1GM0A

A form of the pheromone-binding protein from bombyx mori
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure Reveals Novel Intramolecular Regulation Mechanism for Pheromone-Binding and Release
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
molecule keywords PHEROMONE-BINDING PROTEIN
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1gm0A00
3D77A 2WCMA 3S0BA 3CZ0A 1OOIX 3D74A 1P28A 1ORGA 2QDIA 3R1OA 1XFRA 1TWOA 3DZTA 3R72A 2JPOA 3OGNA 2WC5A 3V2LA 3CZ2A 1LS8A 3NGVA 3B86A 3N7HA 4INXA 3D78A 2P70A 1C3YA 3S0EA 1OW4A 3DXLA 2PQLA 4OZDA 3CZ1A 3BFBA 4PT1A 3VB1A 3B88A 3B6XA 2QEVA 5EL2A 3L47A 3NHTA 3FE8A 2QEHA 3QMEA 2P71A 1OOHA 2WCHA 3B87A 2ERBA 3R1PA 4INWA 3DYEA 4F7FA 2QEBA 3S0AA 3D73A 1OOGA 3DY9A 2WCLA 1DQEA 1TUJA 3L4LA 3S0DA 2WC6A 3Q8IA 3CDNA 1GM0A 3K1EA 1QWVA 3BFAA 3D75A 3CYZA 3NHIA 2WCKA 2H8VA 5DICA 1T14A 4FQTA 3L4AA 2WCJA 3S0FA 1C3ZA 2GTEA 3FE9A 2KPHA 3S0GA 2FJYA 2L2CA 3PJIA 3CABA 3BFHA 3BJHA 3D76A 3RZSA 2QEOA 1OOFA 3B7AA 3FE6A 3R1VA 4JD9A
chains in the Genus database with same CATH superfamily
1QX5B 4GBAA 1XA5A 1QXPA 3GK1A 4GAOA 3S0BA 1F8HA 3D0YB 3OB1B 4PE7A 2JU0A 3WNXB 2WCFA 3HCMA 4C0KA 1MR8A 3SG6A 1PVAA 2KLEA 5JOLA 2EGDA 4I5LB 3WHTB 1XFWO 1EXRA 1ZFSA 2F3ZA 1KWOC 2JNXA 1FBVA 1KFXS 2KDHA 2KQ6A 2RGIA 3E3RA 1LA3A 1AK8A 1AP4A 2KQYA 5F6TA 2LVIA 2M1UA 1DGUA 3ICBA 2M7NA 3JVTB 4IL1A 1SL7A 2KAVA 4JWQA 1CLBA 1A2XA 4OCIA 2KHNA 1DEKA 1QLSA 5B8IB 3BQ3A 5HKWA 4FQOA 1KSOA 1NIWA 1K93D 4GPLB 3BXKA 2FJUB 2M3WA 3EK7A 3O4XA 2EC6B 3OHMB 1WRLA 1CFFA 1Z2CB 2QPTA 1XO5A 1UP5A 2MBXA 1KFUS 5JJGA 1DJYA 4NDCA 5D3OA 3DXLA 2Q91A 3M0WA 3PALA 4MRXA 2JPTA 3BFBA 4OZDA 5FI6A 1NX2A 5CSFA 3TS5B 2G2BA 1C07A 2SASA 3OX5A 2FCDA 4JKTA 4M2QA 2L5XB 2AUCA 3B6XA 4YI9A 2KI4B 4YGDB 5EL2A 2QEHA 2KSPA 2I2RE 2P71A 1XK4C 3KPXA 2WCHA 1MWNA 3I5FC 2GGMA 1QVIZ 5AFPA 4INWA 2KLDA 4GGFC 3EVRA 2KOTA 1TUZA 2Q4UA 4YRUA 2KBMA 2QEBA 1WRKA 2K7CA 2K7OA 2KI6D 4ICBA 1CMFA 1NUBA 4IJ7A 2L4HA 1DQEA 1WDCB 4ZCUA 2ZN8A 2NCOA 1KQMC 5HLVA 1KK8C 5BPJA 1Y1AA 4N5XA 3GK2A 4C0LA 3AAKA 2NLNA 2BCBA 1DJWA 1AJ4A 4PHKA 2LANA 1YTZC 2L4IA 1S3PA 1F55A 4R1EA 4DCKA 3K1EA 3BFAA 1RJVA 1B47A 2LVJA 4OKHA 4YBHB 1A4PA 4UPGA 1K95A 4PE1A 3LLEA 1CFDA 2H61A 2WCKA 1YRTB 3LCPC 2H8VA 2B1UA 2I18A 1TTXA 2CBLA 3GK4X 1LXFC 2LLSA 4N1FA 2K0JA 4CPVA 1ALVA 3O4YA 3ZNIA 2BCAA 2K8MB 4KYNA 2O5GA 4MVFA 3PATA 5D7FA 4AQIA 1BR1B 2L98A 4BY4A 1J55A 1YUUA 1DF0B 3EVVA 1FF1A 