1K8UA

Crystal structure of calcium-free (or apo) human s100a6; cys3met mutant (selenomethionine derivative)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
b'AMPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k8uA00
1LA0A 1S5GY 1WY9A 1ZACA 1BODA 4P2YB 3PFVA 1BG1A 1SCMC 3I5HC 1WLMA 2JXCA 3O2PA 1DF0B 1FBVA 1EL4A 4GGFC 3OP0A 5I2OA 1KCYA 2MHHA 3A4UB 3MSEB 1K2HA 2KGRA 1J55A 3KF9A 2LVIA 1IGVA 2JPTA 3EVVA 3AKAA 1BJFA 2H2KA 1JF2A 1CLMA 2E6WA 4ORCB 1U5IB 2GGZA 1K95A 1XFUO 2D8NA 1BMOA 1XK4C 3BYAA 4BY5A 1HT9A 3CR5X 4QJ4B 2KQYA 4TNCA 1QTXA 3DVEA 1G4YR 2KSPA 1TNXA 2K0JA 2JULA 2WCFA 2I18A 1SRAA 2G9BA 3I5IC 1J1EA 1UUSA 3O6BA 1F4OA 1DTLA 3LLEA 4MEWA 2COLB 1JFKA 1DJZA 1NIWA 2JWWA 1OSAA 1QIWA 3IF7A 2M1UA 5G08A 2TN4A 5BPJA 1QV0A 3TDZA 1DT7B 1RWYA 1MXEA 2KI4C 1YX8A 2M97A 1YUUA 3KHEA 4NDBA 2JTZA 4OVNF 3BOWA 5KU1A 3K21A 4GPLB 1LVCD 3VRQA 1JWDA 1GJYA 3D0YA 4PE4A 1QX2A 2AUCA 3DVJA 4YRUA 4OV2A 1K9PA 1A2XA 2KI6D 5JOLA 4MLWA 2O5GA 4PHKA 1ODBA 1GGZA 5KTYA 3SG3A 1V1GA 1SKTA 2NZ0A 2OS8C 1BR1B 2AMIA 1NUBA 5HLVA 2JRFA 1XO5A 3NXAA 1XFVO 1Y1UA 3BQ3A 2WORA 1KFUL 1LXFC 1CM4A 2BBMA 2F2OA 1EG4A 2WOSA 2F3YA 2KYFA 2M8UA 1KWOC 2Q4UA 2KNEA 1B7TY 1B8LA 3NSOA 5F6TA 3TDIA 1JF0A 5DKRA 1AVSA 1XFZO 4GGFA 1IKUA 2M3WA 1KQVA 5HKWA 5AFPA 1A75A 1S36A 2G2BA 1MHOA 2OTGC 1OMVA 1K9KA 1WDCB 1Y6WA 3CR4X 3LK0A 3EVRA 5CSIA 1D1OA 2B1UA 1K96A 2L2EA 5FYXA 4QJ5B 2KAYA 1IRJA 1K93D 3JVTC 2K61A 3VRNA 1H4BA 1J7OA 4DS7A 1WLZA 1OQPA 3F45A 2M49B 1N0YA 1XK4A 1PSBA 3DVKA 4BY4A 1DJGA 1GQMA 1SL7A 1SY9A 1K8UA 4OKHA 2JT8A 2F3ZA 3H4SE 1QS7A 2LVKA 2M0RA 2BE6A 1CMFA 2CTNA 2Y1MA 1XVJA 3GK2A 1NYAA 1W7IB 1XA5A 4JWQA 2ZRSA 3HCMA 2F8PA 4I5NB 2LM5A 1IQ5A 2JNXA 2KYCA 3DF0B 3EK4A 5I8NA 5DKNA 3I5FB 2MJWB 2KDHA 3WHUB 4ZCVA 1OZSA 5JJGA 1V1FA 2EC6C 1SR6C 3ZWHA 5ER5A 1CFCA 4ORAB 2F2PA 1EJ3A 1FF1A 3IQOA 4GUKA 3TUYB 1SMGA 1CM1A 5KSZA 1AUIB 1QVIY 2BCBA 1K9UA 3WNXB 2JNFA 1YX7A 5CSJA 1QXPA 2JT3A 2PMYA 1AHRA 1KK8C 3GK1A 3NSLA 2LLTA 2LV7A 1N2DA 4HSZA 1JUOA 1F70A 4JQ0D 1BT6A 1B47A 1ZUZA 5D7FA 1F55A 2NXQA 1KK7Z 2LLSA 4JPZB 2PSRA 1CDLA 3FWBA 1KSMA 2CCMA 1PRWA 1LINA 1QX7A 2BE4A 2FJUB 3CZTX 1DGVA 3I5GB 2LHLA 4WQ2A 2LUXA 5AERA 1M45A 2ZN9A 3OX6A 3TDUA 1QX5B 3PALA 1QIVA 3GK4X 4PHMA 1CFPA 4GAOA 1JFJA 3AAJA 4PE0A 4YGAA 2LVVA 3A8RA 1XFWO 3OB1B 2H61C 3TS5B 1SL9A 2PVBA 4PDZA 1AP4A 1UP5A 3BOWB 1F8HA 4QJ3B 4PALA 3TZ1A 3PM8A 1IWQA 2KGBC 1CTRA 1S6JA 1W7JB 3E3RA 3FIAA 3WXAA 1DJWA 1YVLA 3D0YB 3SG2A 2EHBA 2KFFA 1KQMB 1K90D 1RROA 3CGAA 1J7PA 1RK9A 1WDCC 1Y0VH 2LVJA 1UHKA 1B9AA 3KO0A 1M31A 2BL0C 1UHNA 3ICBA 4CLNA 4HREE 1BOCA 1M46A 1UHIA 1CMGA 3BXKA 2ZNEA 3OB2B 4M2PA 1SPYA 1PVBA 1EG3A 5CSNA 2FCDA 4A4CA 1BLQA 4USLA 1G33A 2NLNA 1ZFSA 3PN7C 4DIRA 1R6PA 1L2OB 5HKYA 2BCXA 2K7BA 1CFFA 1TOPA 1CB1A 1F54A 1F71A 2I2RE 2LP2A 1QATA 5PALA 3IQQA 2L50A 3FWCA 1QJTA 4M2QA 1N65A 1B8RA 2AAOA 2PASA 1SCMB 1DJYA 2LLUA 3I5HB 2LCPA 1DJHA 3VGOA 1E8AA 2HQ8A 2NCPA 1UWOA 2P6BB 2ISDA 4NQGA 2BKHB 2CT9A 2JT0A 1IQ3A 5D69A 1ZOTB 1FPWA 3JTDC 1RECA 2M29A 2L5XB 2SCPA 1F4QA 3C1VA 4CFQA 2GV5A 4PHJA 4FQOA 5GQQC 1MWNA 2WCEA 4YGCB 4MZKA 1TNQA 4ETOA 1TN4A 2Q91A 2NCOA 2LANA 1NCXA 4ZCUA 4E68A 3VRPA 1B4CA 4WRIA 1YRTB 1CLLA 1EXRA 5HLOA 1TIZA 2K7OA 3EK7A 3SG7A 4MVFA 3LK1A 3LCPC 1YUTA 1Y1AA 5HYDA 3I5IB 1MF8B 1PK0D 1TRFA 2MAZA 2WNDA 1JC2A 1XFXO 2KOTA 1S26D 3QRXA 2JU0A 4MN0A 3PSRA 4AQJA 1NX1A 1BR4B 2FCEA 3PLFB 1H8BA 1MXLC 2V53A 2HETA 2M7NA 1NSHA 1KFXS 1NPQA 2H61A 1MUXA 5K89A 1JBAA 5HKZA 2MLEC 2JOJA 3FS7A 2LUCA 4AOMA 4YBHB 1LA3A 3SG5A 4MRYA 1S5GZ 2ZN8A 4R1EA 2KAXA 1YVHA 3RM1A 3GOFA 1ALVA 2MA2A 1WRZA 2LC5A 2CXJA 2K7CA 1RTP1 1QLKA 3O78A 3SIBA 1MQ1A 2SASA 1G8IA 5B8IB 2JTTA 2VRGA 4NDDA 1NX0A 3VRRA 1TNWA 1ZMZA 2OS8B 4YGDB 1XYDA 4AQIA 1DJXA 3EKHA 1B1GA 2L98A 2LNKA 4FTGA 2LHIA 1CDNA 3BUOB 4N1FA 5TNCA 4MSPA 3VROA 2KI6C 2F33A 5CPVA 2PALA 1FW4A 1K94A 4MBEA 1M63B 4ORBB 2KQ6A 4NDCA 1PULA 3CR2A 1BU3A 1DGUA 1KWOB 1SW8A 3NSIA 3SG6A 4N5XA 5IBWA 3CTNA 4XJKA 1CKKA 2ZKMX 2IS9A 2O60A 1NWDA 2CBLA 2K2FA 3CWGA 5AANA 1S3PA 3AAKA 1VRKA 2OTGB 1QASA 3KEVA 4C0JA 2KHNA 4C0LA 1IJ6A 4OCIA 2OPOA 3JVTB 2L4HA 4GFTA 1DF0A 1AJ4A 1TCOB 3BUMB 2L0PA 3M0WA 4OR9B 5AEQA 1YUSA 2M7LA 1SL8A 1IH0A 1EH2A 5J3XA 4Q04A 2BCAA 4L9MA 3BUNB 4MZJA 1WRKA 1R2UA 2K2AA 4WQ3A 1DVIA 2L4IA 1U5IA 2HQWA 1KK7Y 2JC2A 2LE9B 2M1KB 1X02A 1OOJA 2R2IA 1NX3A 2L51A 1SK6D 2QACA 1FI5A 2EC6B 1SR6B 1UHHA 1WRLA 4HRGA 3EVUA 4IL1A 1A03A 1LKJA 1SCVA 2KFGA 1HQVA 1PVAA 1SNLA 2RGIA 1Q80A 3BUWB 3DVMA 1B7TZ 3EK8A 1NX2A 2JZIA 3SG4A 1GGWA 4YGEB 4PE1A 2I94A 3I5FC 4P5OE 1AJ5A 1DJIA 1S1EA 2Y4QA 2ZFDA 2WCBA 4PHNA 1KK8B 2QPTA 2HPSA 1NCZA 1S6CA 1XFYO 1IJ5A 3TUYC 4U8DA 1OMRA 5ER4X 2FOTA 5DKQA 2DOQA 2I7AA 1CFDA 1A75B 4XYNA 1MR8A 1QLSA 1IG5A 1QV1A 1S6IA 4A4BA 1YTZC 3LL8B 4DUQA 2PRUA 4DCKA 2M9GA 2KFHA 4I5KA 4C0KA 2BKIB 2LAPA 2E30A 1A29A 2EGDA 1CDMA 4MRXA 4DRWA 1CNPA 1PALA 1PSRA 2ZNDA 2JQ6A 2LMUA 3PATA 5AXIA 4CFRA 4CPVA 1Y1XA 1M39A 1DMOA 2K8MB 3OHMB 1J7QA 2CNPA 3RLZA 2HF5A 3SIAA 1TCFA 1KFXL 1KFUS 3D10A 3O4YA 1CDPA 4F0ZB 3I5GC 3ZNIA 3OX5A 1C7WA 4M2OA 1QVIZ 2KAVA 2KI4B 3KPXA 4PE7A 1SBJA 2KBMA 2Y1NA 4HRHA 2JXLA 3BUXB 1YRUB 1L7ZA 2LP3A 3TS5C 1TTXA 2BL0B 3AKBA 2WC8A 1BF5A 1UURA 1TNPA 4D1EA 1FI6A 1A4PA 3DD4A 4YI9A 1OE9B 3CLNA 4UPGA 3WHTB 1AK8A 1ALWA 1OZOA 4GGNA 2BECA 4PCWA 3CS1A 1KQMC 1NCYA 1YR5A 2A4JA 2MBXA 1UHJA 4CIDA 3PN7B 5I2QA 2ZRTA 1B8CA 1KSOA 1C7VA 3HX4A 4GBAA 1NP8A 2BBNA 1RJVA 2K7DA 1C07A 4YI8A 3SJSA 2GGMA 4N1GA 1OMDA 4XJKB 1J7RA 2KBIA 4YGBB 1JSAA 2MLFC 5I2LA 2LMVA 3DF0A 4ICBA 3NSKA 4MZLA 1RFJA 2Y5IA 1L2OC 1J1DA 1YURA 2MRDA 5CSFA 3JTDB 3EKJA 4GNKB 4I5LB 1SYMA 2LMTA 1CLBA 4I5JA
