2GV5A

Crystal structure of sfi1p/cdc31p complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2gv5A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2gv5A01
3AKBA 4OV2A 1IG5A 1WRLA 4GGNA 1TCOB 1FI6A 1LVCD 1YVLA 1CM1A 4P2YB 2MAZA 2BL0C 1ZMZA 2L98A 1HQVA 1C07A 4CIDA 3VGOA 3FWCA 1SR6B 3PM8A 5I8NA 1ALVA 1S1EA 3I5IB 3NSLA 2K2FA 1CMFA 2K61A 2ZN8A 2HF5A 1LXFC 2GGZA 4NDDA 4YGCB 2LMTA 2A4JA 4XJKA 5J3XA 3O78A 2ZKMX 2JU0A 2I2RE 2WCEA 1HT9A 2VRGA 1J1DA 2E30A 2FOTA 1TN4A 1J7QA 4Q04A 3TDUA 2KFHA 1CDPA 3BUNB 3I5GC 2K8MB 3RM1A 5BPJA 1NPQA 2IS9A 1TNWA 1CKKA 1OSAA 1M46A 3EK4A 2PALA 1MR8A 4NDCA 1NYAA 1K94A 1SKTA 1A75A 5KTYA 1S6CA 2BBMA 3F45A 4F0ZB 4MRYA 4WRIA 2EGDA 2K7DA 3NSKA 1KK8B 1SY9A 2BCAA 2M1KB 4GFTA 4M2PA 4M2OA 5G08A 5K89A 2CXJA 2JT8A 3BOWA 4XJKB 3WNXB 2F3YA 2L51A 5ER5A 4A4CA 3SG6A 4PHKA 3EKJA 2I18A 3JVTB 1A29A 4DCKA 5CPVA 1YX8A 1TNQA 4MZKA 4YRUA 3LK0A 1QIVA 1DJHA 1AJ4A 4PHNA 1M45A 1KFXS 2O60A 3PFVA 1K9UA 1FF1A 1IRJA 2L4IA 1A75B 2LVJA 1QX5B 1L2OB 1B7TY 1YTZC 4N1GA 3TS5C 3I5FC 3EVRA 1DJZA 1EL4A 2PSRA 1OMVA 1GGZA 2EC6C 1SL8A 1Y1UA 2OPOA 1F4OA 3BOWB 3PLFB 4I5LB 3I5GB 4C0KA 2JULA 5IBWA 2JNXA 5I2LA 1SK6D 1CLMA 1MUXA 3TDZA 1MXEA 1BR1B 1RTP1 1N65A 3GK1A 2PMYA 3CS1A 4PE4A 5DKNA 3FIAA 2BKIB 2TN4A 1X02A 1KFUS 5HLOA 1JWDA 5DKQA 1SRAA 2CTNA 4FTGA 3EVUA 5HKWA 1TIZA 4YI8A 4ZCUA 4MZLA 3DVKA 2F8PA 2JRFA 2WNDA 1KSMA 1XFVO 2ZNDA 3VROA 1F70A 5D69A 3RLZA 1J7OA 1BU3A 1YRUB 1XYDA 1J1EA 4UPGA 1R2UA 1CMGA 1U5IA 1F8HA 1PSRA 4ORCB 1WDCC 4D1EA 5AFPA 3TS5B 1CFFA 1N0YA 1LKJA 1BODA 1RECA 2KI6D 1DTLA 1IQ5A 2Y4QA 3I5HC 1CFCA 1W7JB 2ISDA 2EC6B 3WHTB 2JTTA 1EXRA 2BCBA 1TNPA 1V1GA 4C0LA 4ETOA 1LA0A 4GGFC 1EH2A 4ICBA 1J55A 1VRKA 2KGBC 2F2PA 3TZ1A 4N1FA 4NQGA 2E6WA 2LLTA 3IF7A 3LL8B 1CLLA 1K90D 4WQ3A 2JXCA 2WCBA 2F2OA 2MRDA 2EHBA 1U5IB 1QXPA 3K21A 1YURA 2KQYA 3OB2B 1WLMA 1PSBA 4HSZA 2KAYA 2MLFC 4GGFA 1BOCA 1CDMA 2H2KA 3PN7C 3TUYC 1CDNA 1B4CA 1KCYA 3OHMB 3PALA 4OVNF 3KO0A 2M29A 2M97A 1MQ1A 1YUSA 4PE7A 5CSFA 3CR4X 4HRHA 2LCPA 4ORAB 3SG2A 2D8NA 2K0JA 2FCDA 5HYDA 1XK4C 2LUXA 1AVSA 2Y1NA 2OTGC 1KFXL 4DIRA 1WDCB 4OCIA 1CTRA 1GJYA 3PSRA 1FI5A 1JF0A 1D1OA 3I5HB 1Q80A 3EKHA 1PVAA 4MLWA 1S3PA 2MLEC 2M49B 4PHJA 5TNCA 2LHLA 1QS7A 1L7ZA 1JUOA 1R6PA 2CCMA 2LP2A 1S6IA 3OB1B 2JT3A 4GNKB 1KK7Y 3BUOB 3SIBA 3VRNA 1H8BA 2L4HA 4DRWA 1DF0A 1QATA 4A4BA 2BECA 2BBNA 1G33A 1S36A 2LVVA 1H4BA 1K2HA 1S5GZ 2JTZA 2AAOA 1CB1A 2NLNA 2BL0B 1K93D 2LMVA 1DGVA 2M7LA 5AERA 1BF5A 4PHMA 1NCZA 3KEVA 1DJWA 4OR9B 3PN7B 1FW4A 2LVIA 3QRXA 4P5OE 3TUYB 4MVFA 2H61C 1BLQA 1A03A 4YGEB 3JTDC 3DVJA 5DKRA 1OMRA 5B8IB 5FYXA 1MXLC 1QX7A 1OMDA 4MRXA 1BT6A 1NWDA 1WRKA 3WHUB 4PE1A 4HRGA 2KGRA 2OTGB 3OP0A 4MSPA 1DF0B 3CTNA 2GV5A 2MBXA 1UHIA 5HKYA 1XFUO 1SL9A 3OX6A 1RROA 1Y1XA 2ZNEA 