1QX7A 1NWDA 2Y1MA 3EKJA 1HT9A 3S0FA 4DIRA 1JFJA 1CTRA 1YX8A 3F45A 2L2CA 2D8NA 2LLUA 1BT6A 2L5YA 1UHKA 2ZNEA 3AKBA 1IG5A 2JZIA 2KYCA 1ZUZA 3BUOB 1UURA 4AQJA 1RTP1 1OOFA 3KEVA 4C0JA 2JNFA 3B7AA 1ZACA 1WY9A 2V53A 3D77A 1TCOB 1EL4A 3FIAA 5ER5A 1Z4HA 1DELA 2BBNA 4PCWA 1GGZA 5G08A 1SL8A 1G33A 1QVIY 2MAZA 2WCMA 3BUMB 2L2EA 4YGEB 1YR5A 3IQQA 1SK6D 3D74A 1Y1UA 1YUTA 3IF7A 3SS4A 2PYQA 2QDIA 3FS7A 3DZTA 3JVTC 1AHRA 1CDLA 2K61A 3CGAA 1L7ZA 2ZRTA 3CLNA 5CSIA 2WC5A 2PMYA 1SMGA 3V2LA 1OZSA 2BBMA 2BAPA 2L50A 1OZOA 1TCFA 3NSKA 2MJWB 3SG4A 3BOWA 3KO0A 1OOJA 1OMDA 2AMIA 1NYAA 3NSLA 1N2DA 4QJ3B 5HKZA 4INXA 3NXAA 5KTYA 1CNPA 2SCPA 1ZOTB 3DVMA 3SG7A 1YX7A 2LVKA 5I8NA 2YGUA 2JT3A 3CR2A 1NX3A 1UHIA 4MN0A 5FI7A 3RM1A 2M49B 1TRFA 2JTTA 3A8RA 4ZCVA 4I5NB 1M45A 1W7IB 2KYFA 3CZ1A 1C7WA 1B7TZ 3A4UB 3IVTA 3HX4A 3CR4X 1TIZA 3VGOA 4MEWA 5HYDA 3SIAA 1DT7B 2KFHA 2QEVA 2KFGA 3QMEA 3FE8A 5CPVA 5AXIA 1SKTA 3K21A 3NSIA 4HREE 3FWBA 4I5KA 1B8CA 2AAOA 1Y0VH 3BOWB 4WRIA 2ERBA 5FI2A 5HKYA 3IQOA 3PSRA 4MLWA 4U8DA 1SSEB 2JWWA 3DYEA 3SG2A 1MXLC 4GFTA 2ZNDA 1S6JA 2BKIB 4USLA 2ZFDA 2FCEA 2K2FA 2JT0A 2MRDA 4ORBB 2F2OA 5FYXA 5GQQC 1ALWA 2LUCA 1CM4A 3O2PA 4QJ4B 2LM5A 1K2HA 1IJ5A 2ZKMX 2WCLA 1BODA 2L0PA 1PULA 1PVBA 1S1EA 2JQ6A 3I5IB 2KI4C 3CS1A 3S0DA 3I5IC 1SW8A 2WC6A 1G4YR 1KWOB 1SR6B 4TNCA 1WRZA 4CFRA 1N0YA 1IH0A 1A75A 1NCYA 1TNWA 2F3YA 3CDNA 3DVEA 3SS3A 1B7TY 1GM0A 1WLZA 2DOQA 2H2KA 1KK7Y 3DVJA 2MHHA 2HQWA 3D75A 4YI8A 1L2OC 3NHIA 2K7DA 3QRXA 2EC6C 1F71A 1NX1A 4N1GA 4MBEA 1GGWA 5DICA 5I2LA 2BNXA 2HETA 1K9PA 1GJYA 1YRUB 2CTNA 1CDPA 2K60A 2M29A 3EG5B 3I5GB 2PASA 1KCYA 1DC1A 2KGRA 1LA0A 1CMGA 4MZJA 1YUSA 5CSNA 3TUYB 3I5HC 2KPHA 1K96A 4CLNA 3I5HB 4PHNA 2OTGB 3LK1A 5ER4X 4HRHA 1SR6C 2QACA 4MRYA 3BJHA 3ZWHA 1QASA 1KFXL 4QJ5B 1J7OA 2LAPA 1DVIA 1S36A 2WCEA 4JQ0D 1BR4B 2PSRA 5DKRA 2HPSA 1IIOA 2WC8A 3JTDB 4M2PA 1MF8B 3BUNB 2JXLA 4YGBB 4YGCB 1DF0A 2Y4QA 4GGFA 1U5IA 4PDZA 1JF0A 2P6BB 1L2OB 2WOSA 4XJKB 4GUKA 1RECA 3VRQA 3LK0A 1JUOA 1QIVA 1V1FA 2LMTA 3PLFB 1QV1A 1K9UA 1XFRA 1J7PA 3AKAA 1IWQA 1S6IA 2KFFA 3DF0B 3KHEA 2HQ8A 1B8RA 3OGNA 1QJTA 3PM2A 4P2YB 1KK7Z 1RK9A 2NZ0A 3GOFA 1M46A 3OB2B 1GQMA 1UHHA 2E6WA 4OVNF 3SS5A 1TNXA 1JFKA 1KK8B 1FI6A 1KQMB 1FI5A 2WORA 1CDNA 1DTLA 1SPYA 2LE9B 2P70A 1UHNA 1UHJA 1PSBA 1K94A 2JRFA 3D78A 4PE4A 5HL1A 1C3YA 4XYNA 4AOMA 4PHJA 1PSRA 1FPWA 3S0EA 1S6CA 4CIDA 1OW4A 4A4BA 2PALA 2KAXA 4OV2A 2PQLA 1RROA 1U5IB 4XJKA 