2GV5A

Crystal structure of sfi1p/cdc31p complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division control protein 31
publication title Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2gv5A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2gv5A01
1WY9A 1S6CA 1XFUO 2CT9A 1XFVO 1IG5A 2M3WA 1TCOB 1KQMC 3CR2A 1ALWA 3LK0A 3CS1A 2NZ0A 3WHUB 5I2OA 1TCFA 2BCAA 3VGOA 1YX7A 3GK1A 1LXFC 2O60A 1QIWA 1OZOA 2BE4A 1J7PA 1PULA 2WCFA 2FCDA 3EVUA 3DVKA 4N1FA 1BJFA 1PK0D 1JF2A 1QXPA 1R2UA 1KFXS 2F33A 2RGIA 3TDIA 2BKHB 4PCWA 2F2PA 2LMVA 3BUXB 1K93D 3BQ3A 1M45A 2R2IA 1JC2A 2M29A 1SR6C 1U5IB 1JSAA 1Y1XA 5FYXA 1ZOTB 2LUXA 4GAOA 4MZKA 2BL0B 1TNXA 1KWOC 4ORAB 1C7WA 1QLSA 1J1DA 4PDZA 1A4PA 1A2XA 2M49B 2MJWB 2EC6C 1PRWA 4PE4A 1OSAA 1CMGA 2VRGA 4YI9A 5KU1A 1NX3A 2LP3A 3TUYB 1WLMA 1WRLA 4MVFA 5HYDA 3VRNA 1A75A 3LCPC 1DJXA 3O4YA 2KAYA 5AXIA 2KGBC 2KYCA 3NSLA 1J7OA 2BKIB 3I5GB 4BY4A 1IJ5A 1K9UA 2WCEA 2B1UA 3KEVA 2JNXA 4P5OE 5BPJA 1XK4C 2Q91A 2K7DA 2JTZA 4L9MA 5HLVA 1SK6D 1S36A 1IRJA 2FJUB 2ZFDA 1QJTA 4A4CA 5I2QA 1QLKA 1LA3A 1EXRA 2JU0A 1AJ4A 2G9BA 3TDUA 4CIDA 4QJ4B 3NSKA 3WNXB 4AQIA 2I94A 1YRTB 4JQ0D 1UWOA 4PHMA 3BUMB 1KFXL 3PN7B 4QJ3B 5JOLA 1KCYA 1RROA 2M9GA 3A4UB 4XJKB 1C7VA 1E8AA 3GOFA 2BBMA 2H61C 1F71A 1K90D 1NPQA 3CR4X 3VRPA 1TTXA 1J7RA 2K8MB 3EVVA 1S1EA 4R1EA 2DOQA 1F55A 5HKYA 5K89A 2K2FA 2ZKMX 2JWWA 2E6WA 1DT7B 1SMGA 2JT0A 1PVAA 4ORCB 1XVJA 2BE6A 4PHKA 5I2LA 1AK8A 2PALA 4CPVA 1B9AA 3D0YA 1EJ3A 1IWQA 2WC8A 2EGDA 2AAOA 1JBAA 1LKJA 3HX4A 2LHLA 2Q4UA 2M0RA 1YUUA 2KSPA 1XA5A 1G4YR 3DF0A 1KK7Y 1JFKA 1OMDA 2KBIA 1VRKA 2AUCA 4A4BA 3OHMB 3E3RA 5HLOA 1TRFA 3A8RA 2LMUA 5F6TA 1H8BA 1GGZA 2PMYA 3C1VA 1SNLA 4MZJA 2IS9A 1MHOA 2A4JA 3OX5A 1TN4A 3FWBA 1F70A 1NYAA 1CM1A 1M63B 2GGMA 3FWCA 2LAPA 1PALA 2K2AA 1DTLA 2QACA 4JWQA 5JJGA 1C07A 1KWOB 4GGFA 5CSNA 3NSOA 2OTGC 1KFUS 2I18A 4M2OA 1WLZA 2WORA 1L2OB 2WNDA 4DUQA 2BBNA 2JQ6A 4HRGA 1B7TY 2HETA 4ZCVA 2MBXA 5HKZA 3BUWB 1KQVA 1NP8A 3BXKA 1V1FA 2JNFA 4C0KA 3K21A 1FPWA 1S6JA 1UUSA 1OZSA 3QRXA 4DCKA 1BMOA 3LK1A 1S5GY 2KGRA 5CPVA 1ZACA 2LVIA 2CXJA 3CWGA 3PSRA 2LVJA 2MA2A 2V53A 1QX2A 5PALA 1CLBA 4USLA 1BT6A 4NQGA 4PE7A 1JFJA 1LVCD 1N65A 1G8IA 2E30A 4YGBB 2JTTA 2ZRTA 2GGZA 3KF9A 1OOJA 4PALA 2OS8B 2KAVA 3BOWA 1WRKA 1Y1UA 2G2BA 3O6BA 1A75B 1YTZC 3GK2A 3SG5A 3I5IB 3VRQA 1CFFA 2L4IA 3LLEA 4DIRA 1QV1A 2K7BA 2M7LA 2LE9B 2KNEA 5TNCA 3VROA 2JXCA 4NDBA 2LANA 5G08A 1L2OC 1QV0A 2CCMA 1K94A 3EVRA 3ZWHA 4OKHA 1B8CA 2FCEA 1DVIA 1J55A 1AJ5A 2KI4C 1NX0A 2JRFA 1CDLA 3AAKA 2CTNA 1SYMA 4GFTA 1QVIY 2PSRA 1KFUL 1F8HA 1CB1A 2M97A 2BCBA 3EKJA 1FW4A 5KTYA 3CGAA 4MSPA 1CFDA 1PVBA 1XFWO 3WXAA 4I5LB 1A29A 1NCXA 1SL7A 2F2OA 1CLMA 2K0JA 2L4HA 3GK4X 1BG1A 3SG3A 1KK8C 1R6PA 1PSRA 1XFYO 1MR8A 2OS8C 1J7QA 3O78A 1SL9A 1ODBA 2M8UA 3JTDB 1XFXO 4GPLB 3I5IC 3TDZA 1NUBA 3PFVA 1ZMZA 1GQMA 4GGNA 3SG4A 2PVBA 4HREE 1DJHA 1F4OA 1U5IA 3HCMA 5ER5A 4ETOA 1CDNA 1DJGA 4N1GA 1QATA 1DJWA 1SCMC 1UHHA 4ORBB 2JZIA 4P2YB 1K9KA 3SG7A 2KDHA 3TZ1A 1QS7A 2M7NA 1MQ1A 2I7AA 2PASA 4DS7A 4ZCUA 2K61A 1B47A 2KFGA 2LV7A 1MWNA 1OMRA 3SIAA 3DF0B 2OTGB 2FOTA 1DF0A 1DGVA 1K8UA 1TNPA 3OX6A 1B8LA 1V1GA 3SJSA 4UPGA 2M1KB 1RWYA 2L5XB 1D1OA 5ER4X 2NXQA 4CFQA 1DGUA 1KSOA 3TS5B 4N5XA 1BR1B 2JULA 1MXEA 2ZNEA 5GQQC 2MLFC 1S26D 2ZNDA 2JPTA 1BLQA 1N0YA 2Y4QA 3EK4A 2K7CA 4D1EA 4WQ3A 2JT8A 1NX2A 4Q04A 1DMOA 2KYFA 1WDCC 2H2KA 3JTDC 3PM8A 2KFFA 4MRYA 1KK7Z 2KI6D 1M31A 2LLSA 2NCOA 3ZNIA 1HQVA 1UHNA 1EG3A 1FI5A 3ICBA 2P6BB 5D7FA 2HF5A 1NX1A 2L0PA 4OR9B 2LVVA 4C0JA 3PLFB 4ICBA 4CFRA 1N2DA 5B8IB 5AFPA 4CLNA 2BECA 1DJZA 1MF8B 4FTGA 1SPYA 1K2HA 1HT9A 2Y1MA 4AOMA 2JT3A 1F4QA 2F8PA 5IBWA 2KI4B 3I5HC 3BOWB 3NXAA 4OV2A 5CSJA 1B7TZ 2O5GA 1TNQA 2M1UA 5AEQA 2LNKA 3TS5C 4HRHA 5DKNA 4AQJA 1BODA 2L51A 2HPSA 1DJIA 2BCXA 2Y1NA 4U8DA 2KBMA 2OPOA 4YRUA 4I5KA 4GGFC 2L98A 2L50A 1SL8A 1SW8A 3DVJA 2GV5A 1TNWA 4E68A 4PHJA 1SCVA 3SG6A 3BUOB 1H4BA 4PE0A 2KQ6A 1NSHA 1JF0A 4F0ZB 3CLNA 5D69A 1KK8B 1GGWA 2SCPA 3DVEA 3CZTX 1CFCA 1IQ5A 2KQYA 4M2PA 4YGAA 1B1GA 1CM4A 1RTP1 1G33A 1CLLA 3IQOA 4WQ2A 4WRIA 1CMFA 3RM1A 2JOJA 3IF7A 4I5NB 2LP2A 1YVLA 2LC5A 2LCPA 3RLZA 1FI6A 2COLB 4QJ5B 1SCMB 2LUCA 1PSBA 1IGVA 1QTXA 1AUIB 2ZN9A 3IQQA 1M46A 1SBJA 1UP5A 3BUNB 4MEWA 4OCIA 1BU3A 1L7ZA 2LVKA 3EK8A 1SY9A 2MAZA 1RECA 2QPTA 1FF1A 1UHKA 5HKWA 1IQ3A 2KOTA 3OB2B 5CSFA 2D8NA 3PATA 4MLWA 1QVIZ 3I5FC 3JVTC 3F45A 1ZUZA 2LM5A 2WOSA 1NCYA 4OVNF 1QASA 3PALA 2AMIA 2TN4A 2KHNA 1XK4A 3DD4A 2ZN8A 1NCZA 2WCBA 1CTRA 1DF0B 3SIBA 5KSZA 1BOCA 2NCPA 1BR4B 1TIZA 1UURA 4MRXA 1WDCB 2JXLA 1XYDA 1LINA 1M39A 1KSMA 1YRUB 1XFZO 3EKHA 4PHNA 4NDCA 3VRRA 1LA0A 1FBVA 1BF5A 4FQOA 1CKKA 1OMVA 2KFHA 4M2QA 3OB1B 3D0YB 3AKAA 4I5JA 3CR5X 3WHTB 1B8RA 2ZRSA 4XYNA 3AKBA 4GUKA 1K95A 1RJVA 1IKUA 2KAXA 3SG2A 4BY5A 2H61A 5CSIA 4YGCB 2CNPA 1YUTA 1IH0A 1AP4A 1CDMA 1ALVA 2I2RE 1ZFSA 3I5HB 3KHEA 4GNKB 2MRDA 2MLEC 4MZLA 2F3YA 2PRUA 1AVSA 3H4SE 2BL0C 1YURA 4MN0A 4NDDA 1XO5A 2SASA 2LMTA 4JPZB 5AANA 5J3XA 4YGDB 5I8NA 1NIWA 1CNPA 1F54A 2L2EA 1OE9B 2Y5IA 1CFPA 2NLNA 1Y1AA 1JWDA 1MUXA 1EH2A 2LLTA 3MSEB 1QX5B 1K96A 2KI6C 1W7JB 1K9PA 3TUYC 1QIVA 3FIAA 3BYAA 1JUOA 1S3PA 1J1EA 1AHRA 2MHHA 5DKRA 1OQPA 1SKTA 5AERA 1SRAA 3I5GC 2CBLA 1TOPA 3O2PA 2ISDA 1YX8A 1GJYA 1NWDA 1X02A 2LLUA 1S6IA 3FS7A 3M0WA 1KQMB 1UHJA 1EL4A 4XJKA 4C0LA 2HQWA 2F3ZA 3NSIA 3CTNA 1DJYA 2LHIA 1QX7A 4DRWA 1YUSA 2HQ8A 3KPXA 4TNCA 1IJ6A 1Q80A 3OP0A 3DVMA 3KO0A 2K7OA 1RK9A 4HSZA 1A03A 3PN7C 4PE1A 1Y0VH 2EHBA 1W7IB 4MBEA 1SR6B 3I5FB 1S5GZ 3JVTB 1CDPA 1RFJA 1YR5A 3D10A 4IL1A 2JC2A 5DKQA 1EG4A 4YGEB 1B4CA 1Y6WA 3AAJA 4YBHB 1UHIA 3EK7A 1WRZA 2EC6B 1YVHA 3LL8B 4GBAA 4YI8A 1MXLC
