4XYNA 3A4UB 4CFRA 4DUQA 1JC2A 4YGDB 3KHEA 1CFCA 1SK6D 5HLOA 3CTNA 1A03A 2LLUA 5CSIA 1M63B 5AERA 5HKYA 4N5XA 3RLZA 1YX8A 3EK4A 5D7FA 3SIBA 4HREE 4BY5A 3I5FB 1QATA 2BECA 4YGBB 3O4YA 2Y5IA 4M2OA 3BQ3A 1SCVA 4QJ4B 5GQQC 1QASA 1A75A 3I5GB 5BPJA 2JT0A 1V1GA 3ZWHA 4XJKB 1BR1B 1QLSA 2MRDA 3LLEA 1D1OA 1DJZA 1AJ5A 1L2OC 4QJ5B 1SCMC 4ORCB 2R2IA 1QJTA 1K95A 2DOQA 4HSZA 1N0YA 3VRRA 1XFUO 5ER5A 4DIRA 2SASA 2E30A 2OTGB 1CB1A 2ISDA 4PHNA 1DTLA 3O2PA 1KFXL 1IGVA 1C7WA 2M9GA 1OE9B 2LHIA 3WXAA 2FJUB 2A4JA 3O6BA 2K7CA 2LCPA 1FW4A 3OX6A 1SL7A 2CT9A 2JXCA 2PVBA 5D69A 2KFFA 1KFUL 1LVCD 2LLSA 4PHJA 1B8CA 1V1FA 4HRHA 1AUIB 1DVIA 1NCZA 1XK4C 2AUCA 4JQ0D 2JULA 4OKHA 1TOPA 2RGIA 1K93D 2MHHA 2JC2A 3JTDB 2KOTA 3I5HB 1LINA 2P6BB 1DMOA 3ICBA 2WC8A 1ZUZA 1B1GA 1QLKA 1IKUA 3CZTX 2KYCA 4AQIA 2BBNA 2PALA 2KAVA 4PHMA 1F70A 2HF5A 1KCYA 4YGAA 1PALA 4PCWA 1LKJA 2CNPA 2M0RA 1G4YR 1QX7A 1WLZA 1UWOA 1BG1A 1XFXO 1AK8A 3OB2B 3WHUB 1KQMC 3I5IC 4GGFC 1UHKA 1EJ3A 2FOTA 1FI6A 5B8IB 1S3PA 2Q4UA 1WY9A 2WCEA 3AAJA 2KI6C 1OQPA 2OS8B 3AKAA 2NZ0A 2OPOA 1DJWA 2KGBC 1PK0D 4CFQA 3BUWB 1GGZA 3CLNA 1QIWA 3WHTB 1BODA 1S6IA 1FPWA 1S26D 3IQQA 1QTXA 1B8RA 1J7PA 1DJIA 1CKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD4 A;  4NDB A;  1YTZ C;  4E68 A;  5I8N A;  3HX4 A;  4GNK B;  4ZCU A;  2LVV A;  4MBE A;  3DVE A;  1S6J A;  1XFY O;  2MLF C;  5I2L A;  3DF0 A;  4ETO A;  1CNP A;  2KI4 C;  5AXI A;  1S36 A;  2JPT A;  2LLT A;  2AAO A;  1MXE A;  2NXQ A;  1NCY A;  1TCF A;  2LVI A;  1CM4 A;  1R2U A;  2JT3 A;  4L9M A;  1UHI A;  3AKB A;  2KSP A;  3CGA A;  4MSP A;  1BOC A;  4YGC B;  3VRN A;  2O60 A;  3KF9 A;  1RK9 A;  4MZK A;  1A29 A;  5AFP A;  1CFF A;  1YUS A;  4YBH B;  1TN4 A;  1RWY A;  1XFW O;  1SPY A;  2ZN9 A;  2M29 A;  1QVI Y;  4PE1 A;  2EC6 B;  2L2E A;  2WOR A;  3NSK A;  1XFV O;  1PVA A;  3GK4 X;  1SR6 C;  1SBJ A;  2EGD A;  1AVS A;  1YRT B;  2KGR A;  1PVB A;  4YI9 A;  1SL9 A;  5CSJ A;  1FF1 A;  1DJG A;  1QVI Z;  1RTP 1;  1GJY A;  2LHL A;  3F45 A;  1J7O A;  3AAK A;  1EL4 A;  1CDL A;  1VRK A;  2LMT A;  2LP3 A;  2KAY A;  2LUC A;  1KWO C;  2PMY A;  1C07 A;  2CXJ A;  1TNW A;  2TN4 A;  1MF8 B;  2LV7 A;  1K94 A;  2QAC A;  2O5G A;  3EK8 A;  1CDM A;  4DCK A;  1DJX A;  2BCB A;  1MUX A;  4ORB B;  1WDC C;  5DKN A;  1DJH A;  1CTR A;  1SNL A;  1X02 A;  4GAO A;  2NCO A;  1NYA A;  1PSB A;  2Y1N A;  5KTY A;  4GPL B;  2LM5 A;  1UHJ A;  4OVN F;  1WRL A;  2OTG C;  1ZMZ A;  4GGF A;  1CDN A;  1RJV A;  2JXL A;  1OMD A;  2KYF A;  4AQJ A;  5DKQ A;  3HCM A;  4YGE B;  1JBA A;  1U5I A;  2MBX A;  2I2R E;  3BOW A;  1CLL A;  1W7I B;  2K61 A;  4PHK A;  1AJ4 A;  1DGV A;  3FS7 A;  1TCO B;  1OMR A;  4PE7 A;  2AMI A;  2K8M B;  4MRY A;  2ZFD A;  5KU1 A;  5TNC A;  4N1F A;  2LAP A;  1BJF A;  3SG5 A;  2CCM A;  2LMU A;  3TS5 C;  1L7Z A;  1WLM A;  1ZOT B;  3VRP A;  1CMG A;  1BU3 A;  3EK7 A;  2BL0 C;  3D0Y A;  2K2A A;  2KQ6 A;  1A4P A;  3JTD C;  1SCM B;  1S1E A;  1TNP A;  2HQW A;  4MVF A;  1GQM A;  1QXP A;  4C0J A;  2MA2 A;  1EG3 A;  2BCA A;  4OR9 B;  4M2Q A;  3EVU A;  2K7D A;  2LMV A;  2V53 A;  1J1D A;  2LNK A;  1TNX A;  1Y0V H;  4I5L B;  1OOJ A;  1YUU A;  2CBL A;  5J3X A;  4WQ3 A;  1F55 A;  4MZJ A;  1SRA A;  2WCB A;  3GK2 A;  4R1E A;  1IRJ A;  2JZI A;  3PLF B;  3VRQ A;  3BUN B;  3SG4 A;  3PAT A;  2NLN A;  4YRU A;  2F2P A;  1BT6 A;  4CPV