1B4CA 2BE4A 2IS9A 2PRUA 4BY5A 1JWDA 2ZN9A 3PM8A 1PALA 1EG3A 1J1DA 3L47A 5DKNA 1CLLA 2COLB 2MA2A 3DF0A 1C7VA 1XFXO 1OOHA 2BCXA 2LV7A 2F2PA 3B87A 4MSPA 1A03A 1H8BA 1CKKA 2FOTA 3R1PA 1J7RA 1SL9A 2E30A 4PALA 2M8UA 5I2OA 3PN7C 4F7FA 3VROA 2H61C 2NCPA 1UWOA 1SY9A 2JT8A 3O6BA 4NQGA 4DS7A 1ZMZA 4M2OA 5HLOA 4MZKA 2M97A 1IQ3A 1OOGA 3DY9A 1R6PA 1TN4A 2K7BA 3LL8B 1M31A 1CLMA 1YVHA 2VRGA 1RWYA 3EVUA 4ETOA 1TUJA 3UO9A 1XVJA 3OX6A 1SNLA 3L4LA 1IQ5A 4HRGA 1W7JB 4I5JA 2LMVA 1CM1A 5AEQA 1H4BA 2Y1NA 1IKUA 1BOCA 3Q8IA 3CR5X 2KAYA 4FTGA 2KI6C 4HSZA 1B1GA 1B8LA 1DJZA 2F33A 1QWVA 1S26D 3CYZA 2BL0B 3H4SE 1BG1A 1JC2A 2GV5A 4PHMA 3PN7B 2JULA 4DUQA 4ORAB 1T14A 3EK4A 4F0ZB 4Q04A 2KGBC 1K9KA 1FW4A 2I7AA 2WCJA 1XK4A 2BECA 5PALA 1OMVA 2GTEA 1DGVA 2LUXA 1XYDA 2KNEA 2I94A 1A75B 3S0GA 2FJYA 1DMOA 2JXCA 1K8UA 2MLFC 1QV0A 1NP8A 3PJIA 5IBWA 3BFHA 1A29A 1SYMA 3CTNA 1JF2A 1OSAA 1NCZA 4E68A 2LP3A 3RLZA 5KU1A 3FWCA 3NSOA 3UNWA 1F54A 5KSZA 5TNCA 2A4JA 4GGNA 3BUWB 2OS8C 3WXAA 1CFCA 1MHOA 1CFPA 2CCMA 2OPOA 2OS8B 1DJXA 3CZ0A 3SIBA 1OOIX 1P28A 2WCBA 4WQ2A 3TZ1A 1ORGA 2ZRSA 1JSAA 3R1OA 2BE6A 2JTZA 1TWOA 1NPQA 2R2IA 1J7QA 2LC5A 3R72A 1F70A 2JPOA 3AAJA 1QLKA 3VRNA 3CZ2A 3CZTX 1OQPA 1SRAA 1QX2A 2LCPA 1SBJA 3TDZA 1LS8A 1EH2A 1WDCC 2O60A 2EHBA 4PE0A 1M63B 2NXQA 3NGVA 3B86A 5CSJA 3N7HA 1TNPA 1HQVA 1BLQA 4CFQA 2BKHB 3EKHA 4OR9B 1BJFA 2G9BA 4WQ3A 4P5OE 3JTDC 1UUSA 4NDBA 5I2QA 4DRWA 2CT9A 2LHLA 1R2UA 1N65A 2BL0C 4PT1A 1IRJA 1NX0A 1Y6WA 1TOPA 5AANA 3VB1A 1PRWA 2OTGC 1AUIB 4JPZB 3B88A 5AERA 1BF5A 1LKJA 3NHTA 5D69A 1CB1A 1DJIA 2CNPA 2MLEC 3TUYC 1MQ1A 1M39A 2M1KB 3TS5C 1S5GZ 1MUXA 1DJGA 1F4OA 1V1GA 4NDDA 3OP0A 1JBAA 2JC2A 1TNQA 1XFVO 5I94A 2M9GA 1ODBA 1RFJA 5DKQA 3C1VA 4D1EA 1LINA 3D10A 3S0AA 1EG4A 3D73A 1VRKA 1OMRA 3OBVA 1E8AA 2F8PA 1QATA 3PFVA 2M7LA 2K2AA 2L51A 1PK0D 3CWGA 4GNKB 1S5GY 1SCVA 2LVVA 3I5FB 1KFUL 1QIWA 1SCMC 1BMOA 1Q80A 3SG5A 2LMUA 1OE9B 1DJHA 2TN4A 1B9AA 1X02A 1BU3A 1LVCD 3WHUB 1KQVA 2HF5A 3MSEB 1AVSA 1F4QA 1IJ6A 1NSHA 1QS7A 1Y1XA 3O78A 4L9MA 1QTXA 2WNDA 3SJSA 3VRRA 4MZLA 1G8IA 3D0YA 1WLMA 2ISDA 4A4CA 3BYAA 2LHIA 3VRPA 1YURA 3DD4A 1XFYO 2LNKA 3KF9A 4ORCB 1D1OA 2LP2A 4FQTA 3L4AA 1MXEA 4YGAA 1C3ZA 1K90D 3EK8A 3FE9A 1W9ZA 1YVLA 1NCXA 2KBIA 1IGVA 2CXJA 5J3XA 2PVBA 2GGZA 2Y5IA 1AJ5A 1EJ3A 3CABA 2M0RA 2JOJA 1XFUO 3D76A 3DVKA 3RZSA 1KSMA 1SCMB 1CDMA 3BUXB 2QEOA 3I5GC 1J1EA 3SG3A 3TDUA 3TDIA 5K89A 3FE6A 2LLTA 3R1VA 4JD9A 1XFZO
