1GM0A

A form of the pheromone-binding protein from bombyx mori
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure Reveals Novel Intramolecular Regulation Mechanism for Pheromone-Binding and Release
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
molecule keywords PHEROMONE-BINDING PROTEIN
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1gm0A00
2PQLA 3FE8A 5DICA 3S0BA 2P71A 3L47A 2P70A 2QEBA 2WCLA 3L4AA 2JPOA 3CZ1A 4PT1A 1LS8A 1T14A 3R72A 3CYZA 1GM0A 3NHTA 3N7HA 1TWOA 2ERBA 1OOIX 4INWA 2WCKA 2QEOA 3BFAA 4F7FA 3S0GA 3BFBA 4OZDA 1C3ZA 3D77A 1OOGA 2KPHA 4JD9A 3RZSA 2GTEA 2WC5A 3D73A 3S0FA 3B86A 2QEVA 3R1PA 2WCJA 3D75A 3B6XA 3DYEA 3R1OA 2QEHA 1XFRA 3K1EA 3NHIA 1OW4A 3D74A 1ORGA 3B87A 3CABA 3QMEA 3CDNA 2L2CA 4FQTA 1P28A 2H8VA 3S0AA 3OGNA 1OOFA 3PJIA 3S0DA 4INXA 3NGVA 3DXLA 3VB1A 3DY9A 3CZ0A 3R1VA 2WC6A 3B7AA 3CZ2A 3V2LA 2WCHA 3BJHA 3BFHA 2FJYA 1OOHA 3FE6A 3FE9A 1C3YA 3L4LA 5EL2A 3B88A 3S0EA 3DZTA 3D76A 2QDIA 1TUJA 1QWVA 3Q8IA 3D78A 1DQEA 2WCMA
chains in the Genus database with same CATH superfamily
4PALA 2F3ZA 2WC8A 1JFKA 2I2RE 1SR6B 1VRKA 2PMYA 1F4OA 2JU0A 5KSZA 1PK0D 4R1EA 1F70A 1TNWA 1OOJA 2BCAA 2Q91A 3L47A 1NCZA 1CKKA 1MWNA 1QLSA 4JQ0D 3M0WA 5D69A 1ODBA 2QEBA 1SL9A 1D1OA 2OTGB 3WHTB 1B7TY 1JFJA 2JPOA 1V1FA 1AVSA 1G33A 3CZ1A 1N65A 4MN0A 1T14A 1M46A 1DVIA 1KQVA 2PYQA 1B8RA 3ZWHA 3DVMA 1CMGA 1IH0A 2M8UA 2WOSA 1A75B 5HYDA 1QS7A 2LE9B 3BUMB 1S6IA 2LC5A 3VGOA 1QX2A 1JF2A 3EKJA 2KSPA 5TNCA 1DJHA 2ISDA 1K2HA 4I5JA 4INWA 3TZ1A 1YUSA 1BR1B 1XK4A 4U8DA 1RWYA 1K95A 1OMRA 1TCFA 3SJSA 2FCDA 1FI5A 3EKHA 1R2UA 1RROA 2TN4A 3OBVA 2LCPA 4OR9B 2KFGA 3S0GA 4MEWA 1UURA 2OPOA 1XFVO 4MRXA 4OKHA 3O2PA 4QJ5B 3QRXA 1DGVA 1A2XA 2L4IA 1YRTB 1TNPA 3AAKA 2E6WA 3I5HB 4AQJA 3D77A 3KPXA 5KU1A 2MRDA 1QATA 3BYAA 2KPHA 1KK7Z 1WRKA 5CSFA 3RM1A 1NX3A 3PATA 3RZSA 1M31A 1DJXA 3OX5A 3SS5A 1C7VA 3D73A 1DEKA 4MRYA 1XO5A 2ZRTA 2LMVA 1J7QA 1CM1A 1S26D 3B86A 3PSRA 2FCEA 2KQ6A 4JWQA 1XFWO 3BOWB 4D1EA 3B6XA 2LLSA 1DMOA 4F0ZB 1V1GA 1WDCB 1XFRA 5HKWA 3SIBA 1JF0A 3O4YA 1QIWA 1S36A 5GQQC 1BMOA 1UWOA 3D74A 3B87A 1B47A 4HSZA 2M97A 3K21A 1B9AA 2K0JA 1AHRA 1YR5A 1K96A 4FQOA 2H8VA 4MZJA 1BLQA 1ZOTB 3OB2B 1PSBA 1KCYA 4NDBA 5AXIA 1KQMC 3MSEB 1J55A 1UUSA 1SR6C 2KBIA 3A4UB 1F8HA 3DY9A 1W9ZA 3KEVA 2BE6A 4DIRA 3R1VA 3TUYC 2ZN8A 3CTNA 4YGDB 3SS3A 3CZ2A 4Q04A 1CTRA 1LA0A 2WCHA 3FS7A 2CTNA 1RK9A 1AJ4A 2FJYA 2FOTA 2PALA 