A;  1NIW A;  1CM1 A;  2L4I A;  3CWG A;  2OS8 C;  3GOF A;  5AEQ A;  1QV0 A;  2GV5 A;  1AP4 A;  1K96 A;  4MN0 A;  1A2X A;  4D1E A;  1OSA A;  2Y4Q A;  1MHO A;  1JF2 A;  1XA5 A;  3VRO A;  1FI5 A;  1B9A A;  3SIA A;  2WOS A;  3PN7 C;  2D8N A;  3KEV A;  1QIV A;  1N2D A;  1YX7 A;  2I18 A;  2LVK A;  4ORA B;  1A75 B;  4WRI A;  1TIZ A;  2F8P A;  2L5X B;  1MR8 A;  2F3Z A;  1WRK A;  3KPX A;  4ZCV A;  2PAS A;  3EKH A;  1UUS A;  1WRZ A;  2EHB A;  3EVV A;  4M2P A;  3TDU A;  3I5I B;  4MLW A;  2M8U A;  1SYM A;  4OV2 A;  3FIA A;  2BE4 A;  3TDZ A;  4PDZ A;  1B4C A;  1EH2 A;  2JNX A;  2CTN A;  2L0P A;  3MSE B;  1DT7 B;  1Y1U A;  3BOW B;  3SG2 A;  1F71 A;  1SW8 A;  4F0Z B;  1K8U A;  2Y1M A;  3CR2 A;  3PAL A;  1DF0 A;  1UHH A;  2L50 A;  3A8R A;  1QS7 A;  1REC A;  1KQV A;  1EXR A;  3M0W A;  2LE9 B;  4Q04 A;  1K9K A;  4CID A;  1FBV A;  4GUK A;  2BBM A;  4MZL A;  2QPT A;  1IQ5 A;  1M39 A;  3BUM B;  1K2H A;  4JWQ A;  3JVT C;  1JUO A;  5KSZ A;  3NSL A;  1AHR A;  1SY9 A;  1IQ3 A;  1SL8 A;  3D0Y B;  1LA0 A;  2WCF A;  2ZNE A;  3TUY B;  1F54 A;  1KSO A;  3FWB A;  2MAZ A;  2LVJ A;  2K0J A;  2K7O A;  3E3R A;  5CSF A;  3SG7 A;  2KI4 B;  2KI6 D;  4TNC A;  1K9U A;  1UP5 A;  2ZRT A;  3IQO A;  3NXA A;  1E8A A;  2NCP A;  1J55 A;  4PE4 A;  1XK4 A;  5G08 A;  1JFK A;  5JJG A;  3BUO B;  3EKJ A;  1NSH A;  2F3Y A;  3I5F C;  1TNQ A;  4A4B A;  2JT8 A;  3LK0 A;  5HKW A;  1PSR A;  1KK7 Y;  3PSR A;  2KBI A;  1YVH A;  1NX1 A;  4ICB A;  1PRW A;  2ZRS A;  3O78 A;  1OZS A;  3I5G C;  2JQ6 A;  3TDI A;  1KK8 B;  2LAN A;  1KFX S;  3DVK A;  5DKR A;  5FYX A;  1CLM A;  3DVM A;  1YUR A;  1SR6 B;  2L4H A;  2LP2 A;  3TZ1 A;  2KNE A;  3PM8 A;  4I5N B;  1NCX A;  4N1G A;  4PE0 A;  5HLV A;  3BYA A;  4MEW A;  2MJW B;  1NX3 A;  2MLE C;  3C1V A;  1KFU S;  1CFP A;  2VRG A;  4GFT A;  5AAN A;  1B7T Y;  2G2B A;  2KDH A;  1Q80 A;  4I5K A;  1UUR A;  5I2O A;  2M1K B;  1LA3 A;  4NQG A;  1YUT A;  3SG6 A;  3GK1 A;  1KWO B;  1IG5 A;  5IBW A;  2GGM A;  5I2Q A;  2HPS A;  4AOM A;  1W7J B;  2FCD A;  2PSR A;  2KHN A;  1B7T Z;  1WDC B;  1SMG A;  5F6T A;  3K21 A;  1BLQ A;  1B47 A;  3OB1 B;  3SJS A;  3RM1 A;  1XO5 A;  2H61 C;  3DF0 B;  1XVJ A;  1PUL A;  1BMO A;  5CSN A;  1L2O B;  2G9B A;  2BE6 A;  1HT9 A;  3I5H C;  4NDD A;  5ER4 X;  1DF0 B;  5PAL A;  2KAX A;  1IH0 A;  1KSM A;  2LC5 A;  2ZN8 A;  2L98 A;  3NSI A;  1NWD A;  1ODB A;  2KFH A;  4UPG A;  1Y1A A;  4DS7 A;  3ZNI A;  4CLN A;  4PAL A;  2JTZ A;  1TRF A;  5K89 A;  4IL1 A;  2K2F A;  1SKT A;  2F2O A;  1JWD A;  1DGU A;  2BCX A;  1OMV A;  1J1E A;  4MRX A;  2JNF A;  2WND A;  1F4O A;  3IF7 A;  3TS5 B;  4P2Y B;  2PRU A;  3DVJ A;  2BKH B;  1JF0 A;  1M46 A;  1MXL C;  1S5G Y;  2BL0 B;  1RRO A;  1MQ1 A;  2BKI B;  4OCI A;  1RFJ A;  1R6P A;  1CMF A;  1NUB A;  1ALW A;  1NX0 A;  1ZAC A;  1S6C A;  1Y6W A;  1B8L A;  3EVR A;  3WNX B;  2F33 A;  1J7R A;  1EG4 A;  2ZND A;  4HRG A;  1N65 A;  1S5G Z;  2M49 B;  1XFZ O;  1QX5 B;  4USL A;  1MWN A;  1NP8 A;  4C0L A;  1ZFS A;  2HET A;  2I94 A;  2JU0 A;  4QJ3 B;  4WQ2 A;  3LCP C;  5HKZ A;  5JOL A;  3OX5 A;  2E6W A;  2KBM A;  1TTX A;  4FQO A;  4NDC A;  4BY4 A;  2COL B;  3NSO A;  1C7V A;  2IS9 A;  3KO0 A;  1LXF C;  1IJ5 A;  1KQM B;  3OHM B;  4XJK A;  2I7A A;  2M7N A;  1F4Q A;  4YI8 A;  1H4B A;  1U5I B;  3H4S E;  2SCP A;  2H2K A;  3CR5 X;  3SG3 