4BY5A 4CFQA 1BR4B 1F55A 1S6JA 4CPVA 1DMOA 2JWWA 2KHNA 4HREE 1F4QA 1YR5A 3D10A 1UP5A 1JBAA 1GGWA 4JPZB 2L2EA 2Q91A 1CDLA 2HETA 2LVKA 3BUWB 3NSOA 2COLB 4MBEA 4USLA 3DVMA 4YI9A 1IH0A 2JC2A 3SJSA 2WOSA 2Y1MA 1QX2A 3SG7A 1ZACA 2HPSA 1J7PA 4QJ5B 3H4SE 4QJ3B 1K95A 2O5GA 3BQ3A 1KQMC 2KAVA 4PCWA 3EK8A 1NUBA 1SCMC 1XFYO 2ZFDA 3NXAA 5CSNA 1OOJA 2I94A 2M3WA 1UHNA 1OZOA 1RJVA 1UURA 1QVIZ 1CFPA 1XO5A 3SG3A 2M1UA 1G8IA 3ICBA 2NCPA 3JTDB 3CR2A 1LA3A 5CSIA 2JT0A 2B1UA 2KAXA 1RFJA 2M0RA 3I5FB 2SCPA 4XYNA 1EG4A 1F54A 1B8RA 2K7CA 2AMIA 4MZJA 1NX0A 1DJIA 1SMGA 1YVHA 4C0JA 3A8RA 1YUTA 1OE9B 5I2OA 2BE6A 3BYAA 1UHHA 5GQQC 1AK8A 1TNXA 4U8DA 1NX3A 2WORA 3DF0A 3I5IC 1AJ5A 2KNEA 5D7FA 2WC8A 2MHHA 3GK2A 3BUXB 2DOQA 1UWOA 1F71A 3EK7A 1UUSA 2SASA 1BMOA 1K9KA 4I5JA 2R2IA 1PRWA 3SG4A 1QV0A 3LCPC 5KU1A 4DS7A 2K2AA 2LAPA 1C7WA 1NP8A 2LMUA 1RWYA 4I5NB 1XFWO 1A2XA 1BJFA 3BXKA 1M39A 3WXAA 1IWQA 4AQJA 1JSAA 1QASA 1IJ5A 1WRZA 4GUKA 4CFRA 2LC5A 5ER4X 4GAOA 3CLNA 2Y5IA 2AUCA 1UHJA 1B1GA 1KQMB 1CFDA 1NX1A 1A4PA 2F3ZA 2G9BA 2JOJA 2L0PA 5PALA 2LM5A 1KK8C 3DF0B 2KFFA 1IGVA 1QIWA 1YX7A 4IL1A 2KI4C 3LLEA 1ZUZA 2NZ0A 1DT7B 2KDHA 4FQOA 4ZCVA 3SG5A 2LP3A 1MF8B 1EJ3A 3CZTX 3JVTC 2KFGA 3VRRA 2OS8C 2LANA 1CM4A 3BUMB 2KBIA 3FWBA 2I7AA 3DD4A 3GOFA 2HQWA 1XA5A 2ZRTA 4WQ2A 1KQVA 3M0WA 5HKZA 3C1VA 1ALWA 1JFJA 1OZSA 1TCFA 2LHIA 2FJUB 2KBMA 3IQQA 3OX5A 1TTXA 1XK4A 1L2OC 2ZN9A 1B7TZ 1NIWA 2Q4UA 2K7OA 1B8CA 1DJYA 1UHKA 5AXIA 1ZFSA 2KSPA 1QJTA 2LUCA 1K8UA 3DVEA 4PDZA 1S26D 4MEWA 2LNKA 5JOLA 1KFUL 1MHOA 1SPYA 1KWOC 1SNLA 5JJGA 2MJWB 1SL7A 4L9MA 3LK1A 2BKHB 3IQOA 5CSJA 1RK9A 3EVVA 1PALA 3KF9A 4OKHA 1TRFA 4YGDB 3ZNIA 2P6BB 4AOMA 1AP4A 1GQMA 1M63B 2GGMA 2KI4B 1SYMA 3HX4A 4R1EA 5AANA 1JFKA 1B47A 1K9PA 4ORBB 1JF2A 1MWNA 3KPXA 2CT9A 1IKUA 1LINA 2OS8B 2KYFA 1IJ6A 4QJ4B 1OQPA 2H61A 2JZIA 2WCFA 1DJGA 2K7BA 4AQIA 2RGIA 1WLZA 4I5KA 1EG3A 1W7IB 4PE0A 3E3RA 3KHEA 2BE4A 4YGBB 1PK0D 1Y6WA 3CGAA 2MA2A 4JWQA 2JXLA 3TDIA 4NDBA 1FBVA 1S5GY 2PASA 3A4UB 1QTXA 2CNPA 1N2DA 1NCYA 1BG1A 2KQ6A 1KWOB 3AAJA 3AKAA 2NCOA 4TNCA 1XFXO 4GPLB 1QLSA 1Y0VH 4YGAA 2PVBA 5AEQA 2LV7A 3VRPA 2LE9B 1SBJA 4PALA 4N5XA 2G2BA 1AHRA 1NSHA 1PVBA 4DUQA 3NSIA 1DGUA 2M7NA 3GK4X 2JQ6A 3O2PA 3HCMA 1AUIB 2NXQA 5HLVA 4E68A 3D0YA 2KYCA 2QPTA 1J7RA 2HQ8A 2LLUA 1KSOA 1NCXA 1SR6C 2FCEA 5F6TA 1K96A 4GBAA 1IQ3A 1SCVA 2JNFA 4JQ0D 1QV1A 2KI6C 3CR5X 1TOPA 1E8AA 2PRUA 1NX2A 1B9AA 2L50A 3PATA 1Y1AA 2LLSA 3AAKA 1DJXA 1SW8A 1YRTB 1B8LA 1C7VA 1PULA 2L5XB 3O6BA 4YBHB 1DVIA 1QLKA 3O4YA 1ODBA 1M31A 2ZRSA 2QACA 2F33A 2M9GA 1CLBA 2M8UA 5KSZA 2BCXA 3SIAA 4M2QA 1G4YR 2V53A 3VRQA 1XVJA 3FS7A 4CLNA 3CWGA 5I2QA 1JC2A 3D0YB 1FPWA 1YUUA 1ZOTB 2CBLA 1SCMB 1XFZO 2KOTA 1CNPA 1KK7Z 3MSEB 1V1FA 1WY9A 4BY4A 1QVIY 3ZWHA 2JPTA 4MN0A