3LK0A 3PM8A 2RGIA 4L9MA 1BJFA 1HT9A 3FE6A 1C3YA 1XK4C 2NXQA 1CDNA 4MZKA 1B4CA 2ZKMX 1F71A 1M63B 3SG3A 2G9BA 1IG5A 1H4BA 1AJ5A 3WHUB 3DZTA 2NCPA 1TUJA 2GGMA 2JXLA 3NSKA 4XYNA 1A4PA 1OZSA 1YTZC 2LP3A 1U5IA 1KFXL 1UHJA 1DQEA 2F3YA 3UNWA 4M2OA 1BF5A 2BCBA 1G8IA 3ICBA 1CMFA 2Y5IA 3ZNIA 2PQLA 2Q4UA 1DELA 2M49B 4ETOA 1Q80A 2BKIB 1K9PA 4I5LB 1CFCA 2AMIA 3PALA 4NQGA 1CFPA 2I94A 3CR5X 2L5YA 1WY9A 2P70A 5AERA 1AP4A 5G08A 1UHKA 2I18A 1LINA 2K2FA 3OHMB 1DJWA 1HQVA 1PALA 2KFFA 1B1GA 1B8LA 3WXAA 2M7LA 1LS8A 5I2LA 5PALA 1ZMZA 3SIAA 2K60A 2M1UA 5D3OA 1TUZA 1GM0A 2JTTA 1RJVA 4NDDA 2L50A 5FI2A 1KSOA 3SG2A 1NUBA 3DVKA 2K7DA 4ORCB 1LKJA 2CXJA 2ERBA 3KHEA 1JSAA 1EG3A 1C7WA 1Y1XA 2JT0A 5I8NA 1DJGA 1SY9A 2HQWA 4YBHB 5DKNA 3EG5B 2VRGA 3O4XA 1S1EA 1C07A 1YVLA 4YI8A 1KSMA 4CIDA 1MXLC 1M39A 1W7JB 3EK8A 4GAOA 2WORA 1SCVA 2JWWA 1SCMC 1MF8B 3CLNA 4OCIA 2SCPA 2MBXA 1OMDA 3HCMA 1TIZA 2KNEA 4MLWA 4I5KA 1SSEB 4UPGA 1S5GY 1QVIY 1QTXA 4PE7A 5JOLA 5DKQA 4C0LA 1ZACA 2H2KA 2LVJA 2E30A 1OZOA 1F4QA 2L4HA 3UO9A 3R1PA 1UHNA 2MJWB 1NP8A 2WCJA 4XJKB 4WQ2A 1KK8B 2KGBC 3SG5A 1UP5A 2JT8A 2L98A 1A03A 1BOCA 1SMGA 2PSRA 1OW4A 1OQPA 2BKHB 4PCWA 5HL1A 1XVJA 2JNXA 2BECA 1LXFC 1TN4A 4I5NB 1WDCC 1CB1A 2AUCA 3JVTC 3WNXB 1EG4A 4XJKA 5D7FA 3TDZA 2WCEA 2KLDA 2K7BA 4CPVA 1IKUA 3NSLA 1OOFA 3GOFA 1IGVA 1DGUA 3PJIA 4M2QA 1J7RA 3S0DA 1KFUS 4INXA 3TUYB 4AQIA 2K2AA 3BQ3A 3DXLA 1PVAA 3VB1A 2Y1NA 3IVTA 2L51A 1QVIZ 1YX8A 1YX7A 4OVNF 3VRNA 3EVRA 2SASA 2LVKA 3OB1B 3BJHA 1FW4A 2P6BB 1DJYA 2JT3A 3BFHA 2M9GA 4MVFA 4PHNA 4WQ3A 4AOMA 1OOHA 3FE9A 5HKYA 1JBAA 1NX1A 3DD4A 1TCOB 3I5HC 1J1EA 3VRQA 1KWOB 5IBWA 3CWGA 3GK4X 4PE4A 4CFRA 1OSAA 2LMTA 1SL8A 2QDIA 3DF0A 1ZUZA 1CLBA 4A4BA 4GGFC 2F8PA 5I94A 3HX4A 3LLEA 2BAPA 3PFVA 2M29A 2JRFA 2EGDA 3CR2A 1NWDA 2MLEC 3SG6A 1N2DA 2O60A 4NDCA 1GGZA 1A29A 1LVCD 3A8RA 1WRLA 3S0BA 1GJYA 2P71A 5AANA 1NCXA 3LL8B 5FI7A 3GK1A 4QJ3B 3SS4A 1FF1A 2NZ0A 4MSPA 3NSOA 2LNKA 1F54A 1NIWA 3E3RA 1AK8A 1Z2CB 1EH2A 3BUNB 4PT1A 2KLEA 1IWQA 1L2OC 4MZLA 3CYZA 2KI4B 1XFXO 3JVTB 2JXCA 1IJ6A 3OX6A 1UHIA 4ORAB 3O78A 3NHTA 1IRJA 1DTLA 2COLB 5AEQA 1TWOA 1FBVA 3VRPA 5I2QA 5JJGA 2LUXA 1IQ3A 1TTXA 1K93D 3IQOA 3EVUA 3PN7C 5K89A 2QACA 4GBAA 2Y1MA 2WCKA 1QX5B 2QEOA 1FI6A 3AAJA 3FIAA 2BL0C 2LMUA 3BFAA 1BODA 1CDLA 2KAYA 4F7FA 2LUCA 2LANA 2EHBA 3BFBA 3D0YA 2BBMA 4N1GA 1KQMB 2WNDA 3I5IC 1C3ZA 1YVHA 2L5XB 1SCMB 1ZFSA 4GPLB 1SYMA 1DJIA 2WCFA 4ORBB 4ICBA 1U5IB 