1GM0A

A form of the pheromone-binding protein from bombyx mori
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHEROMONE-BINDING PROTEIN
publication title NMR Structure Reveals Novel Intramolecular Regulation Mechanism for Pheromone-Binding and Release
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1gm0A00
3N7HA 3D75A 3L47A 3CYZA 3S0GA 2FJYA 4INWA 3D78A 3D73A 3B6XA 5DICA 2QEBA 3B88A 2WCLA 3R1PA 5EL2A 2ERBA 3CZ0A 2WCKA 3DY9A 3PJIA 1TWOA 3S0EA 2WCMA 2PQLA 3L4AA 3R1OA 2QEVA 2P70A 3FE8A 1OOGA 3CDNA 1TUJA 4OZDA 3NGVA 1OOFA 3B87A 2QEHA 3S0BA 1P28A 1T14A 2QEOA 3S0DA 3FE6A 3D74A 2KPHA 3NHIA 3R1VA 3CZ1A 1GM0A 3DXLA 3NHTA 4PT1A 3S0AA 3QMEA 1C3ZA 2WC6A 3BFAA 1DQEA 3B7AA 2JPOA 2P71A 3CZ2A 3D76A 2H8VA 3S0FA 1OOHA 3BFHA 1C3YA 1OW4A 4FQTA 3K1EA 3DZTA 3BJHA 3R72A 3L4LA 3DYEA 3V2LA 2QDIA 3OGNA 4JD9A 3B86A 2GTEA 3BFBA 1OOIX 2WCHA 3CABA 3RZSA 2WC5A 1QWVA 1XFRA 3D77A 2WCJA 2L2CA 3FE9A 4INXA 4F7FA 3Q8IA 1ORGA 3VB1A 1LS8A
chains in the Genus database with same CATH superfamily
2BBNA 1Y6WA 2NLNA 3S0GA 2FJYA 4HREE 1EH2A 2NCOA 4CLNA 1LA0A 4INWA 4BY5A 1GJYA 4MLWA 3I5IC 3D73A 1S5GZ 4L9MA 3CTNA 1J55A 1DJHA 1SY9A 3SIAA 2KFGA 3R1PA 1UUSA 2K0JA 1BR4B 2I94A 2Q91A 4MZLA 2BL0C 1YURA 3CZ0A 5D69A 1DELA 1X02A 2LMTA 2K7OA 2QPTA 1Z4HA 5B8IB 1XFXO 2KQYA 1PK0D 1TWOA 1SSEB 1QLKA 1XVJA 1ZUZA 1BT6A 2JOJA 5I94A 2WCMA 5AXIA 2BKHB 1G4YR 4OR9B 3JVTB 4ORBB 4XYNA 1L7ZA 5CSFA 4TNCA 5I2QA 2F2OA 2JC2A 1DJWA 3DF0B 3LL8B 1TUZA 4YGCB 1FPWA 2QEVA 2Y1MA 1RWYA 2CXJA 2JT3A 3GOFA 3SIBA 1PSRA 3TUYB 1OOGA 2BE4A 1V1GA 2D8NA 4PDZA 4AQIA 1CM1A 1A75A 1KK7Z 1WRZA 3EG5B 1KFXS 4I5JA 3PM2A 1JFJA 1NX2A 2L4HA 1PALA 4F0ZB 3BYAA 3NSLA 1FBVA 5DKQA 3AKBA 2FCDA 1K9KA 3OHMB 2GV5A 1PVBA 1OSAA 1WRLA 2LMUA 4JQ0D 3WNXB 4GGNA 4C0KA 1CDPA 4M2PA 3SS3A 1QXPA 4PE0A 1JUOA 3FE6A 2LUXA 2EGDA 1K95A 3AAKA 5AERA 2JT8A 1UHNA 4MZJA 2KYFA 3CZ1A 4PE7A 2E30A 3DXLA 1ZACA 1OZSA 1TCOB 3NHTA 3NXAA 4PE1A 1IQ3A 4PT1A 1SYMA 3SS4A 4E68A 2AMIA 4MRXA 2M0RA 2V53A 1F71A 3TDZA 4GPLB 4ZCVA 1BU3A 3BXKA 4YGEB 3OB2B 4PE4A 1A75B 2KI6C 1MF8B 1TIZA 1DGUA 3CGAA 5FI6A 3D10A 1JC2A 2KI6D 4N5XA 1CDMA 3K1EA 1QLSA 1HT9A 4N1FA 1F55A 1SNLA 1PULA 2K2FA 1EG3A 2KAVA 2WC8A 5HYDA 5KSZA 3R72A 5FYXA 1TOPA 3I5FC 4R1EA 2KNEA 4FTGA 1F4QA 1S6IA 3B86A 4A4BA 2O5GA 1QX2A 1XFYO 1LA3A 3CLNA 2NCPA 3DVMA 1NIWA 1OOIX 1WDCC 2LMVA 1EXRA 2QACA 3DVEA 3GK4X 4YGAA 4C0JA 4FQOA 1M31A 1YR5A 1JF2A 1QASA 4P2YB 