chains in the Genus database with same CATH superfamily
1LA0A 1S5GY 1WY9A 1ZACA 1BODA 4P2YB 3PFVA 4INWA 1BG1A 1SCMC 3I5HC 1WLMA 2JXCA 3O2PA 1DF0B 5I94A 1FBVA 1EL4A 4GGFC 3OP0A 4KYNA 5I2OA 1KCYA 2MHHA 3A4UB 3MSEB 1K2HA 2KGRA 1J55A 3KF9A 2LVIA 1IGVA 2WCHA 2JPTA 3B7AA 3EVVA 3AKAA 1BJFA 2H2KA 1JF2A 1CLMA 2E6WA 4ORCB 1U5IB 2GGZA 1K95A 1XFUO 2D8NA 1BMOA 1XK4C 3BYAA 4BY5A 1HT9A 3CR5X 4QJ4B 2KQYA 4TNCA 3NHIA 4FQTA 1QTXA 3DVEA 1G4YR 5FI7A 2KSPA 1P28A 1TNXA 2JULA 2K0JA 2I18A 2WCFA 1SRAA 2G9BA 3I5IC 3D73A 1J1EA 1UUSA 3O6BA 1F4OA 1DTLA 3R1PA 5FI2A 3LLEA 4MEWA 2COLB 1JFKA 4E68A 1DJZA 1NIWA 2JWWA 1OSAA 1QIWA 3IF7A 2M1UA 5G08A 2TN4A 5BPJA 1QV0A 3TDZA 3L4AA 1DT7B 1RWYA 1MXEA 2ERBA 2KI4C 1YX8A 2M97A 1YUUA 3KHEA 4NDBA 2JTZA 4OVNF 1DQEA 3BOWA 3OGNA 5KU1A 2BNXA 3K21A 4GPLB 1LVCD 3VRQA 1JWDA 1GJYA 3D0YA 4PE4A 3BFHA 1QX2A 2AUCA 3DVJA 4YRUA 4OV2A 1K9PA 1A2XA 2KI6D 4F7FA 5JOLA 4MLWA 2O5GA 3VB1A 3B88A 4PHKA 1ODBA 1GGZA 5KTYA 1DELA 2P70A 3SG3A 2P71A 3NGVA 1V1GA 1SKTA 2H8VA 2NZ0A 1BR1B 2OS8C 2AMIA 1NUBA 5HLVA 2JRFA 2WCKA 1XO5A 3NXAA 1XFVO 1Y1UA 3BQ3A 2WORA 3DZTA 1KFUL 1LXFC 1CM4A 2BBMA 2F2OA 1EG4A 2WOSA 3CZ1A 2F3YA 2KYFA 2M8UA 1KWOC 3R72A 3V2LA 2Q4UA 2KNEA 1B7TY 1B8LA 3NSOA 5F6TA 3TDIA 1JF0A 3FE8A 5DKRA 1AVSA 1XFZO 4GGFA 1IKUA 2M3WA 1KQVA 3OBVA 5HKWA 5AFPA 1A75A 1S36A 2G2BA 1MHOA 2OTGC 1OMVA 1K9KA 1WDCB 1Y6WA 3CR4X 3LK0A 3S0BA 3EVRA 5CSIA 1D1OA 2B1UA 1K96A 2L2EA 5FYXA 4QJ5B 2KAYA 1IRJA 1K93D 3JVTC 2K61A 3VRNA 1H4BA 1J7OA 4DS7A 1WLZA 1OQPA 3F45A 2M49B 1N0YA 1XK4A 1PSBA 3DVKA 4BY4A 1DJGA 1GQMA 1SL7A 1SY9A 1K8UA 4OKHA 2JT8A 2FJYA 2F3ZA 3H4SE 1QS7A 2LVKA 2M0RA 2BE6A 1CMFA 2CTNA 2Y1MA 1XVJA 3GK2A 1NYAA 1W7IB 1XA5A 4JWQA 2ZRSA 3HCMA 2F8PA 1C3ZA 4I5NB 2LM5A 1XFRA 1IQ5A 2JNXA 2KYCA 3DF0B 3L4LA 3EK4A 5I8NA 5DKNA 3I5FB 4JKTA 2MJWB 2KDHA 3WHUB 4ZCVA 1OZSA 1OOIX 5JJGA 1OOGA 1V1FA 2EC6C 1SR6C 2PYQA 5ER5A 3ZWHA 4ORAB 2F2PA 1EJ3A 1CFCA 1FF1A 3IQOA 4GUKA 3TUYB 1SMGA 1CM1A 5KSZA 1AUIB 1QVIY 2BCBA 1K9UA 3WNXB 2JNFA 1YX7A 5CSJA 3B87A 1QXPA 2JT3A 2QDIA 2PMYA 3SS4A 1AHRA 1KK8C 3GK1A 3NSLA 2LLTA 1Z2CB 2LV7A 1N2DA 4HSZA 1JUOA 1F70A 4JQ0D 1BT6A 1B47A 1ZUZA 4I5JA 5D7FA 1F55A 2NXQA 1KK7Z 2LLSA 4JPZB 4OZDA 2PSRA 1CDLA 3FWBA 1KSMA 2CCMA 1PRWA 1LINA 1QX7A 2BE4A 2FJUB 3CZTX 3FE6A 1DGVA 3I5GB 2LHLA 4WQ2A 2LUXA 5AERA 1M45A 2ZN9A 3OX6A 3SS3A 1QX5B 3PALA 3TDUA 1QIVA 3GK4X 4PHMA 1CFPA 4GAOA 1JFJA 3AAJA 4PE0A 4YGAA 2JPOA 2LVVA 3A8RA 1XFWO 3OB1B 2H61C 3TS5B 1IIOA 1SL9A 2PVBA 2WC6A 2YGUA 4PDZA 1AP4A 1UP5A 3BOWB 1F8HA 4QJ3B 4PALA 3TZ1A 3PM8A 1IWQA 2KGBC 1CTRA 1S6JA 1W7JB 3E3RA 3FIAA 3WXAA 1DJWA 1YVLA 2KPHA 3BJHA 3D0YB 3SG2A 2EHBA 2KFFA 2BAPA 1KQMB 1K90D 1RROA 3S0AA 3CGAA 1J7PA 1RK9A 1WDCC 1Y0VH 2LVJA 1UHKA 1B9AA 1SSEB 3KO0A 1M31A 2BL0C 1UHNA 3ICBA 4CLNA 4HREE 1BOCA 1M46A 1UHIA 3D78A 3BXKA 1CMGA 2ZNEA 3OB2B 4M2PA 1SPYA 1PVBA 1EG3A 5CSNA 3K1EA 2FCDA 4A4CA 1BLQA 4USLA 1G33A 2NLNA 1ZFSA 3PN7C 4DIRA 1R6PA 1L2OB 2K60A 2BCXA 2K7BA 5HKYA 1TOPA 1CFFA 1CB1A 1F54A 1F71A 2I2RE 2LP2A 1QATA 1QWVA 5PALA 1OOHA 3IQQA 2L50A 3FWCA 1DC1A 1QJTA 4M2QA 1N65A 1B8RA 2AAOA 2PASA 1SCMB 1DJYA 2LLUA 3I5HB 5HL1A 2LCPA 1DJHA 3VGOA 1E8AA 2HQ8A 2NCPA 1UWOA 2P6BB 2ISDA 4NQGA 2BKHB 2CT9A 2JT0A 1IQ3A 5D69A 1LS8A 1TUZA 1ZOTB 1FPWA 3JTDC 1RECA 3DY9A 2M29A 2L5XB 2SCPA 1F4QA 3C1VA 4CFQA 2GV5A 4PHJA 2WCMA 4FQOA 5GQQC 1MWNA 2WCEA 4YGCB 4JD9A 1TNQA 4MZKA 1TN4A 2Q91A 2NCOA 2LANA 1NCXA 4ZCUA 4ETOA 3VRPA 1B4CA 3R1OA 4WRIA 1YRTB 2QEOA 3R1VA 1CLLA 1EXRA 5HLOA 1TIZA 2K7OA 3DXLA 3EK7A 3S0GA 4MVFA 3SG7A 3LK1A 3LCPC 1YUTA 1Y1AA 5HYDA 3I5IB 1MF8B 1PK0D 1TRFA 2MAZA 2WNDA 3CZ2A 1JC2A 1XFXO 2KOTA 1S26D 3QRXA 2JU0A 3RZSA 4MN0A 3PSRA 4AQJA 1NX1A 1BR4B 2FCEA 3PLFB 1H8BA 1MXLC 2V53A 2HETA 2M7NA 1NSHA 1KFXS 2PQLA 1NPQA 2H61A 1MUXA 5K89A 1JBAA 5HKZA 2MLEC 2JOJA 3FS7A 2LUCA 4AOMA 4YBHB 1LA3A 3BFAA 3SG5A 3CABA 5FI6A 4MRYA 1S5GZ 2ZN8A 2QEBA 4R1EA 2KAXA 1YVHA 3RM1A 3GOFA 1C3YA 1DEKA 1ALVA 2MA2A 1WRZA 2LC5A 2CXJA 2K7CA 1RTP1 1QLKA 3UNWA 2L2CA 3O78A 1OW4A 3SIBA 1MQ1A 3D76A 2QEHA 2SASA 2WCJA 1G8IA 5B8IB 2JTTA 2VRGA 2WCLA 4NDDA 1NX0A 3VRRA 1TNWA 3SS5A 1ZMZA 2OS8B 4YGDB 1XYDA 4AQIA 1DJXA 3EKHA 3QMEA 1B1GA 2L98A 2LNKA 4FTGA 2LHIA 1CDNA 3BUOB 4N1FA 5TNCA 4MSPA 3VROA 2KI6C 2F33A 5CPVA 2PALA 1FW4A 1K94A 5EL2A 4MBEA 1M63B 3FE9A 4ORBB 2KQ6A 4NDCA 1PULA 3CR2A 1BU3A 1DGUA 1KWOB 1SW8A 3NSIA 3SG6A 4N5XA 5IBWA 3CTNA 4XJKA 1CKKA 2ZKMX 2IS9A 2O60A 5DICA 1NWDA 2CBLA 2K2FA 3CWGA 5AANA 1S3PA 3AAKA 1VRKA 2OTGB 1QASA 3KEVA 2KLEA 4C0JA 2KHNA 3N7HA 4C0LA 1IJ6A 4OCIA 2OPOA 3JVTB 2L4HA 3EG5B 3Q8IA 4GFTA 1DF0A 1AJ4A 1TCOB 3BUMB 2L0PA 3M0WA 4OR9B 5AEQA 1YUSA 2M7LA 1SL8A 1IH0A 1EH2A 5J3XA 3L47A 2BCAA 4Q04A 4L9MA 3BUNB 4MZJA 1WRKA 1R2UA 2K2AA 3BFBA 4WQ3A 1DVIA 2L4IA 1U5IA 2HQWA 1KK7Y 2JC2A 2LE9B 2M1KB 1X02A 1OOJA 2R2IA 1NX3A 2L51A 1SK6D 2QACA 3IVTA 1FI5A 2EC6B 1SR6B 1UHHA 3S0DA 1WRLA 4HRGA 3EVUA 4IL1A 1A03A 1LKJA 1SCVA 2KFGA 1TUJA 1HQVA 1PVAA 1SNLA 2RGIA 3D77A 1Q80A 3BUWB 3DVMA 1B7TZ 3PM2A 3EK8A 1NX2A 2JZIA 3CDNA 3SG4A 3S0FA 1GGWA 4YGEB 4PE1A 2I94A 3I5FC 4P5OE 1AJ5A 1DJIA 1S1EA 2Y4QA 2ZFDA 2WCBA 4PHNA 1KK8B 3O4XA 2QPTA 3S0EA 3CZ0A 2HPSA 1NCZA 1S6CA 