A;  5HYD A;  4JPZ B;  1QX2 A;  1Y1X A;  2Q91 A;  4I5J A;  1YRU B;  3PN7 B;  2KFG A;  1G8I A;  4FTG A;  1F8H A;  1CFD A;  1H8B A;  3TUY C;  3CR4 X;  2EC6 C;  4C0K A;  3CS1 A;  1K90 D;  1XYD A;  4GBA A;  3D10 A;  2JRF A;  1UHN A;  2JTT A;  3VGO A;  3LL8 B;  1OZO A;  1CDP A;  2K7B A;  2H61 A;  3FWC A;  2JWW A;  4A4C A;  2L51 A;  1BF5 A;  2M3W A;  1CLB A;  1JFJ A;  1HQV A;  3PFV A;  2M1U A;  2JOJ A;  1NX2 A;  3OP0 A;  2LUX A;  1M45 A;  2ZKM X;  3BUX B;  1IWQ A;  2M97 A;  1NPQ A;  1G33 A;  2GGZ A;  2KQY A;  3LK1 A;  1BR4 B;  1KK8 C;  1IJ6 A;  1DJY A;  1M31 A;  3BXK A;  3JVT B;  1GGW A;  2FCE A;  4GGN A;  1JSA A;  1YR5 A;  4U8D A;  1K9P A;  2M7L A;  2B1U A;  4P5O E;  5CPV A;  1YVL A;  1ALV A;  4DRW A;  1QV1 A;  2HQ8 A;  1KK7 Z;  1J7Q A;  3QRX A;  4XYN A;  3A4U B;  4CFR A;  4DUQ A;  1JC2 A;  4YGD B;  3KHE A;  1CFC A;  1SK6 D;  5HLO A;  3CTN A;  1A03 A;  2LLU A;  5CSI A;  1M63 B;  5AER A;  5HKY A;  4N5X A;  3RLZ A;  1YX8 A;  3EK4 A;  5D7F A;  3SIB A;  4HRE E;  4BY5 A;  3I5F B;  1QAT A;  2BEC A;  4YGB B;  3O4Y A;  2Y5I A;  4M2O A;  3BQ3 A;  1SCV A;  4QJ4 B;  5GQQ C;  1QAS A;  1A75 A;  3I5G B;  5BPJ A;  2JT0 A;  1V1G A;  3ZWH A;  4XJK B;  1BR1 B;  1QLS A;  2MRD A;  3LLE A;  1D1O A;  1DJZ A;  1AJ5 A;  1L2O C;  4QJ5 B;  1SCM C;  4ORC B;  2R2I A;  1QJT A;  1K95 A;  2DOQ A;  4HSZ A;  1N0Y A;  3VRR A;  1XFU O;  5ER5 A;  4DIR A;  2SAS A;  2E30 A;  2OTG B;  1CB1 A;  2ISD A;  4PHN A;  1DTL A;  3O2P A;  1KFX L;  1IGV A;  1C7W A;  2M9G A;  1OE9 B;  2LHI A;  3WXA A;  2FJU B;  2A4J A;  3O6B A;  2K7C A;  2LCP A;  1FW4 A;  3OX6 A;  1SL7 A;  2CT9 A;  2JXC A;  2PVB A;  5D69 A;  2KFF A;  1KFU L;  1LVC D;  2LLS A;  4PHJ A;  1B8C A;  1V1F A;  4HRH A;  1AUI B;  1DVI A;  1NCZ A;  1XK4 C;  2AUC A;  4JQ0 D;  2JUL A;  4OKH A;  1TOP A;  2RGI A;  1K93 D;  2MHH A;  2JC2 A;  3JTD B;  2KOT A;  3I5H B;  1LIN A;  2P6B B;  1DMO A;  3ICB A;  2WC8 A;  1ZUZ A;  1B1G A;  1QLK A;  1IKU A;  3CZT X;  2KYC A;  4AQI A;  2BBN A;  2PAL A;  2KAV A;  4PHM A;  1F70 A;  2HF5 A;  1KCY A;  4YGA A;  1PAL A;  4PCW A;  1LKJ A;  2CNP A;  2M0R A;  1G4Y R;  1QX7 A;  1WLZ A;  1UWO A;  1BG1 A;  1XFX O;  1AK8 A;  3OB2 B;  3WHU B;  1KQM C;  3I5I C;  4GGF C;  1UHK A;  1EJ3 A;  2FOT A;  1FI6 A;  5B8I B;  1S3P A;  2Q4U A;  1WY9 A;  2WCE A;  3AAJ A;  2KI6 C;  1OQP A;  2OS8 B;  3AKA A;  2NZ0 A;  2OPO A;  1DJW A;  2KGB C;  1PK0 D;  4CFQ A;  3BUW B;  1GGZ A;  3CLN A;  1QIW A;  3WHT B;  1BOD A;  1S6I A;  1FPW A;  1S26 D;  3IQQ A;  1QTX A;  1B8R A;  1J7P A;  1DJI A;  1CKK A; 
#chains in the Genus database with same CATH topology
 3DD4 A;  4NDB A;  1YTZ C;  4E68 A;  5I8N A;  3HX4 A;  4GNK B;  4ZCU A;  2LVV A;  4MBE A;  3DVE A;  1S6J A;  1XFY O;  2MLF C;  5I2L A;  3DF0 A;  4ETO A;  1CNP A;  2QEO A;  2KI4 C;  5AXI A;  1S36 A;  2JPT A;  2LLT A;  2AAO A;  1MXE A;  2NXQ A;  1NCY A;  1TCF A;  2LVI A;  1CM4 A;  1R2U A;  2JT3 A;  3B6X A;  4L9M A;  3NHI A;  1UHI A;  2WCJ A;  3AKB A;  2KSP A;  3CGA A;  3BFB A;  4MSP A;  1BOC A;  4YGC B;  3VRN A;  2O60 A;  3KF9 A;  1RK9 A;  4MZK A;  1A29 A;  5AFP A;  1CFF A;  1YUS A;  4YBH B;  3B7A A;  1TN4 A;  1RWY A;  1XFW O;  1SPY A;  2ZN9 A;  2M29 A;  1QVI Y;  2L2C A;  4PE1 A;  2EC6 B;  2L2E A;  2WOR A;  3NSK A;  1XFV O;  3S0E A;  1PVA A;  3GK4 X;  1SR6 C;  1SBJ A;  2EGD A;  1AVS