chains in the Genus database with same CATH topology
3D77A 2WCMA 3S0BA 3CZ0A 1OOIX 3D74A 1P28A 1ORGA 2QDIA 3R1OA 1XFRA 1TWOA 3DZTA 3R72A 2JPOA 3OGNA 2WC5A 3V2LA 3CZ2A 1LS8A 3NGVA 3B86A 3N7HA 4INXA 3D78A 2P70A 1C3YA 3S0EA 1OW4A 3DXLA 2PQLA 4OZDA 3CZ1A 3BFBA 4PT1A 3VB1A 3B88A 3B6XA 2QEVA 5EL2A 3L47A 3NHTA 3FE8A 2QEHA 3QMEA 2P71A 1OOHA 2WCHA 3B87A 2ERBA 3R1PA 4INWA 3DYEA 4F7FA 2QEBA 3S0AA 3D73A 1OOGA 3DY9A 2WCLA 1DQEA 1TUJA 3L4LA 3S0DA 2WC6A 3Q8IA 3CDNA 1GM0A 3K1EA 1QWVA 3BFAA 3D75A 3CYZA 3NHIA 2WCKA 2H8VA 5DICA 1T14A 4FQTA 3L4AA 2WCJA 3S0FA 1C3ZA 2GTEA 3FE9A 2KPHA 3S0GA 2FJYA 2L2CA 3PJIA 3CABA 3BFHA 3BJHA 3D76A 3RZSA 2QEOA 1OOFA 3B7AA 3FE6A 3R1VA 4JD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D77 A;  2WCM A;  3S0B A;  3CZ0 A;  1OOI X;  3D74 A;  1P28 A;  1ORG A;  2QDI A;  3R1O A;  1XFR A;  1TWO A;  3DZT A;  3R72 A;  2JPO A;  3OGN A;  2WC5 A;  3V2L A;  3CZ2 A;  1LS8 A;  3NGV A;  3B86 A;  3N7H A;  4INX A;  3D78 A;  2P70 A;  1C3Y A;  3S0E A;  1OW4 A;  3DXL A;  2PQL A;  4OZD A;  3CZ1 A;  3BFB A;  4PT1 A;  3VB1 A;  3B88 A;  3B6X A;  2QEV A;  5EL2 A;  3L47 A;  3NHT A;  3FE8 A;  2QEH A;  3QME A;  2P71 A;  1OOH A;  2WCH A;  3B87 A;  2ERB A;  3R1P A;  4INW A;  3DYE A;  4F7F A;  2QEB A;  3S0A A;  3D73 A;  1OOG A;  3DY9 A;  2WCL A;  1DQE A;  1TUJ A;  3L4L A;  3S0D A;  2WC6 A;  3Q8I A;  3CDN A;  1GM0 A;  3K1E A;  1QWV A;  3BFA A;  3D75 A;  3CYZ A;  3NHI A;  2WCK A;  2H8V A;  5DIC A;  1T14 A;  4FQT A;  3L4A A;  2WCJ A;  3S0F A;  1C3Z A;  2GTE A;  3FE9 A;  2KPH A;  3S0G A;  2FJY A;  2L2C A;  3PJI A;  3CAB A;  3BFH A;  3BJH A;  3D76 A;  3RZS A;  2QEO A;  1OOF A;  3B7A A;  3FE6 A;  3R1V A;  4JD9 A; 
#chains in the Genus database with same CATH topology
 1QX5 B;  4GBA A;  1XA5 A;  1QXP A;  3GK1 A;  4GAO A;  3S0B A;  1F8H A;  3D0Y B;  3OB1 B;  4PE7 A;  2JU0 A;  3WNX B;  2WCF A;  3HCM A;  4C0K A;  1MR8 A;  3SG6 A;  1PVA A;  2KLE A;  5JOL A;  2EGD A;  4I5L B;  3WHT B;  1XFW O;  1EXR A;  1ZFS A;  2F3Z A;  1KWO C;  2JNX A;  1FBV A;  1KFX S;  2KDH A;  2KQ6 A;  2RGI A;  3E3R A;  1LA3 A;  1AK8 A;  1AP4 A;  2KQY A;  5F6T A;  2LVI A;  2M1U A;  1DGU A;  3ICB A;  2M7N A;  3JVT B;  4IL1 A;  1SL7 A;  2KAV A;  4JWQ A;  1CLB A;  1A2X A;  4OCI A;  2KHN A;  1DEK A;  1QLS A;  5B8I B;  3BQ3 A;  5HKW A;  4FQO A;  1KSO A;  1NIW A;  1K93 D;  4GPL B;  3BXK A;  2FJU B;  2M3W A;  3EK7 A;  3O4X A;  2EC6 