chains in the Genus database with same CATH superfamily
1WY9A 1S6CA 1XFUO 2CT9A 1XFVO 3B86A 1IG5A 2M3WA 1TCOB 1KQMC 3CR2A 1ALWA 3LK0A 2L2CA 3CS1A 2NZ0A 2ERBA 3WHUB 5I2OA 1TCFA 2BCAA 3VGOA 1YX7A 3GK1A 1LXFC 2O60A 1QIWA 1OZOA 2BE4A 1J7PA 1PULA 2WCFA 2FCDA 2KLDA 3B6XA 3EVUA 3DVKA 4N1FA 1BJFA 1PK0D 1JF2A 1QXPA 4JKTA 1R2UA 3S0DA 1KFXS 2F33A 2RGIA 3TDIA 2BKHB 4PCWA 2F2PA 2LMVA 3BUXB 1K93D 3BQ3A 1M45A 1ORGA 2R2IA 2M29A 1JC2A 1SR6C 1U5IB 1JSAA 1Y1XA 5FYXA 1ZOTB 3NHTA 2LUXA 4GAOA 4MZKA 2BL0B 1TNXA 1KWOC 4ORAB 1C7WA 1QLSA 1J1DA 1QWVA 2PYQA 1A4PA 1A2XA 4PDZA 2M49B 2MJWB 1C3ZA 2EC6C 1PRWA 4PE4A 4KYNA 1OSAA 1CMGA 2VRGA 4YI9A 5KU1A 1NX3A 1P28A 2LP3A 3TUYB 1WLMA 1WRLA 4MVFA 5HYDA 3VRNA 1A75A 3LCPC 1DJXA 3O4YA 2KAYA 5AXIA 2KGBC 2KYCA 3NSLA 1J7OA 1Z4HA 2BKIB 3I5GB 4BY4A 1IJ5A 1K9UA 2WCEA 2B1UA 3KEVA 2JNXA 4P5OE 5BPJA 1XK4C 2Q91A 3PJIA 2K7DA 4INWA 2JTZA 4L9MA 5HLVA 5FI2A 3DY9A 1SK6D 1S36A 1IRJA 2FJUB 2ZFDA 1QJTA 4A4CA 5I2QA 1QLKA 1LA3A 1EXRA 2JU0A 1AJ4A 2G9BA 3TDUA 1SSEB 4CIDA 3NSKA 4QJ4B 3RZSA 3WNXB 4AQIA 2I94A 1YRTB 3CZ1A 4JQ0D 1UWOA 4PHMA 3BUMB 1KFXL 3PN7B 4QJ3B 5JOLA 1KCYA 1RROA 2M9GA 3A4UB 4XJKB 1C7VA 1E8AA 3GOFA 2BBMA 1GM0A 2H61C 1F71A 1K90D 1NPQA 3CR4X 3VRPA 1TTXA 1J7RA 2K8MB 3EVVA 1S1EA 4R1EA 1OOHA 2DOQA 1F55A 5HKYA 5K89A 2K2FA 2ZKMX 2JWWA 2E6WA 1DT7B 1SMGA 2JT0A 1PVAA 4ORCB 3DYEA 1XVJA 2BE6A 1TUJA 4PHKA 5I2LA 1AK8A 2PALA 4CPVA 1B9AA 3D0YA 1EJ3A 1IWQA 2WC8A 1CKKA 2EGDA 2AAOA 1JBAA 1LKJA 2YGUA 3HX4A 2LHLA 2Q4UA 2M0RA 1YUUA 2KSPA 1XA5A 2QEHA 1G4YR 5FI6A 3DF0A 1KK7Y 3R1PA 1JFKA 1OMDA 2KBIA 1VRKA 2AUCA 4A4BA 3OHMB 3E3RA 5HLOA 1TRFA 3A8RA 2LMUA 5F6TA 1H8BA 1GGZA 2PMYA 3C1VA 1SNLA 4MZJA 2IS9A 1MHOA 2A4JA 3OX5A 1TN4A 3FWBA 1F70A 1NYAA 1CM1A 1M63B 2GGMA 3FWCA 2LAPA 1PALA 2K2AA 1DTLA 2QACA 3DZTA 3OGNA 4JWQA 5JJGA 1C07A 1IIOA 1KWOB 4GGFA 5CSNA 3NSOA 2OTGC 1KFUS 2I18A 4M2OA 1WLZA 3D76A 2PQLA 1L2OB 2WORA 2WNDA 4DUQA 2BBNA 2JQ6A 4HRGA 1B7TY 2KPHA 2HETA 4ZCVA 2MBXA 5HKZA 3BUWB 1KQVA 1NP8A 3BXKA 1V1FA 2JNFA 4PT1A 4C0KA 3K21A 5EL2A 1S6JA 1FPWA 1UUSA 3D74A 1OZSA 3QRXA 4DCKA 1DELA 3BJHA 1BMOA 3LK1A 1S5GY 2KGRA 1LS8A 5CPVA 1ZACA 3S0GA 2LVIA 2CXJA 3CWGA 3PSRA 2LVJA 2MA2A 2V53A 1QX2A 5PALA 1CLBA 4USLA 1BT6A 4NQGA 3L4AA 3N7HA 3UO9A 4PE7A 1JFJA 1LVCD 4FQTA 1N65A 1G8IA 2E30A 4YGBB 2WCJA 2JTTA 2ZRTA 2GGZA 3KF9A 1OOJA 2FJYA 4PALA 2OS8B 2KAVA 3BOWA 1WRKA 1Y1UA 2G2BA 3O6BA 1A75B 1YTZC 3GK2A 3SG5A 3I5IB 3VRQA 1CFFA 2L4IA 3LLEA 4DIRA 1QV1A 2K7BA 2M7LA 2LE9B 2KNEA 2WCHA 5TNCA 3VROA 2JXCA 4NDBA 2LANA 5G08A 1L2OC 1QV0A 2CCMA 1K94A 3EVRA 3ZWHA 4OKHA 1B8CA 3SS3A 2FCEA 1DVIA 1J55A 1AJ5A 2KI4C 3K1EA 5DICA 1NX0A 3B87A 2JRFA 1CDLA 3AAKA 2CTNA 1SYMA 2JPOA 4GFTA 1QVIY 2BAPA 1KFUL 2PSRA 1F8HA 1CB1A 2M97A 2BCBA 3EKJA 1FW4A 3O4XA 5KTYA 3CGAA 4MSPA 1CFDA 1PVBA 1XFWO 3WXAA 4I5LB 1A29A 1NCXA 1SL7A 2F2OA 1CLMA 1OOFA 2K0JA 2L4HA 2WCMA 3GK4X 1BG1A 4F7FA 1XFRA 3CYZA 3SG3A 1KK8C 1R6PA 1PSRA 1XFYO 1MR8A 2OS8C 2QEOA 1J7QA 5I94A 3O78A 3D75A 1SL9A 1ODBA 2M8UA 1OOGA 3JTDB 1XFXO 4GPLB 1OW4A 3I5IC 1NUBA 3TDZA 3PFVA 1ZMZA 1GQMA 4GGNA 3SG4A 2PVBA 4HREE 1DJHA 1F4OA 1U5IA 3HCMA 5ER5A 4ETOA 1CDNA 3FE8A 3SS5A 1DJGA 4N1GA 3VB1A 1QATA 1DJWA 1SCMC 1UHHA 4ORBB 2JZIA 4P2YB 1K9KA 3SG7A 2KDHA 3TZ1A 1QS7A 2M7NA 1MQ1A 2I7AA 2PASA 4DS7A 4ZCUA 2K61A 1B47A 2KFGA 2LV7A 3S0AA 2WCKA 1MWNA 1OMRA 2WC6A 3SIAA 3DF0B 3SS4A 2OTGB 1OOIX 2FOTA 1DF0A 1DGVA 1K8UA 1TNPA 3OX6A 1B8LA 1V1GA 3SJSA 4UPGA 2M1KB 1RWYA 2L5XB 1D1OA 5ER4X 2NXQA 4CFQA 3L4LA 3CDNA 3S0BA 1DGUA 1KSOA 3Q8IA 3TS5B 4N5XA 1BR1B 2JULA 1MXEA 2ZNEA 5GQQC 2MLFC 1S26D 4OZDA 2ZNDA 2JPTA 1BLQA 1N0YA 2Y4QA 3EK4A 2K7CA 4D1EA 4WQ3A 2JT8A 1NX2A 4Q04A 1DMOA 1Z2CB 2KYFA 1WDCC 2H2KA 3JTDC 3PM8A 2KFFA 4MRYA 1KK7Z 5HL1A 2KI6D 1M31A 2LLSA 2NCOA 3ZNIA 1HQVA 1UHNA 1EG3A 4JD9A 1FI5A 1DQEA 3FE6A 2P6BB 3ICBA 5D7FA 2HF5A 3FE9A 1NX1A 2L0PA 2QEBA 4OR9B 2LVVA 3EG5B 4C0JA 3PLFB 4ICBA 4CFRA 1N2DA 3S0EA 5B8IB 5AFPA 4CLNA 2BECA 1DJZA 1C3YA 1MF8B 4FTGA 1SPYA 1K2HA 1HT9A 2Y1MA 4AOMA 2JT3A 1F4QA 2F8PA 5IBWA 2KI4B 3I5HC 1W9ZA 3BOWB 3NXAA 4OV2A 5CSJA 1B7TZ 2O5GA 1TNQA 2M1UA 5AEQA 5FI7A 3R1OA 2LNKA 3TS5C 4HRHA 5DKNA 4AQJA 1BODA 2L51A 3UNWA 2HPSA 1DJIA 2BCXA 2Y1NA 4U8DA 2KBMA 2OPOA 4YRUA 4I5KA 3D78A 4GGFC 2L98A 2L50A 1SL8A 1SW8A 3DVJA 2GV5A 1TNWA 4E68A 4PHJA 1SCVA 3SG6A 2L5YA 3BUOB 3QMEA 4PE0A 1H4BA 2KQ6A 1NSHA 1JF0A 4F0ZB 3CLNA 5D69A 1KK8B 1GGWA 2SCPA 3DVEA 3CZTX 1CFCA 1IQ5A 2KQYA 4M2PA 4YGAA 2GTEA 1B1GA 1CM4A 1RTP1 1G33A 1CLLA 3DXLA 3IQOA 4WQ2A 4WRIA 1CMFA 3RM1A 2JOJA 3IF7A 4I5NB 2LP2A 1DC1A 1YVLA 2LC5A 2LCPA 3RLZA 3R1VA 1FI6A 2COLB 4QJ5B 1SCMB 2LUCA 1PSBA 1IGVA 1QTXA 1AUIB 2ZN9A 3IQQA 1M46A 1SBJA 1UP5A 3BUNB 4MEWA 4OCIA 1BU3A 1L7ZA 3V2LA 2LVKA 3EK8A 1SY9A 2MAZA 1RECA 2QPTA 1FF1A 1UHKA 5HKWA 3S0FA 1T14A 2KOTA 1IQ3A 2P70A 3OB2B 2WCLA 2D8NA 3PATA 4MLWA 1QVIZ 3I5FC 3JVTC 5CSFA 3F45A 1ZUZA 2LM5A 2WOSA 1NCYA 2QEVA 4OVNF 1QASA 3PALA 3NGVA 2AMIA 2TN4A 3BFBA 2KHNA 1XK4A 3DD4A 2ZN8A 1NCZA 2WCBA 1CTRA 1DF0B 3SIBA 5KSZA 1BOCA 2NCPA 1BR4B 1TIZA 1UURA 4MRXA 1WDCB 2JXLA 4IJ7A 1XYDA 1LINA 1M39A 1KSMA 1YRUB 1XFZO 3EKHA 3NHIA 4NDCA 4PHNA 1LA0A 1FBVA 