A;  1YRT B;  2KGR A;  1PVB A;  4YI9 A;  1SL9 A;  5CSJ A;  1FF1 A;  1DJG A;  1QVI Z;  4INX A;  1RTP 1;  1GJY A;  2LHL A;  3F45 A;  1J7O A;  3AAK A;  1EL4 A;  1CDL A;  1VRK A;  2LMT A;  3CYZ A;  2PYQ A;  2LP3 A;  2KAY A;  2LUC A;  1KWO C;  2PMY A;  1C07 A;  2CXJ A;  1TNW A;  1DEK A;  2TN4 A;  1MF8 B;  2LV7 A;  1K94 A;  2QAC A;  2O5G A;  3EK8 A;  1CDM A;  4DCK A;  1DJX A;  2BCB A;  1MUX A;  4ORB B;  1WDC C;  5DKN A;  1DJH A;  1CTR A;  1SNL A;  1X02 A;  4GAO A;  2NCO A;  1NYA A;  5HL1 A;  1PSB A;  2Y1N A;  3D77 A;  5KTY A;  4GPL B;  2LM5 A;  1XFR A;  1UHJ A;  4OVN F;  1WRL A;  1OOG A;  2OTG C;  1ZMZ A;  4GGF A;  1CDN A;  1RJV A;  2JXL A;  1OMD A;  2KYF A;  2JPO A;  4AQJ A;  5DKQ A;  3HCM A;  4YGE B;  1JBA A;  1U5I A;  2MBX A;  3CZ2 A;  2I2R E;  3BOW A;  1CLL A;  1W7I B;  2K61 A;  3D76 A;  4PHK A;  1AJ4 A;  1DGV A;  3FS7 A;  1TCO B;  1OMR A;  4PE7 A;  2AMI A;  5FI6 A;  2K8M B;  4MRY A;  1LS8 A;  2ZFD A;  5TNC A;  5KU1 A;  4N1F A;  2LAP A;  3DYE A;  1BJF A;  3SG5 A;  2CCM A;  2LMU A;  3TS5 C;  1L7Z A;  1WLM A;  1ZOT B;  3VRP A;  1CMG A;  1BU3 A;  3EK7 A;  2BL0 C;  3D0Y A;  2K2A A;  2KQ6 A;  5I94 A;  1A4P A;  3JTD C;  1SCM B;  1S1E A;  1TNP A;  2HQW A;  2WCH A;  4MVF A;  1GQM A;  1QXP A;  3S0D A;  4C0J A;  2MA2 A;  1EG3 A;  2BCA A;  4OR9 B;  4M2Q A;  2GTE A;  3EVU A;  2K7D A;  2LMV A;  2V53 A;  1J1D A;  2LNK A;  1TNX A;  1Y0V H;  4I5L B;  1OOJ A;  1YUU A;  2CBL A;  4OZD A;  5J3X A;  4WQ3 A;  1F55 A;  4JKT A;  4MZJ A;  1SRA A;  2WCB A;  3GK2 A;  4R1E A;  1IRJ A;  2JZI A;  3N7H A;  1P28 A;  3PLF B;  2P71 A;  3VRQ A;  3BUN B;  3BFH A;  2WCK A;  3O4X A;  3PAT A;  1C3Z A;  2NLN A;  2F2P A;  3SG4 A;  1BT6 A;  4CPV A;  4YRU A;  1NIW A;  1CM1 A;  2L4I A;  3CWG A;  2OS8 C;  3GOF A;  5AEQ A;  1QV0 A;  2GV5 A;  1AP4 A;  1K96 A;  4MN0 A;  3IVT A;  1A2X A;  4D1E A;  1OSA A;  2Y4Q A;  1MHO A;  1JF2 A;  2H8V A;  1XA5 A;  3VRO A;  1FI5 A;  1B9A A;  3D74 A;  3SIA A;  1T14 A;  2WOS A;  3D73 A;  3PN7 C;  2D8N A;  2WC6 A;  3KEV A;  1DC1 A;  1QIV A;  1N2D A;  1YX7 A;  2I18 A;  2LVK A;  2WCL A;  4ORA B;  1A75 B;  4WRI A;  1DEL A;  1TIZ A;  2F8P A;  2L5X B;  1MR8 A;  4IJ7 A;  2F3Z A;  3DXL A;  1WRK A;  3KPX A;  4ZCV A;  2PAS A;  3EKH A;  1UUS A;  1WRZ A;  2EHB A;  3EVV A;  4M2P A;  3TDU A;  3I5I B;  4MLW A;  2M8U A;  1SYM A;  4OV2 A;  3FIA A;  2BE4 A;  3TDZ A;  4PDZ A;  1B4C A;  1EH2 A;  2JNX A;  2CTN A;  2L0P A;  3FE6 A;  3MSE B;  1DT7 B;  1Y1U A;  3BOW B;  3SG2 A;  1F71 A;  1SW8 A;  4F0Z B;  1K8U A;  3UNW A;  2Y1M A;  3B88 A;  3CR2 A;  3PAL A;  1DF0 A;  1UHH A;  2L50 A;  3A8R A;  1QS7 A;  1REC A;  1KQV A;  1EXR A;  3M0W A;  2LE9 B;  4Q04 A;  1K9K A;  5FI2 A;  4CID A;  1FBV A;  4GUK A;  3FE9 A;  2BBM A;  4MZL A;  2QPT A;  1IQ5 A;  1M39 A;  2KPH A;  3BUM B;  1K2H A;  4JWQ A;  3JVT C;  1JUO A;  5KSZ A;  3NSL A;  1AHR A;  1SY9 A;  1IQ3 A;  1SL8 A;  3D0Y B;  1LA0 A;  2WCF A;  2ZNE A;  3TUY B;  1F54 A;  3NGV A;  3S0F A;  1KSO A;  3FWB A;  2MAZ A;  2LVJ A;  2K0J A;  3L4L A;  3B87 A;  3S0A A;  2K7O A;  3E3R A;  5CSF A;  3SG7 A;  2KI4 B;  2KI6 D;  4TNC A;  1K9U A;  1UP5 A;  2ZRT A;  3IQO A;  3NXA A;  1E8A A;  2NCP A;  1J55 A;  4PE4 A;  1XK4 A;  3PJI A;  1JFK A;  3SS3 A;  5JJG A;  3BUO B;  3EKJ A;  3DY9 A;  1NSH A;  2F3Y A;  3I5F C;  1TNQ A;  4A4B A;  2JT8 A;  3LK0 