B;  3OHM B;  1WRL A;  1CFF A;  1Z2C B;  2QPT A;  1XO5 A;  1UP5 A;  2MBX A;  1KFU S;  5JJG A;  1DJY A;  4NDC A;  5D3O A;  3DXL A;  2Q91 A;  3M0W A;  3PAL A;  4MRX A;  2JPT A;  3BFB A;  4OZD A;  5FI6 A;  1NX2 A;  5CSF A;  3TS5 B;  2G2B A;  1C07 A;  2SAS A;  3OX5 A;  2FCD A;  4JKT A;  4M2Q A;  2L5X B;  2AUC A;  3B6X A;  4YI9 A;  2KI4 B;  4YGD B;  5EL2 A;  2QEH A;  2KSP A;  2I2R E;  2P71 A;  1XK4 C;  3KPX A;  2WCH A;  1MWN A;  3I5F C;  2GGM A;  1QVI Z;  5AFP A;  4INW A;  2KLD A;  4GGF C;  3EVR A;  2KOT A;  1TUZ A;  2Q4U A;  4YRU A;  2KBM A;  2QEB A;  1WRK A;  2K7C A;  2K7O A;  2KI6 D;  4ICB A;  1CMF A;  1NUB A;  4IJ7 A;  2L4H A;  1DQE A;  1WDC B;  4ZCU A;  2ZN8 A;  2NCO A;  1KQM C;  5HLV A;  1KK8 C;  5BPJ A;  1Y1A A;  4N5X A;  3GK2 A;  4C0L A;  3AAK A;  2NLN A;  2BCB A;  1DJW A;  1AJ4 A;  4PHK A;  2LAN A;  1YTZ C;  2L4I A;  1S3P A;  1F55 A;  4R1E A;  4DCK A;  3K1E A;  3BFA A;  1RJV A;  1B47 A;  2LVJ A;  4OKH A;  4YBH B;  1A4P A;  4UPG A;  1K95 A;  4PE1 A;  3LLE A;  1CFD A;  2H61 A;  2WCK A;  1YRT B;  3LCP C;  2H8V A;  2B1U A;  2I18 A;  1TTX A;  2CBL A;  3GK4 X;  1LXF C;  2LLS A;  4N1F A;  2K0J A;  4CPV A;  1ALV A;  3O4Y A;  3ZNI A;  2BCA A;  2K8M B;  4KYN A;  2O5G A;  4MVF A;  3PAT A;  5D7F A;  4AQI A;  1BR1 B;  2L98 A;  4BY4 A;  1J55 A;  1YUU A;  1DF0 B;  3EVV A;  1FF1 A;  1QX7 A;  1NWD A;  2Y1M A;  3EKJ A;  1HT9 A;  3S0F A;  4DIR A;  1JFJ A;  1CTR A;  1YX8 A;  3F45 A;  2L2C A;  2D8N A;  2LLU A;  1BT6 A;  2L5Y A;  1UHK A;  2ZNE A;  3AKB A;  1IG5 A;  2JZI A;  2KYC A;  1ZUZ A;  3BUO B;  1UUR A;  4AQJ A;  1RTP 1;  1OOF A;  3KEV A;  4C0J A;  2JNF A;  3B7A A;  1ZAC A;  1WY9 A;  2V53 A;  3D77 A;  1TCO B;  1EL4 A;  3FIA A;  5ER5 A;  1Z4H A;  1DEL A;  2BBN A;  4PCW A;  1GGZ A;  5G08 A;  1SL8 A;  1G33 A;  1QVI Y;  2MAZ A;  2WCM A;  3BUM B;  2L2E A;  4YGE B;  1YR5 A;  3IQQ A;  1SK6 D;  3D74 A;  1Y1U A;  1YUT A;  3IF7 A;  3SS4 A;  2PYQ A;  2QDI A;  3FS7 A;  3DZT A;  3JVT C;  1AHR A;  1CDL A;  2K61 A;  3CGA A;  1L7Z A;  2ZRT A;  3CLN A;  5CSI A;  2WC5 A;  2PMY A;  1SMG A;  3V2L A;  1OZS A;  2BBM A;  2BAP A;  2L50 A;  1OZO A;  1TCF A;  3NSK A;  2MJW B;  3SG4 A;  3BOW A;  3KO0 A;  1OOJ A;  1OMD A;  2AMI A;  1NYA A;  3NSL A;  1N2D A;  4QJ3 B;  5HKZ A;  4INX A;  3NXA A;  5KTY A;  1CNP A;  2SCP A;  1ZOT B;  3DVM A;  3SG7 A;  1YX7 A;  2LVK A;  5I8N A;  2YGU A;  2JT3 A;  3CR2 A;  1NX3 A;  1UHI