3VRRA 4FQOA 1BF5A 1OMVA 2KFHA 4M2QA 3OB1B 3D0YB 3AKAA 4I5JA 2BNXA 2P71A 3CR5X 3B7AA 3WHTB 3D77A 2K60A 1B8RA 2ZRSA 4XYNA 3AKBA 4GUKA 1K95A 1RJVA 1IKUA 2KAXA 3SG2A 4BY5A 2H61A 5CSIA 4YGCB 3CZ0A 2CNPA 1YUTA 1IH0A 1AP4A 3OBVA 1CDMA 1ALVA 2I2RE 1ZFSA 3I5HB 3KHEA 4GNKB 2MRDA 2MLEC 4MZLA 2F3YA 2PRUA 1AVSA 3H4SE 2BL0C 1YURA 4MN0A 4NDDA 1XO5A 2KLEA 5D3OA 2SASA 3CABA 2LMTA 3D73A 4JPZB 5J3XA 5AANA 4YGDB 5I8NA 1NIWA 1CNPA 1F54A 2L2EA 1OE9B 2WC5A 2Y5IA 3BFHA 2NLNA 1CFPA 1Y1AA 1JWDA 1MUXA 1EH2A 2LLTA 3PM2A 3MSEB 2H8VA 1QX5B 1K96A 2KI6C 3R72A 1TWOA 1W7JB 1K9PA 3TUYC 2QDIA 1QIVA 3FIAA 3BYAA 1JUOA 1S3PA 1TUZA 1J1EA 1AHRA 2MHHA 5DKRA 1OQPA 1SKTA 1DEKA 5AERA 1SRAA 3I5GC 2CBLA 1TOPA 3O2PA 2ISDA 1YX8A 1GJYA 1NWDA 1X02A 2LLUA 1S6IA 3FS7A 3M0WA 1KQMB 1UHJA 1EL4A 4XJKA 4C0LA 3IVTA 2HQWA 2F3ZA 3NSIA 3L47A 3CTNA 1DJYA 2LHIA 4INXA 1QX7A 4DRWA 1YUSA 2HQ8A 3KPXA 4TNCA 1IJ6A 1Q80A 3OP0A 3DVMA 3KO0A 2K7OA 1RK9A 4HSZA 1A03A 3PN7C 4PE1A 1Y0VH 2EHBA 1W7IB 4MBEA 1SR6B 3I5FB 1S5GZ 3JVTB 3B88A 1CDPA 1RFJA 1YR5A 3BFAA 3D10A 4IL1A 2JC2A 5DKQA 1EG4A 4YGEB 1B4CA 1Y6WA 3AAJA 4YBHB 1UHIA 3EK7A 1WRZA 2EC6B 1YVHA 3LL8B 4GBAA 4YI8A 1MXLC 3CZ2A
chains in the Genus database with same CATH topology
1WY9A 1S6CA 1XFUO 2CT9A 1XFVO 1IG5A 2M3WA 1TCOB 1KQMC 3CR2A 1ALWA 3LK0A 3CS1A 2NZ0A 3WHUB 5I2OA 1TCFA 2BCAA 3VGOA 1YX7A 3GK1A 1LXFC 2O60A 1QIWA 1OZOA 2BE4A 1J7PA 1PULA 2WCFA 2FCDA 3EVUA 3DVKA 4N1FA 1BJFA 1PK0D 1JF2A 1QXPA 1R2UA 1KFXS 2F33A 2RGIA 3TDIA 2BKHB 4PCWA 2F2PA 2LMVA 3BUXB 1K93D 3BQ3A 1M45A 2R2IA 1JC2A 2M29A 1SR6C 1U5IB 1JSAA 1Y1XA 5FYXA 1ZOTB 2LUXA 4GAOA 4MZKA 2BL0B 1TNXA 1KWOC 4ORAB 1C7WA 1QLSA 1J1DA 4PDZA 1A4PA 1A2XA 2M49B 2MJWB 2EC6C 1PRWA 4PE4A 1OSAA 1CMGA 2VRGA 4YI9A 5KU1A 1NX3A 2LP3A 3TUYB 1WLMA 1WRLA 4MVFA 5HYDA 3VRNA 1A75A 3LCPC 1DJXA 3O4YA 2KAYA 5AXIA 2KGBC 2KYCA 3NSLA 1J7OA 2BKIB 3I5GB 4BY4A 1IJ5A 1K9UA 2WCEA 2B1UA 3KEVA 2JNXA 4P5OE 5BPJA 1XK4C 2Q91A 2K7DA 2JTZA 4L9MA 5HLVA 1SK6D 1S36A 1IRJA 2FJUB 2ZFDA 1QJTA 4A4CA 5I2QA 1QLKA 1LA3A 1EXRA 2JU0A 1AJ4A 2G9BA 3TDUA 4CIDA 4QJ4B 3NSKA 3WNXB 4AQIA 2I94A 1YRTB 4JQ0D 1UWOA 4PHMA 3BUMB 1KFXL 3PN7B 4QJ3B 5JOLA 1KCYA 1RROA 2M9GA 3A4UB 4XJKB 1C7VA 1E8AA 3GOFA 2BBMA 2H61C 1F71A 1K90D 1NPQA 3CR4X 3VRPA 1TTXA 1J7RA 2K8MB 3EVVA 1S1EA 4R1EA 2DOQA 1F55A 5HKYA 5K89A 2K2FA 2ZKMX 2JWWA 2E6WA 1DT7B 1SMGA 2JT0A 1PVAA 4ORCB 1XVJA 2BE6A 4PHKA 5I2LA 1AK8A 2PALA 4CPVA 1B9AA 3D0YA 1EJ3A 1IWQA 2WC8A 2EGDA 2AAOA 1JBAA 1LKJA 3HX4A 2LHLA 2Q4UA 2M0RA 1YUUA 2KSPA 1XA5A 1G4YR 3DF0A 1KK7Y 1JFKA 1OMDA 2KBIA 1VRKA 2AUCA 4A4BA 3OHMB 3E3RA 5HLOA 1TRFA 3A8RA 2LMUA 5F6TA 1H8BA 1GGZA 2PMYA 3C1VA 1SNLA 4MZJA 2IS9A 1MHOA 2A4JA 3OX5A 1TN4A 3FWBA 1F70A 1NYAA 1CM1A 1M63B 2GGMA 3FWCA 2LAPA 1PALA 2K2AA 1DTLA 2QACA 4JWQA 5JJGA 1C07A 1KWOB 4GGFA 5CSNA 3NSOA 2OTGC 1KFUS 2I18A 4M2OA 1WLZA 2WORA 1L2OB 2WNDA 4DUQA 2BBNA 2JQ6A 4HRGA 1B7TY 2HETA 4ZCVA 2MBXA 5HKZA 3BUWB 1KQVA 1NP8A 3BXKA 1V1FA 2JNFA 4C0KA 3K21A 1FPWA 1S6JA 1UUSA 1OZSA 3QRXA 4DCKA 1BMOA 3LK1A 1S5GY 2KGRA 5CPVA 1ZACA 2LVIA 2CXJA 3CWGA 3PSRA 2LVJA 2MA2A 2V53A 1QX2A 5PALA 1CLBA 4USLA 1BT6A 4NQGA 4PE7A 1JFJA 1LVCD 1N65A 1G8IA 2E30A 4YGBB 2JTTA 2ZRTA 2GGZA 3KF9A 1OOJA 4PALA 2OS8B 2KAVA 3BOWA 1WRKA 1Y1UA 2G2BA 3O6BA 1A75B 1YTZC 3GK2A 3SG5A 3I5IB 3VRQA 1CFFA 2L4IA 3LLEA 4DIRA 1QV1A 2K7BA 2M7LA 2LE9B 2KNEA 5TNCA 3VROA 2JXCA 4NDBA 2LANA 5G08A 1L2OC 1QV0A 2CCMA 1K94A 3EVRA 3ZWHA 4OKHA 1B8CA 2FCEA 1DVIA 1J55A 1AJ5A 2KI4C 1NX0A 2JRFA 1CDLA 3AAKA 2CTNA 1SYMA 4GFTA 1QVIY 2PSRA 1KFUL 1F8HA 1CB1A 2M97A 2BCBA 3EKJA 1FW4A 5KTYA 3CGAA 4MSPA 1CFDA 1PVBA 1XFWO 3WXAA 4I5LB 1A29A 1NCXA 1SL7A 2F2OA 1CLMA 2K0JA 2L4HA 3GK4X 1BG1A 3SG3A 1KK8C 1R6PA 1PSRA 1XFYO 1MR8A 2OS8C 1J7QA 3O78A 1SL9A 1ODBA 2M8UA 3JTDB 1XFXO 4GPLB 3I5IC 3TDZA 1NUBA 3PFVA 1ZMZA 1GQMA 4GGNA 3SG4A 2PVBA 4HREE 1DJHA 1F4OA 1U5IA 3HCMA 5ER5A 4ETOA 1CDNA 1DJGA 4N1GA 1QATA 1DJWA 1SCMC 1UHHA 4ORBB 2JZIA 4P2YB 1K9KA 3SG7A 2KDHA 3TZ1A 1QS7A 2M7NA 1MQ1A 2I7AA 2PASA 4DS7A 4ZCUA 2K61A 1B47A 2KFGA 2LV7A 1MWNA 1OMRA 3SIAA 3DF0B 2OTGB 2FOTA 1DF0A 1DGVA 1K8UA 1TNPA 3OX6A 1B8LA 1V1GA 3SJSA 4UPGA 2M1KB 1RWYA 2L5XB 1D1OA 5ER4X 2NXQA 4CFQA 1DGUA 1KSOA 3TS5B 4N5XA 1BR1B 2JULA 1MXEA 2ZNEA 5GQQC 2MLFC 1S26D 2ZNDA 2JPTA 1BLQA 1N0YA 2Y4QA 3EK4A 2K7CA 4D1EA 4WQ3A 2JT8A 1NX2A 4Q04A 1DMOA 2KYFA 1WDCC 2H2KA 3JTDC 3PM8A 2KFFA 4MRYA 1KK7Z 2KI6D 1M31A 2LLSA 2NCOA 3ZNIA 1HQVA 1UHNA 1EG3A 1FI5A 3ICBA 2P6BB 5D7FA 2HF5A 1NX1A 2L0PA 4OR9B 2LVVA 4C0JA 3PLFB 4ICBA 4CFRA 1N2DA 5B8IB 5AFPA 4CLNA 2BECA 1DJZA 1MF8B 4FTGA 1SPYA 1K2HA 1HT9A 2Y1MA 4AOMA 2JT3A 1F4QA 2F8PA 5IBWA 2KI4B 3I5HC 3BOWB 3NXAA 4OV2A 5CSJA 1B7TZ 2O5GA 1TNQA 2M1UA 5AEQA 2LNKA 3TS5C 4HRHA 5DKNA 4AQJA 1BODA 2L51A 2HPSA 1DJIA 2BCXA 2Y1NA 4U8DA 2KBMA 2OPOA 4YRUA 4I5KA 4GGFC 2L98A 2L50A 1SL8A 1SW8A 3DVJA 2GV5A 1TNWA 4E68A 4PHJA 1SCVA 3SG6A 3BUOB 1H4BA 4PE0A 2KQ6A 1NSHA 1JF0A 4F0ZB 3CLNA 5D69A 1KK8B 1GGWA 2SCPA 3DVEA 3CZTX 1CFCA 1IQ5A 2KQYA 4M2PA 4YGAA 1B1GA 1CM4A 1RTP1 1G33A 1CLLA 3IQOA 4WQ2A 4WRIA 1CMFA 3RM1A 2JOJA 3IF7A 4I5NB 2LP2A 1YVLA 2LC5A 2LCPA 3RLZA 1FI6A 2COLB 4QJ5B 1SCMB 2LUCA 1PSBA 1IGVA 1QTXA 1AUIB 2ZN9A 3IQQA 1M46A 1SBJA 1UP5A 3BUNB 4MEWA 4OCIA 1BU3A 1L7ZA 2LVKA 3EK8A 1SY9A 2MAZA 1RECA 2QPTA 1FF1A 1UHKA 5HKWA 1IQ3A 2KOTA 3OB2B 5CSFA 2D8NA 3PATA 4MLWA 1QVIZ 3I5FC 3JVTC 3F45A 1ZUZA 2LM5A 2WOSA 1NCYA 4OVNF 1QASA 