A;  5HKW A;  1PSR A;  1KK7 Y;  2KLD A;  3FE8 A;  3PSR A;  2KBI A;  1YVH A;  1NX1 A;  4ICB A;  1PRW A;  2ZRS A;  3O78 A;  1OZS A;  3I5G C;  2JQ6 A;  3TDI A;  1KK8 B;  2LAN A;  3R1P A;  1KFX S;  3DVK A;  5DKR A;  5FYX A;  1CLM A;  1OW4 A;  2QEH A;  3DVM A;  1DQE A;  1YUR A;  1SR6 B;  2L4H A;  2LP2 A;  3TZ1 A;  2KNE A;  3PM8 A;  4I5N B;  1NCX A;  4N1G A;  4PE0 A;  1TUZ A;  5HLV A;  3UO9 A;  3BYA A;  4MEW A;  2MJW B;  1NX3 A;  2MLE C;  3C1V A;  1KFU S;  3R72 A;  5G08 A;  1CFP A;  2VRG A;  4GFT A;  4INW A;  1B7T Y;  5AAN A;  2G2B A;  2KDH A;  1Q80 A;  4I5K A;  1UUR A;  1IIO A;  5I2O A;  2M1K B;  1LA3 A;  4NQG A;  1YUT A;  1OOI X;  3SG6 A;  3RZS A;  3CZ1 A;  1KWO B;  3GK1 A;  1IG5 A;  5IBW A;  2GGM A;  5I2Q A;  2HPS A;  3S0B A;  4AOM A;  1W7J B;  2FCD A;  2PSR A;  2KHN A;  1B7T Z;  1WDC B;  1SMG A;  5F6T A;  3K21 A;  1BLQ A;  1B47 A;  3OB1 B;  3SJS A;  3RM1 A;  3D75 A;  1XO5 A;  2H61 C;  3DF0 B;  1XVJ A;  1PUL A;  1BMO A;  5CSN A;  1L2O B;  2G9B A;  2BE6 A;  1HT9 A;  2WC5 A;  3I5H C;  4NDD A;  5ER4 X;  1DF0 B;  5PAL A;  2KAX A;  1IH0 A;  2QDI A;  1KSM A;  2LC5 A;  2ZN8 A;  2L98 A;  3NSI A;  1NWD A;  1ODB A;  2KFH A;  4UPG A;  1Y1A A;  4DS7 A;  3ZNI A;  1OOF A;  4CLN A;  4PAL A;  2JTZ A;  1TRF A;  3DZT A;  5K89 A;  4IL1 A;  2K2F A;  1SKT A;  2F2O A;  1JWD A;  1DGU A;  2BCX A;  1OMV A;  1J1E A;  4MRX A;  2JNF A;  2WND A;  1F4O A;  2K60 A;  3IF7 A;  3TS5 B;  4P2Y B;  2PRU A;  3DVJ A;  2BKH B;  1JF0 A;  1M46 A;  1MXL C;  1S5G Y;  2BKI B;  1RRO A;  1MQ1 A;  2BL0 B;  4OCI A;  1RFJ A;  1R6P A;  3CAB A;  1CMF A;  2QEB A;  1NUB A;  1ALW A;  1NX0 A;  1ZAC A;  1S6C A;  1Y6W A;  1B8L A;  3EVR A;  1GM0 A;  3WNX B;  2F33 A;  1J7R A;  4QJ5 B;  1EG4 A;  2ZND A;  4HRG A;  1N65 A;  1S5G Z;  2M49 B;  1XFZ O;  1QX5 B;  4USL A;  3OGN A;  1MWN A;  1NP8 A;  3L4A A;  4C0L A;  1ZFS A;  2HET A;  2I94 A;  2JU0 A;  4QJ3 B;  4WQ2 A;  3LCP C;  5HKZ A;  5JOL A;  3OX5 A;  2E6W A;  2KBM A;  1TTX A;  4FQO A;  4NDC A;  4BY4 A;  2COL B;  3L47 A;  3NSO A;  1C7V A;  2IS9 A;  3EG5 B;  3KO0 A;  1LXF C;  1IJ5 A;  1KQM B;  3OHM B;  4XJK A;  3VB1 A;  2I7A A;  2M7N A;  1F4Q A;  4YI8 A;  1H4B A;  1U5I B;  3H4S E;  3R1O A;  3NHT A;  2SCP A;  2H2K A;  3CR5 X;  1Z2C B;  3SG3 A;  5HYD A;  4JPZ B;  1QX2 A;  1Y1X A;  2Q91 A;  4I5J A;  1YRU B;  3PN7 B;  2KFG A;  1G8I A;  4FTG A;  1F8H A;  1CFD A;  1H8B A;  3TUY C;  3CR4 X;  2EC6 C;  4C0K A;  3CS1 A;  1K90 D;  1XYD A;  4GBA A;  3D10 A;  2BAP A;  2JRF A;  1UHN A;  2JTT A;  3VGO A;  1QWV A;  3LL8 B;  1SSE B;  1OZO A;  1CDP A;  2K7B A;  4PT1 A;  2H61 A;  3FWC A;  2JWW A;  4A4C A;  2FJY A;  2L51 A;  1C3Y A;  4KYN A;  1BF5 A;  2M3W A;  1CLB A;  1JFJ A;  1HQV A;  3PFV A;  2M1U A;  2JOJ A;  1NX2 A;  3OP0 A;  2LUX A;  4F7F A;  3QME A;  1M45 A;  2ZKM X;  3BUX B;  1IWQ A;  2M97 A;  1NPQ A;  1G33 A;  2GGZ A;  2KLE A;  2KQY A;  1BR4 B;  1KK8 C;  1IJ6 A;  1DJY A;  1M31 A;  3BXK A;  3CZ0 A;  3LK1 A;  3JVT B;  1GGW A;  2FCE A;  1W9Z A;  3OBV A;  4GGN A;  1JSA A;  1YR5 A;  4U8D A;  1K9P A;  2M7L A;  2B1U A;  4P5O E;  5CPV A;  1YVL A;  1ALV A;  4DRW A;  1QV1 A;  2HQ8 A;  1KK7 Z;  1J7Q A;  3QRX A;  4XYN A;  3A4U B;  4CFR A;  4DUQ A;  1JC2 A;  2YGU A;  3KHE A;  4YGD B;  1SK6 D;  1CFC A;  5HLO A;  3CTN A;  1A03 A;  2LLU A;  5CSI A;  1M63 B;  5AER A;  5HKY