1XFYO 1IJ5A 3TUYC 4U8DA 1OMRA 5ER4X 2FOTA 5DKQA 2DOQA 2I7AA 1CFDA 1A75B 1Z4HA 4XYNA 1MR8A 1QLSA 1IG5A 1QV1A 1S6IA 4INXA 4A4BA 1YTZC 3LL8B 4DUQA 2PRUA 4DCKA 2M9GA 2KFHA 4I5KA 4C0KA 2BKIB 2LAPA 2E30A 1A29A 2EGDA 1CDMA 4MRXA 4IJ7A 4DRWA 1CNPA 1PALA 2WC5A 1PSRA 2ZNDA 2JQ6A 2LMUA 3PATA 5AXIA 4CFRA 4CPVA 1Y1XA 1M39A 1DMOA 2K8MB 3OHMB 1J7QA 2CNPA 3RLZA 2HF5A 3SIAA 1TWOA 1TCFA 1KFXL 4PT1A 1KFUS 3D10A 3O4YA 1CDPA 4F0ZB 3I5GC 3ZNIA 3OX5A 1C7WA 4M2OA 1QVIZ 2KAVA 2KI4B 3KPXA 4PE7A 1SBJA 2KBMA 2Y1NA 4HRHA 2JXLA 3BUXB 1YRUB 1L7ZA 2LP3A 3TS5C 1TTXA 3D74A 2BL0B 3AKBA 2WC8A 2GTEA 1BF5A 1UURA 1TNPA 4D1EA 1FI6A 1A4PA 3DD4A 4YI9A 1OE9B 3CLNA 4UPGA 3WHTB 1AK8A 2L5YA 1ALWA 1OZOA 4GGNA 2BECA 3NHTA 4PCWA 3CS1A 3B6XA 1KQMC 2QEVA 1NCYA 1YR5A 3PJIA 2A4JA 2MBXA 1UHJA 4CIDA 3PN7B 5I2QA 2ZRTA 1B8CA 1KSOA 2KLDA 1C7VA 3HX4A 4GBAA 1NP8A 3D75A 2BBNA 1RJVA 2K7DA 1C07A 4YI8A 3SJSA 2GGMA 4N1GA 1OMDA 1T14A 1GM0A 3UO9A 1W9ZA 4XJKB 1J7RA 2KBIA 3CYZA 4YGBB 2MLFC 5I2LA 1JSAA 2LMVA 3DF0A 4ICBA 3NSKA 4MZLA 1RFJA 2Y5IA 3DYEA 1L2OC 1ORGA 1J1DA 1YURA 2MRDA 3B86A 5D3OA 5CSFA 3JTDB 3EKJA 4GNKB 4I5LB 1SYMA 2LMTA 1CLBA 1OOFA
chains in the Genus database with same CATH topology
1LA0A 1S5GY 1WY9A 1ZACA 1BODA 4P2YB 3PFVA 1BG1A 1SCMC 3I5HC 1WLMA 2JXCA 3O2PA 1DF0B 1FBVA 1EL4A 4GGFC 3OP0A 5I2OA 1KCYA 2MHHA 3A4UB 3MSEB 1K2HA 2KGRA 1J55A 3KF9A 2LVIA 1IGVA 2JPTA 3EVVA 3AKAA 1BJFA 2H2KA 1JF2A 1CLMA 2E6WA 4ORCB 1U5IB 2GGZA 1K95A 1XFUO 2D8NA 1BMOA 1XK4C 3BYAA 4BY5A 1HT9A 3CR5X 4QJ4B 2KQYA 4TNCA 1QTXA 3DVEA 1G4YR 2KSPA 1TNXA 2K0JA 2JULA 2WCFA 2I18A 1SRAA 2G9BA 3I5IC 1J1EA 1UUSA 3O6BA 1F4OA 1DTLA 3LLEA 4MEWA 2COLB 1JFKA 1DJZA 1NIWA 2JWWA 1OSAA 1QIWA 3IF7A 2M1UA 5G08A 2TN4A 5BPJA 1QV0A 3TDZA 1DT7B 1RWYA 1MXEA 2KI4C 1YX8A 2M97A 1YUUA 3KHEA 4NDBA 2JTZA 4OVNF 3BOWA 5KU1A 3K21A 4GPLB 1LVCD 3VRQA 1JWDA 1GJYA 3D0YA 4PE4A 1QX2A 2AUCA 3DVJA 4YRUA 4OV2A 1K9PA 1A2XA 2KI6D 5JOLA 4MLWA 2O5GA 4PHKA 1ODBA 1GGZA 5KTYA 3SG3A 1V1GA 1SKTA 2NZ0A 2OS8C 1BR1B 2AMIA 1NUBA 5HLVA 2JRFA 1XO5A 3NXAA 1XFVO 1Y1UA 3BQ3A 2WORA 1KFUL 1LXFC 1CM4A 2BBMA 2F2OA 1EG4A 2WOSA 2F3YA 2KYFA 2M8UA 1KWOC 2Q4UA 2KNEA 1B7TY 1B8LA 3NSOA 5F6TA 3TDIA 1JF0A 5DKRA 1AVSA 1XFZO 4GGFA 1IKUA 2M3WA 1KQVA 5HKWA 5AFPA 1A75A 1S36A 2G2BA 1MHOA 2OTGC 1OMVA 1K9KA 1WDCB 1Y6WA 3CR4X 3LK0A 3EVRA 5CSIA 1D1OA 2B1UA 1K96A 2L2EA 5FYXA 4QJ5B 2KAYA 1IRJA 1K93D 3JVTC 2K61A 3VRNA 1H4BA 1J7OA 4DS7A 1WLZA 1OQPA 3F45A 2M49B 1N0YA 1XK4A 1PSBA 3DVKA 4BY4A 1DJGA 1GQMA 1SL7A 1SY9A 1K8UA 4OKHA 2JT8A 2F3ZA 3H4SE 1QS7A 2LVKA 2M0RA 2BE6A 1CMFA 2CTNA 2Y1MA 1XVJA 3GK2A 1NYAA 1W7IB 1XA5A 4JWQA 2ZRSA 3HCMA 2F8PA 4I5NB 2LM5A 1IQ5A 2JNXA 2KYCA 3DF0B 3EK4A 5I8NA 5DKNA 3I5FB 2MJWB 2KDHA 3WHUB 4ZCVA 1OZSA 5JJGA 1V1FA 2EC6C 1SR6C 3ZWHA 5ER5A 1CFCA 4ORAB 2F2PA 1EJ3A 1FF1A 3IQOA 4GUKA 3TUYB 1SMGA 1CM1A 5KSZA 1AUIB 1QVIY 2BCBA 1K9UA 3WNXB 2JNFA 1YX7A 5CSJA 1QXPA 2JT3A 2PMYA 1AHRA 1KK8C 3GK1A 3NSLA 2LLTA 2LV7A 1N2DA 4HSZA 1JUOA 1F70A 4JQ0D 1BT6A 1B47A 1ZUZA 5D7FA 1F55A 2NXQA 1KK7Z 2LLSA 4JPZB 2PSRA 1CDLA 3FWBA 1KSMA 2CCMA 1PRWA 1LINA 1QX7A 2BE4A 2FJUB 3CZTX 1DGVA 3I5GB 2LHLA 4WQ2A 2LUXA 5AERA 1M45A 2ZN9A 3OX6A 3TDUA 1QX5B 3PALA 1QIVA 3GK4X 4PHMA 1CFPA 4GAOA 1JFJA 3AAJA 4PE0A 4YGAA 2LVVA 3A8RA 1XFWO 3OB1B 2H61C 3TS5B 1SL9A 2PVBA 4PDZA 1AP4A 1UP5A 3BOWB 1F8HA 4QJ3B 4PALA 3TZ1A 3PM8A 1IWQA 2KGBC 1CTRA 1S6JA 1W7JB 3E3RA 3FIAA 3WXAA 1DJWA 1YVLA 3D0YB 3SG2A 2EHBA 2KFFA 1KQMB 1K90D 1RROA 3CGAA 1J7PA 1RK9A 1WDCC 1Y0VH 2LVJA 1UHKA 1B9AA 3KO0A 1M31A 2BL0C 1UHNA 3ICBA 4CLNA 4HREE 1BOCA 1M46A 1UHIA 1CMGA 3BXKA 2ZNEA 3OB2B 4M2PA 1SPYA 1PVBA 1EG3A 5CSNA 2FCDA 4A4CA 1BLQA 4USLA 1G33A 2NLNA 1ZFSA 3PN7C 4DIRA 1R6PA 1L2OB 5HKYA 2BCXA 2K7BA 1CFFA 1TOPA 1CB1A 1F54A 1F71A 2I2RE 2LP2A 1QATA 5PALA 3IQQA 2L50A 3FWCA 1QJTA 4M2QA 1N65A 1B8RA 2AAOA 2PASA 1SCMB 1DJYA 2LLUA 3I5HB 2LCPA 1DJHA 3VGOA 1E8AA 2HQ8A 2NCPA 1UWOA 2P6BB 2ISDA 4NQGA 2BKHB 2CT9A 2JT0A 1IQ3A 5D69A 1ZOTB 1FPWA 3JTDC 1RECA 2M29A 2L5XB 2SCPA 1F4QA 3C1VA 4CFQA 2GV5A 4PHJA 4FQOA 5GQQC 1MWNA 2WCEA 4YGCB 4MZKA 1TNQA 4ETOA 1TN4A 2Q91A 2NCOA 2LANA 1NCXA 4ZCUA 4E68A 3VRPA 1B4CA 4WRIA 1YRTB 1CLLA 1EXRA 5HLOA 1TIZA 2K7OA 3EK7A 3SG7A 4MVFA 3LK1A 3LCPC 1YUTA 1Y1AA 5HYDA 3I5IB 1MF8B 1PK0D 1TRFA 2MAZA 2WNDA 1JC2A 1XFXO 2KOTA 1S26D 3QRXA 2JU0A 4MN0A 3PSRA 4AQJA 1NX1A 1BR4B 2FCEA 3PLFB 1H8BA 1MXLC 2V53A 2HETA 2M7NA 1NSHA 1KFXS 1NPQA 2H61A 1MUXA 5K89A 1JBAA 5HKZA 2MLEC 2JOJA 3FS7A 2LUCA 4AOMA 4YBHB 1LA3A 3SG5A 4MRYA 1S5GZ 2ZN8A 4R1EA 2KAXA 1YVHA 3RM1A 3GOFA 1ALVA 2MA2A 1WRZA 2LC5A 2CXJA 2K7CA 1RTP1 1QLKA 3O78A 3SIBA 1MQ1A 2SASA 1G8IA 5B8IB 2JTTA 2VRGA 4NDDA 1NX0A 3VRRA 1TNWA 1ZMZA 2OS8B 4YGDB 1XYDA 4AQIA 1DJXA 3EKHA 1B1GA 2L98A 2LNKA 4FTGA 2LHIA 1CDNA 3BUOB 4N1FA 5TNCA 4MSPA 3VROA 2KI6C 2F33A 5CPVA 2PALA 1FW4A 1K94A 4MBEA 1M63B 4ORBB 2KQ6A 4NDCA 1PULA 3CR2A 1BU3A 1DGUA 1KWOB 1SW8A 3NSIA 3SG6A 4N5XA 5IBWA 3CTNA 4XJKA 1CKKA 2ZKMX 2IS9A 2O60A 1NWDA 2CBLA 2K2FA 3CWGA 5AANA 1S3PA 3AAKA 1VRKA 2OTGB 1QASA 3KEVA 4C0JA 2KHNA 4C0LA 1IJ6A 4OCIA 2OPOA 3JVTB 2L4HA 4GFTA 1DF0A 1AJ4A 1TCOB 3BUMB 2L0PA 3M0WA 4OR9B 5AEQA 1YUSA 2M7LA 1SL8A 1IH0A 1EH2A 5J3XA 4Q04A 2BCAA 4L9MA 3BUNB 4MZJA 1WRKA 1R2UA 2K2AA 4WQ3A 1DVIA 2L4IA 1U5IA 2HQWA 1KK7Y 2JC2A 2LE9B 2M1KB 1X02A 1OOJA 2R2IA 1NX3A 2L51A 1SK6D 2QACA 1FI5A 2EC6B 1SR6B 1UHHA 1WRLA 4HRGA 3EVUA 4IL1A 1A03A 1LKJA 