1GM0A

A form of the pheromone-binding protein from bombyx mori
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
b'SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHEROMONE-BINDING PROTEIN
publication title NMR Structure Reveals Novel Intramolecular Regulation Mechanism for Pheromone-Binding and Release
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1gm0A00
1GM0A 3V2LA 1C3ZA 4F7FA 3CZ1A 3BFBA 1OOFA 1QWVA 3D78A 1TUJA 2QEOA 2QEHA 3R72A 5EL2A 3FE8A 2P70A 4JD9A 3B88A 2JPOA 3NHTA 2WC5A 4PT1A 3DXLA 3CZ0A 3CYZA 3QMEA 1T14A 3B6XA 3R1OA 1ORGA 5DICA 3D73A 2PQLA 3L4AA 3S0AA 3S0EA 2FJYA 2WCKA 3L47A 2L2CA 2P71A 3S0DA 3CABA 1C3YA 3DZTA 3PJIA 3D75A 1OOGA 2KPHA 2WCMA 3BFAA 1OOIX 2QEVA 3FE6A 2WCHA 3N7HA 3RZSA 1P28A 3VB1A 3NGVA 1OOHA 3B7AA 3K1EA 3BJHA 2ERBA 4INXA 3S0FA 2QDIA 3BFHA 2WCLA 1TWOA 3CZ2A 3D77A 2QEBA 3R1VA 2H8VA 3FE9A 3NHIA 4OZDA 3B87A 3OGNA 4FQTA 3B86A 3D74A 3R1PA 3S0BA 1LS8A 2WC6A 3S0GA 1OW4A 3L4LA 3DYEA 3CDNA 4INWA 1XFRA 1DQEA 3DY9A 2GTEA 3D76A 2WCJA 3Q8IA
chains in the Genus database with same CATH superfamily
1YRUB 1C3ZA 1RWYA 2M7NA 4GBAA 1TNPA 3JVTC 1DGUA 1OMDA 2QEOA 4YGBB 3PM2A 2OS8B 2F8PA 1BR4B 2L50A 2P70A 4JD9A 1TNXA 2K7DA 1M63B 1AHRA 2JPOA 5ER4X 1OQPA 2M97A 1JFKA 2O60A 3VROA 3I5GC 2M1UA 5HKWA 1DF0B 1K94A 2WCFA 2ZN8A 1BLQA 1KQVA 3CYZA 1TOPA 1ZOTB 1NYAA 1QTXA 2BCAA 3KF9A 1CMGA 1MWNA 2PVBA 2LANA 3EVVA 1OMVA 4PE0A 3GK4X 5DICA 4PHJA 2JOJA 2ZNDA 4L9MA 1Y1AA 4WQ2A 3TUYB 3EKJA 3L4AA 3S0EA 1N0YA 3PN7C 2FJYA 2WCEA 1J7RA 2Y1NA 1S36A 3SG6A 3L47A 2K60A 2K2AA 4M2OA 2H61A 2BBNA 2KHNA 5HLOA 1OOJA 3KO0A 5HKZA 2NXQA 4JQ0D 4M2QA 3DVKA 3PJIA 1OZSA 1TCFA 4HRHA 1SK6D 4U8DA 2KI4B 3EG5B 4OV2A 4R1EA 1OOGA 2BAPA 2KPHA 1JFJA 4MLWA 2O5GA 1DELA 1PSRA 5CPVA 3CR2A 2LVIA 2MHHA 4GPLB 4HREE 1EG3A 3EVRA 3FE6A 4A4BA 3N7HA 1YUSA 5I2QA 1BF5A 1F54A 2CTNA 4XJKA 2BL0B 3SG5A 3D0YA 3VB1A 3D0YB 1DJYA 1G4YR 2MLFC 1K96A 2PMYA 2TN4A 1CM4A 4MVFA 5J3XA 1BU3A 3C1VA 4CLNA 1SY9A 4I5JA 3H4SE 4QJ3B 2PSRA 3AAJA 4INXA 3S0FA 1U5IA 2NLNA 1SPYA 2WCBA 1DMOA 2WOSA 2KFHA 1E8AA 4JKTA 1RTP1 2KGBC 1IJ5A 2WCLA 5HKYA 3EKHA 3SG2A 1G8IA 1TWOA 3EK8A 1UHHA 1G33A 1WLMA 2F3YA 1Y0VH 2K0JA 3D77A 5G08A 2LUXA 4MZJA 2COLB 2JQ6A 2ZKMX 3CGAA 5FI6A 3SIAA 2H8VA 3I5IB 1F4QA 4CFRA 2KYCA 1YURA 3NHIA 1SL8A 4YI9A 2SCPA 1WDCC 2M49B 2R2IA 3B87A 3OGNA 2K7CA 1SR6C 3R1PA 2HQ8A 3SS4A 1ALWA 2I94A 1OMRA 4AQJA 1B8LA 4PCWA 2BE6A 3DF0A 1C07A 3S0BA 2LM5A 