4BY4A 1DMOA 5K89A 2L0PA 2MJWB 1W7JB 4GNKB 1AK8A 1HQVA 3JTDB 3Q8IA 2EHBA 2PALA 4Q04A 1ORGA 2TN4A 4OKHA 5AFPA 2K2AA 4NDBA 3EVRA 2KAXA 1IRJA 1XFWO 3TS5C 1F54A 2K7CA 2L98A 3N7HA 2ISDA 1CTRA 3FIAA 2I7AA 2BCBA 2JNFA 4M2QA 1CNPA 2OS8C 2M3WA 2JXCA 2LANA 3BOWA 2BCXA 4OCIA 3PLFB 1SCMC 1F70A 5DICA 2M29A 1A2XA 1AJ4A 2K7BA 2QEBA 2WCBA 3LK0A 4MN0A 1WRKA 2EC6B 2WCLA 4WRIA 3LCPC 5EL2A 3BUOB 1JSAA 1SW8A 2GGMA 2VRGA 2KSPA 1KK8B 1B47A 1M63B 1EJ3A 5I8NA 3PJIA 4GFTA 1Y1UA 2LVIA 3BUNB 4M2OA 1CFDA 2LM5A 3VGOA 3SG5A 3I5GC 2P6BB 1CMFA 1QX7A 3L4AA 2NXQA 1TTXA 1DF0B 5TNCA 2ZRSA 3FWCA 1YX8A 3LLEA 2H2KA 1OQPA 1OMDA 1XK4A 1R2UA 1E8AA 3TDUA 2L2EA 1QV0A 3IQOA 3D0YA 1YRTB 3OX5A 4ORAB 4MVFA 2YGUA 1MUXA 3O78A 4OZDA 4CFQA 1KWOC 2ZRTA 4HRHA 3B87A 3BOWB 3EKHA 4CFRA 1K94A 1P28A 4AQJA 1Q80A 2JQ6A 3RM1A 1SR6C 2M1UA 1T14A 1BMOA 3PN7B 1DJGA 1L2OB 3S0DA 4C0LA 3D74A 1RK9A 2AUCA 4YI8A 1RTP1 2G9BA 2DOQA 3VRNA 1IIOA 3UO9A 1XFUO 1KFUL 1H4BA 3SJSA 1GGWA 1MXEA 1KQMC 2CBLA 1JFKA 1WY9A 1C3ZA 2LUCA 3A4UB 1B1GA 2WC6A 1B7TY 4GGFA 1BJFA 1DQEA 1UURA 1QTXA 3B7AA 1XYDA 2JTZA 3CZ2A 3D0YB 3D76A 5HLOA 1DJYA 3OB1B 1QJTA 4PALA 2BNXA 1TRFA 1UHKA 1IG5A 1OOHA 1ALVA 2KLEA 4I5NB 1J1EA 1S6JA 2M1KB 3BFHA 4I5LB 3I5IB 1G33A 1OW4A 1NX3A 4GAOA 1F4OA 1DJXA 2ZKMX 2R2IA 1CDLA 3BJHA 3CR4X 2KGRA 2Y5IA 3KHEA 4JWQA 2MA2A 2BL0B 3V2LA 1IQ5A 2PASA 2JTTA 4NQGA 1QS7A 2LNKA 2I2RE 5I2OA 3O4XA 2KFHA 1NCYA 3NSKA 2GTEA 2BECA 3BFBA 1SL9A 1A03A 1OZOA 3BUMB 4QJ3B 5G08A 1V1FA 1K8UA 3LK1A 4GUKA 2K7DA 2WC5A 1SL8A 1DC1A 1NP8A 1XFRA 2KBMA 2MHHA 5HKZA 3FE9A 5KTYA 2WCEA 3CR2A 1DJZA 2LVVA 4NDCA 4OV2A 2KHNA 2PRUA 2LC5A 1SL7A 2K8MB 1G8IA 4MSPA 2KQ6A 3VRQA 3PFVA 1KCYA 3D75A 4PHNA 2HF5A 3SG2A 3HCMA 1K9UA 3JTDC 3AAJA 3I5HB 4XJKA 1FI5A 2JT0A 1ZOTB 3MSEB 4KYNA 1ALWA 3EVVA 3VROA 2HPSA 1IKUA 2KYCA 3PM8A 2ZNDA 2I18A 2ZN9A 5GQQC 5HKYA 1K9PA 2E6WA 4ORCB 1NYAA 2MLFC 1EL4A 3B88A 4PCWA 3A8RA 1QX5B 2F33A 1R6PA 1KQVA 3DY9A 5CSNA 2F3ZA 1PVAA 1OE9B 2SASA 1NCZA 1RECA 2HQ8A 2LP3A 2OTGC 1IGVA 2L51A 2LVKA 3F45A 3PALA 1DF0A 4CIDA 2L5YA 3SG3A 3TZ1A 1UP5A 3R1OA 2CT9A 1OOJA 1DVIA 3FE8A 4MZKA 5AEQA 1K2HA 2B1UA 1OMVA 3BUWB 2PMYA 5CPVA 1KSMA 1S1EA 3NGVA 4I5KA 1OOFA 1F8HA 3OX6A 4XJKB 2QEHA 2CCMA 2WNDA 1FW4A 1J7QA 1B9AA 2M7LA 1M46A 4ICBA 4MBEA 1UHIA 3UNWA 3I5FB 3KEVA 1S6CA 2LHIA 4JPZB 1BOCA 1S26D 1C7WA 5DKNA 1QV1A 4MEWA 3GK1A 1TNWA 2L5XB 1SKTA 1H8BA 1WDCB 5DKRA 1YUTA 2KOTA 1CB1A 2H61C 4OVNF 1J1DA 