chains in the Genus database with same CATH superfamily
3AKBA 4OV2A 1IG5A 1WRLA 4GGNA 1TCOB 1FI6A 1LVCD 1YVLA 3B88A 1CM1A 4P2YB 2MAZA 2BL0C 1ZMZA 2L98A 1HQVA 1C07A 4CIDA 3VGOA 3FWCA 1SR6B 3PM8A 5I8NA 1ALVA 1S1EA 3I5IB 3NSLA 2K2FA 1CMFA 2K61A 2ZN8A 3DYEA 2HF5A 1LXFC 2GGZA 4NDDA 4YGCB 1TWOA 2LMTA 2A4JA 1IIOA 4XJKA 2FJYA 5J3XA 3O78A 2ZKMX 2JU0A 1DQEA 1GM0A 3R72A 2I2RE 2WCEA 1HT9A 2VRGA 1J1DA 3UO9A 2E30A 2FOTA 1TN4A 1J7QA 4Q04A 3TDUA 2KFHA 1CDPA 3BUNB 3I5GC 2K8MB 3RM1A 5BPJA 1NPQA 2IS9A 1TNWA 1CKKA 1OSAA 1M46A 3BFBA 3CDNA 3EK4A 2PALA 1MR8A 4NDCA 1NYAA 1K94A 1SKTA 1A75A 5KTYA 1S6CA 3D76A 2BBMA 3Q8IA 3F45A 4F0ZB 4MRYA 4WRIA 2EGDA 2K7DA 3NSKA 1KK8B 1SY9A 2BCAA 2M1KB 4GFTA 4M2PA 4M2OA 5G08A 2BNXA 5K89A 2CXJA 2JT8A 3BOWA 4XJKB 3WNXB 1OOIX 2F3YA 2L51A 5ER5A 4A4CA 3SG6A 4PHKA 3EKJA 2I18A 3JVTB 1A29A 1DC1A 3SS3A 5DICA 3SS5A 4DCKA 5CPVA 1ORGA 1YX8A 1TNQA 4MZKA 4YRUA 3LK0A 1QIVA 1DJHA 1AJ4A 2GTEA 4PHNA 1M45A 1KFXS 2O60A 3PFVA 1K9UA 1FF1A 1IRJA 2L4IA 1A75B 2LVJA 1QX5B 1L2OB 1B7TY 1YTZC 4N1GA 4IJ7A 3TS5C 3D75A 3I5FC 3EVRA 1DJZA 1EL4A 2PSRA 1OMVA 1GGZA 2EC6C 1SL8A 1Y1UA 2OPOA 1F4OA 3BOWB 2QEOA 3PLFB 4I5LB 3I5GB 4C0KA 2JULA 5IBWA 2JNXA 3S0EA 3K1EA 1SK6D 5I2LA 1CLMA 1MUXA 2H8VA 3TDZA 1MXEA 1BR1B 1RTP1 1N65A 3D74A 2PMYA 3CS1A 3GK1A 4PE4A 5DKNA 2KLEA 2BKIB 3FIAA 2TN4A 1X02A 1KFUS 5HLOA 1JWDA 5DKQA 1SRAA 2CTNA 3S0AA 4FTGA 3EVUA 5HKWA 1TIZA 4YI8A 4ZCUA 4MZLA 3DVKA 2F8PA 2JRFA 2WNDA 1KSMA 3EG5B 1XFVO 2ZNDA 2QDIA 3VROA 1T14A 1F70A 5D69A 1SSEB 3RLZA 1J7OA 1BU3A 1YRUB 1XYDA 1J1EA 4UPGA 1R2UA 3R1PA 1CMGA 1U5IA 1F8HA 1PSRA 3D77A 4ORCB 1WDCC 4D1EA 5AFPA 3TS5B 1CFFA 1N0YA 5I94A 1LKJA 1BODA 1RECA 2KI6D 1DTLA 1IQ5A 2Y4QA 3I5HC 1CFCA 1W7JB 3FE8A 5HL1A 3CABA 2EC6B 2ISDA 3D78A 3WHTB 2JTTA 4JD9A 1EXRA 2BCBA 1TNPA 1V1GA 4C0LA 4ETOA 1LA0A 4GGFC 5D3OA 3CZ1A 1EH2A 4ICBA 1J55A 1VRKA 2KGBC 2F2PA 3TZ1A 4N1FA 4NQGA 2E6WA 2LLTA 2QEHA 3IF7A 3LL8B 1CLLA 1K90D 4WQ3A 2JXCA 2WCBA 2F2OA 2MRDA 2EHBA 1U5IB 1QXPA 3K21A 4JKTA 1YURA 2KQYA 3OB2B 2YGUA 1WLMA 1PSBA 4HSZA 5FI6A 2KAYA 2MLFC 4GGFA 1BOCA 1CDMA 2H2KA 3PN7C 3L47A 3TUYC 1CDNA 1B4CA 2QEBA 1KCYA 3OHMB 3PALA 4OVNF 3KO0A 2M29A 2M97A 1MQ1A 1YUSA 4PE7A 5CSFA 3CR4X 4HRHA 2LCPA 4ORAB 3SG2A 2D8NA 1OOHA 2FCDA 2K0JA 3D73A 5HYDA 1XK4C 2LUXA 1AVSA 2Y1NA 2OTGC 1KFXL 4DIRA 1WDCB 4OCIA 1CTRA 2WC6A 1GJYA 3PSRA 1FI5A 1JF0A 1D1OA 3I5HB 1Q80A 3EKHA 3RZSA 1PVAA 4MLWA 1S3PA 1TUJA 2MLEC 2M49B 4PHJA 5TNCA 2LHLA 1QS7A 4FQTA 1L7ZA 1JUOA 1R6PA 2CCMA 2LP2A 1S6IA 3OB1B 3CZ2A 2JT3A 2KPHA 4GNKB 1KK7Y 2L5YA 3BUOB 3NGVA 3SIBA 3VRNA 1H8BA 2L4HA 4DRWA 1DF0A 1QATA 4A4BA 2BECA 2BBNA 1G33A 1S36A 2LVVA 1H4BA 1K2HA 1S5GZ 2JTZA 2AAOA 1CB1A 2NLNA 2BL0B 1K93D 2LMVA 1DGVA 2K60A 3S0FA 2M7LA 5AERA 2BAPA 1BF5A 4PHMA 1NCZA 3KEVA 