1SCVA 2KFGA 1HQVA 1PVAA 1SNLA 2RGIA 1Q80A 3BUWB 3DVMA 1B7TZ 3EK8A 1NX2A 2JZIA 3SG4A 1GGWA 4YGEB 4PE1A 2I94A 3I5FC 4P5OE 1AJ5A 1DJIA 1S1EA 2Y4QA 2ZFDA 2WCBA 4PHNA 1KK8B 2QPTA 2HPSA 1NCZA 1S6CA 1XFYO 1IJ5A 3TUYC 4U8DA 1OMRA 5ER4X 2FOTA 5DKQA 2DOQA 2I7AA 1CFDA 1A75B 4XYNA 1MR8A 1QLSA 1IG5A 1QV1A 1S6IA 4A4BA 1YTZC 3LL8B 4DUQA 2PRUA 4DCKA 2M9GA 2KFHA 4I5KA 4C0KA 2BKIB 2LAPA 2E30A 1A29A 2EGDA 1CDMA 4MRXA 4DRWA 1CNPA 1PALA 1PSRA 2ZNDA 2JQ6A 2LMUA 3PATA 5AXIA 4CFRA 4CPVA 1Y1XA 1M39A 1DMOA 2K8MB 3OHMB 1J7QA 2CNPA 3RLZA 2HF5A 3SIAA 1TCFA 1KFXL 1KFUS 3D10A 3O4YA 1CDPA 4F0ZB 3I5GC 3ZNIA 3OX5A 1C7WA 4M2OA 1QVIZ 2KAVA 2KI4B 3KPXA 4PE7A 1SBJA 2KBMA 2Y1NA 4HRHA 2JXLA 3BUXB 1YRUB 1L7ZA 2LP3A 3TS5C 1TTXA 2BL0B 3AKBA 2WC8A 1BF5A 1UURA 1TNPA 4D1EA 1FI6A 1A4PA 3DD4A 4YI9A 1OE9B 3CLNA 4UPGA 3WHTB 1AK8A 1ALWA 1OZOA 4GGNA 2BECA 4PCWA 3CS1A 1KQMC 1NCYA 1YR5A 2A4JA 2MBXA 1UHJA 4CIDA 3PN7B 5I2QA 2ZRTA 1B8CA 1KSOA 1C7VA 3HX4A 4GBAA 1NP8A 2BBNA 1RJVA 2K7DA 1C07A 4YI8A 3SJSA 2GGMA 4N1GA 1OMDA 4XJKB 1J7RA 2KBIA 4YGBB 1JSAA 2MLFC 5I2LA 2LMVA 3DF0A 4ICBA 3NSKA 4MZLA 1RFJA 2Y5IA 1L2OC 1J1DA 1YURA 2MRDA 5CSFA 3JTDB 3EKJA 4GNKB 4I5LB 1SYMA 2LMTA 1CLBA 4I5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LA0 A;  1S5G Y;  1WY9 A;  1ZAC A;  1BOD A;  4P2Y B;  3PFV A;  1BG1 A;  1SCM C;  3I5H C;  1WLM A;  2JXC A;  3O2P A;  1DF0 B;  1FBV A;  1EL4 A;  4GGF C;  3OP0 A;  5I2O A;  1KCY A;  2MHH A;  3A4U B;  3MSE B;  1K2H A;  2KGR A;  1J55 A;  3KF9 A;  2LVI A;  1IGV A;  2JPT A;  3EVV A;  3AKA A;  1BJF A;  2H2K A;  1JF2 A;  1CLM A;  2E6W A;  4ORC B;  1U5I B;  2GGZ A;  1K95 A;  1XFU O;  2D8N A;  1BMO A;  1XK4 C;  3BYA A;  4BY5 A;  1HT9 A;  3CR5 X;  4QJ4 B;  2KQY A;  4TNC A;  1QTX A;  3DVE A;  1G4Y R;  2KSP A;  1TNX A;  2K0J A;  2JUL A;  2WCF A;  2I18 A;  1SRA A;  2G9B A;  3I5I C;  1J1E A;  1UUS A;  3O6B A;  1F4O A;  1DTL A;  3LLE A;  4MEW A;  2COL B;  1JFK A;  1DJZ A;  1NIW A;  2JWW A;  1OSA A;  1QIW A;  3IF7 A;  2M1U A;  5G08 A;  2TN4 A;  5BPJ A;  1QV0 A;  3TDZ A;  1DT7 B;  1RWY A;  1MXE A;  2KI4 C;  1YX8 A;  2M97 A;  1YUU A;  3KHE A;  4NDB A;  2JTZ A;  4OVN F;  3BOW A;  5KU1 A;  3K21 A;  4GPL B;  1LVC D;  3VRQ A;  1JWD A;  1GJY A;  3D0Y A;  4PE4 A;  1QX2 A;  2AUC A;  3DVJ A;  4YRU A;  4OV2 A;  1K9P A;  1A2X A;  2KI6 D;  5JOL A;  4MLW A;  2O5G A;  4PHK A;  1ODB A;  1GGZ A;  5KTY A;  3SG3 A;  1V1G A;  1SKT A;  2NZ0 A;  2OS8 C;  1BR1 B;  2AMI A;  1NUB A;  5HLV A;  2JRF A;  1XO5 A;  3NXA A;  1XFV O;  1Y1U A;  3BQ3 A;  2WOR A;  1KFU L;  1LXF C;  1CM4 A;  2BBM A;  2F2O A;  1EG4 A;  2WOS A;  2F3Y A;  2KYF A;  2M8U A;  1KWO C;  2Q4U A;  2KNE A;  1B7T Y;  1B8L A;  3NSO A;  5F6T A;  3TDI A;  1JF0 A;  5DKR A;  1AVS A;  1XFZ O;  4GGF A;  1IKU A;  2M3W A;  1KQV A;  5HKW A;  5AFP A;  1A75 A;  1S36 A;  2G2B A;  1MHO A;  2OTG C;  1OMV A;  1K9K A;  1WDC B;  1Y6W A;  3CR4 X;  3LK0 A;  3EVR A;  5CSI A;  1D1O A;  2B1U A;  1K96 A;  2L2E A;  5FYX A;  4QJ5 B;  2KAY A;  1IRJ A;  1K93 D;  3JVT C;  2K61 A;  3VRN A;  1H4B A;  1J7O A;  4DS7 A;  1WLZ A;  1OQP A;  3F45 A;  2M49 B;  1N0Y A;  1XK4 A;  1PSB A;  3DVK A;  4BY4 A;  1DJG A;  1GQM A;  1SL7 A;  1SY9 A;  1K8U A;  4OKH A;  2JT8 A;  2F3Z A;  3H4S E;  1QS7 A;  2LVK A;  2M0R A;  2BE6 A;  1CMF A;  2CTN A;  2Y1M A;  1XVJ A;  3GK2 A;  1NYA A;  1W7I B;  1XA5 A;  4JWQ A;  2ZRS A;  3HCM A;  2F8P A;  4I5N B;  2LM5 A;  1IQ5 A;  2JNX A;  2KYC A;  3DF0 B;  3EK4 A;  5I8N A;  5DKN A;  3I5F B;  2MJW B;  2KDH A;  3WHU B;  4ZCV A;  1OZS A;  5JJG A;  1V1F A;  2EC6 C;  1SR6 C;  3ZWH A;  5ER5 A;  1CFC A;  4ORA B;  2F2P A;  1EJ3 A;  1FF1 A;  3IQO A;  4GUK A;  3TUY B;  1SMG A;  1CM1 A;  5KSZ A;  1AUI B;  1QVI Y;  2BCB A;  1K9U A;  3WNX B;  2JNF A;  1YX7 A;  5CSJ A;  1QXP A;  2JT3 A;  2PMY A;  1AHR A;  1KK8 C;  3GK1 A;  3NSL A;  2LLT A;  2LV7 A;  1N2D A;  4HSZ A;  1JUO A;  1F70 A;  4JQ0 D;  1BT6 A;  1B47 A;  1ZUZ A;  5D7F A;  1F55 A;  2NXQ A;  1KK7 Z;  2LLS A;  4JPZ B;  2PSR A;  1CDL A;  3FWB A;  1KSM A;  2CCM A;  1PRW A;  1LIN A;  1QX7 A;  2BE4 A;  2FJU B;  3CZT X;  1DGV A;  3I5G B;  2LHL A;  4WQ2 A;  2LUX A;  5AER A;  1M45 A;  2ZN9 A;  3OX6 A;  3TDU A;  1QX5 B;  3PAL A;  1QIV A;  3GK4 X;  4PHM A;  1CFP A;  4GAO A;  1JFJ A;  3AAJ A;  4PE0 A;  4YGA A;  2LVV A;  3A8R A;  1XFW O;  3OB1 B;  2H61 C;  3TS5 B;  1SL9 A;  2PVB A;  4PDZ A;  1AP4 A;  1UP5 A;  3BOW B;  1F8H A;  4QJ3 B;  4PAL A;  3TZ1 A;  3PM8 A;  1IWQ A;  2KGB C;  1CTR A;  1S6J A;  1W7J B;  3E3R A;  3FIA A;  3WXA A;  1DJW A;  1YVL A;  3D0Y B;  3SG2 A;  2EHB A;  2KFF A;  1KQM B;  1K90 D;  1RRO A;  3CGA A;  1J7P A;  1RK9 A;  1WDC C;  1Y0V H;  2LVJ A;  1UHK A;  1B9A A;  3KO0 A;  1M31 A;  2BL0 C;  1UHN A;  3ICB A;  4CLN A;  4HRE E;  1BOC A;  1M46 A;  1UHI A;  1CMG A;  3BXK A;  2ZNE A;  3OB2 B;  4M2P A;  1SPY A;  1PVB A;  1EG3 A;  5CSN A;  2FCD A;  4A4C A;  1BLQ A;  4USL A;  1G33 A;  2NLN A;  1ZFS A;  3PN7 C;  4DIR A;  1R6P A;  1L2O B;  5HKY A;  2BCX A;  2K7B A;  1CFF A;  1TOP A;  1CB1 A;  1F54 A;  1F71 A;  2I2R E;  2LP2 A;  1QAT A;  5PAL A;  3IQQ A;  2L50 A;  3FWC A;  1QJT A;  4M2Q A;  1N65 A;  1B8R A;  2AAO A;  2PAS A;  1SCM B;  1DJY A;  2LLU A;  3I5H B;  2LCP A;  1DJH A;  3VGO A;  1E8A A;  2HQ8 A;  2NCP A;  1UWO A;  2P6B B;  2ISD A;  4NQG A;  2BKH B;  2CT9 A;  2JT0 A;  1IQ3 A;  5D69 A;  1ZOT B;  