1Y1XA 3QRXA 1GM0A 1AVSA 4DRWA 2CNPA 1B8RA 5I2LA 2BAPA 3CWGA 3QMEA 3S0AA 2Q4UA 2KI4B 2M49B 2KGBC 5FI7A 3BFAA 3JVTC 1IJ5A 3O4YA 3O6BA 1KSOA 4YI9A 1J7OA 1ZFSA 3KO0A 3VRPA 1QIWA 2JPOA 3TS5B 2P71A 4A4CA 1M45A 2JWWA 1YUSA 3OBVA 2CTNA 2OPOA 2OS8B 1B8CA 1J7PA 4CPVA 3H4SE 3TUYC 1ODBA 2K60A 1C3YA 5HL1A 1JF0A 3EK4A 1Y1AA 2SCPA 2Y1NA 2MAZA 1SCMB 4FQTA 1W7IB 1VRKA 2NZ0A 2BKIB 4PHJA 4USLA 3ZNIA 5CSJA 1YVLA 2JNXA 4DIRA 3VRRA 1JWDA 2WORA 1SBJA 1UHJA 3DYEA 5ER5A 2JZIA 3SG7A 4QJ4B 2LLSA 1SRAA 1GQMA 2HETA 1OMRA 4PHKA 2BBMA 2LAPA 4JD9A 4MRYA 1DTLA 1CLBA 1NX0A 1D1OA 1KK7Y 2Y4QA 3ICBA 3WHTB 1CFCA 4QJ5B 2LLTA 1CLMA 3I5GB 1XFVO 3RZSA 1QWVA 2ZNEA 2F3YA 1UWOA 3D77A 1CLLA 1BR1B 2LCPA 2MRDA 5HLVA 4DUQA 2WOSA 4UPGA 1TN4A 3NSOA 2LVJA 4ETOA 1TNQA 2JU0A 1WLZA 3BQ3A 1KWOB 1LINA 3DVKA 3KPXA 2KDHA 3ZWHA 2JXLA 3L47A 2BE6A 3CYZA 4GGFC 4IJ7A 4JKTA 1K93D 1BF5A 2AAOA 1ZMZA 3M0WA 3DD4A 3KF9A 3SS5A 1NX1A 2F2PA 1NPQA 1SR6B 1WLMA 3D78A 2FOTA 3HX4A 2LP2A 1CKKA 1B7TZ 2M9GA 2PYQA 2ZN8A 2LLUA 1DGVA 1N65A 2IS9A 2M8UA 1LVCD 3B6XA 4IL1A 1CDNA 2PSRA 1NUBA 3C1VA 3CZTX 2KBIA 2ERBA 3I5HC 1M39A 3O2PA 2JPTA 2WCKA 1IJ6A 1IWQA 1Y0VH 1Z2CB 1KQMB 2L4IA 1N0YA 1FI6A 1QIVA 3S0EA 1LKJA 1W9ZA 2PQLA 1CFPA 1DJIA 2COLB 2FJUB 4PHMA 1B4CA 1K90D 2F8PA 1YRUB 3GK2A 3WHUB 3IF7A 1PSBA 4GBAA 3NSIA 1YX7A 1YVHA 2P70A 1K96A 5JJGA 3EK7A 5KU1A 1RJVA 1KFXL 2WCFA 1GGZA 1AP4A 3CDNA 2KLDA 1TUJA 1U5IA 4AOMA 3PATA 2LE9B 2O60A 3SG4A 5FI2A 2MBXA 3S0BA 2ZFDA 1NCXA 1S36A 5HKWA 1C07A 1TNPA 5D3OA 1N2DA 3RLZA 5F6TA 1CMGA 4WQ3A 4DCKA 1NWDA 2QEOA 1MHOA 1CFFA 2GGZA 5PALA 2M97A 3SG6A 2KPHA 1BLQA 1A29A 4YGBB 2EC6C 3NHIA 3R1VA 1TNXA 1XO5A 4DS7A 1AJ5A 1KK8C 1EG4A 1PRWA 1C7VA 1MQ1A 1QVIY 1UHHA 1IH0A 1QATA 1BG1A 3CR5X 1A4PA 2G2BA 1SMGA 2KFFA 1AUIB 3BUXB 3IVTA 3K21A 3EK8A 4NDDA 2HQWA 4YGDB 3EKJA 1AHRA 1S3PA 3DVJA 2LHLA 1SCVA 5BPJA 4YRUA 3FS7A 2H8VA 2BCAA 5IBWA 1U5IB 1MWNA 3S0FA 1MXLC 3TDIA 2KI4C 1B8LA 1DEKA 1DT7B 2A4JA 3FWBA 3PSRA 5AANA 3DZTA 4YBHB 1BODA 1SK6D 2JRFA 2K61A 1FF1A 3L4LA 3OP0A 5D7FA 1QVIZ 2KAYA 1CM4A 2QDIA 3WXAA 3OGNA 2H61A 3PN7C 2L50A 2OTGB 1RROA 1KFUS 1L2OC 1NSHA 2JULA 1XFZO 1S5GY 4HRGA 3IQQA 2WCHA 4WQ2A 1SPYA 1RFJA 3AKAA 3CABA 4U8DA 1J7RA 3E3RA 4ZCUA 2M7NA 1JBAA 3CS1A 2MLEC 1YUUA 5ER4X 2WCJA 2L2CA 2FCEA 2LV7A 2PVBA 3DF0A 5CSIA 4INXA 4F7FA 1TCFA 1XA5A 5J3XA 1MR8A 4HSZA 3VB1A 4D1EA 4P5OE 1YTZC 1LS8A 4N1GA 5JOLA 1LXFC 3EVUA 2RGIA 1XK4C