2R2IA 2LAPA 1TRFA 1KK8C 3CGAA 1KFUL 5J3XA 4CLNA 4HREE 3S0FA 2QEVA 2LLUA 2ZN9A 1S5GZ 3D75A 4KYNA 2M3WA 4GUKA 3TS5B 5ER4X 2QEHA 1QV1A 1YURA 3BUOB 3K1EA 2MLFC 5CPVA 1QIVA 3D10A 1PRWA 5KTYA 4BY4A 1QX7A 2MAZA 3QMEA 2KFHA 3CZTX 1EL4A 2IS9A 1DF0B 2L2CA 1J7PA 2D8NA 2HQ8A 1P28A 1CDPA 2Y4QA 3OGNA 2CBLA 2KYFA 1K9KA 1YUTA 1DF0A 2EC6B 1QLKA 2LLTA 4ZCUA 2LP2A 3OP0A 4E68A 2KGRA 1SW8A 2LVVA 4HRGA 5B8IB 1E8AA 2F2OA 3TS5C 2NLNA 1JC2A 3AKAA 2KQYA 2WC6A 4YGBB 1NSHA 3B7AA 1BT6A 1XFZO 1KK7Y 2AAOA 3TDIA 3V2LA 1WLMA 4A4CA 1FPWA 1DT7B 1MQ1A 1EXRA 2HF5A 4CFQA 3F45A 1SKTA 2LV7A 1DC1A 1CDMA 3BUXB 1YRUB 2HETA 1AUIB 1JUOA 5EL2A 2A4JA 3B88A 4C0KA 2LVIA 4YI9A 3DVJA 1XYDA 2PASA 3D76A 2NCOA 5HLOA 3TDUA 4HRHA 1JWDA 1Y0VH 2B1UA 3D0YB 1QWVA 3Q8IA 1MUXA 1IJ5A 2CNPA 1YUUA 3JTDB 4GNKB 4PHMA 1NX0A 1PSRA 2KBMA 1DJZA 1G4YR 2KHNA 2WCMA 4DCKA 1SL7A 2DOQA 3C1VA 1CFDA 1X02A 2ZFDA 2PVBA 2BBNA 3FE8A 5DICA 4MBEA 2KDHA 1IIOA 4PE0A 1TOPA 2JULA 1MR8A 1XFUO 2GGZA 3AKBA 1Y1AA 1L2OB 2WCLA 3L4AA 3NSIA 1NX2A 2KI4C 5HLVA 2HPSA 2F2PA 2JQ6A 3I5FC 5CSNA 1W7IB 2O5GA 3R72A 1CM4A 4GGFA 2G2BA 1NPQA 2K7CA 2BNXA 3CR4X 1QJTA 2K61A 3BXKA 3I5GC 4YGAA 1R6PA 2KI6D 3N7HA 4FTGA 2QPTA 3LK1A 3H4SE 4DRWA 4USLA 1BR4B 1A75A 1OOIX 4GFTA 4WRIA 2BL0B 4P2YB 4PHJA 1TNQA 2PRUA 2BE4A 4ZCVA 1EJ3A 1TNXA 1CFFA 3IF7A 1K9UA 1RFJA 2I7AA 4BY5A 1NYAA 5DKRA 5BPJA 3KO0A 4OV2A 2ZNDA 2CCMA 2F33A 3PN7B 1SBJA 3CS1A 2KOTA 1RTP1 3DF0B 1NCYA 1LA3A 1QV0A 1RECA 1S6JA 3IQQA 4OZDA 3SG4A 2JOJA 1OOGA 2KAVA 4M2PA 1PULA 2YGUA 3I5FB 4P5OE 1SK6D 1SNLA 5FYXA 5FI6A 4JD9A 4YRUA 2GTEA 5F6TA 4DUQA 1ALVA 4C0JA 2WC5A 4PE1A 2JC2A 1QXPA 3FWCA 3JTDC 2BCXA 2JTZA 1Y1UA 3BOWA 1UHHA 4IL1A 3DYEA 2MHHA 3R1OA 1MHOA 2K7OA 3NHIA 1K90D 3NXAA 5I2OA 2M7NA 4DS7A 3O6BA 1KFXS 1F55A 3EK7A 1M45A 2M0RA 4GGNA 1J1DA 2M1KB 1ORGA 1XA5A 2EC6C 2JPTA 2KAXA 3CABA 1GQMA 3CDNA 1PVBA 2OS8B 4FQTA 3VROA 3DVEA 4YGCB 1OMVA 1SPYA 3S0AA 1K94A 5CSIA 1GGWA 4IJ7A 1OE9B 2V53A 5CSJA 1L7ZA 2WCBA 4N5XA 3KF9A 1KWOC 1N0YA 3VRRA 2ZRSA 1K8UA 1SRAA 3NGVA 2K8MB 4JKTA 1CNPA 2KYCA 3CZ0A 1WLZA 3FWBA 1S6CA 3LCPC 2KI6C 5AFPA 2L0PA 5ER5A 1Y6WA 2ZNEA 3EK4A 1QASA 1J7OA 2LHIA 1B8CA 3SG7A 2OS8C 3PM2A 3RLZA 4QJ4B 1Z4HA 4YGEB 2JNFA 1B7TZ 2CT9A 3I5IB 1CLMA 3L4LA 2LHLA 2FJUB 3I5GB 1BU3A 3S0EA 1S3PA 2L2EA 5HKZA 2MA2A 4N1FA 1ALWA 2OTGC 1CLLA 2GV5A 1BG1A 4PDZA 2JZIA 4PHKA 4JPZB 3GK2A 3PLFB 4TNCA 1H8BA 1IQ5A 1MXEA 3BUWB 2LM5A 3D78A 1XFYO 3EVVA 2H61C 1WRZA 2H61A