1MQ1A 2CT9A 5FYXA 1DJZA 2OTGB 3F45A 1CDNA 1J7PA 1AVSA 3O6BA 2KI6C 1A29A 1JF2A 1W7JB 1SL9A 3WHUB 3CS1A 1N2DA 3VRQA 3UNWA 3DYEA 1QV1A 2JZIA 4PDZA 2LNKA 3CR5X 2ZRSA 1QS7A 4ORAB 3I5FB 3UO9A 4A4CA 1MXEA 1Y1XA 1KFXS 2GTEA 4DIRA 1KCYA 2L51A 2LVJA 1GGWA 2FCDA 2L5YA 1M45A 1CLBA 1TUZA 1GM0A 1KSOA 3CZ1A 3BFBA 1OOFA 3OX5A 1TUJA 2WORA 4USLA 3R72A 3BUWB 5EL2A 3EK4A 5CSNA 2B1UA 3NXAA 4QJ4B 5AEQA 1R6PA 1YRTB 4MBEA 5DKQA 2AUCA 1LKJA 1R2UA 3FWBA 2JT0A 5FI2A 2G2BA 2Y1MA 3BXKA 1BJFA 1V1FA 1A75A 1L2OB 2F2PA 2KFGA 4DUQA 1A75B 2M8UA 3I5HB 4IJ7A 1J1DA 3QMEA 5I2LA 2GV5A 5JOLA 1AJ4A 1CTRA 1PVAA 3NSOA 1XFWO 3HX4A 3R1OA 1BODA 3BUXB 2LUCA 2JXLA 3D73A 5AXIA 2PQLA 3M0WA 1MHOA 4GFTA 2LVVA 3BQ3A 1M39A 2WCKA 1DJXA 5PALA 2ZFDA 1KQMB 2SASA 3CR4X 3E3RA 2L2CA 3FIAA 1B8CA 1TN4A 2EC6B 3TS5C 4UPGA 1AJ5A 1F70A 3O2PA 3FWCA 1XFVO 1A03A 3TDZA 1Y6WA 1DJWA 3NSIA 1TTXA 2LLTA 3CTNA 4OCIA 4OR9B 3IQQA 1DJGA 2L2EA 3RM1A 1KSMA 3MSEB 1XA5A 1CB1A 2CNPA 1WRKA 3DVMA 1WRLA 2L5XB 3A4UB 2WCMA 4PHNA 1XK4C 1CLLA 4MN0A 3ZWHA 1CKKA 2QEVA 1B8RA 3VGOA 3ZNIA 1QASA 1KK8C 2AMIA 2KI6D 1N65A 1YUUA 3LK1A 2ZRTA 5ER5A 4WQ3A 3QRXA 3B7AA 2V53A 1CNPA 2NCPA 2KFFA 3K1EA 5D69A 4PALA 1ZACA 3AAKA 1DGVA 1KFUS 1JSAA 1CM1A 3TZ1A 1J55A 1DEKA 1PVBA 1QLSA 1TNQA 2BNXA 2IS9A 2M3WA 3CZTX 4YGCB 3SG3A 1OZOA 1UWOA 1SBJA 2ISDA 2I7AA 2LMTA 1HT9A 2KOTA 3CZ2A 2KAXA 4P2YB 1A2XA 4OVNF 2LP2A 1K9UA 5D3OA 1YX7A 3IQOA 1CFFA 1J1EA 4N1GA 1LA3A 4FQOA 1FF1A 1NCYA 2QPTA 5AANA 1H4BA 2M1KB 4GAOA 2KLDA 1PALA 3WNXB 3PATA 4XJKB 2KGRA 2JT8A 2QACA 4OZDA 1D1OA 1SW8A 4OKHA 1IGVA 4P5OE 5B8IB 4XYNA 1GJYA 1C7VA 4PE4A 1LS8A 3JVTB 1U5IB 1BR1B 4MRXA 5KSZA 4MZKA 1OW4A 1S1EA 1YTZC 1Z2CB 2K7BA 3JTDC 4PE7A 1K90D 3OHMB 5I8NA 1CDMA 2KYFA 2CXJA 4HSZA 2JTTA 5K89A 3CDNA 3I5GB 1NX3A 1XFRA 3PM8A 1XK4A 1SNLA 2MRDA 1S5GZ 3DD4A 3GK2A 2NCOA 4MRYA 2H2KA 1K93D 3IVTA 1NIWA 2KQ6A 4QJ5B 3Q8IA 1JUOA 5FI7A 1IQ5A 3VRRA 1IWQA 1QWVA 3D78A 3HCMA 1NX2A 1XFZO 1XO5A 3PN7B 2BE4A 4IL1A 1S3PA 2WC8A 3B88A 3DF0B 2L0PA 4DRWA 2F2OA 3CLNA 1KWOC 4GGNA 2LLUA 3NHTA 2WC5A 2BKHB 1EL4A 2KBMA 2HETA 1OE9B 2JXCA 3CZ0A 2LLSA 1BOCA 1PK0D 1B7TZ 1T14A 3B6XA 2AAOA 1ORGA 2Q91A 3A8RA 1CFCA 1PSBA 1AP4A 1K9PA 2OS8C 3DVJA 1LA0A 1NWDA 1K95A 1MR8A 4MSPA 1UHNA 1H8BA 1S26D 3OX6A 4ORBB 2MAZA 4D1EA 2OPOA 5JJGA 4MZLA 2I2RE 4YGAA 2P71A 3BOWA 1BMOA 3S0DA 1ALVA 1MF8B 1QVIZ 4NDBA 5BPJA 1Y1UA 1CLMA 1UHJA 1YVHA 1C3YA 2PRUA 2YGUA 5HLVA 3EK7A 1SRAA 4ZCVA 3D75A 