chains in the Genus database with same CATH topology
3N7HA 3D75A 3L47A 3CYZA 3S0GA 2FJYA 4INWA 3D78A 3D73A 3B6XA 5DICA 2QEBA 3B88A 2WCLA 3R1PA 5EL2A 2ERBA 3CZ0A 2WCKA 3DY9A 3PJIA 1TWOA 3S0EA 2WCMA 2PQLA 3L4AA 3R1OA 2QEVA 2P70A 3FE8A 1OOGA 3CDNA 1TUJA 4OZDA 3NGVA 1OOFA 3B87A 2QEHA 3S0BA 1P28A 1T14A 2QEOA 3S0DA 3FE6A 3D74A 2KPHA 3NHIA 3R1VA 3CZ1A 1GM0A 3DXLA 3NHTA 4PT1A 3S0AA 3QMEA 1C3ZA 2WC6A 3BFAA 1DQEA 3B7AA 2JPOA 2P71A 3CZ2A 3D76A 2H8VA 3S0FA 1OOHA 3BFHA 1C3YA 1OW4A 4FQTA 3K1EA 3DZTA 3BJHA 3R72A 3L4LA 3DYEA 3V2LA 2QDIA 3OGNA 4JD9A 3B86A 2GTEA 3BFBA 1OOIX 2WCHA 3CABA 3RZSA 2WC5A 1QWVA 1XFRA 3D77A 2WCJA 2L2CA 3FE9A 4INXA 4F7FA 3Q8IA 1ORGA 3VB1A 1LS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7H A;  3D75 A;  3L47 A;  3CYZ A;  3S0G A;  2FJY A;  4INW A;  3D78 A;  3D73 A;  3B6X A;  5DIC A;  2QEB A;  3B88 A;  2WCL A;  3R1P A;  5EL2 A;  2ERB A;  3CZ0 A;  2WCK A;  3DY9 A;  3PJI A;  1TWO A;  3S0E A;  2WCM A;  2PQL A;  3L4A A;  3R1O A;  2QEV A;  2P70 A;  3FE8 A;  1OOG A;  3CDN A;  1TUJ A;  4OZD A;  3NGV A;  1OOF A;  3B87 A;  2QEH A;  3S0B A;  1P28 A;  1T14 A;  2QEO A;  3S0D A;  3FE6 A;  3D74 A;  2KPH A;  3NHI A;  3R1V A;  3CZ1 A;  1GM0 A;  3DXL A;  3NHT A;  4PT1 A;  3S0A A;  3QME A;  1C3Z A;  2WC6 A;  3BFA A;  1DQE A;  3B7A A;  2JPO A;  2P71 A;  3CZ2 A;  3D76 A;  2H8V A;  3S0F A;  1OOH A;  3BFH A;  1C3Y A;  1OW4 A;  4FQT A;  3K1E A;  3DZT A;  3BJH A;  3R72 A;  3L4L A;  3DYE A;  3V2L A;  2QDI A;  3OGN A;  4JD9 A;  3B86 A;  2GTE A;  3BFB A;  1OOI X;  2WCH A;  3CAB A;  3RZS A;  2WC5 A;  1QWV A;  1XFR A;  3D77 A;  2WCJ A;  2L2C A;  3FE9 A;  4INX A;  4F7F A;  3Q8I A;  1ORG A;  3VB1 A;  1LS8 A; 
#chains in the Genus database with same CATH topology
 2BBN A;  1Y6W A;  2NLN A;  3S0G A;  2FJY A;  4HRE E;  1EH2 A;  2NCO A;  4CLN A;  1LA0 A;  4INW A;  4BY5 A;  1GJY A;  4MLW A;  3I5I C;  3D73 A;  1S5G Z;  4L9M A;  3CTN A;  1J55 A;  1DJH A;  1SY9 A;  3SIA A;  2KFG A;  3R1P A;  1UUS A;  2K0J A;  1BR4 B;  2I94 A;  2Q91 A;  4MZL A;  2BL0 C;  1YUR A;  3CZ0 A;  5D69 A;  1DEL A;  1X02 A;  2LMT A;  2K7O A;  2QPT A;  1Z4H A;  5B8I B;  1XFX O;  2KQY A;  1PK0 D;  1TWO A;  1SSE B;  1QLK A;  1XVJ A;  1ZUZ A;  1BT6 A;  2JOJ A;  5I94 A;  2WCM A;  5AXI A;  2BKH B;  1G4Y R;  4OR9 B;  3JVT B;  4ORB B;  4XYN A;  1L7Z A;  5CSF A;  4TNC A;  5I2Q A;  2F2O A;  2JC2 A;  1DJW A;  3DF0 B;  3LL8 B;  1TUZ A;  4YGC B;  1FPW A;  2QEV