chains in the Genus database with same CATH topology
2PQLA 3FE8A 5DICA 3S0BA 2P71A 3L47A 2P70A 2QEBA 2WCLA 3L4AA 2JPOA 3CZ1A 4PT1A 1LS8A 1T14A 3R72A 3CYZA 1GM0A 3NHTA 3N7HA 1TWOA 2ERBA 1OOIX 4INWA 2WCKA 2QEOA 3BFAA 4F7FA 3S0GA 3BFBA 4OZDA 1C3ZA 3D77A 1OOGA 2KPHA 4JD9A 3RZSA 2GTEA 2WC5A 3D73A 3S0FA 3B86A 2QEVA 3R1PA 2WCJA 3D75A 3B6XA 3DYEA 3R1OA 2QEHA 1XFRA 3K1EA 3NHIA 1OW4A 3D74A 1ORGA 3B87A 3CABA 3QMEA 3CDNA 2L2CA 4FQTA 1P28A 2H8VA 3S0AA 3OGNA 1OOFA 3PJIA 3S0DA 4INXA 3NGVA 3DXLA 3VB1A 3DY9A 3CZ0A 3R1VA 2WC6A 3B7AA 3CZ2A 3V2LA 2WCHA 3BJHA 3BFHA 2FJYA 1OOHA 3FE6A 3FE9A 1C3YA 3L4LA 5EL2A 3B88A 3S0EA 3DZTA 3D76A 2QDIA 1TUJA 1QWVA 3Q8IA 3D78A 1DQEA 2WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQL A;  3FE8 A;  5DIC A;  3S0B A;  2P71 A;  3L47 A;  2P70 A;  2QEB A;  2WCL A;  3L4A A;  2JPO A;  3CZ1 A;  4PT1 A;  1LS8 A;  1T14 A;  3R72 A;  3CYZ A;  1GM0 A;  3NHT A;  3N7H A;  1TWO A;  2ERB A;  1OOI X;  4INW A;  2WCK A;  2QEO A;  3BFA A;  4F7F A;  3S0G A;  3BFB A;  4OZD A;  1C3Z A;  3D77 A;  1OOG A;  2KPH A;  4JD9 A;  3RZS A;  2GTE A;  2WC5 A;  3D73 A;  3S0F A;  3B86 A;  2QEV A;  3R1P A;  2WCJ A;  3D75 A;  3B6X A;  3DYE A;  3R1O A;  2QEH A;  1XFR A;  3K1E A;  3NHI A;  1OW4 A;  3D74 A;  1ORG A;  3B87 A;  3CAB A;  3QME A;  3CDN A;  2L2C A;  4FQT A;  1P28 A;  2H8V A;  3S0A A;  3OGN A;  1OOF A;  3PJI A;  3S0D A;  4INX A;  3NGV A;  3DXL A;  3VB1 A;  3DY9 A;  3CZ0 A;  3R1V A;  2WC6 A;  3B7A A;  3CZ2 A;  3V2L A;  2WCH A;  3BJH A;  3BFH A;  2FJY A;  1OOH A;  3FE6 A;  3FE9 A;  1C3Y A;  3L4L A;  5EL2 A;  3B88 A;  3S0E A;  3DZT A;  3D76 A;  2QDI A;  1TUJ A;  1QWV A;  3Q8I A;  3D78 A;  1DQE A;  2WCM A; 
#chains in the Genus database with same CATH topology
 4PAL A;  2F3Z A;  2WC8 A;  1JFK A;  2I2R E;  1SR6 B;  1VRK A;  2PMY A;  1F4O A;  2JU0 A;  5KSZ A;  1PK0 D;  4R1E A;  1F70 A;  1TNW A;  1OOJ A;  2BCA A;  2Q91 A;  3L47 A;  1NCZ A;  1CKK A;  1MWN A;  1QLS A;  4JQ0 D;  3M0W A;  5D69 A;  1ODB A;  2QEB A;  1SL9 A;  1D1O A;  2OTG B;  3WHT B;  1B7T Y;  1JFJ A;  2JPO A;  1V1F A;  1AVS A;  1G33 A;  3CZ1 A;  1N65 A;  4MN0 A;  1T14 A;  1M46 A;  1DVI A;  1KQV A;  2PYQ A;  1B8R A;  3ZWH A;  3DVM A;  1CMG A;  1IH0 A;  2M8U A;  2WOS A;  1A75 B;  5HYD A;  1QS7 A;  2LE9 B;  3BUM B;  1S6I A;  2LC5 A;  3VGO A;  1QX2 A;  1JF2 A;  3EKJ A;  2KSP A;  5TNC A;  1DJH A;  2ISD A;  1K2H A;  4I5J A;  4INW A;  