2GGZA 3WXAA 2MA2A 1ODBA 1QIWA 1CDLA 3TDUA 2KBIA 3BFAA 5AERA 1OOIX 1KK7Z 2LAPA 3TUYC 1MUXA 2K61A 1NSHA 2WCHA 5HL1A 1Z4HA 1S6JA 1JF0A 1P28A 1M31A 2LHLA 3K21A 3NGVA 5TNCA 1LVCD 5I94A 1NX1A 1IRJA 1WLZA 2K7OA 1MXLC 4I5NB 1BG1A 1JBAA 3KEVA 1IG5A 2BKIB 4ETOA 2LCPA 1B9AA 2ERBA 1WDCB 3O4YA 3O78A 5CSIA 2PASA 2ZN9A 2KQYA 1X02A 1SR6B 2QDIA 2KI4C 1SKTA 2MLEC 3BFHA 4GNKB 3GOFA 1PRWA 3ICBA 2FJUB 2G9BA 2JPTA 1F8HA 4I5KA 3SG7A 2FCEA 1XFUO 2JULA 4E68A 1SYMA 2BL0C 1UUSA 1WY9A 4NDCA 3SG4A 3TDIA 2QEBA 1S6CA 1IH0A 1SMGA 3FE9A 2RGIA 1SL7A 5F6TA 4GGFC 4FQTA 2KNEA 2E6WA 2WNDA 3D74A 1SCMC 4KYNA 1UURA 2KAYA 4PE1A 5DKNA 2LVKA 1RFJA 2K8MB 4ORCB 4N1FA 1ZUZA 5AFPA 2NZ0A 2WC6A 1LINA 1QV0A 2F3ZA 2F33A 3PSRA 2ZNEA 4JWQA 4BY4A 1DF0A 1NCZA 3CWGA 4I5LB 2A4JA 4BY5A 1K8UA 1DJIA 3KPXA 1M46A 4AOMA 1ZMZA 3SS3A 1AUIB 3I5IC 4N5XA 3PFVA 5GQQC 1B4CA 3SJSA 3AKBA 1EG4A 1GQMA 2MJWB 4C0JA 1NX0A 1YVLA 3D76A 2GGMA 2WCJA 3PLFB 3VRPA 2HF5A 2Y5IA 3RZSA 3D10A 3V2LA 1QJTA 1XFYO 4F7FA 2L4IA 2P6BB 4NDDA 2OTGC 2QEHA 3RLZA 2JTZA 3FE8A 1OSAA 2KAVA 2FOTA 4MEWA 3TS5B 3WHTB 1J7OA 4YI8A 1FBVA 3FS7A 1EJ3A 2JU0A 3KHEA 1K2HA 3LCPC 1NCXA 1IJ6A 3BYAA 2KSPA 3SS5A 4C0LA 1CDPA 1SSEB 3I5FC 4PT1A 2I18A 1XFXO 3DXLA 1QX5B 5DKRA 2E30A 1KFXL 4YGDB 2MBXA 3OB1B 2LE9B 1FI6A 1LXFC 4M2PA 1DT7B 1DJHA 4ICBA 4JPZB 3LL8B 1C7WA 1SCVA 3S0AA 1ZFSA 2HQWA 2M29A 1CMFA 1QX2A 1TIZA 1RK9A 1TCOB 4CPVA 3VRNA 1DC1A 1KK8B 2JWWA 4GGFA 2Q4UA 2KLEA 1XVJA 1SCMB 2CBLA 2L98A 5KU1A 3CABA 1B1GA 1IIOA 1BT6A 1L7ZA 1F71A 4CFQA 3DZTA 2JRFA 3OBVA 1L2OC 1HQVA 1QLKA 1W9ZA 2KDHA 1V1GA 3I5HC 4GUKA 4YGEB 4YBHB 1TNWA 1EXRA 1RJVA 3BUNB 1F4OA 3OB2B 1JC2A 2LV7A 2HPSA 1YX8A 1S5GY 3SIBA 1CFPA 2EGDA 1KQMC 5CSJA 3BUMB 2D8NA 1AK8A 1NUBA 2EC6C 1OOHA 3LK0A 5D7FA 1YUTA 4DS7A 1EH2A 4WRIA 2LP3A 3GK1A 3BJHA 4TNCA 3DVEA 2CCMA 4NQGA 1CFDA 4DCKA 1PULA 4CIDA 1FPWA 4HRGA 3BOWB 1UHIA 5I2OA 1J7QA 1FI5A 3BUOB 3OP0A 1NPQA 3PALA 4Q04A 2JNFA 1TRFA 4YRUA 3EVUA 4PHKA 2LHIA 3AKAA 3JTDB 2LMUA 1VRKA 1UP5A 1B7TY 3R1VA 1QXPA 2BECA 2LC5A 3NSLA 5KTYA 1NP8A 4FTGA 5HYDA 1W7IB 4F0ZB 2DOQA 1B47A 2LMVA 1KFUL 1RROA 2JC2A 2L4HA 1IKUA 2VRGA 2BCBA 1F55A 1QX7A 3B86A 1DTLA 2H61C 2M7LA 2JNXA 3LLEA 2BBMA 3NSKA 5CSFA 4ZCUA 2BCXA 2M9GA 1QVIY 1UHKA 3S0GA 2EHBA 2PALA 1FW4A 1S6IA 3O4XA 4PHMA 1K9KA 3L4LA 2Y4QA 1KWOB 1XYDA 1YR5A 1KK7Y 1QATA 2M0RA 4INWA 1WRZA 1GGZA 1DQEA 1IQ3A 2K2FA 3DY9A 3IF7A 1QIVA 4AQIA 1A4PA 2PYQA 1Q80A 1RECA 1JWDA 5IBWA 1DVIA 2JT3A 4C0KA