1DJWA 4OR9B 3PN7B 1FW4A 2LVIA 3QRXA 4P5OE 3TUYB 2P71A 3CYZA 4INWA 4MVFA 2H61C 1BLQA 3R1VA 1A03A 4YGEB 1Z4HA 3JTDC 3DVJA 5DKRA 1OMRA 4INXA 5FYXA 1MXLC 1QX7A 1OMDA 5B8IB 4MRXA 1BT6A 1NWDA 1WRKA 3DXLA 3WHUB 4PE1A 4HRGA 2KGRA 2OTGB 3OP0A 4MSPA 1DF0B 3O4XA 3CTNA 1XFRA 2GV5A 2MBXA 1UHIA 5HKYA 1XFUO 1SL9A 1OOGA 3OX6A 1RROA 1Y1XA 2ZNEA 3FE6A 4BY5A 1BR4B 4CFQA 1S6JA 3S0BA 1F55A 4CPVA 1DMOA 2JWWA 2KHNA 4HREE 3SS4A 1F4QA 1YR5A 3D10A 1UP5A 1JBAA 1GGWA 4JPZB 2L2EA 2Q91A 1CDLA 2HETA 2LVKA 3BUWB 3FE9A 2COLB 3NSOA 4MBEA 3DVMA 4USLA 1IH0A 3PM2A 2JC2A 3SJSA 2WOSA 2Y1MA 1QX2A 2PYQA 1ZACA 2HPSA 3SG7A 2QEVA 1J7PA 4KYNA 4QJ5B 3H4SE 4QJ3B 1K95A 3BFHA 2O5GA 3BQ3A 1LS8A 1KQMC 2KAVA 4PCWA 3EK8A 1NUBA 1SCMC 1XFYO 2ZFDA 3B86A 3NXAA 5CSNA 5EL2A 1OOJA 2I94A 2M3WA 1UHNA 1OZOA 1RJVA 1UURA 1QVIZ 1CFPA 1W9ZA 1XO5A 3BFAA 2M1UA 1G8IA 3ICBA 2NCPA 3JTDB 3SG3A 3CR2A 1LA3A 2KLDA 3IVTA 5CSIA 2JT0A 2B1UA 2P70A 1C3YA 2KAXA 1RFJA 2M0RA 3I5FB 2SCPA 4XYNA 1EG4A 1F54A 1B8RA 2K7CA 2AMIA 4MZJA 1NX0A 3S0GA 1DJIA 1SMGA 1YVHA 4C0JA 3R1OA 3A8RA 1TUZA 1OE9B 1YUTA 2BE6A 3BYAA 3S0DA 1UHHA 5I2OA 5GQQC 1AK8A 3DY9A 1TNXA 4U8DA 1NX3A 2WORA 3DF0A 3I5IC 1AJ5A 2KNEA 5D7FA 2WC8A 3B7AA 2MHHA 3GK2A 3BUXB 2DOQA 1UWOA 1F71A 3EK7A 1UUSA 2SASA 3NHIA 1BMOA 1K9KA 4I5JA 3UNWA 2R2IA 1PRWA 3SG4A 1QV0A 3LCPC 5KU1A 4DS7A 2K2AA 2LAPA 1C7WA 1NP8A 2LMUA 1RWYA 3CZ0A 4I5NB 1XFWO 1A2XA 1BJFA 3BXKA 1M39A 3WXAA 1IWQA 2WCMA 4AQJA 1JSAA 1WRZA 1QASA 1IJ5A 4GUKA 4CFRA 2LC5A 5ER4X 4GAOA 3CLNA 2Y5IA 3L4AA 2AUCA 1UHJA 1B1GA 1KQMB 1CFDA 1NX1A 3QMEA 1A4PA 2F3ZA 2G9BA 2JOJA 2L0PA 5PALA 2LM5A 1KK8C 3B87A 3DF0B 2KFFA 1IGVA 1QIWA 1YX7A 3N7HA 4IL1A 2KI4C 3LLEA 1ZUZA 2PQLA 2NZ0A 1DT7B 2KDHA 4FQOA 4ZCVA 3SG5A 2LP3A 1MF8B 1EJ3A 5FI2A 3CZTX 3JVTC 2KFGA 3VRRA 2OS8C 2LANA 1CM4A 3BUMB 2KBIA 3FWBA 2I7AA 3DD4A 3GOFA 2HQWA 1XA5A 2ZRTA 4WQ2A 1KQVA 3M0WA 5HKZA 3C1VA 1ALWA 1JFJA 1OZSA 1TCFA 2LHIA 2FJUB 2KBMA 3IQQA 3OX5A 1TTXA 1XK4A 5FI7A 1P28A 1L2OC 2ERBA 2ZN9A 1B7TZ 1NIWA 2Q4UA 2K7OA 1B8CA 1DJYA 1UHKA 5AXIA 1ZFSA 2KSPA 1QJTA 2LUCA 3VB1A 1K8UA 3DVEA 4PDZA 1S26D 4MEWA 2LNKA 5JOLA 1KFUL 1MHOA 3OGNA 1SPYA 1KWOC 1SNLA 2WCJA 5JJGA 1OOFA 2MJWB 1SL7A 4L9MA 3LK1A 2BKHB 3IQOA 1DELA 5CSJA 1RK9A 3EVVA 1PALA 3KF9A 4OKHA 1TRFA 4YGDB 3ZNIA 1OW4A 2P6BB 4AOMA 1AP4A 1GQMA 1M63B 2GGMA 2KI4B 1SYMA 3HX4A 4R1EA 5AANA 1QWVA 1JFKA 1B47A 1K9PA 4ORBB 1JF2A 1MWNA 2L2CA 3KPXA 2CT9A 1IKUA 1LINA 2OS8B 3PJIA 2KYFA 1IJ6A 4QJ4B 4F7FA 1OQPA 2H61A 2JZIA 2WCFA 1DJGA 2K7BA 4AQIA 2RGIA 1WLZA 3BJHA 2WCHA 3DZTA 4I5KA 1EG3A 1W7IB 4PE0A 3E3RA 3KHEA 2BE4A 4YGBB 1PK0D 1Y6WA 3CGAA 2MA2A 4JWQA 2JXLA 4PT1A 3TDIA 1DEKA 3L4LA 4NDBA 1FBVA 1S5GY 2PASA 3A4UB 1QTXA 2CNPA 1N2DA 1NCYA 1BG1A 2KQ6A 1KWOB 2WC5A 3OBVA 3AAJA 3AKAA 2NCOA 4YI9A 4TNCA 