3PALA 2AMIA 2TN4A 2KHNA 1XK4A 3DD4A 2ZN8A 1NCZA 2WCBA 1CTRA 1DF0B 3SIBA 5KSZA 1BOCA 2NCPA 1BR4B 1TIZA 1UURA 4MRXA 1WDCB 2JXLA 1XYDA 1LINA 1M39A 1KSMA 1YRUB 1XFZO 3EKHA 4PHNA 4NDCA 3VRRA 1LA0A 1FBVA 1BF5A 4FQOA 1CKKA 1OMVA 2KFHA 4M2QA 3OB1B 3D0YB 3AKAA 4I5JA 3CR5X 3WHTB 1B8RA 2ZRSA 4XYNA 3AKBA 4GUKA 1K95A 1RJVA 1IKUA 2KAXA 3SG2A 4BY5A 2H61A 5CSIA 4YGCB 2CNPA 1YUTA 1IH0A 1AP4A 1CDMA 1ALVA 2I2RE 1ZFSA 3I5HB 3KHEA 4GNKB 2MRDA 2MLEC 4MZLA 2F3YA 2PRUA 1AVSA 3H4SE 2BL0C 1YURA 4MN0A 4NDDA 1XO5A 2SASA 2LMTA 4JPZB 5AANA 5J3XA 4YGDB 5I8NA 1NIWA 1CNPA 1F54A 2L2EA 1OE9B 2Y5IA 1CFPA 2NLNA 1Y1AA 1JWDA 1MUXA 1EH2A 2LLTA 3MSEB 1QX5B 1K96A 2KI6C 1W7JB 1K9PA 3TUYC 1QIVA 3FIAA 3BYAA 1JUOA 1S3PA 1J1EA 1AHRA 2MHHA 5DKRA 1OQPA 1SKTA 5AERA 1SRAA 3I5GC 2CBLA 1TOPA 3O2PA 2ISDA 1YX8A 1GJYA 1NWDA 1X02A 2LLUA 1S6IA 3FS7A 3M0WA 1KQMB 1UHJA 1EL4A 4XJKA 4C0LA 2HQWA 2F3ZA 3NSIA 3CTNA 1DJYA 2LHIA 1QX7A 4DRWA 1YUSA 2HQ8A 3KPXA 4TNCA 1IJ6A 1Q80A 3OP0A 3DVMA 3KO0A 2K7OA 1RK9A 4HSZA 1A03A 3PN7C 4PE1A 1Y0VH 2EHBA 1W7IB 4MBEA 1SR6B 3I5FB 1S5GZ 3JVTB 1CDPA 1RFJA 1YR5A 3D10A 4IL1A 2JC2A 5DKQA 1EG4A 4YGEB 1B4CA 1Y6WA 3AAJA 4YBHB 1UHIA 3EK7A 1WRZA 2EC6B 1YVHA 3LL8B 4GBAA 4YI8A 1MXLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY9 A;  1S6C A;  1XFU O;  2CT9 A;  1XFV O;  1IG5 A;  2M3W A;  1TCO B;  1KQM C;  3CR2 A;  1ALW A;  3LK0 A;  3CS1 A;  2NZ0 A;  3WHU B;  5I2O A;  1TCF A;  2BCA A;  3VGO A;  1YX7 A;  3GK1 A;  1LXF C;  2O60 A;  1QIW A;  1OZO A;  2BE4 A;  1J7P A;  1PUL A;  2WCF A;  2FCD A;  3EVU A;  3DVK A;  4N1F A;  1BJF A;  1PK0 D;  1JF2 A;  1QXP A;  1R2U A;  1KFX S;  2F33 A;  2RGI A;  3TDI A;  2BKH B;  4PCW A;  2F2P A;  2LMV A;  3BUX B;  1K93 D;  3BQ3 A;  1M45 A;  2R2I A;  1JC2 A;  2M29 A;  1SR6 C;  1U5I B;  1JSA A;  1Y1X A;  5FYX A;  1ZOT B;  2LUX A;  4GAO A;  4MZK A;  2BL0 B;  1TNX A;  1KWO C;  4ORA B;  1C7W A;  1QLS A;  1J1D A;  4PDZ A;  1A4P A;  1A2X A;  2M49 B;  2MJW B;  2EC6 C;  1PRW A;  4PE4 A;  1OSA A;  1CMG A;  2VRG A;  4YI9 A;  5KU1 A;  1NX3 A;  2LP3 A;  3TUY B;  1WLM A;  1WRL A;  4MVF A;  5HYD A;  3VRN A;  1A75 A;  3LCP C;  1DJX A;  3O4Y A;  2KAY A;  5AXI A;  2KGB C;  2KYC A;  3NSL A;  1J7O A;  2BKI B;  3I5G B;  4BY4 A;  1IJ5 A;  1K9U A;  2WCE A;  2B1U A;  3KEV A;  2JNX A;  4P5O E;  5BPJ A;  1XK4 C;  2Q91 A;  2K7D A;  2JTZ A;  4L9M A;  5HLV A;  1SK6 D;  1S36 A;  1IRJ A;  2FJU B;  2ZFD A;  1QJT A;  4A4C A;  5I2Q A;  1QLK A;  1LA3 A;  1EXR A;  2JU0 A;  1AJ4 A;  2G9B A;  3TDU A;  4CID A;  4QJ4 B;  3NSK A;  3WNX B;  4AQI A;  2I94 A;  1YRT B;  4JQ0 D;  1UWO A;  4PHM A;  3BUM B;  1KFX L;  3PN7 B;  4QJ3 B;  5JOL A;  1KCY A;  1RRO A;  2M9G A;  3A4U B;  4XJK B;  1C7V A;  1E8A A;  3GOF A;  2BBM A;  2H61 C;  1F71 A;  1K90 D;  1NPQ A;  3CR4 X;  3VRP A;  1TTX A;  1J7R A;  2K8M B;  3EVV A;  1S1E A;  4R1E A;  2DOQ A;  1F55 A;  5HKY A;  5K89 A;  2K2F A;  2ZKM X;  2JWW A;  2E6W A;  1DT7 B;  1SMG A;  2JT0 A;  1PVA A;  4ORC B;  1XVJ A;  2BE6 A;  4PHK A;  5I2L A;  1AK8 A;  2PAL A;  4CPV A;  1B9A A;  3D0Y A;  1EJ3 A;  1IWQ A;  2WC8 A;  2EGD A;  2AAO A;  1JBA A;  1LKJ A;  3HX4 A;  2LHL A;  2Q4U A;  2M0R A;  1YUU A;  2KSP A;  1XA5 A;  1G4Y R;  3DF0 A;  1KK7 Y;  1JFK A;  1OMD A;  2KBI A;  1VRK A;  2AUC A;  4A4B A;  3OHM B;  3E3R A;  5HLO A;  1TRF A;  3A8R A;  2LMU A;  5F6T A;  1H8B A;  1GGZ A;  2PMY A;  3C1V A;  1SNL A;  4MZJ A;  2IS9 A;  1MHO A;  2A4J A;  3OX5 A;  1TN4 A;  3FWB A;  1F70 A;  1NYA A;  1CM1 A;  1M63 B;  2GGM A;  3FWC A;  2LAP A;  1PAL A;  2K2A A;  1DTL A;  2QAC A;  4JWQ A;  5JJG A;  1C07 A;  1KWO B;  4GGF A;  5CSN A;  3NSO A;  2OTG C;  1KFU S;  2I18 A;  4M2O A;  1WLZ A;  2WOR A;  1L2O B;  2WND A;  4DUQ A;  2BBN A;  2JQ6 A;  4HRG A;  1B7T Y;  2HET A;  4ZCV A;  2MBX A;  5HKZ A;  3BUW B;  1KQV A;  1NP8 A;  3BXK A;  1V1F A;  2JNF A;  4C0K A;  3K21 A;  1FPW A;  1S6J A;  1UUS A;  1OZS A;  3QRX A;  4DCK A;  1BMO A;  3LK1 A;  1S5G Y;  2KGR A;  5CPV A;  1ZAC A;  2LVI A;  2CXJ A;  3CWG A;  3PSR A;  2LVJ A;  2MA2 A;  2V53 A;  1QX2 A;  5PAL A;  1CLB A;  4USL A;  1BT6 A;  4NQG A;  4PE7 A;  1JFJ A;  1LVC D;  1N65 A;  1G8I A;  2E30 A;  4YGB B;  2JTT A;  2ZRT A;  2GGZ A;  3KF9 A;  1OOJ A;  4PAL A;  2OS8 B;  2KAV A;  3BOW A;  1WRK A;  1Y1U A;  2G2B A;  3O6B A;  1A75 B;  1YTZ C;  3GK2 A;  3SG5 A;  3I5I B;  3VRQ A;  1CFF A;  2L4I A;  3LLE A;  4DIR A;  1QV1 A;  2K7B A;  2M7L A;  2LE9 B;  2KNE A;  5TNC A;  3VRO A;  2JXC A;  4NDB A;  2LAN A;  5G08 A;  1L2O C;  1QV0 A;  2CCM A;  1K94 A;  3EVR A;  3ZWH A;  4OKH A;  1B8C A;  2FCE A;  1DVI A;  1J55 A;  1AJ5 A;  2KI4 C;  1NX0 A;  2JRF A;  1CDL A;  3AAK A;  2CTN A;  1SYM A;  4GFT A;  1QVI Y;  2PSR A;  1KFU L;  1F8H A;  1CB1 A;  2M97 A;  2BCB A;  3EKJ A;  1FW4 A;  5KTY A;  3CGA A;  4MSP A;  1CFD A;  1PVB A;  1XFW O;  3WXA A;  4I5L B;  1A29 A;  1NCX A;  1SL7 A;  2F2O A;  1CLM A;  2K0J A;  2L4H A;  3GK4 X;  1BG1 A;  3SG3 A;  1KK8 C;  1R6P A;  1PSR A;  1XFY O;  1MR8 A;  2OS8 C;  1J7Q A;  3O78 A;  1SL9 A;  1ODB A;  2M8U A;  3JTD B;  1XFX O;  4GPL B;  3I5I C;  3TDZ A;  1NUB A;  3PFV A;  1ZMZ A;  1GQM A;  4GGN A;  3SG4 A;  2PVB A;  4HRE E;  1DJH A;  1F4O A;  1U5I A;  3HCM A;  5ER5 A;  4ETO A;  1CDN A;  1DJG A;  4N1G A;  1QAT A;  1DJW A;  1SCM C;  1UHH A;  4ORB B;  2JZI A;  4P2Y B;  1K9K A;  3SG7 A;  2KDH A;  3TZ1 A;  1QS7 A;  