3TZ1 A;  1YUS A;  1BR1 B;  1XK4 A;  4U8D A;  1RWY A;  1K95 A;  1OMR A;  1TCF A;  3SJS A;  2FCD A;  1FI5 A;  3EKH A;  1R2U A;  1RRO A;  2TN4 A;  3OBV A;  2LCP A;  4OR9 B;  2KFG A;  3S0G A;  4MEW A;  1UUR A;  2OPO A;  1XFV O;  4MRX A;  4OKH A;  3O2P A;  4QJ5 B;  3QRX A;  1DGV A;  1A2X A;  2L4I A;  1YRT B;  1TNP A;  3AAK A;  2E6W A;  3I5H B;  4AQJ A;  3D77 A;  3KPX A;  5KU1 A;  2MRD A;  1QAT A;  3BYA A;  2KPH A;  1KK7 Z;  1WRK A;  5CSF A;  3RM1 A;  1NX3 A;  3PAT A;  3RZS A;  1M31 A;  1DJX A;  3OX5 A;  3SS5 A;  1C7V A;  3D73 A;  1DEK A;  4MRY A;  1XO5 A;  2ZRT A;  2LMV A;  1J7Q A;  1CM1 A;  1S26 D;  3B86 A;  3PSR A;  2FCE A;  2KQ6 A;  4JWQ A;  1XFW O;  3BOW B;  4D1E A;  3B6X A;  2LLS A;  1DMO A;  4F0Z B;  1V1G A;  1WDC B;  1XFR A;  5HKW A;  3SIB A;  1JF0 A;  3O4Y A;  1QIW A;  1S36 A;  5GQQ C;  1BMO A;  1UWO A;  3D74 A;  3B87 A;  1B47 A;  4HSZ A;  2M97 A;  3K21 A;  1B9A A;  2K0J A;  1AHR A;  1YR5 A;  1K96 A;  4FQO A;  2H8V A;  4MZJ A;  1BLQ A;  1ZOT B;  3OB2 B;  1PSB A;  1KCY A;  4NDB A;  5AXI A;  1KQM C;  3MSE B;  1J55 A;  1UUS A;  1SR6 C;  2KBI A;  3A4U B;  1F8H A;  3DY9 A;  1W9Z A;  3KEV A;  2BE6 A;  4DIR A;  3R1V A;  3TUY C;  2ZN8 A;  3CTN A;  4YGD B;  3SS3 A;  3CZ2 A;  4Q04 A;  1CTR A;  1LA0 A;  2WCH A;  3FS7 A;  2CTN A;  1RK9 A;  1AJ4 A;  2FJY A;  2FOT A;  2PAL A;  3LK0 A;  3PM8 A;  2RGI A;  4L9M A;  1BJF A;  1HT9 A;  3FE6 A;  1C3Y A;  1XK4 C;  2NXQ A;  1CDN A;  4MZK A;  1B4C A;  2ZKM X;  1F71 A;  1M63 B;  3SG3 A;  2G9B A;  1IG5 A;  1H4B A;  1AJ5 A;  3WHU B;  3DZT A;  2NCP A;  1TUJ A;  2GGM A;  2JXL A;  3NSK A;  4XYN A;  1A4P A;  1OZS A;  1YTZ C;  2LP3 A;  1U5I A;  1KFX L;  1UHJ A;  1DQE A;  2F3Y A;  3UNW A;  4M2O A;  1BF5 A;  2BCB A;  1G8I A;  3ICB A;  1CMF A;  2Y5I A;  3ZNI A;  2PQL A;  2Q4U A;  1DEL A;  2M49 B;  4ETO A;  1Q80 A;  2BKI B;  1K9P A;  4I5L B;  1CFC A;  2AMI A;  3PAL A;  4NQG A;  1CFP A;  2I94 A;  3CR5 X;  2L5Y A;  1WY9 A;  2P70 A;  5AER A;  1AP4 A;  5G08 A;  1UHK A;  2I18 A;  1LIN A;  2K2F A;  3OHM B;  1DJW A;  1HQV A;  1PAL A;  2KFF A;  1B1G A;  1B8L A;  3WXA A;  2M7L A;  1LS8 A;  5I2L A;  5PAL A;  1ZMZ A;  3SIA A;  2K60 A;  2M1U A;  5D3O A;  1TUZ A;  1GM0 A;  2JTT A;  1RJV A;  4NDD A;  2L50 A;  5FI2 A;  1KSO A;  3SG2 A;  1NUB A;  3DVK A;  2K7D A;  4ORC B;  1LKJ A;  2CXJ A;  2ERB A;  3KHE A;  1JSA A;  1EG3 A;  1C7W A;  1Y1X A;  2JT0 A;  5I8N A;  1DJG