chains in the Genus database with same CATH topology
1GM0A 3V2LA 1C3ZA 4F7FA 3CZ1A 3BFBA 1OOFA 1QWVA 3D78A 1TUJA 2QEOA 2QEHA 3R72A 5EL2A 3FE8A 2P70A 4JD9A 3B88A 2JPOA 3NHTA 2WC5A 4PT1A 3DXLA 3CZ0A 3CYZA 3QMEA 1T14A 3B6XA 3R1OA 1ORGA 5DICA 3D73A 2PQLA 3L4AA 3S0AA 3S0EA 2FJYA 2WCKA 3L47A 2L2CA 2P71A 3S0DA 3CABA 1C3YA 3DZTA 3PJIA 3D75A 1OOGA 2KPHA 2WCMA 3BFAA 1OOIX 2QEVA 3FE6A 2WCHA 3N7HA 3RZSA 1P28A 3VB1A 3NGVA 1OOHA 3B7AA 3K1EA 3BJHA 2ERBA 4INXA 3S0FA 2QDIA 3BFHA 2WCLA 1TWOA 3CZ2A 3D77A 2QEBA 3R1VA 2H8VA 3FE9A 3NHIA 4OZDA 3B87A 3OGNA 4FQTA 3B86A 3D74A 3R1PA 3S0BA 1LS8A 2WC6A 3S0GA 1OW4A 3L4LA 3DYEA 3CDNA 4INWA 1XFRA 1DQEA 3DY9A 2GTEA 3D76A 2WCJA 3Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GM0 A;  3V2L A;  1C3Z A;  4F7F A;  3CZ1 A;  3BFB A;  1OOF A;  1QWV A;  3D78 A;  1TUJ A;  2QEO A;  2QEH A;  3R72 A;  5EL2 A;  3FE8 A;  2P70 A;  4JD9 A;  3B88 A;  2JPO A;  3NHT A;  2WC5 A;  4PT1 A;  3DXL A;  3CZ0 A;  3CYZ A;  3QME A;  1T14 A;  3B6X A;  3R1O A;  1ORG A;  5DIC A;  3D73 A;  2PQL A;  3L4A A;  3S0A A;  3S0E A;  2FJY A;  2WCK A;  3L47 A;  2L2C A;  2P71 A;  3S0D A;  3CAB A;  1C3Y A;  3DZT A;  3PJI A;  3D75 A;  1OOG A;  2KPH A;  2WCM A;  3BFA A;  1OOI X;  2QEV A;  3FE6 A;  2WCH A;  3N7H A;  3RZS A;  1P28 A;  3VB1 A;  3NGV A;  1OOH A;  3B7A A;  3K1E A;  3BJH A;  2ERB A;  4INX A;  3S0F A;  2QDI A;  3BFH A;  2WCL A;  1TWO A;  3CZ2 A;  3D77 A;  2QEB A;  3R1V A;  2H8V A;  3FE9 A;  3NHI A;  4OZD A;  3B87 A;  3OGN A;  4FQT A;  3B86 A;  3D74 A;  3R1P A;  3S0B A;  1LS8 A;  2WC6 A;  3S0G A;  1OW4 A;  3L4L A;  3DYE A;  3CDN A;  4INW A;  1XFR A;  1DQE A;  3DY9 A;  2GTE A;  3D76 A;  2WCJ A;  3Q8I A; 
#chains in the Genus database with same CATH topology
 1YRU B;  1C3Z A;  1RWY A;  2M7N A;  4GBA A;  1TNP A;  3JVT C;  1DGU A;  1OMD A;  2QEO A;  4YGB B;  3PM2 A;  2OS8 B;  2F8P A;  1BR4 B;  2L50 A;  2P70 A;  4JD9 A;  1TNX A;  2K7D A;  1M63 B;  1AHR A;  2JPO A;  5ER4 X;  1OQP A;  2M97 A;  1JFK A;  2O60 A;  3VRO A;  3I5G C;  2M1U A;  5HKW A;  1DF0 B;  1K94 A;  2WCF A;  2ZN8 A;  1BLQ A;  1KQV A;  3CYZ A;  1TOP A;  1ZOT B;  1NYA A;  1QTX A;  2BCA A;  3KF9 A;  1CMG A;  1MWN A;  2PVB A;  2LAN A;  3EVV A;  1OMV A;  4PE0 A;  3GK4 X;  5DIC A;  4PHJ A;  2JOJ A;  2ZND A;  4L9M A;  1Y1A A;  4WQ2 A;  3TUY B;  3EKJ A;  3L4A A;  3S0E A;  1N0Y A;  3PN7 C;  2FJY A;  2WCE A;  1J7R A;  2Y1N A;  