A;  4MN0 A;  5FI7 A;  3RM1 A;  2M49 B;  1TRF A;  2JTT A;  3A8R A;  4ZCV A;  4I5N B;  1M45 A;  1W7I B;  2KYF A;  3CZ1 A;  1C7W A;  1B7T Z;  3A4U B;  3IVT A;  3HX4 A;  3CR4 X;  1TIZ A;  3VGO A;  4MEW A;  5HYD A;  3SIA A;  1DT7 B;  2KFH A;  2QEV A;  2KFG A;  3QME A;  3FE8 A;  5CPV A;  5AXI A;  1SKT A;  3K21 A;  3NSI A;  4HRE E;  3FWB A;  4I5K A;  1B8C A;  2AAO A;  1Y0V H;  3BOW B;  4WRI A;  2ERB A;  5FI2 A;  5HKY A;  3IQO A;  3PSR A;  4MLW A;  4U8D A;  1SSE B;  2JWW A;  3DYE A;  3SG2 A;  1MXL C;  4GFT A;  2ZND A;  1S6J A;  2BKI B;  4USL A;  2ZFD A;  2FCE A;  2K2F A;  2JT0 A;  2MRD A;  4ORB B;  2F2O A;  5FYX A;  5GQQ C;  1ALW A;  2LUC A;  1CM4 A;  3O2P A;  4QJ4 B;  2LM5 A;  1K2H A;  1IJ5 A;  2ZKM X;  2WCL A;  1BOD A;  2L0P A;  1PUL A;  1PVB A;  1S1E A;  2JQ6 A;  3I5I B;  2KI4 C;  3CS1 A;  3S0D A;  3I5I C;  1SW8 A;  2WC6 A;  1G4Y R;  1KWO B;  1SR6 B;  4TNC A;  1WRZ A;  4CFR A;  1N0Y A;  1IH0 A;  1A75 A;  1NCY A;  1TNW A;  2F3Y A;  3CDN A;  3DVE A;  3SS3 A;  1B7T Y;  1GM0 A;  1WLZ A;  2DOQ A;  2H2K A;  1KK7 Y;  3DVJ A;  2MHH A;  2HQW A;  3D75 A;  4YI8 A;  1L2O C;  3NHI A;  2K7D A;  3QRX A;  2EC6 C;  1F71 A;  1NX1 A;  4N1G A;  4MBE A;  1GGW A;  5DIC A;  5I2L A;  2BNX A;  2HET A;  1K9P A;  1GJY A;  1YRU B;  2CTN A;  1CDP A;  2K60 A;  2M29 A;  3EG5 B;  3I5G B;  2PAS A;  1KCY A;  1DC1 A;  2KGR A;  1LA0 A;  1CMG A;  4MZJ A;  1YUS A;  5CSN A;  3TUY B;  3I5H C;  2KPH A;  1K96 A;  4CLN A;  3I5H B;  4PHN A;  2OTG B;  3LK1 A;  5ER4 X;  4HRH A;  1SR6 C;  2QAC A;  4MRY A;  3BJH A;  3ZWH A;  1QAS A;  1KFX L;  4QJ5 B;  1J7O A;  2LAP A;  1DVI A;  1S36 A;  2WCE A;  4JQ0 D;  1BR4 B;  2PSR A;  5DKR A;  2HPS A;  1IIO A;  2WC8 A;  3JTD B;  4M2P A;  1MF8 B;  3BUN B;  2JXL A;  4YGB B;  4YGC B;  1DF0 A;  2Y4Q A;  4GGF A;  1U5I A;  4PDZ A;  1JF0 A;  2P6B B;  1L2O B;  2WOS A;  4XJK B;  4GUK A;  1REC A;  3VRQ A;  3LK0 A;  1JUO A;  1QIV A;  1V1F A;  2LMT A;  3PLF B;  1QV1 A;  1K9U A;  1XFR A;  1J7P A;  3AKA A;  1IWQ A;  1S6I A;  2KFF A;  3DF0 B;  3KHE A;  2HQ8 A;  1B8R A;  3OGN A;  1QJT A;  3PM2 A;  4P2Y B;  1KK7 Z;  1RK9 A;  2NZ0 A;  3GOF A;  1M46 A;  3OB2 B;  1GQM A;  1UHH A;  2E6W A;  4OVN F;  3SS5 A;  1TNX A;  1JFK A;  1KK8 B;  1FI6 A;  1KQM B;  1FI5 A;  2WOR A;  1CDN A;  1DTL A;  1SPY A;  2LE9 B;  2P70 A;  1UHN A;  1UHJ A;  1PSB A;  1K94 A;  2JRF A;  3D78 A;  4PE4 A;  5HL1 A;  1C3Y A;  4XYN A;  4AOM