1XFXO 4GPLB 1QLSA 1Y0VH 2WCKA 4YGAA 2PVBA 5AEQA 2LV7A 3VRPA 2LE9B 1SBJA 4PALA 4N5XA 2G2BA 1AHRA 1NSHA 1PVBA 4DUQA 2JPOA 3NSIA 1C3ZA 1DGUA 2M7NA 3GK4X 2JQ6A 3O2PA 3HCMA 1AUIB 2NXQA 5HLVA 4E68A 3D0YA 2KYCA 2QPTA 1J7RA 2HQ8A 2LLUA 1KSOA 1NCXA 1SR6C 2FCEA 5F6TA 1K96A 4GBAA 1IQ3A 1SCVA 2JNFA 4JQ0D 1QV1A 2KI6C 3CR5X 1TOPA 1E8AA 2PRUA 1NX2A 1B9AA 2L50A 3PATA 1Y1AA 2LLSA 3NHTA 3AAKA 1Z2CB 1DJXA 1SW8A 1YRTB 1B8LA 1C7VA 1PULA 2L5XB 3O6BA 4YBHB 1DVIA 1QLKA 3B6XA 3O4YA 1ODBA 1M31A 2ZRSA 2QACA 2F33A 2M9GA 1CLBA 2M8UA 2WCLA 4OZDA 5KSZA 2BCXA 3SIAA 4M2QA 1G4YR 2V53A 3VRQA 1XVJA 3FS7A 4CLNA 3V2LA 3CWGA 5I2QA 1JC2A 3D0YB 1FPWA 1YUUA 1ZOTB 2CBLA 1XFZO 1SCMB 2KOTA 1CNPA 1KK7Z 3MSEB 1V1FA 1WY9A 4BY4A 1QVIY 3ZWHA 2JPTA 4MN0A
chains in the Genus database with same CATH topology
3AKBA 4OV2A 1IG5A 1WRLA 4GGNA 1TCOB 1FI6A 1LVCD 1YVLA 1CM1A 4P2YB 2MAZA 2BL0C 1ZMZA 2L98A 1HQVA 1C07A 4CIDA 3VGOA 3FWCA 1SR6B 3PM8A 5I8NA 1ALVA 1S1EA 3I5IB 3NSLA 2K2FA 1CMFA 2K61A 2ZN8A 2HF5A 1LXFC 2GGZA 4NDDA 4YGCB 2LMTA 2A4JA 4XJKA 5J3XA 3O78A 2ZKMX 2JU0A 2I2RE 2WCEA 1HT9A 2VRGA 1J1DA 2E30A 2FOTA 1TN4A 1J7QA 4Q04A 3TDUA 2KFHA 1CDPA 3BUNB 3I5GC 2K8MB 3RM1A 5BPJA 1NPQA 2IS9A 1TNWA 1CKKA 1OSAA 1M46A 3EK4A 2PALA 1MR8A 4NDCA 1NYAA 1K94A 1SKTA 1A75A 5KTYA 1S6CA 2BBMA 3F45A 4F0ZB 4MRYA 4WRIA 2EGDA 2K7DA 3NSKA 1KK8B 1SY9A 2BCAA 2M1KB 4GFTA 4M2PA 4M2OA 5G08A 5K89A 2CXJA 2JT8A 3BOWA 4XJKB 3WNXB 2F3YA 2L51A 5ER5A 4A4CA 3SG6A 4PHKA 3EKJA 2I18A 3JVTB 1A29A 4DCKA 5CPVA 1YX8A 1TNQA 4MZKA 4YRUA 3LK0A 1QIVA 1DJHA 1AJ4A 4PHNA 1M45A 1KFXS 2O60A 3PFVA 1K9UA 1FF1A 1IRJA 2L4IA 1A75B 2LVJA 1QX5B 1L2OB 1B7TY 1YTZC 4N1GA 3TS5C 3I5FC 3EVRA 1DJZA 1EL4A 2PSRA 1OMVA 1GGZA 2EC6C 1SL8A 1Y1UA 2OPOA 1F4OA 3BOWB 3PLFB 4I5LB 3I5GB 4C0KA 2JULA 5IBWA 2JNXA 5I2LA 1SK6D 1CLMA 1MUXA 3TDZA 1MXEA 1BR1B 1RTP1 1N65A 3GK1A 2PMYA 3CS1A 4PE4A 5DKNA 3FIAA 2BKIB 2TN4A 1X02A 1KFUS 5HLOA 1JWDA 5DKQA 1SRAA 2CTNA 4FTGA 3EVUA 5HKWA 1TIZA 4YI8A 4ZCUA 4MZLA 3DVKA 2F8PA 2JRFA 2WNDA 1KSMA 1XFVO 2ZNDA 3VROA 1F70A 5D69A 3RLZA 1J7OA 1BU3A 1YRUB 1XYDA 1J1EA 4UPGA 1R2UA 1CMGA 1U5IA 1F8HA 1PSRA 4ORCB 1WDCC 4D1EA 5AFPA 3TS5B 1CFFA 1N0YA 1LKJA 1BODA 1RECA 2KI6D 1DTLA 1IQ5A 2Y4QA 3I5HC 1CFCA 1W7JB 2ISDA 2EC6B 3WHTB 2JTTA 1EXRA 2BCBA 1TNPA 1V1GA 4C0LA 4ETOA 1LA0A 4GGFC 1EH2A 4ICBA 1J55A 1VRKA 2KGBC 2F2PA 3TZ1A 4N1FA 4NQGA 2E6WA 2LLTA 3IF7A 3LL8B 1CLLA 1K90D 4WQ3A 2JXCA 2WCBA 2F2OA 2MRDA 2EHBA 1U5IB 1QXPA 3K21A 1YURA 2KQYA 3OB2B 1WLMA 1PSBA 4HSZA 2KAYA 2MLFC 4GGFA 1BOCA 1CDMA 2H2KA 3PN7C 3TUYC 1CDNA 1B4CA 1KCYA 3OHMB 3PALA 4OVNF 3KO0A 2M29A 2M97A 1MQ1A 1YUSA 4PE7A 5CSFA 3CR4X 4HRHA 2LCPA 4ORAB 3SG2A 2D8NA 2K0JA 2FCDA 5HYDA 1XK4C 2LUXA 1AVSA 2Y1NA 2OTGC 1KFXL 4DIRA 1WDCB 4OCIA 1CTRA 1GJYA 3PSRA 1FI5A 