1S36 A;  3SG6 A;  3L47 A;  2K60 A;  2K2A A;  4M2O A;  2H61 A;  2BBN A;  2KHN A;  5HLO A;  1OOJ A;  3KO0 A;  5HKZ A;  2NXQ A;  4JQ0 D;  4M2Q A;  3DVK A;  3PJI A;  1OZS A;  1TCF A;  4HRH A;  1SK6 D;  4U8D A;  2KI4 B;  3EG5 B;  4OV2 A;  4R1E A;  1OOG A;  2BAP A;  2KPH A;  1JFJ A;  4MLW A;  2O5G A;  1DEL A;  1PSR A;  5CPV A;  3CR2 A;  2LVI A;  2MHH A;  4GPL B;  4HRE E;  1EG3 A;  3EVR A;  3FE6 A;  4A4B A;  3N7H A;  1YUS A;  5I2Q A;  1BF5 A;  1F54 A;  2CTN A;  4XJK A;  2BL0 B;  3SG5 A;  3D0Y A;  3VB1 A;  3D0Y B;  1DJY A;  1G4Y R;  2MLF C;  1K96 A;  2PMY A;  2TN4 A;  1CM4 A;  4MVF A;  5J3X A;  1BU3 A;  3C1V A;  4CLN A;  1SY9 A;  4I5J A;  3H4S E;  4QJ3 B;  2PSR A;  3AAJ A;  4INX A;  3S0F A;  1U5I A;  2NLN A;  1SPY A;  2WCB A;  1DMO A;  2WOS A;  2KFH A;  1E8A A;  4JKT A;  1RTP 1;  2KGB C;  1IJ5 A;  2WCL A;  5HKY A;  3EKH A;  3SG2 A;  1G8I A;  1TWO A;  3EK8 A;  1UHH A;  1G33 A;  1WLM A;  2F3Y A;  1Y0V H;  2K0J A;  3D77 A;  5G08 A;  2LUX A;  4MZJ A;  2COL B;  2JQ6 A;  2ZKM X;  3CGA A;  5FI6 A;  3SIA A;  2H8V A;  3I5I B;  1F4Q A;  4CFR A;  2KYC A;  1YUR A;  3NHI A;  1SL8 A;  4YI9 A;  2SCP A;  1WDC C;  2M49 B;  2R2I A;  3B87 A;  3OGN A;  2K7C A;  1SR6 C;  3R1P A;  2HQ8 A;  3SS4 A;  1ALW A;  2I94 A;  1OMR A;  4AQJ A;  1B8L A;  4PCW A;  2BE6 A;  3DF0 A;  1C07 A;  3S0B A;  2LM5 A;  1MQ1 A;  2CT9 A;  5FYX A;  1DJZ A;  2OTG B;  3F45 A;  1CDN A;  1J7P A;  1AVS A;  3O6B A;  2KI6 C;  1A29 A;  1JF2 A;  1W7J B;  1SL9 A;  3WHU B;  3CS1 A;  1N2D A;  3VRQ A;  3UNW A;  3DYE A;  1QV1 A;  2JZI A;  4PDZ A;  2LNK A;  3CR5 X;  2ZRS A;  1QS7 A;  4ORA B;  3I5F B;  3UO9 A;  4A4C A;  1MXE A;  1Y1X A;  1KFX S;  2GTE A;  4DIR A;  1KCY A;  2L51 A;  2LVJ A;  1GGW A;  2FCD A;  2L5Y A;  1M45 A;  1CLB A;  1TUZ A;  1GM0 A;  1KSO A;  3CZ1 A;  3BFB A;  1OOF A;  3OX5 A;  1TUJ A;  2WOR A;  4USL A;  3R72 A;  3BUW B;  5EL2 A;  3EK4 A;  5CSN A;  2B1U A;  3NXA A;  4QJ4 B;  5AEQ A;  1R6P A;  1YRT B;  4MBE A;  5DKQ A;  2AUC A;  1LKJ A;  1R2U A;  3FWB A;  2JT0 A;  5FI2 A;  2G2B A;  2Y1M A;  3BXK A;  1BJF A;  1V1F A;  1A75 A;  1L2O B;  2F2P A;  2KFG A;  4DUQ A;  1A75 B;  2M8U A;  3I5H B;  4IJ7 A;  1J1D A;  3QME A;  5I2L A;  2GV5 A;  5JOL A;  1AJ4 A;  1CTR A;  1PVA A;  3NSO A;  1XFW O;  3HX4 A;  3R1O A;  1BOD A;  3BUX B;  2LUC A;  2JXL A;  3D73 A;  5AXI A;  2PQL A;  3M0W A;  1MHO A;  4GFT A;  2LVV A;  3BQ3 A;  1M39 A;  2WCK A;  