A;  4PHJ A;  1PSR A;  1FPW A;  3S0E A;  1S6C A;  4CID A;  1OW4 A;  4A4B A;  2PAL A;  2KAX A;  4OV2 A;  2PQL A;  1RRO A;  1U5I B;  4XJK A;  1B4C A;  2BE4 A;  2IS9 A;  2PRU A;  4BY5 A;  1JWD A;  2ZN9 A;  3PM8 A;  1PAL A;  1EG3 A;  1J1D A;  3L47 A;  5DKN A;  1CLL A;  2COL B;  2MA2 A;  3DF0 A;  1C7V A;  1XFX O;  1OOH A;  2BCX A;  2LV7 A;  2F2P A;  3B87 A;  4MSP A;  1A03 A;  1H8B A;  1CKK A;  2FOT A;  3R1P A;  1J7R A;  1SL9 A;  2E30 A;  4PAL A;  2M8U A;  5I2O A;  3PN7 C;  4F7F A;  3VRO A;  2H61 C;  2NCP A;  1UWO A;  1SY9 A;  2JT8 A;  3O6B A;  4NQG A;  4DS7 A;  1ZMZ A;  4M2O A;  5HLO A;  4MZK A;  2M97 A;  1IQ3 A;  1OOG A;  3DY9 A;  1R6P A;  1TN4 A;  2K7B A;  3LL8 B;  1M31 A;  1CLM A;  1YVH A;  2VRG A;  1RWY A;  3EVU A;  4ETO A;  1TUJ A;  3UO9 A;  1XVJ A;  3OX6 A;  1SNL A;  3L4L A;  1IQ5 A;  4HRG A;  1W7J B;  4I5J A;  2LMV A;  1CM1 A;  5AEQ A;  1H4B A;  2Y1N A;  1IKU A;  1BOC A;  3Q8I A;  3CR5 X;  2KAY A;  4FTG A;  2KI6 C;  4HSZ A;  1B1G A;  1B8L A;  1DJZ A;  2F33 A;  1QWV A;  1S26 D;  3CYZ A;  2BL0 B;  3H4S E;  1BG1 A;  1JC2 A;  2GV5 A;  4PHM A;  3PN7 B;  2JUL A;  4DUQ A;  4ORA B;  1T14 A;  3EK4 A;  4F0Z B;  4Q04 A;  2KGB C;  1K9K A;  1FW4 A;  2I7A A;  2WCJ A;  1XK4 A;  2BEC A;  5PAL A;  1OMV A;  2GTE A;  1DGV A;  2LUX A;  1XYD A;  2KNE A;  2I94 A;  1A75 B;  3S0G A;  2FJY A;  1DMO A;  2JXC A;  1K8U A;  2MLF C;  1QV0 A;  1NP8 A;  3PJI A;  5IBW A;  3BFH A;  1A29 A;  1SYM A;  3CTN A;  1JF2 A;  1OSA A;  1NCZ A;  4E68 A;  2LP3 A;  3RLZ A;  5KU1 A;  3FWC A;  3NSO A;  3UNW A;  1F54 A;  5KSZ A;  5TNC A;  2A4J A;  4GGN A;  3BUW B;  2OS8 C;  3WXA A;  1CFC A;  1MHO A;  1CFP A;  2CCM A;  2OPO A;  2OS8 B;  1DJX A;  3CZ0 A;  3SIB A;  1OOI X;  1P28 A;  2WCB A;  4WQ2 A;  3TZ1 A;  1ORG A;  2ZRS A;  1JSA A;  3R1O A;  2BE6 A;  2JTZ A;  1TWO A;  1NPQ A;  2R2I A;  1J7Q A;  2LC5 A;  3R72 A;  1F70 A;  2JPO A;  3AAJ A;  1QLK A;  3VRN A;  3CZ2 A;  3CZT X;  1OQP A;  1SRA A;  1QX2 A;  2LCP A;  1SBJ A;  3TDZ A;  1LS8 A;  1EH2 A;  1WDC C;  2O60 A;  2EHB A;  4PE0 A;  1M63 B;  2NXQ A;  3NGV A;  3B86 A;  5CSJ A;  3N7H A;  1TNP A;  1HQV A;  1BLQ A;  4CFQ A;  2BKH B;  3EKH A;  4OR9 B;  1BJF A;  2G9B A;  4WQ3 A;  4P5O E;  3JTD C;  1UUS A;  4NDB A;  5I2Q A;  4DRW A;  2CT9 A;  2LHL A;  1R2U A;  1N65 A;  2BL0 C;  4PT1 A;  1IRJ A;  1NX0 A;  1Y6W A;  1TOP A;  5AAN A;  3VB1 A;  1PRW A;  2OTG C;  1AUI B;  4JPZ B;  3B88 