2M7N A;  1MQ1 A;  2I7A A;  2PAS A;  4DS7 A;  4ZCU A;  2K61 A;  1B47 A;  2KFG A;  2LV7 A;  1MWN A;  1OMR A;  3SIA A;  3DF0 B;  2OTG B;  2FOT A;  1DF0 A;  1DGV A;  1K8U A;  1TNP A;  3OX6 A;  1B8L A;  1V1G A;  3SJS A;  4UPG A;  2M1K B;  1RWY A;  2L5X B;  1D1O A;  5ER4 X;  2NXQ A;  4CFQ A;  1DGU A;  1KSO A;  3TS5 B;  4N5X A;  1BR1 B;  2JUL A;  1MXE A;  2ZNE A;  5GQQ C;  2MLF C;  1S26 D;  2ZND A;  2JPT A;  1BLQ A;  1N0Y A;  2Y4Q A;  3EK4 A;  2K7C A;  4D1E A;  4WQ3 A;  2JT8 A;  1NX2 A;  4Q04 A;  1DMO A;  2KYF A;  1WDC C;  2H2K A;  3JTD C;  3PM8 A;  2KFF A;  4MRY A;  1KK7 Z;  2KI6 D;  1M31 A;  2LLS A;  2NCO A;  3ZNI A;  1HQV A;  1UHN A;  1EG3 A;  1FI5 A;  3ICB A;  2P6B B;  5D7F A;  2HF5 A;  1NX1 A;  2L0P A;  4OR9 B;  2LVV A;  4C0J A;  3PLF B;  4ICB A;  4CFR A;  1N2D A;  5B8I B;  5AFP A;  4CLN A;  2BEC A;  1DJZ A;  1MF8 B;  4FTG A;  1SPY A;  1K2H A;  1HT9 A;  2Y1M A;  4AOM A;  2JT3 A;  1F4Q A;  2F8P A;  5IBW A;  2KI4 B;  3I5H C;  3BOW B;  3NXA A;  4OV2 A;  5CSJ A;  1B7T Z;  2O5G A;  1TNQ A;  2M1U A;  5AEQ A;  2LNK A;  3TS5 C;  4HRH A;  5DKN A;  4AQJ A;  1BOD A;  2L51 A;  2HPS A;  1DJI A;  2BCX A;  2Y1N A;  4U8D A;  2KBM A;  2OPO A;  4YRU A;  4I5K A;  4GGF C;  2L98 A;  2L50 A;  1SL8 A;  1SW8 A;  3DVJ A;  2GV5 A;  1TNW A;  4E68 A;  4PHJ A;  1SCV A;  3SG6 A;  3BUO B;  1H4B A;  4PE0 A;  2KQ6 A;  1NSH A;  1JF0 A;  4F0Z B;  3CLN A;  5D69 A;  1KK8 B;  1GGW A;  2SCP A;  3DVE A;  3CZT X;  1CFC A;  1IQ5 A;  2KQY A;  4M2P A;  4YGA A;  1B1G A;  1CM4 A;  1RTP 1;  1G33 A;  1CLL A;  3IQO A;  4WQ2 A;  4WRI A;  1CMF A;  3RM1 A;  2JOJ A;  3IF7 A;  4I5N B;  2LP2 A;  1YVL A;  2LC5 A;  2LCP A;  3RLZ A;  1FI6 A;  2COL B;  4QJ5 B;  1SCM B;  2LUC A;  1PSB A;  1IGV A;  1QTX A;  1AUI B;  2ZN9 A;  3IQQ A;  1M46 A;  1SBJ A;  1UP5 A;  3BUN B;  4MEW A;  4OCI A;  1BU3 A;  1L7Z A;  2LVK A;  3EK8 A;  1SY9 A;  2MAZ A;  1REC A;  2QPT A;  1FF1 A;  1UHK A;  5HKW A;  1IQ3 A;  2KOT A;  3OB2 B;  5CSF A;  2D8N A;  3PAT A;  4MLW A;  1QVI Z;  3I5F C;  3JVT C;  3F45 A;  1ZUZ A;  2LM5 A;  2WOS A;  1NCY A;  4OVN F;  1QAS A;  3PAL A;  2AMI A;  2TN4 A;  2KHN A;  1XK4 A;  3DD4 A;  2ZN8 A;  1NCZ A;  2WCB A;  1CTR A;  1DF0 B;  3SIB A;  5KSZ A;  1BOC A;  2NCP A;  1BR4 B;  1TIZ A;  1UUR A;  4MRX A;  1WDC B;  2JXL A;  1XYD A;  1LIN A;  1M39 A;  1KSM A;  1YRU B;  1XFZ O;  3EKH A;  4PHN A;  4NDC A;  3VRR A;  1LA0 A;  1FBV A;  1BF5 A;  4FQO A;  1CKK A;  1OMV A;  2KFH A;  4M2Q A;  3OB1 B;  3D0Y B;  3AKA A;  4I5J A;  3CR5 X;  3WHT B;  1B8R A;  2ZRS A;  4XYN A;  3AKB A;  4GUK A;  1K95 A;  1RJV A;  1IKU A;  2KAX A;  3SG2 A;  4BY5 A;  2H61 A;  5CSI A;  4YGC B;  2CNP A;  1YUT A;  1IH0 A;  1AP4 A;  1CDM A;  1ALV A;  2I2R E;  1ZFS A;  3I5H B;  3KHE A;  4GNK B;  2MRD A;  2MLE C;  4MZL A;  2F3Y A;  2PRU A;  1AVS A;  3H4S E;  2BL0 C;  1YUR A;  4MN0 A;  4NDD A;  1XO5 A;  2SAS A;  2LMT A;  4JPZ B;  5AAN A;  5J3X A;  4YGD B;  5I8N A;  1NIW A;  1CNP A;  1F54 A;  2L2E A;  1OE9 B;  2Y5I A;  1CFP A;  2NLN A;  1Y1A A;  1JWD A;  1MUX A;  1EH2 A;  2LLT A;  3MSE B;  1QX5 B;  1K96 A;  2KI6 C;  1W7J B;  1K9P A;  3TUY C;  1QIV A;  3FIA A;  3BYA A;  1JUO A;  1S3P A;  1J1E A;  1AHR A;  2MHH A;  5DKR A;  1OQP A;  1SKT A;  5AER A;  1SRA A;  3I5G C;  2CBL A;  1TOP A;  3O2P A;  2ISD A;  1YX8 A;  1GJY A;  1NWD A;  1X02 A;  2LLU A;  1S6I A;  3FS7 A;  3M0W A;  1KQM B;  1UHJ A;  1EL4 A;  4XJK A;  4C0L A;  2HQW A;  2F3Z A;  3NSI A;  3CTN A;  1DJY A;  2LHI A;  1QX7 A;  4DRW A;  1YUS A;  2HQ8 A;  3KPX A;  4TNC A;  1IJ6 A;  1Q80 A;  3OP0 A;  3DVM A;  3KO0 A;  2K7O A;  1RK9 A;  4HSZ A;  1A03 A;  3PN7 C;  4PE1 A;  1Y0V H;  2EHB A;  1W7I B;  4MBE A;  1SR6 B;  3I5F B;  1S5G Z;  3JVT B;  1CDP A;  1RFJ A;  1YR5 A;  3D10 A;  4IL1 A;  2JC2 A;  5DKQ A;  1EG4 A;  4YGE B;  1B4C A;  1Y6W A;  3AAJ A;  4YBH B;  1UHI A;  3EK7 A;  1WRZ A;  2EC6 B;  1YVH A;  3LL8 B;  4GBA A;  4YI8 A;  1MXL C; 
#chains in the Genus database with same CATH topology
 1WY9 A;  1S6C A;  1XFU O;  2CT9 A;  1XFV O;  3B86 A;  1IG5 A;  2M3W A;  1TCO B;  1KQM C;  3CR2 A;  1ALW A;  3LK0 A;  2L2C A;  3CS1 A;  2NZ0 A;  2ERB A;  3WHU B;  5I2O A;  1TCF A;  2BCA A;  3VGO A;  1YX7 A;  3GK1 A;  1LXF C;  2O60 A;  1QIW A;  1OZO A;  2BE4 A;  1J7P A;  1PUL A;  2WCF A;  2FCD A;  2KLD A;  3B6X A;  3EVU A;  3DVK A;  4N1F A;  1BJF A;  1PK0 D;  1JF2 A;  1QXP A;  4JKT A;  1R2U A;  3S0D A;  1KFX S;  2F33 A;  2RGI A;  3TDI A;  2BKH B;  4PCW A;  2F2P A;  2LMV A;  3BUX B;  1K93 D;  3BQ3 A;  1M45 A;  1ORG A;  2R2I A;  2M29 A;  1JC2 A;  1SR6 C;  1U5I B;  1JSA A;  1Y1X A;  5FYX A;  1ZOT B;  3NHT A;  2LUX A;  4GAO A;  4MZK A;  2BL0 B;  1TNX A;  1KWO C;  4ORA B;  1C7W A;  1QLS A;  1J1D A;  1QWV A;  2PYQ A;  1A4P A;  1A2X A;  4PDZ A;  2M49 B;  2MJW B;  1C3Z A;  2EC6 C;  1PRW A;  4PE4 A;  4KYN A;  1OSA A;  1CMG A;  2VRG A;  4YI9 A;  5KU1 A;  1NX3 A;  1P28 A;  2LP3 A;  3TUY B;  1WLM A;  1WRL A;  4MVF A;  5HYD A;  3VRN A;  1A75 A;  3LCP C;  1DJX A;  3O4Y A;  2KAY A;  5AXI A;  2KGB C;  2KYC A;  3NSL A;  1J7O A;  1Z4H A;  2BKI B;  3I5G B;  4BY4 A;  1IJ5 A;  1K9U A;  2WCE A;  2B1U A;  3KEV A;  2JNX A;  4P5O E;  5BPJ A;  1XK4 C;  2Q91 A;  3PJI A;  2K7D A;  4INW A;  2JTZ A;  4L9M A;  5HLV A;  5FI2 A;  3DY9 A;  1SK6 D;  1S36 A;  1IRJ A;  2FJU B;  2ZFD A;  1QJT A;  4A4C A;  5I2Q A;  1QLK A;  