1DJX A;  5PAL A;  2ZFD A;  1KQM B;  2SAS A;  3CR4 X;  3E3R A;  2L2C A;  3FIA A;  1B8C A;  1TN4 A;  2EC6 B;  3TS5 C;  4UPG A;  1AJ5 A;  1F70 A;  3O2P A;  3FWC A;  1XFV O;  1A03 A;  3TDZ A;  1Y6W A;  1DJW A;  3NSI A;  1TTX A;  2LLT A;  3CTN A;  4OCI A;  4OR9 B;  3IQQ A;  1DJG A;  2L2E A;  3RM1 A;  1KSM A;  3MSE B;  1XA5 A;  1CB1 A;  2CNP A;  1WRK A;  3DVM A;  1WRL A;  2L5X B;  3A4U B;  2WCM A;  4PHN A;  1XK4 C;  1CLL A;  4MN0 A;  3ZWH A;  1CKK A;  2QEV A;  1B8R A;  3VGO A;  3ZNI A;  1QAS A;  1KK8 C;  2AMI A;  2KI6 D;  1N65 A;  1YUU A;  3LK1 A;  2ZRT A;  5ER5 A;  4WQ3 A;  3QRX A;  3B7A A;  2V53 A;  1CNP A;  2NCP A;  2KFF A;  3K1E A;  5D69 A;  4PAL A;  1ZAC A;  3AAK A;  1DGV A;  1KFU S;  1JSA A;  1CM1 A;  3TZ1 A;  1J55 A;  1DEK A;  1PVB A;  1QLS A;  1TNQ A;  2BNX A;  2IS9 A;  2M3W A;  3CZT X;  4YGC B;  3SG3 A;  1OZO A;  1UWO A;  1SBJ A;  2ISD A;  2I7A A;  2LMT A;  1HT9 A;  2KOT A;  3CZ2 A;  2KAX A;  4P2Y B;  1A2X A;  4OVN F;  2LP2 A;  1K9U A;  5D3O A;  1YX7 A;  3IQO A;  1CFF A;  1J1E A;  4N1G A;  1LA3 A;  4FQO A;  1FF1 A;  1NCY A;  2QPT A;  5AAN A;  1H4B A;  2M1K B;  4GAO A;  2KLD A;  1PAL A;  3WNX B;  3PAT A;  4XJK B;  2KGR A;  2JT8 A;  2QAC A;  4OZD A;  1D1O A;  1SW8 A;  4OKH A;  1IGV A;  4P5O E;  5B8I B;  4XYN A;  1GJY A;  1C7V A;  4PE4 A;  1LS8 A;  3JVT B;  1U5I B;  1BR1 B;  4MRX A;  5KSZ A;  4MZK A;  1OW4 A;  1S1E A;  1YTZ C;  1Z2C B;  2K7B A;  3JTD C;  4PE7 A;  1K90 D;  3OHM B;  5I8N A;  1CDM A;  2KYF A;  2CXJ A;  4HSZ A;  2JTT A;  5K89 A;  3CDN A;  3I5G B;  1NX3 A;  1XFR A;  3PM8 A;  1XK4 A;  1SNL A;  2MRD A;  1S5G Z;  3DD4 A;  3GK2 A;  2NCO A;  4MRY A;  2H2K A;  1K93 D;  3IVT A;  1NIW A;  2KQ6 A;  4QJ5 B;  3Q8I A;  1JUO A;  5FI7 A;  1IQ5 A;  3VRR A;  1IWQ A;  1QWV A;  3D78 A;  3HCM A;  1NX2 A;  1XFZ O;  1XO5 A;  3PN7 B;  2BE4 A;  4IL1 A;  1S3P A;  2WC8 A;  3B88 A;  3DF0 B;  2L0P A;  4DRW A;  2F2O A;  3CLN A;  1KWO C;  4GGN A;  2LLU A;  3NHT A;  2WC5 A;  2BKH B;  1EL4 A;  2KBM A;  2HET A;  1OE9 B;  2JXC A;  3CZ0 A;  2LLS A;  1BOC A;  1PK0 D;  1B7T Z;  1T14 A;  3B6X A;  2AAO A;  1ORG A;  2Q91 A;  3A8R A;  1CFC A;  1PSB A;  1AP4 A;  1K9P A;  2OS8 C;  3DVJ A;  1LA0 A;  1NWD A;  1K95 A;  1MR8 A;  4MSP A;  1UHN A;  1H8B A;  1S26 D;  3OX6 A;  4ORB B;  2MAZ A;  4D1E A;  2OPO A;  5JJG A;  4MZL A;  2I2R E;  4YGA A;  2P71 A;  3BOW A;  1BMO A;  3S0D A;  1ALV A;  1MF8 B;  1QVI Z;  