1JF0A 1D1OA 3I5HB 1Q80A 3EKHA 1PVAA 4MLWA 1S3PA 2MLEC 2M49B 4PHJA 5TNCA 2LHLA 1QS7A 1L7ZA 1JUOA 1R6PA 2CCMA 2LP2A 1S6IA 3OB1B 2JT3A 4GNKB 1KK7Y 3BUOB 3SIBA 3VRNA 1H8BA 2L4HA 4DRWA 1DF0A 1QATA 4A4BA 2BECA 2BBNA 1G33A 1S36A 2LVVA 1H4BA 1K2HA 1S5GZ 2JTZA 2AAOA 1CB1A 2NLNA 2BL0B 1K93D 2LMVA 1DGVA 2M7LA 5AERA 1BF5A 4PHMA 1NCZA 3KEVA 1DJWA 4OR9B 3PN7B 1FW4A 2LVIA 3QRXA 4P5OE 3TUYB 4MVFA 2H61C 1BLQA 1A03A 4YGEB 3JTDC 3DVJA 5DKRA 1OMRA 5B8IB 5FYXA 1MXLC 1QX7A 1OMDA 4MRXA 1BT6A 1NWDA 1WRKA 3WHUB 4PE1A 4HRGA 2KGRA 2OTGB 3OP0A 4MSPA 1DF0B 3CTNA 2GV5A 2MBXA 1UHIA 5HKYA 1XFUO 1SL9A 3OX6A 1RROA 1Y1XA 2ZNEA 4BY5A 4CFQA 1BR4B 1F55A 1S6JA 4CPVA 1DMOA 2JWWA 2KHNA 4HREE 1F4QA 1YR5A 3D10A 1UP5A 1JBAA 1GGWA 4JPZB 2L2EA 2Q91A 1CDLA 2HETA 2LVKA 3BUWB 3NSOA 2COLB 4MBEA 4USLA 3DVMA 4YI9A 1IH0A 2JC2A 3SJSA 2WOSA 2Y1MA 1QX2A 3SG7A 1ZACA 2HPSA 1J7PA 4QJ5B 3H4SE 4QJ3B 1K95A 2O5GA 3BQ3A 1KQMC 2KAVA 4PCWA 3EK8A 1NUBA 1SCMC 1XFYO 2ZFDA 3NXAA 5CSNA 1OOJA 2I94A 2M3WA 1UHNA 1OZOA 1RJVA 1UURA 1QVIZ 1CFPA 1XO5A 3SG3A 2M1UA 1G8IA 3ICBA 2NCPA 3JTDB 3CR2A 1LA3A 5CSIA 2JT0A 2B1UA 2KAXA 1RFJA 2M0RA 3I5FB 2SCPA 4XYNA 1EG4A 1F54A 1B8RA 2K7CA 2AMIA 4MZJA 1NX0A 1DJIA 1SMGA 1YVHA 4C0JA 3A8RA 1YUTA 1OE9B 5I2OA 2BE6A 3BYAA 1UHHA 5GQQC 1AK8A 1TNXA 4U8DA 1NX3A 2WORA 3DF0A 3I5IC 1AJ5A 2KNEA 5D7FA 2WC8A 2MHHA 3GK2A 3BUXB 2DOQA 1UWOA 1F71A 3EK7A 1UUSA 2SASA 1BMOA 1K9KA 4I5JA 2R2IA 1PRWA 3SG4A 1QV0A 3LCPC 5KU1A 4DS7A 2K2AA 2LAPA 1C7WA 1NP8A 2LMUA 1RWYA 4I5NB 1XFWO 1A2XA 1BJFA 3BXKA 1M39A 3WXAA 1IWQA 4AQJA 1JSAA 1QASA 1IJ5A 1WRZA 4GUKA 4CFRA 2LC5A 5ER4X 4GAOA 3CLNA 2Y5IA 2AUCA 1UHJA 1B1GA 1KQMB 1CFDA 1NX1A 1A4PA 2F3ZA 2G9BA 2JOJA 2L0PA 5PALA 2LM5A 1KK8C 3DF0B 2KFFA 1IGVA 1QIWA 1YX7A 4IL1A 2KI4C 3LLEA 1ZUZA 2NZ0A 1DT7B 2KDHA 4FQOA 4ZCVA 3SG5A 2LP3A 1MF8B 1EJ3A 3CZTX 3JVTC 2KFGA 3VRRA 2OS8C 2LANA 1CM4A 3BUMB 2KBIA 3FWBA 2I7AA 3DD4A 3GOFA 2HQWA 1XA5A 2ZRTA 4WQ2A 1KQVA 3M0WA 5HKZA 3C1VA 1ALWA 1JFJA 1OZSA 1TCFA 2LHIA 2FJUB 2KBMA 3IQQA 3OX5A 1TTXA 1XK4A 1L2OC 2ZN9A 1B7TZ 1NIWA 2Q4UA 2K7OA 1B8CA 1DJYA 1UHKA 5AXIA 1ZFSA 2KSPA 1QJTA 2LUCA 1K8UA 3DVEA 4PDZA 1S26D 4MEWA 2LNKA 5JOLA 1KFUL 1MHOA 1SPYA 1KWOC 1SNLA 5JJGA 2MJWB 1SL7A 4L9MA 3LK1A 2BKHB 3IQOA 5CSJA 1RK9A 3EVVA 1PALA 3KF9A 4OKHA 1TRFA 4YGDB 3ZNIA 2P6BB 4AOMA 1AP4A 1GQMA 1M63B 2GGMA 2KI4B 1SYMA 3HX4A 4R1EA 5AANA 1JFKA 1B47A 1K9PA 4ORBB 1JF2A 1MWNA 3KPXA 2CT9A 1IKUA 1LINA 2OS8B 2KYFA 1IJ6A 4QJ4B 1OQPA 2H61A 2JZIA 2WCFA 1DJGA 2K7BA 4AQIA 2RGIA 1WLZA 4I5KA 1EG3A 1W7IB 4PE0A 3E3RA 3KHEA 2BE4A 4YGBB 1PK0D 1Y6WA 3CGAA 2MA2A 4JWQA 2JXLA 3TDIA 4NDBA 1FBVA 1S5GY 2PASA 3A4UB 1QTXA 2CNPA 1N2DA 1NCYA 1BG1A 2KQ6A 1KWOB 3AAJA 3AKAA 2NCOA 4TNCA 1XFXO 4GPLB 1QLSA 1Y0VH 4YGAA 2PVBA 5AEQA 2LV7A 3VRPA 2LE9B 