1LA3 A;  1EXR A;  2JU0 A;  1AJ4 A;  2G9B A;  3TDU A;  1SSE B;  4CID A;  3NSK A;  4QJ4 B;  3RZS A;  3WNX B;  4AQI A;  2I94 A;  1YRT B;  3CZ1 A;  4JQ0 D;  1UWO A;  4PHM A;  3BUM B;  1KFX L;  3PN7 B;  4QJ3 B;  5JOL A;  1KCY A;  1RRO A;  2M9G A;  3A4U B;  4XJK B;  1C7V A;  1E8A A;  3GOF A;  2BBM A;  1GM0 A;  2H61 C;  1F71 A;  1K90 D;  1NPQ A;  3CR4 X;  3VRP A;  1TTX A;  1J7R A;  2K8M B;  3EVV A;  1S1E A;  4R1E A;  1OOH A;  2DOQ A;  1F55 A;  5HKY A;  5K89 A;  2K2F A;  2ZKM X;  2JWW A;  2E6W A;  1DT7 B;  1SMG A;  2JT0 A;  1PVA A;  4ORC B;  3DYE A;  1XVJ A;  2BE6 A;  1TUJ A;  4PHK A;  5I2L A;  1AK8 A;  2PAL A;  4CPV A;  1B9A A;  3D0Y A;  1EJ3 A;  1IWQ A;  2WC8 A;  1CKK A;  2EGD A;  2AAO A;  1JBA A;  1LKJ A;  2YGU A;  3HX4 A;  2LHL A;  2Q4U A;  2M0R A;  1YUU A;  2KSP A;  1XA5 A;  2QEH A;  1G4Y R;  5FI6 A;  3DF0 A;  1KK7 Y;  3R1P A;  1JFK A;  1OMD A;  2KBI A;  1VRK A;  2AUC A;  4A4B A;  3OHM B;  3E3R A;  5HLO A;  1TRF A;  3A8R A;  2LMU A;  5F6T A;  1H8B A;  1GGZ A;  2PMY A;  3C1V A;  1SNL A;  4MZJ A;  2IS9 A;  1MHO A;  2A4J A;  3OX5 A;  1TN4 A;  3FWB A;  1F70 A;  1NYA A;  1CM1 A;  1M63 B;  2GGM A;  3FWC A;  2LAP A;  1PAL A;  2K2A A;  1DTL A;  2QAC A;  3DZT A;  3OGN A;  4JWQ A;  5JJG A;  1C07 A;  1IIO A;  1KWO B;  4GGF A;  5CSN A;  3NSO A;  2OTG C;  1KFU S;  2I18 A;  4M2O A;  1WLZ A;  3D76 A;  2PQL A;  1L2O B;  2WOR A;  2WND A;  4DUQ A;  2BBN A;  2JQ6 A;  4HRG A;  1B7T Y;  2KPH A;  2HET A;  4ZCV A;  2MBX A;  5HKZ A;  3BUW B;  1KQV A;  1NP8 A;  3BXK A;  1V1F A;  2JNF A;  4PT1 A;  4C0K A;  3K21 A;  5EL2 A;  1S6J A;  1FPW A;  1UUS A;  3D74 A;  1OZS A;  3QRX A;  4DCK A;  1DEL A;  3BJH A;  1BMO A;  3LK1 A;  1S5G Y;  2KGR A;  1LS8 A;  5CPV A;  1ZAC A;  3S0G A;  2LVI A;  2CXJ A;  3CWG A;  3PSR A;  2LVJ A;  2MA2 A;  2V53 A;  1QX2 A;  5PAL A;  1CLB A;  4USL A;  1BT6 A;  4NQG A;  3L4A A;  3N7H A;  3UO9 A;  4PE7 A;  1JFJ A;  1LVC D;  4FQT A;  1N65 A;  1G8I A;  2E30 A;  4YGB B;  2WCJ A;  2JTT A;  2ZRT A;  2GGZ A;  3KF9 A;  1OOJ A;  2FJY A;  4PAL A;  2OS8 B;  2KAV A;  3BOW A;  1WRK A;  1Y1U A;  2G2B A;  3O6B A;  1A75 B;  1YTZ C;  3GK2 A;  3SG5 A;  3I5I B;  3VRQ A;  1CFF A;  2L4I A;  3LLE A;  4DIR A;  1QV1 A;  2K7B A;  2M7L A;  2LE9 B;  2KNE A;  2WCH A;  5TNC A;  3VRO A;  2JXC A;  4NDB A;  2LAN A;  5G08 A;  1L2O C;  1QV0 A;  2CCM A;  1K94 A;  3EVR A;  3ZWH A;  4OKH A;  1B8C A;  3SS3 A;  2FCE A;  1DVI A;  1J55 A;  1AJ5 A;  2KI4 C;  3K1E A;  5DIC A;  1NX0 A;  3B87 A;  2JRF A;  1CDL A;  3AAK A;  2CTN A;  1SYM A;  2JPO A;  4GFT A;  1QVI Y;  2BAP A;  1KFU L;  2PSR A;  1F8H A;  1CB1 A;  2M97 A;  2BCB A;  3EKJ A;  1FW4 A;  3O4X A;  5KTY A;  3CGA A;  4MSP A;  1CFD A;  1PVB A;  1XFW O;  3WXA A;  4I5L B;  1A29 A;  1NCX A;  1SL7 A;  2F2O A;  1CLM A;  1OOF A;  2K0J A;  2L4H A;  2WCM A;  3GK4 X;  1BG1 A;  4F7F A;  1XFR A;  3CYZ A;  3SG3 A;  1KK8 C;  1R6P A;  1PSR A;  1XFY O;  1MR8 A;  2OS8 C;  2QEO A;  1J7Q A;  5I94 A;  3O78 A;  3D75 A;  1SL9 A;  1ODB A;  2M8U A;  1OOG A;  3JTD B;  1XFX O;  4GPL B;  1OW4 A;  3I5I C;  1NUB A;  3TDZ A;  3PFV A;  1ZMZ A;  1GQM A;  4GGN A;  3SG4 A;  2PVB A;  4HRE E;  1DJH A;  1F4O A;  1U5I A;  3HCM A;  5ER5 A;  4ETO A;  1CDN A;  3FE8 A;  3SS5 A;  1DJG A;  4N1G A;  3VB1 A;  1QAT A;  1DJW A;  1SCM C;  1UHH A;  4ORB B;  2JZI A;  4P2Y B;  1K9K A;  3SG7 A;  2KDH A;  3TZ1 A;  1QS7 A;  2M7N A;  1MQ1 A;  2I7A A;  2PAS A;  4DS7 A;  4ZCU A;  2K61 A;  1B47 A;  2KFG A;  2LV7 A;  3S0A A;  2WCK A;  1MWN A;  1OMR A;  2WC6 A;  3SIA A;  3DF0 B;  3SS4 A;  2OTG B;  1OOI X;  2FOT A;  1DF0 A;  1DGV A;  1K8U A;  1TNP A;  3OX6 A;  1B8L A;  1V1G A;  3SJS A;  4UPG A;  2M1K B;  1RWY A;  2L5X B;  1D1O A;  5ER4 X;  2NXQ A;  4CFQ A;  3L4L A;  3CDN A;  3S0B A;  1DGU A;  1KSO A;  3Q8I A;  3TS5 B;  4N5X A;  1BR1 B;  2JUL A;  1MXE A;  2ZNE A;  5GQQ C;  2MLF C;  1S26 D;  4OZD A;  2ZND A;  2JPT A;  1BLQ A;  1N0Y A;  2Y4Q A;  3EK4 A;  2K7C A;  4D1E A;  4WQ3 A;  2JT8 A;  1NX2 A;  4Q04 A;  1DMO A;  1Z2C B;  2KYF A;  1WDC C;  2H2K A;  3JTD C;  3PM8 A;  2KFF A;  4MRY A;  1KK7 Z;  5HL1 A;  2KI6 D;  1M31 A;  2LLS A;  2NCO A;  3ZNI A;  1HQV A;  1UHN A;  1EG3 A;  4JD9 A;  1FI5 A;  1DQE A;  3FE6 A;  2P6B B;  3ICB A;  5D7F A;  2HF5 A;  3FE9 A;  1NX1 A;  2L0P A;  2QEB A;  4OR9 B;  2LVV A;  3EG5 B;  4C0J A;  3PLF B;  4ICB A;  4CFR A;  1N2D A;  3S0E A;  5B8I B;  5AFP A;  4CLN A;  2BEC A;  1DJZ A;  1C3Y A;  1MF8 B;  4FTG A;  1SPY A;  1K2H A;  1HT9 A;  2Y1M A;  4AOM A;  2JT3 A;  1F4Q A;  2F8P A;  5IBW A;  2KI4 B;  3I5H C;  1W9Z A;  3BOW B;  3NXA A;  4OV2 A;  5CSJ A;  1B7T Z;  2O5G A;  1TNQ A;  2M1U A;  5AEQ A;  5FI7 A;  3R1O A;  2LNK A;  3TS5 C;  4HRH A;  5DKN A;  4AQJ A;  1BOD A;  2L51 A;  3UNW A;  2HPS A;  1DJI A;  2BCX A;  2Y1N A;  4U8D A;  2KBM A;  2OPO A;  4YRU A;  4I5K A;  3D78 A;  4GGF C;  2L98 A;  2L50 A;  1SL8 A;  1SW8 A;  3DVJ A;  2GV5 A;  1TNW A;  4E68 A;  4PHJ A;  1SCV A;  3SG6 A;  2L5Y A;  3BUO B;  3QME A;  4PE0 A;  1H4B A;  2KQ6 A;  1NSH A;  1JF0 A;  4F0Z B;  3CLN A;  5D69 A;  1KK8 B;  1GGW A;  2SCP A;  3DVE A;  3CZT X;  1CFC A;  1IQ5 A;  2KQY A;  4M2P A;  4YGA A;  2GTE A;  1B1G A;  1CM4 A;  1RTP 1;  1G33 A;  1CLL A;  3DXL A;  3IQO A;  4WQ2 A;  4WRI A;  1CMF A;  3RM1 A;  2JOJ A;  3IF7 A;  4I5N B;  2LP2 A;  1DC1 A;  1YVL A;  2LC5 A;  2LCP A;  3RLZ A;  