4NDB A;  5BPJ A;  1Y1U A;  1CLM A;  1UHJ A;  1YVH A;  1C3Y A;  2PRU A;  2YGU A;  5HLV A;  3EK7 A;  1SRA A;  4ZCV A;  3D75 A;  2GGZ A;  3WXA A;  2MA2 A;  1ODB A;  1QIW A;  1CDL A;  3TDU A;  2KBI A;  3BFA A;  5AER A;  1OOI X;  1KK7 Z;  2LAP A;  3TUY C;  1MUX A;  2K61 A;  1NSH A;  2WCH A;  5HL1 A;  1Z4H A;  1S6J A;  1JF0 A;  1P28 A;  1M31 A;  2LHL A;  3K21 A;  3NGV A;  5TNC A;  1LVC D;  5I94 A;  1NX1 A;  1IRJ A;  1WLZ A;  2K7O A;  1MXL C;  4I5N B;  1BG1 A;  1JBA A;  3KEV A;  1IG5 A;  2BKI B;  4ETO A;  2LCP A;  1B9A A;  2ERB A;  1WDC B;  3O4Y A;  3O78 A;  5CSI A;  2PAS A;  2ZN9 A;  2KQY A;  1X02 A;  1SR6 B;  2QDI A;  2KI4 C;  1SKT A;  2MLE C;  3BFH A;  4GNK B;  3GOF A;  1PRW A;  3ICB A;  2FJU B;  2G9B A;  2JPT A;  1F8H A;  4I5K A;  3SG7 A;  2FCE A;  1XFU O;  2JUL A;  4E68 A;  1SYM A;  2BL0 C;  1UUS A;  1WY9 A;  4NDC A;  3SG4 A;  3TDI A;  2QEB A;  1S6C A;  1IH0 A;  1SMG A;  3FE9 A;  2RGI A;  1SL7 A;  5F6T A;  4GGF C;  4FQT A;  2KNE A;  2E6W A;  2WND A;  3D74 A;  1SCM C;  4KYN A;  1UUR A;  2KAY A;  4PE1 A;  5DKN A;  2LVK A;  1RFJ A;  2K8M B;  4ORC B;  4N1F A;  1ZUZ A;  5AFP A;  2NZ0 A;  2WC6 A;  1LIN A;  1QV0 A;  2F3Z A;  2F33 A;  3PSR A;  2ZNE A;  4JWQ A;  4BY4 A;  1DF0 A;  1NCZ A;  3CWG A;  4I5L B;  2A4J A;  4BY5 A;  1K8U A;  1DJI A;  3KPX A;  1M46 A;  4AOM A;  1ZMZ A;  3SS3 A;  1AUI B;  3I5I C;  4N5X A;  3PFV A;  5GQQ C;  1B4C A;  3SJS A;  3AKB A;  1EG4 A;  1GQM A;  2MJW B;  4C0J A;  1NX0 A;  1YVL A;  3D76 A;  2GGM A;  2WCJ A;  3PLF B;  3VRP A;  2HF5 A;  2Y5I A;  3RZS A;  3D10 A;  3V2L A;  1QJT A;  1XFY O;  4F7F A;  2L4I A;  2P6B B;  4NDD A;  2OTG C;  2QEH A;  3RLZ A;  2JTZ A;  3FE8 A;  1OSA A;  2KAV A;  2FOT A;  4MEW A;  3TS5 B;  3WHT B;  1J7O A;  4YI8 A;  1FBV A;  3FS7 A;  1EJ3 A;  2JU0 A;  3KHE A;  1K2H A;  3LCP C;  1NCX A;  1IJ6 A;  3BYA A;  2KSP A;  3SS5 A;  4C0L A;  1CDP A;  1SSE B;  3I5F C;  4PT1 A;  2I18 A;  1XFX O;  3DXL A;  1QX5 B;  5DKR A;  2E30 A;  1KFX L;  4YGD B;  2MBX A;  3OB1 B;  2LE9 B;  1FI6 A;  1LXF C;  4M2P A;  1DT7 B;  1DJH A;  4ICB A;  4JPZ B;  3LL8 B;  1C7W A;  1SCV A;  3S0A A;  1ZFS A;  2HQW A;  2M29 A;  1CMF A;  1QX2 A;  1TIZ A;  1RK9 A;  1TCO B;  4CPV A;  3VRN A;  1DC1 A;  1KK8 B;  2JWW A;  4GGF A;  2Q4U A;  2KLE A;  1XVJ A;  1SCM B;  2CBL A;  2L98 A;  5KU1 A;  3CAB A;  1B1G A;  1IIO A;  1BT6 A;  1L7Z A;  1F71 A;  4CFQ A;  3DZT A;  2JRF A;  3OBV A;  1L2O