A;  2Y1M A;  1RWY A;  2CXJ A;  2JT3 A;  3GOF A;  3SIB A;  1PSR A;  3TUY B;  1OOG A;  2BE4 A;  1V1G A;  2D8N A;  4PDZ A;  4AQI A;  1CM1 A;  1A75 A;  1KK7 Z;  1WRZ A;  3EG5 B;  1KFX S;  4I5J A;  3PM2 A;  1JFJ A;  1NX2 A;  2L4H A;  1PAL A;  4F0Z B;  3BYA A;  3NSL A;  1FBV A;  5DKQ A;  3AKB A;  2FCD A;  1K9K A;  3OHM B;  2GV5 A;  1PVB A;  1OSA A;  1WRL A;  2LMU A;  4JQ0 D;  3WNX B;  4GGN A;  4C0K A;  1CDP A;  4M2P A;  3SS3 A;  1QXP A;  4PE0 A;  1JUO A;  3FE6 A;  2LUX A;  2EGD A;  1K95 A;  3AAK A;  5AER A;  2JT8 A;  1UHN A;  4MZJ A;  2KYF A;  3CZ1 A;  4PE7 A;  2E30 A;  3DXL A;  1ZAC A;  1OZS A;  1TCO B;  3NHT A;  3NXA A;  4PE1 A;  1IQ3 A;  4PT1 A;  1SYM A;  3SS4 A;  4E68 A;  2AMI A;  4MRX A;  2M0R A;  2V53 A;  1F71 A;  3TDZ A;  4GPL B;  4ZCV A;  1BU3 A;  3BXK A;  4YGE B;  3OB2 B;  4PE4 A;  1A75 B;  2KI6 C;  1MF8 B;  1TIZ A;  1DGU A;  3CGA A;  5FI6 A;  3D10 A;  1JC2 A;  2KI6 D;  4N5X A;  1CDM A;  3K1E A;  1QLS A;  1HT9 A;  4N1F A;  1F55 A;  1SNL A;  1PUL A;  2K2F A;  1EG3 A;  2KAV A;  2WC8 A;  5HYD A;  5KSZ A;  3R72 A;  5FYX A;  1TOP A;  3I5F C;  4R1E A;  2KNE A;  4FTG A;  1F4Q A;  1S6I A;  3B86 A;  4A4B A;  2O5G A;  1QX2 A;  1XFY O;  1LA3 A;  3CLN A;  2NCP A;  3DVM A;  1NIW A;  1OOI X;  1WDC C;  2LMV A;  1EXR A;  2QAC A;  3DVE A;  3GK4 X;  4YGA A;  4C0J A;  4FQO A;  1M31 A;  1YR5 A;  1JF2 A;  1QAS A;  4P2Y B;  4BY4 A;  1DMO A;  5K89 A;  2L0P A;  2MJW B;  1W7J B;  4GNK B;  1AK8 A;  1HQV A;  3JTD B;  3Q8I A;  2EHB A;  2PAL A;  4Q04 A;  1ORG A;  2TN4 A;  4OKH A;  5AFP A;  2K2A A;  4NDB A;  3EVR A;  2KAX A;  1IRJ A;  1XFW O;  3TS5 C;  1F54 A;  2K7C A;  2L98 A;  3N7H A;  2ISD A;  1CTR A;  3FIA A;  2I7A A;  2BCB A;  2JNF A;  4M2Q A;  1CNP A;  2OS8 C;  2M3W A;  2JXC A;  2LAN A;  3BOW A;  2BCX A;  4OCI A;  3PLF B;  1SCM C;  1F70 A;  5DIC A;  2M29 A;  1A2X A;  1AJ4 A;  2K7B A;  2QEB A;  2WCB A;  3LK0 A;  4MN0 A;  1WRK A;  2EC6 B;  2WCL A;  4WRI A;  3LCP C;  5EL2 A;  3BUO B;  1JSA A;  1SW8 A;  2GGM A;  2VRG A;  2KSP A;  1KK8 B;  1B47 A;  1M63 B;  1EJ3 A;  5I8N A;  3PJI A;  4GFT A;  1Y1U A;  2LVI A;  3BUN B;  4M2O A;  1CFD A;  2LM5 A;  3VGO A;  3SG5 A;  3I5G C;  2P6B B;  1CMF A;  1QX7 A;  3L4A A;  2NXQ A;  1TTX A;  1DF0 B;  5TNC A;  2ZRS A;  3FWC A;  1YX8 A;  3LLE A;  2H2K A;  1OQP A;  1OMD A;  1XK4 A;  1R2U A;  1E8A A;  3TDU A;  2L2E A;  1QV0 A;  3IQO A;  3D0Y A;  1YRT B;  3OX5 