A;  4N5X A;  3RLZ A;  1YX8 A;  3EK4 A;  5D7F A;  3SIB A;  4HRE E;  4BY5 A;  3I5F B;  1QAT A;  2BEC A;  4YGB B;  3O4Y A;  2Y5I A;  2ERB A;  3BQ3 A;  1SCV A;  4M2O A;  4QJ4 B;  5GQQ C;  1QAS A;  3PM2 A;  3SS5 A;  1A75 A;  3I5G B;  5BPJ A;  2JT0 A;  1V1G A;  3ZWH A;  4XJK B;  1BR1 B;  1QLS A;  2MRD A;  3LLE A;  1D1O A;  3K1E A;  1DJZ A;  1AJ5 A;  1L2O C;  1Z4H A;  2WCM A;  3Q8I A;  1SCM C;  4ORC B;  2R2I A;  5FI7 A;  1QJT A;  1K95 A;  2DOQ A;  4HSZ A;  1N0Y A;  3VRR A;  1XFU O;  1ORG A;  5ER5 A;  3R1V A;  4DIR A;  2SAS A;  2E30 A;  2OTG B;  1CB1 A;  2ISD A;  4PHN A;  1DTL A;  3O2P A;  1KFX L;  1IGV A;  1C7W A;  2M9G A;  1OE9 B;  2LHI A;  3WXA A;  2FJU B;  2A4J A;  3O6B A;  2K7C A;  2LCP A;  1FW4 A;  3OX6 A;  1SL7 A;  2CT9 A;  2JXC A;  4JD9 A;  2PVB A;  5D69 A;  2KFF A;  1KFU L;  1LVC D;  2LLS A;  4PHJ A;  1TWO A;  1B8C A;  1V1F A;  2QEV A;  1AUI B;  3BFA A;  1DVI A;  1NCZ A;  1XK4 C;  2AUC A;  4HRH A;  2JUL A;  4JQ0 D;  1TOP A;  4OKH A;  2RGI A;  3S0G A;  1K93 D;  2MHH A;  1TUJ A;  2JC2 A;  3JTD B;  2KOT A;  3I5H B;  1LIN A;  3SS4 A;  2P6B B;  1DMO A;  3ICB A;  2WC8 A;  5DIC A;  1ZUZ A;  1B1G A;  1QLK A;  1IKU A;  3CZT X;  2KYC A;  3V2L A;  4AQI A;  4FQT A;  2BBN A;  2PAL A;  2KAV A;  5D3O A;  4PHM A;  1F70 A;  2HF5 A;  1KCY A;  4YGA A;  1PAL A;  4PCW A;  1LKJ A;  2CNP A;  2M0R A;  2P70 A;  1G4Y R;  3B86 A;  1QX7 A;  1WLZ A;  1UWO A;  1BG1 A;  1XFX O;  1AK8 A;  3OB2 B;  3WHU B;  1KQM C;  3I5I C;  4GGF C;  1UHK A;  1EJ3 A;  2FOT A;  1FI6 A;  5B8I B;  1S3P A;  2Q4U A;  1WY9 A;  2WCE A;  3AAJ A;  2KI6 C;  3BJH A;  1OQP A;  1OOH A;  2OS8 B;  3D78 A;  5EL2 A;  3AKA A;  2NZ0 A;  2OPO A;  1DJW A;  2KGB C;  2PQL A;  1PK0 D;  4CFQ A;  3BUW B;  1GGZ A;  3CLN A;  1QIW A;  2L5Y A;  2BNX A;  3WHT B;  1BOD A;  1S6I A;  1FPW A;  1S26 D;  3IQQ A;  1QTX A;  1B8R A;  3CDN A;  1J7P A;  1DJI A;  1CKK A; 
#chains in the Genus database with same CATH homology
 3DD4 A;  4NDB A;  1YTZ C;  4E68 A;  5I8N A;  3HX4 A;  4GNK B;  4ZCU A;  2LVV A;  4MBE A;  3DVE A;  1S6J A;  1XFY O;  2MLF C;  5I2L A;  3DF0 A;  4ETO A;  1CNP A;  2KI4 C;  5AXI A;  1S36 A;  2JPT A;  2LLT A;  2AAO A;  1MXE A;  2NXQ A;  1NCY A;  1TCF A;  2LVI A;  1CM4 A;  1R2U A;  2JT3 A;  4L9M A;  1UHI A;  3AKB A;  2KSP A;  3CGA A;  4MSP A;  1BOC A;  4YGC B;  3VRN A;  2O60 A;  3KF9 A;  1RK9 A;  4MZK A;  1A29 A;  5AFP A;  1CFF A;  1YUS A;  4YBH B;  1TN4 A;  1RWY A;  1XFW O;  1SPY A;  2ZN9 A;  2M29 A;  1QVI Y;  4PE1 A;  2EC6 B;  2L2E A;  2WOR A;  3NSK A;  1XFV O;  1PVA A;  3GK4 X;  1SR6 C;  1SBJ A;  2EGD A;  1AVS A;  1YRT B;  2KGR A;  1PVB A;  4YI9 A;  1SL9 A;  5CSJ A;  1FF1 A;  1DJG A;  1QVI Z;  1RTP 1;  1GJY A;  2LHL A;  3F45 A;  1J7O A;  3AAK A;  1EL4 A;  1CDL A;  1VRK A;  2LMT A;  2LP3 A;  2KAY A;  2LUC A;  1KWO C;  2PMY A;  1C07 A;  2CXJ A;  1TNW A;  2TN4 A;  1MF8 B;  2LV7 A;  1K94 A;  2QAC A;  2O5G A;  3EK8 A;  1CDM A;  4DCK A;  1DJX A;  2BCB A;  1MUX A;  4ORB B;  1WDC C;  5DKN A;  1DJH A;  1CTR A;  1SNL A;  1X02 A;  4GAO A;  2NCO A;  1NYA A;  1PSB A;  2Y1N A;  5KTY A;  4GPL B;  2LM5 A;  1UHJ A;  4OVN F;  1WRL A;  2OTG C;  1ZMZ A;  4GGF A;  1CDN A;  1RJV A;  2JXL A;  1OMD A;  2KYF A;  4AQJ A;  5DKQ A;  3HCM A;  4YGE B;  1JBA A;  1U5I A;  2MBX A;  2I2R E;  3BOW A;  1CLL A;  1W7I B;  2K61 A;  4PHK