3R1V A;  1FI6 A;  2COL B;  4QJ5 B;  1SCM B;  2LUC A;  1PSB A;  1IGV A;  1QTX A;  1AUI B;  2ZN9 A;  3IQQ A;  1M46 A;  1SBJ A;  1UP5 A;  3BUN B;  4MEW A;  4OCI A;  1BU3 A;  1L7Z A;  3V2L A;  2LVK A;  3EK8 A;  1SY9 A;  2MAZ A;  1REC A;  2QPT A;  1FF1 A;  1UHK A;  5HKW A;  3S0F A;  1T14 A;  2KOT A;  1IQ3 A;  2P70 A;  3OB2 B;  2WCL A;  2D8N A;  3PAT A;  4MLW A;  1QVI Z;  3I5F C;  3JVT C;  5CSF A;  3F45 A;  1ZUZ A;  2LM5 A;  2WOS A;  1NCY A;  2QEV A;  4OVN F;  1QAS A;  3PAL A;  3NGV A;  2AMI A;  2TN4 A;  3BFB A;  2KHN A;  1XK4 A;  3DD4 A;  2ZN8 A;  1NCZ A;  2WCB A;  1CTR A;  1DF0 B;  3SIB A;  5KSZ A;  1BOC A;  2NCP A;  1BR4 B;  1TIZ A;  1UUR A;  4MRX A;  1WDC B;  2JXL A;  4IJ7 A;  1XYD A;  1LIN A;  1M39 A;  1KSM A;  1YRU B;  1XFZ O;  3EKH A;  3NHI A;  4NDC A;  4PHN A;  1LA0 A;  1FBV A;  3VRR A;  4FQO A;  1BF5 A;  1OMV A;  2KFH A;  4M2Q A;  3OB1 B;  3D0Y B;  3AKA A;  4I5J A;  2BNX A;  2P71 A;  3CR5 X;  3B7A A;  3WHT B;  3D77 A;  2K60 A;  1B8R A;  2ZRS A;  4XYN A;  3AKB A;  4GUK A;  1K95 A;  1RJV A;  1IKU A;  2KAX A;  3SG2 A;  4BY5 A;  2H61 A;  5CSI A;  4YGC B;  3CZ0 A;  2CNP A;  1YUT A;  1IH0 A;  1AP4 A;  3OBV A;  1CDM A;  1ALV A;  2I2R E;  1ZFS A;  3I5H B;  3KHE A;  4GNK B;  2MRD A;  2MLE C;  4MZL A;  2F3Y A;  2PRU A;  1AVS A;  3H4S E;  2BL0 C;  1YUR A;  4MN0 A;  4NDD A;  1XO5 A;  2KLE A;  5D3O A;  2SAS A;  3CAB A;  2LMT A;  3D73 A;  4JPZ B;  5J3X A;  5AAN A;  4YGD B;  5I8N A;  1NIW A;  1CNP A;  1F54 A;  2L2E A;  1OE9 B;  2WC5 A;  2Y5I A;  3BFH A;  2NLN A;  1CFP A;  1Y1A A;  1JWD A;  1MUX A;  1EH2 A;  2LLT A;  3PM2 A;  3MSE B;  2H8V A;  1QX5 B;  1K96 A;  2KI6 C;  3R72 A;  1TWO A;  1W7J B;  1K9P A;  3TUY C;  2QDI A;  1QIV A;  3FIA A;  3BYA A;  1JUO A;  1S3P A;  1TUZ A;  1J1E A;  1AHR A;  2MHH A;  5DKR A;  1OQP A;  1SKT A;  1DEK A;  5AER A;  1SRA A;  3I5G C;  2CBL A;  1TOP A;  3O2P A;  2ISD A;  1YX8 A;  1GJY A;  1NWD A;  1X02 A;  2LLU A;  1S6I A;  3FS7 A;  3M0W A;  1KQM B;  1UHJ A;  1EL4 A;  4XJK A;  4C0L A;  3IVT A;  2HQW A;  2F3Z A;  3NSI A;  3L47 A;  3CTN A;  1DJY A;  2LHI A;  4INX A;  1QX7 A;  4DRW A;  1YUS A;  2HQ8 A;  3KPX A;  4TNC A;  1IJ6 A;  1Q80 A;  3OP0 A;  3DVM A;  3KO0 A;  2K7O A;  1RK9 A;  4HSZ A;  1A03 A;  3PN7 C;  4PE1 A;  1Y0V H;  2EHB A;  1W7I B;  4MBE A;  1SR6 B;  3I5F B;  1S5G Z;  3JVT B;  3B88 A;  1CDP A;  1RFJ A;  1YR5 A;  3BFA A;  3D10 A;  4IL1 A;  2JC2 A;  5DKQ A;  1EG4 A;  4YGE B;  1B4C A;  1Y6W A;  3AAJ A;  4YBH B;  1UHI A;  3EK7 A;  1WRZ A;  2EC6 B;  1YVH A;  3LL8 B;  4GBA A;  4YI8 A;  1MXL C;  3CZ2 A; 
#chains in the Genus database with same CATH homology
 1WY9 A;  1S6C A;  1XFU O;  2CT9 A;  1XFV O;  1IG5 A;  2M3W A;  1TCO B;  1KQM C;  3CR2 A;  1ALW A;  3LK0 A;  3CS1 A;  2NZ0 A;  3WHU B;  5I2O A;  1TCF A;  2BCA A;  3VGO A;  1YX7 A;  3GK1 A;  1LXF C;  2O60 A;  1QIW A;  1OZO A;  2BE4 A;  1J7P A;  1PUL A;  2WCF A;  2FCD A;  3EVU A;  3DVK A;  4N1F A;  1BJF A;  1PK0 D;  1JF2 A;  1QXP A;  1R2U A;  1KFX S;  2F33 A;  2RGI A;  3TDI A;  2BKH B;  4PCW A;  2F2P A;  2LMV A;  3BUX B;  1K93 D;  3BQ3 A;  1M45 A;  2R2I A;  1JC2 A;  2M29 A;  1SR6 C;  1U5I B;  1JSA A;  1Y1X A;  5FYX A;  1ZOT B;  2LUX A;  4GAO A;  4MZK A;  2BL0 B;  1TNX A;  1KWO C;  4ORA B;  1C7W A;  1QLS A;  1J1D A;  4PDZ A;  1A4P A;  1A2X A;  2M49 B;  2MJW B;  2EC6 C;  1PRW A;  4PE4 A;  1OSA A;  1CMG A;  2VRG A;  4YI9 A;  5KU1 A;  1NX3 A;  2LP3 A;  3TUY B;  1WLM A;  1WRL A;  4MVF A;  5HYD A;  3VRN A;  1A75 A;  3LCP C;  1DJX A;  3O4Y A;  2KAY A;  5AXI A;  2KGB C;  2KYC A;  3NSL A;  1J7O A;  2BKI B;  3I5G B;  4BY4 A;  1IJ5 A;  1K9U A;  2WCE A;  2B1U A;  3KEV A;  2JNX A;  4P5O E;  5BPJ A;  1XK4 C;  2Q91 A;  2K7D A;  2JTZ A;  4L9M A;  5HLV A;  1SK6 D;  1S36 A;  1IRJ A;  2FJU B;  2ZFD A;  1QJT A;  4A4C A;  5I2Q A;  1QLK A;  1LA3 A;  1EXR A;  2JU0 A;  1AJ4 A;  2G9B A;  3TDU A;  4CID A;  4QJ4 B;  3NSK A;  3WNX B;  4AQI A;  2I94 A;  1YRT B;  4JQ0 D;  1UWO A;  4PHM A;  3BUM B;  1KFX L;  3PN7 B;  4QJ3 B;  5JOL A;  1KCY A;  1RRO A;  2M9G A;  3A4U B;  4XJK B;  1C7V A;  1E8A A;  3GOF A;  2BBM A;  2H61 C;  1F71 A;  1K90 D;  1NPQ A;  3CR4 X;  3VRP A;  1TTX A;  1J7R A;  2K8M B;  3EVV A;  1S1E A;  4R1E A;  2DOQ A;  1F55 A;  5HKY A;  5K89 A;  2K2F A;  2ZKM X;  2JWW A;  2E6W A;  1DT7 B;  1SMG A;  2JT0 A;  1PVA A;  4ORC B;  1XVJ A;  2BE6 A;  4PHK A;  5I2L A;  1AK8 A;  2PAL A;  4CPV A;  1B9A A;  3D0Y A;  1EJ3 A;  1IWQ A;  2WC8 A;  2EGD A;  2AAO A;  1JBA A;  1LKJ A;  3HX4 A;  2LHL A;  2Q4U A;  2M0R A;  1YUU A;  2KSP A;  1XA5 A;  1G4Y R;  3DF0 A;  1KK7 Y;  1JFK A;  1OMD A;  2KBI A;  1VRK A;  2AUC A;  4A4B A;  3OHM B;  3E3R A;  5HLO A;  1TRF A;  3A8R A;  2LMU A;  5F6T A;  1H8B A;  1GGZ A;  2PMY A;  3C1V A;  1SNL A;  4MZJ A;  2IS9 A;  1MHO A;  2A4J A;  3OX5 A;  1TN4 A;  3FWB A;  1F70 A;  1NYA A;  1CM1 A;  1M63 B;  2GGM A;  3FWC A;  2LAP A;  1PAL A;  2K2A A;  1DTL A;  2QAC A;  4JWQ A;  5JJG A;  1C07 A;  1KWO B;  4GGF A;  5CSN A;  3NSO A;  2OTG C;  1KFU S;  2I18 A;  4M2O A;  1WLZ A;  2WOR A;  1L2O B;  2WND A;  4DUQ A;  2BBN A;  2JQ6 A;  4HRG A;  1B7T Y;  2HET A;  4ZCV A;  2MBX A;  5HKZ A;  3BUW B;  1KQV A;  1NP8 A;  3BXK A;  1V1F A;  2JNF A;  4C0K A;  3K21 A;  1FPW A;  1S6J A;  1UUS A;  1OZS A;  3QRX A;  4DCK A;  1BMO A;  3LK1 A;  1S5G Y;  2KGR A;  5CPV A;  1ZAC A;  2LVI