C;  1HQV A;  1QLK A;  1W9Z A;  2KDH A;  1V1G A;  3I5H C;  4GUK A;  4YGE B;  4YBH B;  1TNW A;  1EXR A;  1RJV A;  3BUN B;  1F4O A;  3OB2 B;  1JC2 A;  2LV7 A;  2HPS A;  1YX8 A;  1S5G Y;  3SIB A;  1CFP A;  2EGD A;  1KQM C;  5CSJ A;  3BUM B;  2D8N A;  1AK8 A;  1NUB A;  2EC6 C;  1OOH A;  3LK0 A;  5D7F A;  1YUT A;  4DS7 A;  1EH2 A;  4WRI A;  2LP3 A;  3GK1 A;  3BJH A;  4TNC A;  3DVE A;  2CCM A;  4NQG A;  1CFD A;  4DCK A;  1PUL A;  4CID A;  1FPW A;  4HRG A;  3BOW B;  1UHI A;  5I2O A;  1J7Q A;  1FI5 A;  3BUO B;  3OP0 A;  1NPQ A;  3PAL A;  4Q04 A;  2JNF A;  1TRF A;  4YRU A;  3EVU A;  4PHK A;  2LHI A;  3AKA A;  3JTD B;  2LMU A;  1VRK A;  1UP5 A;  1B7T Y;  3R1V A;  1QXP A;  2BEC A;  2LC5 A;  3NSL A;  5KTY A;  1NP8 A;  4FTG A;  5HYD A;  1W7I B;  4F0Z B;  2DOQ A;  1B47 A;  2LMV A;  1KFU L;  1RRO A;  2JC2 A;  2L4H A;  1IKU A;  2VRG A;  2BCB A;  1F55 A;  1QX7 A;  3B86 A;  1DTL A;  2H61 C;  2M7L A;  2JNX A;  3LLE A;  2BBM A;  3NSK A;  5CSF A;  4ZCU A;  2BCX A;  2M9G A;  1QVI Y;  1UHK A;  3S0G A;  2EHB A;  2PAL A;  1FW4 A;  1S6I A;  3O4X A;  4PHM A;  1K9K A;  3L4L A;  2Y4Q A;  1KWO B;  1XYD A;  1YR5 A;  1KK7 Y;  1QAT A;  2M0R A;  4INW A;  1WRZ A;  1GGZ A;  1DQE A;  1IQ3 A;  2K2F A;  3DY9 A;  3IF7 A;  1QIV A;  4AQI A;  1A4P A;  2PYQ A;  1Q80 A;  1REC A;  1JWD A;  5IBW A;  1DVI A;  2JT3 A;  4C0K A; 
#chains in the Genus database with same CATH homology
 1GM0 A;  3V2L A;  1C3Z A;  4F7F A;  3CZ1 A;  3BFB A;  1OOF A;  1QWV A;  3D78 A;  1TUJ A;  2QEO A;  2QEH A;  3R72 A;  5EL2 A;  3FE8 A;  2P70 A;  4JD9 A;  3B88 A;  2JPO A;  3NHT A;  2WC5 A;  4PT1 A;  3DXL A;  3CZ0 A;  3CYZ A;  3QME A;  1T14 A;  3B6X A;  3R1O A;  1ORG A;  5DIC A;  3D73 A;  2PQL A;  3L4A A;  3S0A A;  3S0E A;  2FJY A;  2WCK A;  3L47 A;  2L2C A;  2P71 A;  3S0D A;  3CAB A;  1C3Y A;  3DZT A;  3PJI A;  3D75 A;  1OOG A;  2KPH A;  2WCM A;  3BFA A;  1OOI X;  2QEV A;  3FE6 A;  2WCH A;  3N7H A;  3RZS A;  1P28 A;  3VB1 A;  3NGV A;  1OOH A;  3B7A A;  3K1E A;  3BJH A;  2ERB A;  4INX A;  3S0F A;  2QDI A;  3BFH A;  2WCL A;  1TWO A;  3CZ2 A;  3D77 A;  2QEB A;  3R1V A;  2H8V A;  3FE9 A;  3NHI A;  4OZD A;  3B87 A;  3OGN A;  4FQT A;  3B86 A;  3D74 A;  3R1P A;  3S0B A;  1LS8 A;  2WC6 A;  3S0G A;  1OW4 A;  3L4L A;  3DYE A;  3CDN A;  4INW A;  1XFR A;  1DQE A;  3DY9 A;  2GTE A;  3D76 A;  2WCJ A;  3Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...