A;  1SY9 A;  2HQW A;  4YBH B;  5DKN A;  3EG5 B;  2VRG A;  3O4X A;  1S1E A;  1C07 A;  1YVL A;  4YI8 A;  1KSM A;  4CID A;  1MXL C;  1M39 A;  1W7J B;  3EK8 A;  4GAO A;  2WOR A;  1SCV A;  2JWW A;  1SCM C;  1MF8 B;  3CLN A;  4OCI A;  2SCP A;  2MBX A;  1OMD A;  3HCM A;  1TIZ A;  2KNE A;  4MLW A;  4I5K A;  1SSE B;  4UPG A;  1S5G Y;  1QVI Y;  1QTX A;  4PE7 A;  5JOL A;  5DKQ A;  4C0L A;  1ZAC A;  2H2K A;  2LVJ A;  2E30 A;  1OZO A;  1F4Q A;  2L4H A;  3UO9 A;  3R1P A;  1UHN A;  2MJW B;  1NP8 A;  2WCJ A;  4XJK B;  4WQ2 A;  1KK8 B;  2KGB C;  3SG5 A;  1UP5 A;  2JT8 A;  2L98 A;  1A03 A;  1BOC A;  1SMG A;  2PSR A;  1OW4 A;  1OQP A;  2BKH B;  4PCW A;  5HL1 A;  1XVJ A;  2JNX A;  2BEC A;  1LXF C;  1TN4 A;  4I5N B;  1WDC C;  1CB1 A;  2AUC A;  3JVT C;  3WNX B;  1EG4 A;  4XJK A;  5D7F A;  3TDZ A;  2WCE A;  2KLD A;  2K7B A;  4CPV A;  1IKU A;  3NSL A;  1OOF A;  3GOF A;  1IGV A;  1DGU A;  3PJI A;  4M2Q A;  1J7R A;  3S0D A;  1KFU S;  4INX A;  3TUY B;  4AQI A;  2K2A A;  3BQ3 A;  3DXL A;  1PVA A;  3VB1 A;  2Y1N A;  3IVT A;  2L51 A;  1QVI Z;  1YX8 A;  1YX7 A;  4OVN F;  3VRN A;  3EVR A;  2SAS A;  2LVK A;  3OB1 B;  3BJH A;  1FW4 A;  2P6B B;  1DJY A;  2JT3 A;  3BFH A;  2M9G A;  4MVF A;  4PHN A;  4WQ3 A;  4AOM A;  1OOH A;  3FE9 A;  5HKY A;  1JBA A;  1NX1 A;  3DD4 A;  1TCO B;  3I5H C;  1J1E A;  3VRQ A;  1KWO B;  5IBW A;  3CWG A;  3GK4 X;  4PE4 A;  4CFR A;  1OSA A;  2LMT A;  1SL8 A;  2QDI A;  3DF0 A;  1ZUZ A;  1CLB A;  4A4B A;  4GGF C;  2F8P A;  5I94 A;  3HX4 A;  3LLE A;  2BAP A;  3PFV A;  2M29 A;  2JRF A;  2EGD A;  3CR2 A;  1NWD A;  2MLE C;  3SG6 A;  1N2D A;  2O60 A;  4NDC A;  1GGZ A;  1A29 A;  1LVC D;  3A8R A;  1WRL A;  3S0B A;  1GJY A;  2P71 A;  5AAN A;  1NCX A;  3LL8 B;  5FI7 A;  3GK1 A;  4QJ3 B;  3SS4 A;  1FF1 A;  2NZ0 A;  4MSP A;  3NSO A;  2LNK A;  1F54 A;  1NIW A;  3E3R A;  1AK8 A;  1Z2C B;  1EH2 A;  3BUN B;  4PT1 A;  2KLE A;  1IWQ A;  1L2O C;  4MZL A;  3CYZ A;  2KI4 B;  1XFX O;  3JVT B;  2JXC A;  1IJ6 A;  3OX6 A;  1UHI A;  4ORA B;  3O78 A;  3NHT A;  1IRJ A;  1DTL A;  2COL B;  5AEQ A;  1TWO A;  1FBV A;  3VRP A;  5I2Q A;  5JJG A;  2LUX A;  1IQ3 A;  1TTX A;  1K93 D;  3IQO A;  3EVU A;  3PN7 C;  5K89 A;  2QAC A;  4GBA A;  2Y1M A;  2WCK A;  1QX5 B;  2QEO A;  1FI6 A;  3AAJ A;  3FIA A;  2BL0 C;  2LMU A;  3BFA A;  1BOD A;  1CDL A;  2KAY A;  4F7F A;  2LUC A;  2LAN A;  2EHB A;  3BFB A;  3D0Y A;  2BBM A;  4N1G