A;  4ORA B;  4MVF A;  2YGU A;  1MUX A;  3O78 A;  4OZD A;  4CFQ A;  1KWO C;  2ZRT A;  4HRH A;  3B87 A;  3BOW B;  3EKH A;  4CFR A;  1K94 A;  1P28 A;  4AQJ A;  1Q80 A;  2JQ6 A;  3RM1 A;  1SR6 C;  2M1U A;  1T14 A;  1BMO A;  3PN7 B;  1DJG A;  1L2O B;  3S0D A;  4C0L A;  3D74 A;  1RK9 A;  2AUC A;  4YI8 A;  1RTP 1;  2G9B A;  2DOQ A;  3VRN A;  1IIO A;  3UO9 A;  1XFU O;  1KFU L;  1H4B A;  3SJS A;  1GGW A;  1MXE A;  1KQM C;  2CBL A;  1JFK A;  1WY9 A;  1C3Z A;  2LUC A;  3A4U B;  1B1G A;  2WC6 A;  1B7T Y;  4GGF A;  1BJF A;  1DQE A;  1UUR A;  1QTX A;  3B7A A;  1XYD A;  2JTZ A;  3CZ2 A;  3D0Y B;  3D76 A;  5HLO A;  1DJY A;  3OB1 B;  1QJT A;  4PAL A;  2BNX A;  1TRF A;  1UHK A;  1IG5 A;  1OOH A;  1ALV A;  2KLE A;  4I5N B;  1J1E A;  1S6J A;  2M1K B;  3BFH A;  4I5L B;  3I5I B;  1G33 A;  1OW4 A;  1NX3 A;  4GAO A;  1F4O A;  1DJX A;  2ZKM X;  2R2I A;  1CDL A;  3BJH A;  3CR4 X;  2KGR A;  2Y5I A;  3KHE A;  4JWQ A;  2MA2 A;  2BL0 B;  3V2L A;  1IQ5 A;  2PAS A;  2JTT A;  4NQG A;  1QS7 A;  2LNK A;  2I2R E;  5I2O A;  3O4X A;  2KFH A;  1NCY A;  3NSK A;  2GTE A;  2BEC A;  3BFB A;  1SL9 A;  1A03 A;  1OZO A;  3BUM B;  4QJ3 B;  5G08 A;  1V1F A;  1K8U A;  3LK1 A;  4GUK A;  2K7D A;  2WC5 A;  1SL8 A;  1DC1 A;  1NP8 A;  1XFR A;  2KBM A;  2MHH A;  5HKZ A;  3FE9 A;  5KTY A;  2WCE A;  3CR2 A;  1DJZ A;  2LVV A;  4NDC A;  4OV2 A;  2KHN A;  2PRU A;  2LC5 A;  1SL7 A;  2K8M B;  1G8I A;  4MSP A;  2KQ6 A;  3VRQ A;  3PFV A;  1KCY A;  3D75 A;  4PHN A;  2HF5 A;  3SG2 A;  3HCM A;  1K9U A;  3JTD C;  3AAJ A;  3I5H B;  4XJK A;  1FI5 A;  2JT0 A;  1ZOT B;  3MSE B;  4KYN A;  1ALW A;  3EVV A;  3VRO A;  2HPS A;  1IKU A;  2KYC A;  3PM8 A;  2ZND A;  2I18 A;  2ZN9 A;  5GQQ C;  5HKY A;  1K9P A;  2E6W A;  4ORC B;  1NYA A;  2MLF C;  1EL4 A;  3B88 A;  4PCW A;  3A8R A;  1QX5 B;  2F33 A;  1R6P A;  1KQV A;  3DY9 A;  5CSN A;  2F3Z A;  1PVA A;  1OE9 B;  2SAS A;  1NCZ A;  1REC A;  2HQ8 A;  2LP3 A;  2OTG C;  1IGV A;  2L51 A;  2LVK A;  3F45 A;  3PAL A;  1DF0 A;  4CID A;  2L5Y A;  3SG3 A;  3TZ1 A;  1UP5 A;  3R1O A;  2CT9 A;  1OOJ A;  1DVI A;  3FE8 A;  4MZK A;  5AEQ A;  1K2H A;  2B1U A;  1OMV A;  3BUW B;  2PMY A;  5CPV A;  1KSM A;  1S1E A;  3NGV A;  4I5K A;  1OOF A;  1F8H A;  3OX6 A;  4XJK B;  2QEH A;  2CCM A;  2WND A;  1FW4 A;  1J7Q A;  1B9A A;  2M7L A;  1M46 A;  4ICB A;  4MBE A;  1UHI A;  3UNW A;  3I5F B;  3KEV A;  1S6C A;  2LHI A;  4JPZ B;  