1FPW A;  3JTD C;  1REC A;  2M29 A;  2L5X B;  2SCP A;  1F4Q A;  3C1V A;  4CFQ A;  2GV5 A;  4PHJ A;  4FQO A;  5GQQ C;  1MWN A;  2WCE A;  4YGC B;  4MZK A;  1TNQ A;  4ETO A;  1TN4 A;  2Q91 A;  2NCO A;  2LAN A;  1NCX A;  4ZCU A;  4E68 A;  3VRP A;  1B4C A;  4WRI A;  1YRT B;  1CLL A;  1EXR A;  5HLO A;  1TIZ A;  2K7O A;  3EK7 A;  3SG7 A;  4MVF A;  3LK1 A;  3LCP C;  1YUT A;  1Y1A A;  5HYD A;  3I5I B;  1MF8 B;  1PK0 D;  1TRF A;  2MAZ A;  2WND A;  1JC2 A;  1XFX O;  2KOT A;  1S26 D;  3QRX A;  2JU0 A;  4MN0 A;  3PSR A;  4AQJ A;  1NX1 A;  1BR4 B;  2FCE A;  3PLF B;  1H8B A;  1MXL C;  2V53 A;  2HET A;  2M7N A;  1NSH A;  1KFX S;  1NPQ A;  2H61 A;  1MUX A;  5K89 A;  1JBA A;  5HKZ A;  2MLE C;  2JOJ A;  3FS7 A;  2LUC A;  4AOM A;  4YBH B;  1LA3 A;  3SG5 A;  4MRY A;  1S5G Z;  2ZN8 A;  4R1E A;  2KAX A;  1YVH A;  3RM1 A;  3GOF A;  1ALV A;  2MA2 A;  1WRZ A;  2LC5 A;  2CXJ A;  2K7C A;  1RTP 1;  1QLK A;  3O78 A;  3SIB A;  1MQ1 A;  2SAS A;  1G8I A;  5B8I B;  2JTT A;  2VRG A;  4NDD A;  1NX0 A;  3VRR A;  1TNW A;  1ZMZ A;  2OS8 B;  4YGD B;  1XYD A;  4AQI A;  1DJX A;  3EKH A;  1B1G A;  2L98 A;  2LNK A;  4FTG A;  2LHI A;  1CDN A;  3BUO B;  4N1F A;  5TNC A;  4MSP A;  3VRO A;  2KI6 C;  2F33 A;  5CPV A;  2PAL A;  1FW4 A;  1K94 A;  4MBE A;  1M63 B;  4ORB B;  2KQ6 A;  4NDC A;  1PUL A;  3CR2 A;  1BU3 A;  1DGU A;  1KWO B;  1SW8 A;  3NSI A;  3SG6 A;  4N5X A;  5IBW A;  3CTN A;  4XJK A;  1CKK A;  2ZKM X;  2IS9 A;  2O60 A;  1NWD A;  2CBL A;  2K2F A;  3CWG A;  5AAN A;  1S3P A;  3AAK A;  1VRK A;  2OTG B;  1QAS A;  3KEV A;  4C0J A;  2KHN A;  4C0L A;  1IJ6 A;  4OCI A;  2OPO A;  3JVT B;  2L4H A;  4GFT A;  1DF0 A;  1AJ4 A;  1TCO B;  3BUM B;  2L0P A;  3M0W A;  4OR9 B;  5AEQ A;  1YUS A;  2M7L A;  1SL8 A;  1IH0 A;  1EH2 A;  5J3X A;  4Q04 A;  2BCA A;  4L9M A;  3BUN B;  4MZJ A;  1WRK A;  1R2U A;  2K2A A;  4WQ3 A;  1DVI A;  2L4I A;  1U5I A;  2HQW A;  1KK7 Y;  2JC2 A;  2LE9 B;  2M1K B;  1X02 A;  1OOJ A;  2R2I A;  1NX3 A;  2L51 A;  1SK6 D;  2QAC A;  1FI5 A;  2EC6 B;  1SR6 B;  1UHH A;  1WRL A;  4HRG A;  3EVU A;  4IL1 A;  1A03 A;  1LKJ A;  1SCV A;  2KFG A;  1HQV A;  1PVA A;  1SNL A;  2RGI A;  1Q80 A;  3BUW B;  3DVM A;  1B7T Z;  3EK8 A;  1NX2 A;  2JZI A;  3SG4 A;  1GGW A;  4YGE B;  4PE1 A;  2I94 A;  3I5F C;  4P5O E;  1AJ5 A;  1DJI A;  1S1E A;  2Y4Q A;  2ZFD A;  2WCB A;  4PHN A;  1KK8 B;  2QPT A;  2HPS A;  1NCZ A;  1S6C A;  1XFY O;  1IJ5 A;  3TUY C;  4U8D A;  1OMR A;  5ER4 X;  2FOT A;  5DKQ A;  2DOQ A;  2I7A A;  1CFD A;  1A75 B;  4XYN A;  1MR8 A;  1QLS A;  1IG5 A;  1QV1 A;  1S6I A;  4A4B A;  1YTZ C;  3LL8 B;  4DUQ A;  2PRU A;  4DCK A;  2M9G A;  2KFH A;  4I5K A;  4C0K A;  2BKI B;  2LAP A;  2E30 A;  1A29 A;  2EGD A;  1CDM A;  4MRX A;  4DRW A;  1CNP A;  1PAL A;  1PSR A;  2ZND A;  2JQ6 A;  2LMU A;  3PAT A;  5AXI A;  4CFR A;  4CPV A;  1Y1X A;  1M39 A;  1DMO A;  2K8M B;  3OHM B;  1J7Q A;  2CNP A;  3RLZ A;  2HF5 A;  3SIA A;  1TCF A;  1KFX L;  1KFU S;  3D10 A;  3O4Y A;  1CDP A;  4F0Z B;  3I5G C;  3ZNI A;  3OX5 A;  1C7W A;  4M2O A;  1QVI Z;  2KAV A;  2KI4 B;  3KPX A;  4PE7 A;  1SBJ A;  2KBM A;  2Y1N A;  4HRH A;  2JXL A;  3BUX B;  1YRU B;  1L7Z A;  2LP3 A;  3TS5 C;  1TTX A;  2BL0 B;  3AKB A;  2WC8 A;  1BF5 A;  1UUR A;  1TNP A;  4D1E A;  1FI6 A;  1A4P A;  3DD4 A;  4YI9 A;  1OE9 B;  3CLN A;  4UPG A;  3WHT B;  1AK8 A;  1ALW A;  1OZO A;  4GGN A;  2BEC A;  4PCW A;  3CS1 A;  1KQM C;  1NCY A;  1YR5 A;  2A4J A;  2MBX A;  1UHJ A;  4CID A;  3PN7 B;  5I2Q A;  2ZRT A;  1B8C A;  1KSO A;  1C7V A;  3HX4 A;  4GBA A;  1NP8 A;  2BBN A;  1RJV A;  2K7D A;  1C07 A;  4YI8 A;  3SJS A;  2GGM A;  4N1G A;  1OMD A;  4XJK B;  1J7R A;  2KBI A;  4YGB B;  1JSA A;  2MLF C;  5I2L A;  2LMV A;  3DF0 A;  4ICB A;  3NSK A;  4MZL A;  1RFJ A;  2Y5I A;  1L2O C;  1J1D A;  1YUR A;  2MRD A;  5CSF A;  3JTD B;  3EKJ A;  4GNK B;  4I5L B;  1SYM A;  2LMT A;  1CLB A;  4I5J A; 
#chains in the Genus database with same CATH topology
 1LA0 A;  1S5G Y;  1WY9 A;  1ZAC A;  1BOD A;  4P2Y B;  3PFV A;  4INW A;  1BG1 A;  1SCM C;  3I5H C;  1WLM A;  2JXC A;  3O2P A;  1DF0 B;  5I94 A;  1FBV A;  1EL4 A;  4GGF C;  3OP0 A;  4KYN A;  5I2O A;  1KCY A;  2MHH A;  3A4U B;  3MSE B;  1K2H A;  2KGR A;  1J55 A;  3KF9 A;  2LVI A;  1IGV A;  2WCH A;  2JPT A;  3B7A A;  3EVV A;  3AKA A;  1BJF A;  2H2K A;  1JF2 A;  1CLM A;  2E6W A;  4ORC B;  1U5I B;  2GGZ A;  1K95 A;  1XFU O;  2D8N A;  1BMO A;  1XK4 C;  3BYA A;  4BY5 A;  1HT9 A;  3CR5 X;  4QJ4 B;  2KQY A;  4TNC A;  3NHI A;  4FQT A;  1QTX A;  3DVE A;  1G4Y R;  5FI7 A;  2KSP A;  1P28 A;  1TNX A;  2JUL A;  2K0J A;  2I18 A;  2WCF A;  1SRA A;  2G9B A;  3I5I C;  3D73 A;  1J1E A;  1UUS A;  3O6B A;  1F4O A;  1DTL A;  3R1P A;  5FI2 A;  3LLE A;  4MEW A;  2COL B;  1JFK A;  4E68 A;  1DJZ A;  1NIW A;  2JWW A;  1OSA A;  1QIW A;  3IF7 A;  2M1U A;  5G08 A;  2TN4 A;  5BPJ A;  1QV0 A;  3TDZ A;  3L4A A;  1DT7 B;  1RWY A;  1MXE A;  2ERB A;  2KI4 C;  1YX8 A;  2M97 A;  1YUU A;  3KHE A;  4NDB A;  2JTZ A;  4OVN F;  1DQE A;  3BOW A;  3OGN A;  5KU1 A;  2BNX A;  3K21 A;  4GPL B;  1LVC D;  3VRQ A;  1JWD A;  1GJY A;  3D0Y A;  4PE4 A;  3BFH A;  1QX2 A;  2AUC A;  3DVJ A;  4YRU A;  4OV2 A;  1K9P A;  1A2X A;  2KI6 D;  4F7F A;  5JOL A;  4MLW A;  2O5G A;  3VB1 A;  3B88 A;  4PHK A;  1ODB A;  1GGZ A;  5KTY A;  1DEL A;  2P70 A;  3SG3 A;  2P71 