A;  2CXJ A;  3CWG A;  3PSR A;  2LVJ A;  2MA2 A;  2V53 A;  1QX2 A;  5PAL A;  1CLB A;  4USL A;  1BT6 A;  4NQG A;  4PE7 A;  1JFJ A;  1LVC D;  1N65 A;  1G8I A;  2E30 A;  4YGB B;  2JTT A;  2ZRT A;  2GGZ A;  3KF9 A;  1OOJ A;  4PAL A;  2OS8 B;  2KAV A;  3BOW A;  1WRK A;  1Y1U A;  2G2B A;  3O6B A;  1A75 B;  1YTZ C;  3GK2 A;  3SG5 A;  3I5I B;  3VRQ A;  1CFF A;  2L4I A;  3LLE A;  4DIR A;  1QV1 A;  2K7B A;  2M7L A;  2LE9 B;  2KNE A;  5TNC A;  3VRO A;  2JXC A;  4NDB A;  2LAN A;  5G08 A;  1L2O C;  1QV0 A;  2CCM A;  1K94 A;  3EVR A;  3ZWH A;  4OKH A;  1B8C A;  2FCE A;  1DVI A;  1J55 A;  1AJ5 A;  2KI4 C;  1NX0 A;  2JRF A;  1CDL A;  3AAK A;  2CTN A;  1SYM A;  4GFT A;  1QVI Y;  2PSR A;  1KFU L;  1F8H A;  1CB1 A;  2M97 A;  2BCB A;  3EKJ A;  1FW4 A;  5KTY A;  3CGA A;  4MSP A;  1CFD A;  1PVB A;  1XFW O;  3WXA A;  4I5L B;  1A29 A;  1NCX A;  1SL7 A;  2F2O A;  1CLM A;  2K0J A;  2L4H A;  3GK4 X;  1BG1 A;  3SG3 A;  1KK8 C;  1R6P A;  1PSR A;  1XFY O;  1MR8 A;  2OS8 C;  1J7Q A;  3O78 A;  1SL9 A;  1ODB A;  2M8U A;  3JTD B;  1XFX O;  4GPL B;  3I5I C;  3TDZ A;  1NUB A;  3PFV A;  1ZMZ A;  1GQM A;  4GGN A;  3SG4 A;  2PVB A;  4HRE E;  1DJH A;  1F4O A;  1U5I A;  3HCM A;  5ER5 A;  4ETO A;  1CDN A;  1DJG A;  4N1G A;  1QAT A;  1DJW A;  1SCM C;  1UHH A;  4ORB B;  2JZI A;  4P2Y B;  1K9K A;  3SG7 A;  2KDH A;  3TZ1 A;  1QS7 A;  2M7N A;  1MQ1 A;  2I7A A;  2PAS A;  4DS7 A;  4ZCU A;  2K61 A;  1B47 A;  2KFG A;  2LV7 A;  1MWN A;  1OMR A;  3SIA A;  3DF0 B;  2OTG B;  2FOT A;  1DF0 A;  1DGV A;  1K8U A;  1TNP A;  3OX6 A;  1B8L A;  1V1G A;  3SJS A;  4UPG A;  2M1K B;  1RWY A;  2L5X B;  1D1O A;  5ER4 X;  2NXQ A;  4CFQ A;  1DGU A;  1KSO A;  3TS5 B;  4N5X A;  1BR1 B;  2JUL A;  1MXE A;  2ZNE A;  5GQQ C;  2MLF C;  1S26 D;  2ZND A;  2JPT A;  1BLQ A;  1N0Y A;  2Y4Q A;  3EK4 A;  2K7C A;  4D1E A;  4WQ3 A;  2JT8 A;  1NX2 A;  4Q04 A;  1DMO A;  2KYF A;  1WDC C;  2H2K A;  3JTD C;  3PM8 A;  2KFF A;  4MRY A;  1KK7 Z;  2KI6 D;  1M31 A;  2LLS A;  2NCO A;  3ZNI A;  1HQV A;  1UHN A;  1EG3 A;  1FI5 A;  3ICB A;  2P6B B;  5D7F A;  2HF5 A;  1NX1 A;  2L0P A;  4OR9 B;  2LVV A;  4C0J A;  3PLF B;  4ICB A;  4CFR A;  1N2D A;  5B8I B;  5AFP A;  4CLN A;  2BEC A;  1DJZ A;  1MF8 B;  4FTG A;  1SPY A;  1K2H A;  1HT9 A;  2Y1M A;  4AOM A;  2JT3 A;  1F4Q A;  2F8P A;  5IBW A;  2KI4 B;  3I5H C;  3BOW B;  3NXA A;  4OV2 A;  5CSJ A;  1B7T Z;  2O5G A;  1TNQ A;  2M1U A;  5AEQ A;  2LNK A;  3TS5 C;  4HRH A;  5DKN A;  4AQJ A;  1BOD A;  2L51 A;  2HPS A;  1DJI A;  2BCX A;  2Y1N A;  4U8D A;  2KBM A;  2OPO A;  4YRU A;  4I5K A;  4GGF C;  2L98 A;  2L50 A;  1SL8 A;  1SW8 A;  3DVJ A;  2GV5 A;  1TNW A;  4E68 A;  4PHJ A;  1SCV A;  3SG6 A;  3BUO B;  1H4B A;  4PE0 A;  2KQ6 A;  1NSH A;  1JF0 A;  4F0Z B;  3CLN A;  5D69 A;  1KK8 B;  1GGW A;  2SCP A;  3DVE A;  3CZT X;  1CFC A;  1IQ5 A;  2KQY A;  4M2P A;  4YGA A;  1B1G A;  1CM4 A;  1RTP 1;  1G33 A;  1CLL A;  3IQO A;  4WQ2 A;  4WRI A;  1CMF A;  3RM1 A;  2JOJ A;  3IF7 A;  4I5N B;  2LP2 A;  1YVL A;  2LC5 A;  2LCP A;  3RLZ A;  1FI6 A;  2COL B;  4QJ5 B;  1SCM B;  2LUC A;  1PSB A;  1IGV A;  1QTX A;  1AUI B;  2ZN9 A;  3IQQ A;  1M46 A;  1SBJ A;  1UP5 A;  3BUN B;  4MEW A;  4OCI A;  1BU3 A;  1L7Z A;  2LVK A;  3EK8 A;  1SY9 A;  2MAZ A;  1REC A;  2QPT A;  1FF1 A;  1UHK A;  5HKW A;  1IQ3 A;  2KOT A;  3OB2 B;  5CSF A;  2D8N A;  3PAT A;  4MLW A;  1QVI Z;  3I5F C;  3JVT C;  3F45 A;  1ZUZ A;  2LM5 A;  2WOS A;  1NCY A;  4OVN F;  1QAS A;  3PAL A;  2AMI A;  2TN4 A;  2KHN A;  1XK4 A;  3DD4 A;  2ZN8 A;  1NCZ A;  2WCB A;  1CTR A;  1DF0 B;  3SIB A;  5KSZ A;  1BOC A;  2NCP A;  1BR4 B;  1TIZ A;  1UUR A;  4MRX A;  1WDC B;  2JXL A;  1XYD A;  1LIN A;  1M39 A;  1KSM A;  1YRU B;  1XFZ O;  3EKH A;  4PHN A;  4NDC A;  3VRR A;  1LA0 A;  1FBV A;  1BF5 A;  4FQO A;  1CKK A;  1OMV A;  2KFH A;  4M2Q A;  3OB1 B;  3D0Y B;  3AKA A;  4I5J A;  3CR5 X;  3WHT B;  1B8R A;  2ZRS A;  4XYN A;  3AKB A;  4GUK A;  1K95 A;  1RJV A;  1IKU A;  2KAX A;  3SG2 A;  4BY5 A;  2H61 A;  5CSI A;  4YGC B;  2CNP A;  1YUT A;  1IH0 A;  1AP4 A;  1CDM A;  1ALV A;  2I2R E;  1ZFS A;  3I5H B;  3KHE A;  4GNK B;  2MRD A;  2MLE C;  4MZL A;  2F3Y A;  2PRU A;  1AVS A;  3H4S E;  2BL0 C;  1YUR A;  4MN0 A;  4NDD A;  1XO5 A;  2SAS A;  2LMT A;  4JPZ B;  5AAN A;  5J3X A;  4YGD B;  5I8N A;  1NIW A;  1CNP A;  1F54 A;  2L2E A;  1OE9 B;  2Y5I A;  1CFP A;  2NLN A;  1Y1A A;  1JWD A;  1MUX A;  1EH2 A;  2LLT A;  3MSE B;  1QX5 B;  1K96 A;  2KI6 C;  1W7J B;  1K9P A;  3TUY C;  1QIV A;  3FIA A;  3BYA A;  1JUO A;  1S3P A;  1J1E A;  1AHR A;  2MHH A;  5DKR A;  1OQP A;  1SKT A;  5AER A;  1SRA A;  3I5G C;  2CBL A;  1TOP A;  3O2P A;  2ISD A;  1YX8 A;  1GJY A;  1NWD A;  1X02 A;  2LLU A;  1S6I A;  3FS7 A;  3M0W A;  1KQM B;  1UHJ A;  1EL4 A;  4XJK A;  4C0L A;  2HQW A;  2F3Z A;  3NSI A;  3CTN A;  1DJY A;  2LHI A;  1QX7 A;  4DRW A;  1YUS A;  2HQ8 A;  3KPX A;  4TNC A;  1IJ6 A;  1Q80 A;  3OP0 A;  3DVM A;  3KO0 A;  2K7O A;  1RK9 A;  4HSZ A;  1A03 A;  3PN7 C;  4PE1 A;  1Y0V H;  2EHB A;  1W7I B;  4MBE A;  1SR6 B;  3I5F B;  1S5G Z;  3JVT B;  1CDP A;  1RFJ A;  1YR5 A;  3D10 A;  4IL1 A;  2JC2 A;  5DKQ A;  1EG4 A;  4YGE B;  1B4C A;  1Y6W A;  3AAJ A;  4YBH B;  1UHI A;  3EK7 A;  1WRZ A;  2EC6 B;  1YVH A;  3LL8 B;  4GBA A;  4YI8 A;  1MXL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...