A;  1KQM B;  2WND A;  3I5I C;  1C3Z A;  1YVH A;  2L5X B;  1SCM B;  1ZFS A;  4GPL B;  1SYM A;  1DJI A;  2WCF A;  4ORB B;  4ICB A;  1U5I B;  2R2I A;  2LAP A;  1TRF A;  1KK8 C;  3CGA A;  1KFU L;  5J3X A;  4CLN A;  4HRE E;  3S0F A;  2QEV A;  2LLU A;  2ZN9 A;  1S5G Z;  3D75 A;  4KYN A;  2M3W A;  4GUK A;  3TS5 B;  5ER4 X;  2QEH A;  1QV1 A;  1YUR A;  3BUO B;  3K1E A;  2MLF C;  5CPV A;  1QIV A;  3D10 A;  1PRW A;  5KTY A;  4BY4 A;  1QX7 A;  2MAZ A;  3QME A;  2KFH A;  3CZT X;  1EL4 A;  2IS9 A;  1DF0 B;  2L2C A;  1J7P A;  2D8N A;  2HQ8 A;  1P28 A;  1CDP A;  2Y4Q A;  3OGN A;  2CBL A;  2KYF A;  1K9K A;  1YUT A;  1DF0 A;  2EC6 B;  1QLK A;  2LLT A;  4ZCU A;  2LP2 A;  3OP0 A;  4E68 A;  2KGR A;  1SW8 A;  2LVV A;  4HRG A;  5B8I B;  1E8A A;  2F2O A;  3TS5 C;  2NLN A;  1JC2 A;  3AKA A;  2KQY A;  2WC6 A;  4YGB B;  1NSH A;  3B7A A;  1BT6 A;  1XFZ O;  1KK7 Y;  2AAO A;  3TDI A;  3V2L A;  1WLM A;  4A4C A;  1FPW A;  1DT7 B;  1MQ1 A;  1EXR A;  2HF5 A;  4CFQ A;  3F45 A;  1SKT A;  2LV7 A;  1DC1 A;  1CDM A;  3BUX B;  1YRU B;  2HET A;  1AUI B;  1JUO A;  5EL2 A;  2A4J A;  3B88 A;  4C0K A;  2LVI A;  4YI9 A;  3DVJ A;  1XYD A;  2PAS A;  3D76 A;  2NCO A;  5HLO A;  3TDU A;  4HRH A;  1JWD A;  1Y0V H;  2B1U A;  3D0Y B;  1QWV A;  3Q8I A;  1MUX A;  1IJ5 A;  2CNP A;  1YUU A;  3JTD B;  4GNK B;  4PHM A;  1NX0 A;  1PSR A;  2KBM A;  1DJZ A;  1G4Y R;  2KHN A;  2WCM A;  4DCK A;  1SL7 A;  2DOQ A;  3C1V A;  1CFD A;  1X02 A;  2ZFD A;  2PVB A;  2BBN A;  3FE8 A;  5DIC A;  4MBE A;  2KDH A;  1IIO A;  4PE0 A;  1TOP A;  2JUL A;  1MR8 A;  1XFU O;  2GGZ A;  3AKB A;  1Y1A A;  1L2O B;  2WCL A;  3L4A A;  3NSI A;  1NX2 A;  2KI4 C;  5HLV A;  2HPS A;  2F2P A;  2JQ6 A;  3I5F C;  5CSN A;  1W7I B;  2O5G A;  3R72 A;  1CM4 A;  4GGF A;  2G2B A;  1NPQ A;  2K7C A;  2BNX A;  3CR4 X;  1QJT A;  2K61 A;  3BXK A;  3I5G C;  4YGA A;  1R6P A;  2KI6 D;  3N7H A;  4FTG A;  2QPT A;  3LK1 A;  3H4S E;  4DRW A;  4USL A;  1BR4 B;  1A75 A;  1OOI X;  4GFT A;  4WRI A;  2BL0 B;  4P2Y B;  4PHJ A;  1TNQ A;  2PRU A;  2BE4 A;  4ZCV A;  1EJ3 A;  1TNX A;  1CFF A;  3IF7 A;  1K9U A;  1RFJ A;  2I7A A;  4BY5 A;  1NYA A;  5DKR A;  5BPJ A;  3KO0 A;  4OV2 A;  2ZND A;  2CCM A;  2F33 A;  3PN7 B;  1SBJ A;  3CS1 A;  2KOT A;  1RTP 1;  3DF0 B;  1NCY A;  1LA3 A;  1QV0 A;  1REC A;  1S6J A;  3IQQ A;  4OZD A;  3SG4 A;  2JOJ A;  1OOG A;  2KAV A;  4M2P A;  1PUL A;  2YGU A;  3I5F B;  4P5O