A;  3NGV A;  1V1G A;  1SKT A;  2H8V A;  2NZ0 A;  1BR1 B;  2OS8 C;  2AMI A;  1NUB A;  5HLV A;  2JRF A;  2WCK A;  1XO5 A;  3NXA A;  1XFV O;  1Y1U A;  3BQ3 A;  2WOR A;  3DZT A;  1KFU L;  1LXF C;  1CM4 A;  2BBM A;  2F2O A;  1EG4 A;  2WOS A;  3CZ1 A;  2F3Y A;  2KYF A;  2M8U A;  1KWO C;  3R72 A;  3V2L A;  2Q4U A;  2KNE A;  1B7T Y;  1B8L A;  3NSO A;  5F6T A;  3TDI A;  1JF0 A;  3FE8 A;  5DKR A;  1AVS A;  1XFZ O;  4GGF A;  1IKU A;  2M3W A;  1KQV A;  3OBV A;  5HKW A;  5AFP A;  1A75 A;  1S36 A;  2G2B A;  1MHO A;  2OTG C;  1OMV A;  1K9K A;  1WDC B;  1Y6W A;  3CR4 X;  3LK0 A;  3S0B A;  3EVR A;  5CSI A;  1D1O A;  2B1U A;  1K96 A;  2L2E A;  5FYX A;  4QJ5 B;  2KAY A;  1IRJ A;  1K93 D;  3JVT C;  2K61 A;  3VRN A;  1H4B A;  1J7O A;  4DS7 A;  1WLZ A;  1OQP A;  3F45 A;  2M49 B;  1N0Y A;  1XK4 A;  1PSB A;  3DVK A;  4BY4 A;  1DJG A;  1GQM A;  1SL7 A;  1SY9 A;  1K8U A;  4OKH A;  2JT8 A;  2FJY A;  2F3Z A;  3H4S E;  1QS7 A;  2LVK A;  2M0R A;  2BE6 A;  1CMF A;  2CTN A;  2Y1M A;  1XVJ A;  3GK2 A;  1NYA A;  1W7I B;  1XA5 A;  4JWQ A;  2ZRS A;  3HCM A;  2F8P A;  1C3Z A;  4I5N B;  2LM5 A;  1XFR A;  1IQ5 A;  2JNX A;  2KYC A;  3DF0 B;  3L4L A;  3EK4 A;  5I8N A;  5DKN A;  3I5F B;  4JKT A;  2MJW B;  2KDH A;  3WHU B;  4ZCV A;  1OZS A;  1OOI X;  5JJG A;  1OOG A;  1V1F A;  2EC6 C;  1SR6 C;  2PYQ A;  5ER5 A;  3ZWH A;  4ORA B;  2F2P A;  1EJ3 A;  1CFC A;  1FF1 A;  3IQO A;  4GUK A;  3TUY B;  1SMG A;  1CM1 A;  5KSZ A;  1AUI B;  1QVI Y;  2BCB A;  1K9U A;  3WNX B;  2JNF A;  1YX7 A;  5CSJ A;  3B87 A;  1QXP A;  2JT3 A;  2QDI A;  2PMY A;  3SS4 A;  1AHR A;  1KK8 C;  3GK1 A;  3NSL A;  2LLT A;  1Z2C B;  2LV7 A;  1N2D A;  4HSZ A;  1JUO A;  1F70 A;  4JQ0 D;  1BT6 A;  1B47 A;  1ZUZ A;  4I5J A;  5D7F A;  1F55 A;  2NXQ A;  1KK7 Z;  2LLS A;  4JPZ B;  4OZD A;  2PSR A;  1CDL A;  3FWB A;  1KSM A;  2CCM A;  1PRW A;  1LIN A;  1QX7 A;  2BE4 A;  2FJU B;  3CZT X;  3FE6 A;  1DGV A;  3I5G B;  2LHL A;  4WQ2 A;  2LUX A;  5AER A;  1M45 A;  2ZN9 A;  3OX6 A;  3SS3 A;  1QX5 B;  3PAL A;  3TDU A;  1QIV A;  3GK4 X;  4PHM A;  1CFP A;  4GAO A;  1JFJ A;  3AAJ A;  4PE0 A;  4YGA A;  2JPO A;  2LVV A;  3A8R A;  1XFW O;  3OB1 B;  2H61 C;  3TS5 B;  1IIO A;  1SL9 A;  2PVB A;  2WC6 A;  2YGU A;  4PDZ A;  1AP4 A;  1UP5 A;  3BOW B;  1F8H A;  4QJ3 B;  4PAL A;  3TZ1 A;  3PM8 A;  1IWQ A;  2KGB C;  1CTR A;  1S6J A;  1W7J B;  3E3R A;  3FIA A;  3WXA A;  1DJW A;  1YVL A;  2KPH A;  3BJH A;  3D0Y B;  3SG2 A;  2EHB A;  2KFF A;  2BAP A;  1KQM B;  1K90 D;  1RRO A;  3S0A A;  3CGA A;  1J7P A;  1RK9 A;  1WDC C;  1Y0V H;  2LVJ A;  1UHK A;  1B9A A;  1SSE B;  3KO0 A;  1M31 A;  2BL0 C;  1UHN A;  3ICB A;  4CLN A;  4HRE E;  1BOC A;  1M46 A;  1UHI A;  3D78 A;  3BXK A;  1CMG A;  2ZNE A;  3OB2 B;  4M2P A;  1SPY A;  1PVB A;  1EG3 A;  5CSN A;  3K1E A;  2FCD A;  4A4C A;  1BLQ A;  4USL A;  1G33 A;  2NLN A;  1ZFS A;  3PN7 C;  4DIR A;  1R6P A;  1L2O B;  2K60 A;  2BCX A;  2K7B A;  5HKY A;  1TOP A;  1CFF A;  1CB1 A;  1F54 A;  1F71 A;  2I2R E;  2LP2 A;  1QAT A;  1QWV A;  5PAL A;  1OOH A;  3IQQ A;  2L50 A;  3FWC A;  1DC1 A;  1QJT A;  4M2Q A;  1N65 A;  1B8R A;  2AAO A;  2PAS A;  1SCM B;  1DJY A;  2LLU A;  3I5H B;  5HL1 A;  2LCP A;  1DJH A;  3VGO A;  1E8A A;  2HQ8 A;  2NCP A;  1UWO A;  2P6B B;  2ISD A;  4NQG A;  2BKH B;  2CT9 A;  2JT0 A;  1IQ3 A;  5D69 A;  1LS8 A;  1TUZ A;  1ZOT B;  1FPW A;  3JTD C;  1REC A;  3DY9 A;  2M29 A;  2L5X B;  2SCP A;  1F4Q A;  3C1V A;  4CFQ A;  2GV5 A;  4PHJ A;  2WCM A;  4FQO A;  5GQQ C;  1MWN A;  2WCE A;  4YGC B;  4JD9 A;  1TNQ A;  4MZK A;  1TN4 A;  2Q91 A;  2NCO A;  2LAN A;  1NCX A;  4ZCU A;  4ETO A;  3VRP A;  1B4C A;  3R1O A;  4WRI A;  1YRT B;  2QEO A;  3R1V A;  1CLL A;  1EXR A;  5HLO A;  1TIZ A;  2K7O A;  3DXL A;  3EK7 A;  3S0G A;  4MVF A;  3SG7 A;  3LK1 A;  3LCP C;  1YUT A;  1Y1A A;  5HYD A;  3I5I B;  1MF8 B;  1PK0 D;  1TRF A;  2MAZ A;  2WND A;  3CZ2 A;  1JC2 A;  1XFX O;  2KOT A;  1S26 D;  3QRX A;  2JU0 A;  3RZS A;  4MN0 A;  3PSR A;  4AQJ A;  1NX1 A;  1BR4 B;  2FCE A;  3PLF B;  1H8B A;  1MXL C;  2V53 A;  2HET A;  2M7N A;  1NSH A;  1KFX S;  2PQL A;  1NPQ A;  2H61 A;  1MUX A;  5K89 A;  1JBA A;  5HKZ A;  2MLE C;  2JOJ A;  3FS7 A;  2LUC A;  4AOM A;  4YBH B;  1LA3 A;  3BFA A;  3SG5 A;  3CAB A;  5FI6 A;  4MRY A;  1S5G Z;  2ZN8 A;  2QEB A;  4R1E A;  2KAX A;  1YVH A;  3RM1 A;  3GOF A;  1C3Y A;  1DEK A;  1ALV A;  2MA2 A;  1WRZ A;  2LC5 A;  2CXJ A;  2K7C A;  1RTP 1;  1QLK A;  3UNW A;  2L2C A;  3O78 A;  1OW4 A;  3SIB A;  1MQ1 A;  3D76 A;  2QEH A;  2SAS A;  2WCJ A;  1G8I A;  5B8I B;  2JTT A;  2VRG A;  2WCL A;  4NDD A;  1NX0 A;  3VRR A;  1TNW A;  3SS5 A;  1ZMZ A;  2OS8 B;  4YGD B;  1XYD A;  4AQI A;  1DJX A;  3EKH A;  3QME A;  1B1G A;  2L98 A;  2LNK A;  4FTG A;  2LHI A;  1CDN A;  3BUO B;  4N1F A;  5TNC A;  4MSP A;  3VRO A;  2KI6 C;  2F33 A;  5CPV A;  2PAL A;  1FW4 A;  1K94 A;  5EL2 A;  4MBE A;  1M63 B;  3FE9 A;  4ORB B;  2KQ6 A;  4NDC A;  1PUL A;  3CR2 A;  1BU3 A;  1DGU A;  1KWO B;  1SW8 A;  3NSI A;  3SG6 A;  4N5X A;  5IBW A;  3CTN A;  4XJK A;  1CKK A;  2ZKM X;  2IS9 A;  2O60 A;  5DIC A;  1NWD A;  2CBL A;  2K2F A;  3CWG A;  5AAN A;  1S3P A;  3AAK A;  1VRK A;  2OTG B;  1QAS A;  3KEV A;  2KLE A;  4C0J A;  2KHN A;  3N7H A;  4C0L A;  1IJ6 A;  4OCI A;  2OPO A;  3JVT B;  2L4H A;  3EG5 B;  3Q8I A;  4GFT A;  1DF0 A;  