1BOC A;  1S26 D;  1C7W A;  5DKN A;  1QV1 A;  4MEW A;  3GK1 A;  1TNW A;  2L5X B;  1SKT A;  1H8B A;  1WDC B;  5DKR A;  1YUT A;  2KOT A;  1CB1 A;  2H61 C;  4OVN F;  1J1D A;  1Y1X A;  3QRX A;  1GM0 A;  1AVS A;  4DRW A;  2CNP A;  1B8R A;  5I2L A;  2BAP A;  3CWG A;  3QME A;  3S0A A;  2Q4U A;  2KI4 B;  2M49 B;  2KGB C;  5FI7 A;  3BFA A;  3JVT C;  1IJ5 A;  3O4Y A;  3O6B A;  1KSO A;  4YI9 A;  1J7O A;  1ZFS A;  3KO0 A;  3VRP A;  1QIW A;  2JPO A;  3TS5 B;  2P71 A;  4A4C A;  1M45 A;  2JWW A;  1YUS A;  3OBV A;  2CTN A;  2OPO A;  2OS8 B;  1B8C A;  1J7P A;  4CPV A;  3H4S E;  3TUY C;  1ODB A;  2K60 A;  1C3Y A;  5HL1 A;  1JF0 A;  3EK4 A;  1Y1A A;  2SCP A;  2Y1N A;  2MAZ A;  1SCM B;  4FQT A;  1W7I B;  1VRK A;  2NZ0 A;  2BKI B;  4PHJ A;  4USL A;  3ZNI A;  5CSJ A;  1YVL A;  2JNX A;  4DIR A;  3VRR A;  1JWD A;  2WOR A;  1SBJ A;  1UHJ A;  3DYE A;  5ER5 A;  2JZI A;  3SG7 A;  4QJ4 B;  2LLS A;  1SRA A;  1GQM A;  2HET A;  1OMR A;  4PHK A;  2BBM A;  2LAP A;  4JD9 A;  4MRY A;  1DTL A;  1CLB A;  1NX0 A;  1D1O A;  1KK7 Y;  2Y4Q A;  3ICB A;  3WHT B;  1CFC A;  4QJ5 B;  2LLT A;  1CLM A;  3I5G B;  1XFV O;  3RZS A;  1QWV A;  2ZNE A;  2F3Y A;  1UWO A;  3D77 A;  1CLL A;  1BR1 B;  2LCP A;  2MRD A;  5HLV A;  4DUQ A;  2WOS A;  4UPG A;  1TN4 A;  3NSO A;  2LVJ A;  4ETO A;  1TNQ A;  2JU0 A;  1WLZ A;  3BQ3 A;  1KWO B;  1LIN A;  3DVK A;  3KPX A;  2KDH A;  3ZWH A;  2JXL A;  3L47 A;  2BE6 A;  3CYZ A;  4GGF C;  4IJ7 A;  4JKT A;  1K93 D;  1BF5 A;  2AAO A;  1ZMZ A;  3M0W A;  3DD4 A;  3KF9 A;  3SS5 A;  1NX1 A;  2F2P A;  1NPQ A;  1SR6 B;  1WLM A;  3D78 A;  2FOT A;  3HX4 A;  2LP2 A;  1CKK A;  1B7T Z;  2M9G A;  2PYQ A;  2ZN8 A;  2LLU A;  1DGV A;  1N65 A;  2IS9 A;  2M8U A;  1LVC D;  3B6X A;  4IL1 A;  1CDN A;  2PSR A;  1NUB A;  3C1V A;  3CZT X;  2KBI A;  2ERB A;  3I5H C;  1M39 A;  3O2P A;  2JPT A;  2WCK A;  1IJ6 A;  1IWQ A;  1Y0V H;  1Z2C B;  1KQM B;  2L4I A;  1N0Y A;  1FI6 A;  1QIV A;  3S0E A;  1LKJ A;  1W9Z A;  2PQL A;  1CFP A;  1DJI A;  2COL B;  2FJU B;  4PHM A;  1B4C A;  1K90 D;  2F8P A;  1YRU B;  3GK2 A;  3WHU B;  3IF7 A;  1PSB A;  4GBA A;  3NSI A;  1YX7 A;  1YVH A;  2P70 A;  1K96 A;  5JJG A;  3EK7 A;  5KU1 A;  1RJV A;  1KFX L;  2WCF A;  1GGZ A;  1AP4 A;  3CDN A;  2KLD A;  1TUJ A;  1U5I A;  4AOM A;  3PAT A;  2LE9 B;  2O60 A;  3SG4 A;  5FI2 A;  2MBX A;  3S0B A;  2ZFD A;  1NCX A;  1S36 A;  5HKW A;  1C07 A;  1TNP A;  5D3O