1SBJA 4PALA 4N5XA 2G2BA 1AHRA 1NSHA 1PVBA 4DUQA 3NSIA 1DGUA 2M7NA 3GK4X 2JQ6A 3O2PA 3HCMA 1AUIB 2NXQA 5HLVA 4E68A 3D0YA 2KYCA 2QPTA 1J7RA 2HQ8A 2LLUA 1KSOA 1NCXA 1SR6C 2FCEA 5F6TA 1K96A 4GBAA 1IQ3A 1SCVA 2JNFA 4JQ0D 1QV1A 2KI6C 3CR5X 1TOPA 1E8AA 2PRUA 1NX2A 1B9AA 2L50A 3PATA 1Y1AA 2LLSA 3AAKA 1DJXA 1SW8A 1YRTB 1B8LA 1C7VA 1PULA 2L5XB 3O6BA 4YBHB 1DVIA 1QLKA 3O4YA 1ODBA 1M31A 2ZRSA 2QACA 2F33A 2M9GA 1CLBA 2M8UA 5KSZA 2BCXA 3SIAA 4M2QA 1G4YR 2V53A 3VRQA 1XVJA 3FS7A 4CLNA 3CWGA 5I2QA 1JC2A 3D0YB 1FPWA 1YUUA 1ZOTB 2CBLA 1SCMB 1XFZO 2KOTA 1CNPA 1KK7Z 3MSEB 1V1FA 1WY9A 4BY4A 1QVIY 3ZWHA 2JPTA 4MN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKB A;  4OV2 A;  1IG5 A;  1WRL A;  4GGN A;  1TCO B;  1FI6 A;  1LVC D;  1YVL A;  1CM1 A;  4P2Y B;  2MAZ A;  2BL0 C;  1ZMZ A;  2L98 A;  1HQV A;  1C07 A;  4CID A;  3VGO A;  3FWC A;  1SR6 B;  3PM8 A;  5I8N A;  1ALV A;  1S1E A;  3I5I B;  3NSL A;  2K2F A;  1CMF A;  2K61 A;  2ZN8 A;  2HF5 A;  1LXF C;  2GGZ A;  4NDD A;  4YGC B;  2LMT A;  2A4J A;  4XJK A;  5J3X A;  3O78 A;  2ZKM X;  2JU0 A;  2I2R E;  2WCE A;  1HT9 A;  2VRG A;  1J1D A;  2E30 A;  2FOT A;  1TN4 A;  1J7Q A;  4Q04 A;  3TDU A;  2KFH A;  1CDP A;  3BUN B;  3I5G C;  2K8M B;  3RM1 A;  5BPJ A;  1NPQ A;  2IS9 A;  1TNW A;  1CKK A;  1OSA A;  1M46 A;  3EK4 A;  2PAL A;  1MR8 A;  4NDC A;  1NYA A;  1K94 A;  1SKT A;  1A75 A;  5KTY A;  1S6C A;  2BBM A;  3F45 A;  4F0Z B;  4MRY A;  4WRI A;  2EGD A;  2K7D A;  3NSK A;  1KK8 B;  1SY9 A;  2BCA A;  2M1K B;  4GFT A;  4M2P A;  4M2O A;  5G08 A;  5K89 A;  2CXJ A;  2JT8 A;  3BOW A;  4XJK B;  3WNX B;  2F3Y A;  2L51 A;  5ER5 A;  4A4C A;  3SG6 A;  4PHK A;  3EKJ A;  2I18 A;  3JVT B;  1A29 A;  4DCK A;  5CPV A;  1YX8 A;  1TNQ A;  4MZK A;  4YRU A;  3LK0 A;  1QIV A;  1DJH A;  1AJ4 A;  4PHN A;  1M45 A;  1KFX S;  2O60 A;  3PFV A;  1K9U A;  1FF1 A;  1IRJ A;  2L4I A;  1A75 B;  2LVJ A;  1QX5 B;  1L2O B;  1B7T Y;  1YTZ C;  4N1G A;  3TS5 C;  3I5F C;  3EVR A;  1DJZ A;  1EL4 A;  2PSR A;  1OMV A;  1GGZ A;  2EC6 C;  1SL8 A;  1Y1U A;  2OPO A;  1F4O A;  3BOW B;  3PLF B;  4I5L B;  3I5G B;  4C0K A;  2JUL A;  5IBW A;  2JNX A;  5I2L A;  1SK6 D;  1CLM A;  1MUX A;  3TDZ A;  1MXE A;  1BR1 B;  1RTP 1;  1N65 A;  3GK1 A;  2PMY A;  3CS1 A;  4PE4 A;  5DKN A;  3FIA A;  2BKI B;  2TN4 A;  1X02 A;  1KFU S;  5HLO A;  1JWD A;  5DKQ A;  1SRA A;  2CTN A;  4FTG A;  3EVU A;  5HKW A;  1TIZ A;  4YI8 A;  4ZCU A;  4MZL A;  3DVK A;  2F8P A;  2JRF A;  2WND A;  1KSM A;  1XFV O;  2ZND A;  3VRO A;  1F70 A;  5D69 A;  3RLZ A;  1J7O A;  1BU3 A;  1YRU B;  1XYD A;  1J1E A;  4UPG A;  1R2U A;  1CMG A;  1U5I A;  1F8H A;  1PSR A;  4ORC B;  1WDC C;  4D1E A;  5AFP A;  3TS5 B;  1CFF A;  1N0Y A;  1LKJ A;  1BOD A;  1REC A;  2KI6 D;  