1AJ4 A;  1TCO B;  3BUM B;  2L0P A;  3M0W A;  4OR9 B;  5AEQ A;  1YUS A;  2M7L A;  1SL8 A;  1IH0 A;  1EH2 A;  5J3X A;  3L47 A;  2BCA A;  4Q04 A;  4L9M A;  3BUN B;  4MZJ A;  1WRK A;  1R2U A;  2K2A A;  3BFB A;  4WQ3 A;  1DVI A;  2L4I A;  1U5I A;  2HQW A;  1KK7 Y;  2JC2 A;  2LE9 B;  2M1K B;  1X02 A;  1OOJ A;  2R2I A;  1NX3 A;  2L51 A;  1SK6 D;  2QAC A;  3IVT A;  1FI5 A;  2EC6 B;  1SR6 B;  1UHH A;  3S0D A;  1WRL A;  4HRG A;  3EVU A;  4IL1 A;  1A03 A;  1LKJ A;  1SCV A;  2KFG A;  1TUJ A;  1HQV A;  1PVA A;  1SNL A;  2RGI A;  3D77 A;  1Q80 A;  3BUW B;  3DVM A;  1B7T Z;  3PM2 A;  3EK8 A;  1NX2 A;  2JZI A;  3CDN A;  3SG4 A;  3S0F A;  1GGW A;  4YGE B;  4PE1 A;  2I94 A;  3I5F C;  4P5O E;  1AJ5 A;  1DJI A;  1S1E A;  2Y4Q A;  2ZFD A;  2WCB A;  4PHN A;  1KK8 B;  3O4X A;  2QPT A;  3S0E A;  3CZ0 A;  2HPS A;  1NCZ A;  1S6C A;  1XFY O;  1IJ5 A;  3TUY C;  4U8D A;  1OMR A;  5ER4 X;  2FOT A;  5DKQ A;  2DOQ A;  2I7A A;  1CFD A;  1A75 B;  1Z4H A;  4XYN A;  1MR8 A;  1QLS A;  1IG5 A;  1QV1 A;  1S6I A;  4INX A;  4A4B A;  1YTZ C;  3LL8 B;  4DUQ A;  2PRU A;  4DCK A;  2M9G A;  2KFH A;  4I5K A;  4C0K A;  2BKI B;  2LAP A;  2E30 A;  1A29 A;  2EGD A;  1CDM A;  4MRX A;  4IJ7 A;  4DRW A;  1CNP A;  1PAL A;  2WC5 A;  1PSR A;  2ZND A;  2JQ6 A;  2LMU A;  3PAT A;  5AXI A;  4CFR A;  4CPV A;  1Y1X A;  1M39 A;  1DMO A;  2K8M B;  3OHM B;  1J7Q A;  2CNP A;  3RLZ A;  2HF5 A;  3SIA A;  1TWO A;  1TCF A;  1KFX L;  4PT1 A;  1KFU S;  3D10 A;  3O4Y A;  1CDP A;  4F0Z B;  3I5G C;  3ZNI A;  3OX5 A;  1C7W A;  4M2O A;  1QVI Z;  2KAV A;  2KI4 B;  3KPX A;  4PE7 A;  1SBJ A;  2KBM A;  2Y1N A;  4HRH A;  2JXL A;  3BUX B;  1YRU B;  1L7Z A;  2LP3 A;  3TS5 C;  1TTX A;  3D74 A;  2BL0 B;  3AKB A;  2WC8 A;  2GTE A;  1BF5 A;  1UUR A;  1TNP A;  4D1E A;  1FI6 A;  1A4P A;  3DD4 A;  4YI9 A;  1OE9 B;  3CLN A;  4UPG A;  3WHT B;  1AK8 A;  2L5Y A;  1ALW A;  1OZO A;  4GGN A;  2BEC A;  3NHT A;  4PCW A;  3CS1 A;  3B6X A;  1KQM C;  2QEV A;  1NCY A;  1YR5 A;  3PJI A;  2A4J A;  2MBX A;  1UHJ A;  4CID A;  3PN7 B;  5I2Q A;  2ZRT A;  1B8C A;  1KSO A;  2KLD A;  1C7V A;  3HX4 A;  4GBA A;  1NP8 A;  3D75 A;  2BBN A;  1RJV A;  2K7D A;  1C07 A;  4YI8 A;  3SJS A;  2GGM A;  4N1G A;  1OMD A;  1T14 A;  1GM0 A;  3UO9 A;  1W9Z A;  4XJK B;  1J7R A;  2KBI A;  3CYZ A;  4YGB B;  2MLF C;  5I2L A;  1JSA A;  2LMV A;  3DF0 A;  4ICB A;  3NSK A;  4MZL A;  1RFJ A;  2Y5I A;  3DYE A;  1L2O C;  1ORG A;  1J1D A;  1YUR A;  2MRD A;  3B86 A;  5D3O A;  5CSF A;  3JTD B;  3EKJ A;  4GNK B;  4I5L B;  1SYM A;  2LMT A;  1CLB A;  1OOF A; 
#chains in the Genus database with same CATH homology
 1LA0 A;  1S5G Y;  1WY9 A;  1ZAC A;  1BOD A;  4P2Y B;  3PFV A;  1BG1 A;  1SCM C;  3I5H C;  1WLM A;  2JXC A;  3O2P A;  1DF0 B;  1FBV A;  1EL4 A;  4GGF C;  3OP0 A;  5I2O A;  1KCY A;  2MHH A;  3A4U B;  3MSE B;  1K2H A;  2KGR A;  1J55 A;  3KF9 A;  2LVI A;  1IGV A;  2JPT A;  3EVV A;  3AKA A;  1BJF A;  2H2K A;  1JF2 A;  1CLM A;  2E6W A;  4ORC B;  1U5I B;  2GGZ A;  1K95 A;  1XFU O;  2D8N A;  1BMO A;  1XK4 C;  3BYA A;  4BY5 A;  1HT9 A;  3CR5 X;  4QJ4 B;  2KQY A;  4TNC A;  1QTX A;  3DVE A;  1G4Y R;  2KSP A;  1TNX A;  2K0J A;  2JUL A;  2WCF A;  2I18 A;  1SRA A;  2G9B A;  3I5I C;  1J1E A;  1UUS A;  3O6B A;  1F4O A;  1DTL A;  3LLE A;  4MEW A;  2COL B;  1JFK A;  1DJZ A;  1NIW A;  2JWW A;  1OSA A;  1QIW A;  3IF7 A;  2M1U A;  5G08 A;  2TN4 A;  5BPJ A;  1QV0 A;  3TDZ A;  1DT7 B;  1RWY A;  1MXE A;  2KI4 C;  1YX8 A;  2M97 A;  1YUU A;  3KHE A;  4NDB A;  2JTZ A;  4OVN F;  3BOW A;  5KU1 A;  3K21 A;  4GPL B;  1LVC D;  3VRQ A;  1JWD A;  1GJY A;  3D0Y A;  4PE4 A;  1QX2 A;  2AUC A;  3DVJ A;  4YRU A;  4OV2 A;  1K9P A;  1A2X A;  2KI6 D;  5JOL A;  4MLW A;  2O5G A;  4PHK A;  1ODB A;  1GGZ A;  5KTY A;  3SG3 A;  1V1G A;  1SKT A;  2NZ0 A;  2OS8 C;  1BR1 B;  2AMI A;  1NUB A;  5HLV A;  2JRF A;  1XO5 A;  3NXA A;  1XFV O;  1Y1U A;  3BQ3 A;  2WOR A;  1KFU L;  1LXF C;  1CM4 A;  2BBM A;  2F2O A;  1EG4 A;  2WOS A;  2F3Y A;  2KYF A;  2M8U A;  1KWO C;  2Q4U A;  2KNE A;  1B7T Y;  1B8L A;  3NSO A;  5F6T A;  3TDI A;  1JF0 A;  5DKR A;  1AVS A;  1XFZ O;  4GGF A;  1IKU A;  2M3W A;  1KQV A;  5HKW A;  5AFP A;  1A75 A;  1S36 A;  2G2B A;  1MHO A;  2OTG C;  1OMV A;  1K9K A;  1WDC B;  1Y6W A;  3CR4 X;  3LK0 A;  3EVR A;  5CSI A;  1D1O A;  2B1U A;  1K96 A;  2L2E A;  5FYX A;  4QJ5 B;  2KAY A;  1IRJ A;  1K93 D;  3JVT C;  2K61 A;  3VRN A;  1H4B A;  1J7O A;  4DS7 A;  1WLZ A;  1OQP A;  3F45 A;  2M49 B;  1N0Y A;  1XK4 A;  1PSB A;  3DVK A;  4BY4 A;  1DJG A;  1GQM A;  1SL7 A;  1SY9 A;  1K8U A;  4OKH A;  2JT8 A;  2F3Z A;  3H4S E;  1QS7 A;  2LVK A;  2M0R A;  2BE6 A;  1CMF A;  2CTN A;  2Y1M A;  1XVJ A;  3GK2 A;  1NYA A;  1W7I B;  1XA5 A;  4JWQ A;  2ZRS A;  3HCM A;  2F8P A;  4I5N B;  2LM5 A;  1IQ5 A;  2JNX A;  2KYC A;  3DF0 B;  3EK4 A;  5I8N A;  5DKN A;  3I5F B;  2MJW B;  2KDH A;  3WHU B;  4ZCV A;  1OZS A;  5JJG A;  1V1F A;  2EC6 C;  1SR6 C;  3ZWH A;  5ER5 A;  1CFC A;  4ORA B;  2F2P A;  1EJ3 A;  1FF1 A;  3IQO A;  4GUK A;  3TUY B;  1SMG A;  1CM1 A;  5KSZ A;  1AUI B;  1QVI Y;  2BCB A;  1K9U A;  3WNX B;  2JNF A;  1YX7 A;  5CSJ A;  1QXP A;  2JT3 A;  2PMY A;  1AHR A;  1KK8 C;  3GK1 A;  3NSL A;  2LLT A;  2LV7 A;  1N2D A;  4HSZ A;  1JUO A;  1F70 A;  4JQ0 D;  1BT6 A;  1B47 A;  1ZUZ A;  5D7F A;  1F55 A;  2NXQ A;  1KK7 Z;  