A;  1AJ4 A;  1DGV A;  3FS7 A;  1TCO B;  1OMR A;  4PE7 A;  2AMI A;  2K8M B;  4MRY A;  2ZFD A;  5KU1 A;  5TNC A;  4N1F A;  2LAP A;  1BJF A;  3SG5 A;  2CCM A;  2LMU A;  3TS5 C;  1L7Z A;  1WLM A;  1ZOT B;  3VRP A;  1CMG A;  1BU3 A;  3EK7 A;  2BL0 C;  3D0Y A;  2K2A A;  2KQ6 A;  1A4P A;  3JTD C;  1SCM B;  1S1E A;  1TNP A;  2HQW A;  4MVF A;  1GQM A;  1QXP A;  4C0J A;  2MA2 A;  1EG3 A;  2BCA A;  4OR9 B;  4M2Q A;  3EVU A;  2K7D A;  2LMV A;  2V53 A;  1J1D A;  2LNK A;  1TNX A;  1Y0V H;  4I5L B;  1OOJ A;  1YUU A;  2CBL A;  5J3X A;  4WQ3 A;  1F55 A;  4MZJ A;  1SRA A;  2WCB A;  3GK2 A;  4R1E A;  1IRJ A;  2JZI A;  3PLF B;  3VRQ A;  3BUN B;  3SG4 A;  3PAT A;  2NLN A;  4YRU A;  2F2P A;  1BT6 A;  4CPV A;  1NIW A;  1CM1 A;  2L4I A;  3CWG A;  2OS8 C;  3GOF A;  5AEQ A;  1QV0 A;  2GV5 A;  1AP4 A;  1K96 A;  4MN0 A;  1A2X A;  4D1E A;  1OSA A;  2Y4Q A;  1MHO A;  1JF2 A;  1XA5 A;  3VRO A;  1FI5 A;  1B9A A;  3SIA A;  2WOS A;  3PN7 C;  2D8N A;  3KEV A;  1QIV A;  1N2D A;  1YX7 A;  2I18 A;  2LVK A;  4ORA B;  1A75 B;  4WRI A;  1TIZ A;  2F8P A;  2L5X B;  1MR8 A;  2F3Z A;  1WRK A;  3KPX A;  4ZCV A;  2PAS A;  3EKH A;  1UUS A;  1WRZ A;  2EHB A;  3EVV A;  4M2P A;  3TDU A;  3I5I B;  4MLW A;  2M8U A;  1SYM A;  4OV2 A;  3FIA A;  2BE4 A;  3TDZ A;  4PDZ A;  1B4C A;  1EH2 A;  2JNX A;  2CTN A;  2L0P A;  3MSE B;  1DT7 B;  1Y1U A;  3BOW B;  3SG2 A;  1F71 A;  1SW8 A;  4F0Z B;  1K8U A;  2Y1M A;  3CR2 A;  3PAL A;  1DF0 A;  1UHH A;  2L50 A;  3A8R A;  1QS7 A;  1REC A;  1KQV A;  1EXR A;  3M0W A;  2LE9 B;  4Q04 A;  1K9K A;  4CID A;  1FBV A;  4GUK A;  2BBM A;  4MZL A;  2QPT A;  1IQ5 A;  1M39 A;  3BUM B;  1K2H A;  4JWQ A;  3JVT C;  1JUO A;  5KSZ A;  3NSL A;  1AHR A;  1SY9 A;  1IQ3 A;  1SL8 A;  3D0Y B;  1LA0 A;  2WCF A;  2ZNE A;  3TUY B;  1F54 A;  1KSO A;  3FWB A;  2MAZ A;  2LVJ A;  2K0J A;  2K7O A;  3E3R A;  5CSF A;  3SG7 A;  2KI4 B;  2KI6 D;  4TNC A;  1K9U A;  1UP5 A;  2ZRT A;  3IQO A;  3NXA A;  1E8A A;  2NCP A;  1J55 A;  4PE4 A;  1XK4 A;  5G08 A;  1JFK A;  5JJG A;  3BUO B;  3EKJ A;  1NSH A;  2F3Y A;  3I5F C;  1TNQ A;  4A4B A;  2JT8 A;  3LK0 A;  5HKW A;  1PSR A;  1KK7 Y;  3PSR A;  2KBI A;  1YVH A;  1NX1 A;  4ICB A;  1PRW A;  2ZRS A;  3O78 A;  1OZS A;  3I5G C;  2JQ6 A;  3TDI A;  1KK8 B;  2LAN A;  1KFX S;  3DVK A;  5DKR A;  5FYX A;  1CLM A;  3DVM A;  1YUR A;  1SR6 B;  2L4H A;  2LP2 A;  3TZ1 A;  2KNE A;  3PM8 A;  4I5N B;  1NCX A;  4N1G A;  4PE0 A;  5HLV A;  3BYA A;  4MEW A;  2MJW B;  1NX3 A;  2MLE C;  3C1V A;  1KFU S;  1CFP A;  2VRG A;  4GFT A;  5AAN A;  1B7T Y;  2G2B A;  2KDH A;  1Q80 A;  4I5K A;  1UUR A;  5I2O A;  2M1K B;  1LA3 A;  4NQG A;  1YUT A;  3SG6 A;  3GK1 A;  1KWO B;  1IG5 A;  5IBW A;  2GGM A;  5I2Q A;  2HPS A;  4AOM A;  1W7J B;  2FCD A;  2PSR A;  2KHN A;  1B7T Z;  1WDC B;  1SMG A;  5F6T A;  3K21 A;  1BLQ A;  1B47 A;  3OB1 B;  3SJS A;  3RM1 A;  1XO5 A;  2H61 C;  3DF0 B;  1XVJ A;  1PUL A;  1BMO A;  5CSN A;  1L2O B;  2G9B A;  2BE6 A;  1HT9 A;  3I5H C;  4NDD A;  5ER4 X;  1DF0 B;  5PAL A;  2KAX A;  1IH0 A;  1KSM A;  2LC5 A;  2ZN8 A;  2L98 A;  3NSI A;  1NWD A;  1ODB A;  2KFH A;  4UPG A;  1Y1A A;  4DS7 A;  3ZNI A;  4CLN A;  4PAL A;  2JTZ A;  1TRF A;  5K89 A;  4IL1 A;  2K2F A;  1SKT A;  2F2O A;  1JWD A;  1DGU A;  2BCX A;  1OMV A;  1J1E A;  4MRX A;  2JNF A;  2WND A;  1F4O A;  3IF7 