E;  1SK6 D;  1SNL A;  5FYX A;  5FI6 A;  4JD9 A;  4YRU A;  2GTE A;  5F6T A;  4DUQ A;  1ALV A;  4C0J A;  2WC5 A;  4PE1 A;  2JC2 A;  1QXP A;  3FWC A;  3JTD C;  2BCX A;  2JTZ A;  1Y1U A;  3BOW A;  1UHH A;  4IL1 A;  3DYE A;  2MHH A;  3R1O A;  1MHO A;  2K7O A;  3NHI A;  1K90 D;  3NXA A;  5I2O A;  2M7N A;  4DS7 A;  3O6B A;  1KFX S;  1F55 A;  3EK7 A;  1M45 A;  2M0R A;  4GGN A;  1J1D A;  2M1K B;  1ORG A;  1XA5 A;  2EC6 C;  2JPT A;  2KAX A;  3CAB A;  1GQM A;  3CDN A;  1PVB A;  2OS8 B;  4FQT A;  3VRO A;  3DVE A;  4YGC B;  1OMV A;  1SPY A;  3S0A A;  1K94 A;  5CSI A;  1GGW A;  4IJ7 A;  1OE9 B;  2V53 A;  5CSJ A;  1L7Z A;  2WCB A;  4N5X A;  3KF9 A;  1KWO C;  1N0Y A;  3VRR A;  2ZRS A;  1K8U A;  1SRA A;  3NGV A;  2K8M B;  4JKT A;  1CNP A;  2KYC A;  3CZ0 A;  1WLZ A;  3FWB A;  1S6C A;  3LCP C;  2KI6 C;  5AFP A;  2L0P A;  5ER5 A;  1Y6W A;  2ZNE A;  3EK4 A;  1QAS A;  1J7O A;  2LHI A;  1B8C A;  3SG7 A;  2OS8 C;  3PM2 A;  3RLZ A;  4QJ4 B;  1Z4H A;  4YGE B;  2JNF A;  1B7T Z;  2CT9 A;  3I5I B;  1CLM A;  3L4L A;  2LHL A;  2FJU B;  3I5G B;  1BU3 A;  3S0E A;  1S3P A;  2L2E A;  5HKZ A;  2MA2 A;  4N1F A;  1ALW A;  2OTG C;  1CLL A;  2GV5 A;  1BG1 A;  4PDZ A;  2JZI A;  4PHK A;  4JPZ B;  3GK2 A;  3PLF B;  4TNC A;  1H8B A;  1IQ5 A;  1MXE A;  3BUW B;  2LM5 A;  3D78 A;  1XFY O;  3EVV A;  2H61 C;  1WRZ A;  2H61 A; 
#chains in the Genus database with same CATH homology
 2PQL A;  3FE8 A;  5DIC A;  3S0B A;  2P71 A;  3L47 A;  2P70 A;  2QEB A;  2WCL A;  3L4A A;  2JPO A;  3CZ1 A;  4PT1 A;  1LS8 A;  1T14 A;  3R72 A;  3CYZ A;  1GM0 A;  3NHT A;  3N7H A;  1TWO A;  2ERB A;  1OOI X;  4INW A;  2WCK A;  2QEO A;  3BFA A;  4F7F A;  3S0G A;  3BFB A;  4OZD A;  1C3Z A;  3D77 A;  1OOG A;  2KPH A;  4JD9 A;  3RZS A;  2GTE A;  2WC5 A;  3D73 A;  3S0F A;  3B86 A;  2QEV A;  3R1P A;  2WCJ A;  3D75 A;  3B6X A;  3DYE A;  3R1O A;  2QEH A;  1XFR A;  3K1E A;  3NHI A;  1OW4 A;  3D74 A;  1ORG A;  3B87 A;  3CAB A;  3QME A;  3CDN A;  2L2C A;  4FQT A;  1P28 A;  2H8V A;  3S0A A;  3OGN A;  1OOF A;  3PJI A;  3S0D A;  4INX A;  3NGV A;  3DXL A;  3VB1 A;  3DY9 A;  3CZ0 A;  3R1V A;  2WC6 A;  3B7A A;  3CZ2 A;  3V2L A;  2WCH A;  3BJH A;  3BFH A;  2FJY A;  1OOH A;  3FE6 A;  3FE9 A;  1C3Y A;  3L4L A;  5EL2 A;  3B88 A;  3S0E A;  3DZT A;  3D76 A;  2QDI A;  1TUJ A;  1QWV A;  3Q8I A;  3D78 A;  1DQE A;  2WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...