2LLS A;  4JPZ B;  2PSR A;  1CDL A;  3FWB A;  1KSM A;  2CCM A;  1PRW A;  1LIN A;  1QX7 A;  2BE4 A;  2FJU B;  3CZT X;  1DGV A;  3I5G B;  2LHL A;  4WQ2 A;  2LUX A;  5AER A;  1M45 A;  2ZN9 A;  3OX6 A;  3TDU A;  1QX5 B;  3PAL A;  1QIV A;  3GK4 X;  4PHM A;  1CFP A;  4GAO A;  1JFJ A;  3AAJ A;  4PE0 A;  4YGA A;  2LVV A;  3A8R A;  1XFW O;  3OB1 B;  2H61 C;  3TS5 B;  1SL9 A;  2PVB A;  4PDZ A;  1AP4 A;  1UP5 A;  3BOW B;  1F8H A;  4QJ3 B;  4PAL A;  3TZ1 A;  3PM8 A;  1IWQ A;  2KGB C;  1CTR A;  1S6J A;  1W7J B;  3E3R A;  3FIA A;  3WXA A;  1DJW A;  1YVL A;  3D0Y B;  3SG2 A;  2EHB A;  2KFF A;  1KQM B;  1K90 D;  1RRO A;  3CGA A;  1J7P A;  1RK9 A;  1WDC C;  1Y0V H;  2LVJ A;  1UHK A;  1B9A A;  3KO0 A;  1M31 A;  2BL0 C;  1UHN A;  3ICB A;  4CLN A;  4HRE E;  1BOC A;  1M46 A;  1UHI A;  1CMG A;  3BXK A;  2ZNE A;  3OB2 B;  4M2P A;  1SPY A;  1PVB A;  1EG3 A;  5CSN A;  2FCD A;  4A4C A;  1BLQ A;  4USL A;  1G33 A;  2NLN A;  1ZFS A;  3PN7 C;  4DIR A;  1R6P A;  1L2O B;  5HKY A;  2BCX A;  2K7B A;  1CFF A;  1TOP A;  1CB1 A;  1F54 A;  1F71 A;  2I2R E;  2LP2 A;  1QAT A;  5PAL A;  3IQQ A;  2L50 A;  3FWC A;  1QJT A;  4M2Q A;  1N65 A;  1B8R A;  2AAO A;  2PAS A;  1SCM B;  1DJY A;  2LLU A;  3I5H B;  2LCP A;  1DJH A;  3VGO A;  1E8A A;  2HQ8 A;  2NCP A;  1UWO A;  2P6B B;  2ISD A;  4NQG A;  2BKH B;  2CT9 A;  2JT0 A;  1IQ3 A;  5D69 A;  1ZOT B;  1FPW A;  3JTD C;  1REC A;  2M29 A;  2L5X B;  2SCP A;  1F4Q A;  3C1V A;  4CFQ A;  2GV5 A;  4PHJ A;  4FQO A;  5GQQ C;  1MWN A;  2WCE A;  4YGC B;  4MZK A;  1TNQ A;  4ETO A;  1TN4 A;  2Q91 A;  2NCO A;  2LAN A;  1NCX A;  4ZCU A;  4E68 A;  3VRP A;  1B4C A;  4WRI A;  1YRT B;  1CLL A;  1EXR A;  5HLO A;  1TIZ A;  2K7O A;  3EK7 A;  3SG7 A;  4MVF A;  3LK1 A;  3LCP C;  1YUT A;  1Y1A A;  5HYD A;  3I5I B;  1MF8 B;  1PK0 D;  1TRF A;  2MAZ A;  2WND A;  1JC2 A;  1XFX O;  2KOT A;  1S26 D;  3QRX A;  2JU0 A;  4MN0 A;  3PSR A;  4AQJ A;  1NX1 A;  1BR4 B;  2FCE A;  3PLF B;  1H8B A;  1MXL C;  2V53 A;  2HET A;  2M7N A;  1NSH A;  1KFX S;  1NPQ A;  2H61 A;  1MUX A;  5K89 A;  1JBA A;  5HKZ A;  2MLE C;  2JOJ A;  3FS7 A;  2LUC A;  4AOM A;  4YBH B;  1LA3 A;  3SG5 A;  4MRY A;  1S5G Z;  2ZN8 A;  4R1E A;  2KAX A;  1YVH A;  3RM1 A;  3GOF A;  1ALV A;  2MA2 A;  1WRZ A;  2LC5 A;  2CXJ A;  2K7C A;  1RTP 1;  1QLK A;  3O78 A;  3SIB A;  1MQ1 A;  2SAS A;  1G8I A;  5B8I B;  2JTT A;  2VRG A;  4NDD A;  1NX0 A;  3VRR A;  1TNW A;  1ZMZ A;  2OS8 B;  4YGD B;  1XYD A;  4AQI A;  1DJX A;  3EKH A;  1B1G A;  2L98 A;  2LNK A;  4FTG A;  2LHI A;  1CDN A;  3BUO B;  4N1F A;  5TNC A;  4MSP A;  3VRO A;  2KI6 C;  2F33 A;  5CPV A;  2PAL A;  1FW4 A;  1K94 A;  4MBE A;  1M63 B;  4ORB B;  2KQ6 A;  4NDC A;  1PUL A;  3CR2 A;  1BU3 A;  1DGU A;  1KWO B;  1SW8 A;  3NSI A;  3SG6 A;  4N5X A;  5IBW A;  3CTN A;  4XJK A;  1CKK A;  2ZKM X;  2IS9 A;  2O60 A;  1NWD A;  2CBL A;  2K2F A;  3CWG A;  5AAN A;  1S3P A;  3AAK A;  1VRK A;  2OTG B;  1QAS A;  3KEV A;  4C0J A;  2KHN A;  4C0L A;  1IJ6 A;  4OCI A;  2OPO A;  3JVT B;  2L4H A;  4GFT A;  1DF0 A;  1AJ4 A;  1TCO B;  3BUM B;  2L0P A;  3M0W A;  4OR9 B;  5AEQ A;  1YUS A;  2M7L A;  1SL8 A;  1IH0 A;  1EH2 A;  5J3X A;  4Q04 A;  2BCA A;  4L9M A;  3BUN B;  4MZJ A;  1WRK A;  1R2U A;  2K2A A;  4WQ3 A;  1DVI A;  2L4I A;  1U5I A;  2HQW A;  1KK7 Y;  2JC2 A;  2LE9 B;  2M1K B;  1X02 A;  1OOJ A;  2R2I A;  1NX3 A;  2L51 A;  1SK6 D;  2QAC A;  1FI5 A;  2EC6 B;  1SR6 B;  1UHH A;  1WRL A;  4HRG A;  3EVU A;  4IL1 A;  1A03 A;  1LKJ A;  1SCV A;  2KFG A;  1HQV A;  1PVA A;  1SNL A;  2RGI A;  1Q80 A;  3BUW B;  3DVM A;  1B7T Z;  3EK8 A;  1NX2 A;  2JZI A;  3SG4 A;  1GGW A;  4YGE B;  4PE1 A;  2I94 A;  3I5F C;  4P5O E;  1AJ5 A;  1DJI A;  1S1E A;  2Y4Q A;  2ZFD A;  2WCB A;  4PHN A;  1KK8 B;  2QPT A;  2HPS A;  1NCZ A;  1S6C A;  1XFY O;  1IJ5 A;  3TUY C;  4U8D A;  1OMR A;  5ER4 X;  2FOT A;  5DKQ A;  2DOQ A;  2I7A A;  1CFD A;  1A75 B;  4XYN A;  1MR8 A;  1QLS A;  1IG5 A;  1QV1 A;  1S6I A;  4A4B A;  1YTZ C;  3LL8 B;  4DUQ A;  2PRU A;  4DCK A;  2M9G A;  2KFH A;  4I5K A;  4C0K A;  2BKI B;  2LAP A;  2E30 A;  1A29 A;  2EGD A;  1CDM A;  4MRX A;  4DRW A;  1CNP A;  1PAL A;  1PSR A;  2ZND A;  2JQ6 A;  2LMU A;  3PAT A;  5AXI A;  4CFR A;  4CPV A;  1Y1X A;  1M39 A;  1DMO A;  2K8M B;  3OHM B;  1J7Q A;  2CNP A;  3RLZ A;  2HF5 A;  3SIA A;  1TCF A;  1KFX L;  1KFU S;  3D10 A;  3O4Y A;  1CDP A;  4F0Z B;  3I5G C;  3ZNI A;  3OX5 A;  1C7W A;  4M2O A;  1QVI Z;  2KAV A;  2KI4 B;  3KPX A;  4PE7 A;  1SBJ A;  2KBM A;  2Y1N A;  4HRH A;  2JXL A;  3BUX B;  1YRU B;  1L7Z A;  2LP3 A;  3TS5 C;  1TTX A;  2BL0 B;  3AKB A;  2WC8 A;  1BF5 A;  1UUR A;  1TNP A;  4D1E A;  1FI6 A;  1A4P A;  3DD4 A;  4YI9 A;  1OE9 B;  3CLN A;  4UPG A;  3WHT B;  1AK8 A;  1ALW A;  1OZO A;  4GGN A;  2BEC A;  4PCW A;  3CS1 A;  1KQM C;  1NCY A;  1YR5 A;  2A4J A;  2MBX A;  1UHJ A;  4CID A;  3PN7 B;  5I2Q A;  2ZRT A;  1B8C A;  1KSO A;  1C7V A;  3HX4 A;  4GBA A;  1NP8 A;  2BBN A;  1RJV A;  2K7D A;  1C07 A;  4YI8 A;  3SJS A;  2GGM A;  4N1G A;  1OMD A;  4XJK B;  1J7R A;  2KBI A;  4YGB B;  1JSA A;  2MLF C;  5I2L A;  2LMV A;  3DF0 A;  4ICB A;  3NSK A;  4MZL A;  1RFJ A;  2Y5I A;  1L2O C;  1J1D A;  1YUR A;  2MRD A;  5CSF A;  3JTD B;  3EKJ A;  4GNK B;  4I5L B;  1SYM A;  2LMT A;  1CLB A;  4I5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...