A;  5AER A;  1BF5 A;  1LKJ A;  3NHT A;  5D69 A;  1CB1 A;  1DJI A;  2CNP A;  2MLE C;  3TUY C;  1MQ1 A;  1M39 A;  2M1K B;  3TS5 C;  1S5G Z;  1MUX A;  1DJG A;  1F4O A;  1V1G A;  4NDD A;  3OP0 A;  1JBA A;  2JC2 A;  1TNQ A;  1XFV O;  5I94 A;  2M9G A;  1ODB A;  1RFJ A;  5DKQ A;  3C1V A;  4D1E A;  1LIN A;  3D10 A;  3S0A A;  1EG4 A;  3D73 A;  1VRK A;  1OMR A;  3OBV A;  1E8A A;  2F8P A;  1QAT A;  3PFV A;  2M7L A;  2K2A A;  2L51 A;  1PK0 D;  3CWG A;  4GNK B;  1S5G Y;  1SCV A;  2LVV A;  3I5F B;  1KFU L;  1QIW A;  1SCM C;  1BMO A;  1Q80 A;  3SG5 A;  2LMU A;  1OE9 B;  1DJH A;  2TN4 A;  1B9A A;  1X02 A;  1BU3 A;  1LVC D;  3WHU B;  1KQV A;  2HF5 A;  3MSE B;  1AVS A;  1F4Q A;  1IJ6 A;  1NSH A;  1QS7 A;  1Y1X A;  3O78 A;  4L9M A;  1QTX A;  2WND A;  3SJS A;  3VRR A;  4MZL A;  1G8I A;  3D0Y A;  1WLM A;  2ISD A;  4A4C A;  3BYA A;  2LHI A;  3VRP A;  1YUR A;  3DD4 A;  1XFY O;  2LNK A;  3KF9 A;  4ORC B;  1D1O A;  2LP2 A;  4FQT A;  3L4A A;  1MXE A;  4YGA A;  1C3Z A;  1K90 D;  3EK8 A;  3FE9 A;  1W9Z A;  1YVL A;  1NCX A;  2KBI A;  1IGV A;  2CXJ A;  5J3X A;  2PVB A;  2GGZ A;  2Y5I A;  1AJ5 A;  1EJ3 A;  3CAB A;  2M0R A;  2JOJ A;  1XFU O;  3D76 A;  3DVK A;  3RZS A;  1KSM A;  1SCM B;  1CDM A;  3BUX B;  2QEO A;  3I5G C;  1J1E A;  3SG3 A;  3TDU A;  3TDI A;  5K89 A;  3FE6 A;  2LLT A;  3R1V A;  4JD9 A;  1XFZ O; 
#chains in the Genus database with same CATH homology
 3D77 A;  2WCM A;  3S0B A;  3CZ0 A;  1OOI X;  3D74 A;  1P28 A;  1ORG A;  2QDI A;  3R1O A;  1XFR A;  1TWO A;  3DZT A;  3R72 A;  2JPO A;  3OGN A;  2WC5 A;  3V2L A;  3CZ2 A;  1LS8 A;  3NGV A;  3B86 A;  3N7H A;  4INX A;  3D78 A;  2P70 A;  1C3Y A;  3S0E A;  1OW4 A;  3DXL A;  2PQL A;  4OZD A;  3CZ1 A;  3BFB A;  4PT1 A;  3VB1 A;  3B88 A;  3B6X A;  2QEV A;  5EL2 A;  3L47 A;  3NHT A;  3FE8 A;  2QEH A;  3QME A;  2P71 A;  1OOH A;  2WCH A;  3B87 A;  2ERB A;  3R1P A;  4INW A;  3DYE A;  4F7F A;  2QEB A;  3S0A A;  3D73 A;  1OOG A;  3DY9 A;  2WCL A;  1DQE A;  1TUJ A;  3L4L A;  3S0D A;  2WC6 A;  3Q8I A;  3CDN A;  1GM0 A;  3K1E A;  1QWV A;  3BFA A;  3D75 A;  3CYZ A;  3NHI A;  2WCK A;  2H8V A;  5DIC A;  1T14 A;  4FQT A;  3L4A A;  2WCJ A;  3S0F A;  1C3Z A;  2GTE A;  3FE9 A;  2KPH A;  3S0G A;  2FJY A;  2L2C A;  3PJI A;  3CAB A;  3BFH A;  3BJH A;  3D76 A;  3RZS A;  2QEO A;  1OOF A;  3B7A A;  3FE6 A;  3R1V A;  4JD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...