A;  3TS5 B;  4P2Y B;  2PRU A;  3DVJ A;  2BKH B;  1JF0 A;  1M46 A;  1MXL C;  1S5G Y;  2BL0 B;  1RRO A;  1MQ1 A;  2BKI B;  4OCI A;  1RFJ A;  1R6P A;  1CMF A;  1NUB A;  1ALW A;  1NX0 A;  1ZAC A;  1S6C A;  1Y6W A;  1B8L A;  3EVR A;  3WNX B;  2F33 A;  1J7R A;  1EG4 A;  2ZND A;  4HRG A;  1N65 A;  1S5G Z;  2M49 B;  1XFZ O;  1QX5 B;  4USL A;  1MWN A;  1NP8 A;  4C0L A;  1ZFS A;  2HET A;  2I94 A;  2JU0 A;  4QJ3 B;  4WQ2 A;  3LCP C;  5HKZ A;  5JOL A;  3OX5 A;  2E6W A;  2KBM A;  1TTX A;  4FQO A;  4NDC A;  4BY4 A;  2COL B;  3NSO A;  1C7V A;  2IS9 A;  3KO0 A;  1LXF C;  1IJ5 A;  1KQM B;  3OHM B;  4XJK A;  2I7A A;  2M7N A;  1F4Q A;  4YI8 A;  1H4B A;  1U5I B;  3H4S E;  2SCP A;  2H2K A;  3CR5 X;  3SG3 A;  5HYD A;  4JPZ B;  1QX2 A;  1Y1X A;  2Q91 A;  4I5J A;  1YRU B;  3PN7 B;  2KFG A;  1G8I A;  4FTG A;  1F8H A;  1CFD A;  1H8B A;  3TUY C;  3CR4 X;  2EC6 C;  4C0K A;  3CS1 A;  1K90 D;  1XYD A;  4GBA A;  3D10 A;  2JRF A;  1UHN A;  2JTT A;  3VGO A;  3LL8 B;  1OZO A;  1CDP A;  2K7B A;  2H61 A;  3FWC A;  2JWW A;  4A4C A;  2L51 A;  1BF5 A;  2M3W A;  1CLB A;  1JFJ A;  1HQV A;  3PFV A;  2M1U A;  2JOJ A;  1NX2 A;  3OP0 A;  2LUX A;  1M45 A;  2ZKM X;  3BUX B;  1IWQ A;  2M97 A;  1NPQ A;  1G33 A;  2GGZ A;  2KQY A;  3LK1 A;  1BR4 B;  1KK8 C;  1IJ6 A;  1DJY A;  1M31 A;  3BXK A;  3JVT B;  1GGW A;  2FCE A;  4GGN A;  1JSA A;  1YR5 A;  4U8D A;  1K9P A;  2M7L A;  2B1U A;  4P5O E;  5CPV A;  1YVL A;  1ALV A;  4DRW A;  1QV1 A;  2HQ8 A;  1KK7 Z;  1J7Q A;  3QRX A;  4XYN A;  3A4U B;  4CFR A;  4DUQ A;  1JC2 A;  4YGD B;  3KHE A;  1CFC A;  1SK6 D;  5HLO A;  3CTN A;  1A03 A;  2LLU A;  5CSI A;  1M63 B;  5AER A;  5HKY A;  4N5X A;  3RLZ A;  1YX8 A;  3EK4 A;  5D7F A;  3SIB A;  4HRE E;  4BY5 A;  3I5F B;  1QAT A;  2BEC A;  4YGB B;  3O4Y A;  2Y5I A;  4M2O A;  3BQ3 A;  1SCV A;  4QJ4 B;  5GQQ C;  1QAS A;  1A75 A;  3I5G B;  5BPJ A;  2JT0 A;  1V1G A;  3ZWH A;  4XJK B;  1BR1 B;  1QLS A;  2MRD A;  3LLE A;  1D1O A;  1DJZ A;  1AJ5 A;  1L2O C;  4QJ5 B;  1SCM C;  4ORC B;  2R2I A;  1QJT A;  1K95 A;  2DOQ A;  4HSZ A;  1N0Y A;  3VRR A;  1XFU O;  5ER5 A;  4DIR A;  2SAS A;  2E30 A;  2OTG B;  1CB1 A;  2ISD A;  4PHN A;  1DTL A;  3O2P A;  1KFX L;  1IGV A;  1C7W A;  2M9G A;  1OE9 B;  2LHI A;  3WXA A;  2FJU B;  2A4J A;  3O6B A;  2K7C A;  2LCP A;  1FW4 A;  3OX6 A;  1SL7 A;  2CT9 A;  2JXC A;  2PVB A;  5D69 A;  2KFF A;  1KFU L;  1LVC D;  2LLS A;  4PHJ A;  1B8C A;  1V1F A;  4HRH A;  1AUI B;  1DVI A;  1NCZ A;  1XK4 C;  2AUC A;  4JQ0 D;  2JUL A;  4OKH A;  1TOP A;  2RGI A;  1K93 D;  2MHH A;  2JC2 A;  3JTD B;  2KOT A;  3I5H B;  1LIN A;  2P6B B;  1DMO A;  3ICB A;  2WC8 A;  1ZUZ A;  1B1G A;  1QLK A;  1IKU A;  3CZT X;  2KYC A;  4AQI A;  2BBN A;  2PAL A;  2KAV A;  4PHM A;  1F70 A;  2HF5 A;  1KCY A;  4YGA A;  1PAL A;  4PCW A;  1LKJ A;  2CNP A;  2M0R A;  1G4Y R;  1QX7 A;  1WLZ A;  1UWO A;  1BG1 A;  1XFX O;  1AK8 A;  3OB2 B;  3WHU B;  1KQM C;  3I5I C;  4GGF C;  1UHK A;  1EJ3 A;  2FOT A;  1FI6 A;  5B8I B;  1S3P A;  2Q4U A;  1WY9 A;  2WCE A;  3AAJ A;  2KI6 C;  1OQP A;  2OS8 B;  3AKA A;  2NZ0 A;  2OPO A;  1DJW A;  2KGB C;  1PK0 D;  4CFQ A;  3BUW B;  1GGZ A;  3CLN A;  1QIW A;  3WHT B;  1BOD A;  1S6I A;  1FPW A;  1S26 D;  3IQQ A;  1QTX A;  1B8R A;  1J7P A;  1DJI A;  1CKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...