A;  1N2D A;  3RLZ A;  5F6T A;  1CMG A;  4WQ3 A;  4DCK A;  1NWD A;  2QEO A;  1MHO A;  1CFF A;  2GGZ A;  5PAL A;  2M97 A;  3SG6 A;  2KPH A;  1BLQ A;  1A29 A;  4YGB B;  2EC6 C;  3NHI A;  3R1V A;  1TNX A;  1XO5 A;  4DS7 A;  1AJ5 A;  1KK8 C;  1EG4 A;  1PRW A;  1C7V A;  1MQ1 A;  1QVI Y;  1UHH A;  1IH0 A;  1QAT A;  1BG1 A;  3CR5 X;  1A4P A;  2G2B A;  1SMG A;  2KFF A;  1AUI B;  3BUX B;  3IVT A;  3K21 A;  3EK8 A;  4NDD A;  2HQW A;  4YGD B;  3EKJ A;  1AHR A;  1S3P A;  3DVJ A;  2LHL A;  1SCV A;  5BPJ A;  4YRU A;  3FS7 A;  2H8V A;  2BCA A;  5IBW A;  1U5I B;  1MWN A;  3S0F A;  1MXL C;  3TDI A;  2KI4 C;  1B8L A;  1DEK A;  1DT7 B;  2A4J A;  3FWB A;  3PSR A;  5AAN A;  3DZT A;  4YBH B;  1BOD A;  1SK6 D;  2JRF A;  2K61 A;  1FF1 A;  3L4L A;  3OP0 A;  5D7F A;  1QVI Z;  2KAY A;  1CM4 A;  2QDI A;  3WXA A;  3OGN A;  2H61 A;  3PN7 C;  2L50 A;  2OTG B;  1RRO A;  1KFU S;  1L2O C;  1NSH A;  2JUL A;  1XFZ O;  1S5G Y;  4HRG A;  3IQQ A;  2WCH A;  4WQ2 A;  1SPY A;  1RFJ A;  3AKA A;  3CAB A;  4U8D A;  1J7R A;  3E3R A;  4ZCU A;  2M7N A;  1JBA A;  3CS1 A;  2MLE C;  1YUU A;  5ER4 X;  2WCJ A;  2L2C A;  2FCE A;  2LV7 A;  2PVB A;  3DF0 A;  5CSI A;  4INX A;  4F7F A;  1TCF A;  1XA5 A;  5J3X A;  1MR8 A;  4HSZ A;  3VB1 A;  4D1E A;  4P5O E;  1YTZ C;  1LS8 A;  4N1G A;  5JOL A;  1LXF C;  3EVU A;  2RGI A;  1XK4 C; 
#chains in the Genus database with same CATH homology
 3N7H A;  3D75 A;  3L47 A;  3CYZ A;  3S0G A;  2FJY A;  4INW A;  3D78 A;  3D73 A;  3B6X A;  5DIC A;  2QEB A;  3B88 A;  2WCL A;  3R1P A;  5EL2 A;  2ERB A;  3CZ0 A;  2WCK A;  3DY9 A;  3PJI A;  1TWO A;  3S0E A;  2WCM A;  2PQL A;  3L4A A;  3R1O A;  2QEV A;  2P70 A;  3FE8 A;  1OOG A;  3CDN A;  1TUJ A;  4OZD A;  3NGV A;  1OOF A;  3B87 A;  2QEH A;  3S0B A;  1P28 A;  1T14 A;  2QEO A;  3S0D A;  3FE6 A;  3D74 A;  2KPH A;  3NHI A;  3R1V A;  3CZ1 A;  1GM0 A;  3DXL A;  3NHT A;  4PT1 A;  3S0A A;  3QME A;  1C3Z A;  2WC6 A;  3BFA A;  1DQE A;  3B7A A;  2JPO A;  2P71 A;  3CZ2 A;  3D76 A;  2H8V A;  3S0F A;  1OOH A;  3BFH A;  1C3Y A;  1OW4 A;  4FQT A;  3K1E A;  3DZT A;  3BJH A;  3R72 A;  3L4L A;  3DYE A;  3V2L A;  2QDI A;  3OGN A;  4JD9 A;  3B86 A;  2GTE A;  3BFB A;  1OOI X;  2WCH A;  3CAB A;  3RZS A;  2WC5 A;  1QWV A;  1XFR A;  3D77 A;  2WCJ A;  2L2C A;  3FE9 A;  4INX A;  4F7F A;  3Q8I A;  1ORG A;  3VB1 A;  1LS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...