1DTL A;  1IQ5 A;  2Y4Q A;  3I5H C;  1CFC A;  1W7J B;  2ISD A;  2EC6 B;  3WHT B;  2JTT A;  1EXR A;  2BCB A;  1TNP A;  1V1G A;  4C0L A;  4ETO A;  1LA0 A;  4GGF C;  1EH2 A;  4ICB A;  1J55 A;  1VRK A;  2KGB C;  2F2P A;  3TZ1 A;  4N1F A;  4NQG A;  2E6W A;  2LLT A;  3IF7 A;  3LL8 B;  1CLL A;  1K90 D;  4WQ3 A;  2JXC A;  2WCB A;  2F2O A;  2MRD A;  2EHB A;  1U5I B;  1QXP A;  3K21 A;  1YUR A;  2KQY A;  3OB2 B;  1WLM A;  1PSB A;  4HSZ A;  2KAY A;  2MLF C;  4GGF A;  1BOC A;  1CDM A;  2H2K A;  3PN7 C;  3TUY C;  1CDN A;  1B4C A;  1KCY A;  3OHM B;  3PAL A;  4OVN F;  3KO0 A;  2M29 A;  2M97 A;  1MQ1 A;  1YUS A;  4PE7 A;  5CSF A;  3CR4 X;  4HRH A;  2LCP A;  4ORA B;  3SG2 A;  2D8N A;  2K0J A;  2FCD A;  5HYD A;  1XK4 C;  2LUX A;  1AVS A;  2Y1N A;  2OTG C;  1KFX L;  4DIR A;  1WDC B;  4OCI A;  1CTR A;  1GJY A;  3PSR A;  1FI5 A;  1JF0 A;  1D1O A;  3I5H B;  1Q80 A;  3EKH A;  1PVA A;  4MLW A;  1S3P A;  2MLE C;  2M49 B;  4PHJ A;  5TNC A;  2LHL A;  1QS7 A;  1L7Z A;  1JUO A;  1R6P A;  2CCM A;  2LP2 A;  1S6I A;  3OB1 B;  2JT3 A;  4GNK B;  1KK7 Y;  3BUO B;  3SIB A;  3VRN A;  1H8B A;  2L4H A;  4DRW A;  1DF0 A;  1QAT A;  4A4B A;  2BEC A;  2BBN A;  1G33 A;  1S36 A;  2LVV A;  1H4B A;  1K2H A;  1S5G Z;  2JTZ A;  2AAO A;  1CB1 A;  2NLN A;  2BL0 B;  1K93 D;  2LMV A;  1DGV A;  2M7L A;  5AER A;  1BF5 A;  4PHM A;  1NCZ A;  3KEV A;  1DJW A;  4OR9 B;  3PN7 B;  1FW4 A;  2LVI A;  3QRX A;  4P5O E;  3TUY B;  4MVF A;  2H61 C;  1BLQ A;  1A03 A;  4YGE B;  3JTD C;  3DVJ A;  5DKR A;  1OMR A;  5B8I B;  5FYX A;  1MXL C;  1QX7 A;  1OMD A;  4MRX A;  1BT6 A;  1NWD A;  1WRK A;  3WHU B;  4PE1 A;  4HRG A;  2KGR A;  2OTG B;  3OP0 A;  4MSP A;  1DF0 B;  3CTN A;  2GV5 A;  2MBX A;  1UHI A;  5HKY A;  1XFU O;  1SL9 A;  3OX6 A;  1RRO A;  1Y1X A;  2ZNE A;  4BY5 A;  4CFQ A;  1BR4 B;  1F55 A;  1S6J A;  4CPV A;  1DMO A;  2JWW A;  2KHN A;  4HRE E;  1F4Q A;  1YR5 A;  3D10 A;  1UP5 A;  1JBA A;  1GGW A;  4JPZ B;  2L2E A;  2Q91 A;  1CDL A;  2HET A;  2LVK A;  3BUW B;  3NSO A;  2COL B;  4MBE A;  4USL A;  3DVM A;  4YI9 A;  1IH0 A;  2JC2 A;  3SJS A;  2WOS A;  2Y1M A;  1QX2 A;  3SG7 A;  1ZAC A;  2HPS A;  1J7P A;  4QJ5 B;  3H4S E;  4QJ3 B;  1K95 A;  2O5G A;  3BQ3 A;  1KQM C;  2KAV A;  4PCW A;  3EK8 A;  1NUB A;  1SCM C;  1XFY O;  2ZFD A;  3NXA A;  5CSN A;  1OOJ A;  2I94 A;  2M3W A;  1UHN A;  1OZO A;  1RJV A;  1UUR A;  1QVI Z;  1CFP A;  1XO5 A;  3SG3 A;  2M1U A;  1G8I A;  3ICB A;  2NCP A;  3JTD B;  3CR2 A;  1LA3 A;  5CSI A;  2JT0 A;  2B1U A;  2KAX A;  1RFJ A;  2M0R A;  3I5F B;  2SCP A;  4XYN A;  1EG4 A;  1F54 A;  1B8R A;  2K7C A;  2AMI A;  4MZJ A;  1NX0 A;  1DJI A;  1SMG A;  1YVH A;  4C0J A;  3A8R A;  1YUT A;  1OE9 B;  5I2O A;  2BE6 A;  3BYA A;  1UHH A;  5GQQ C;  1AK8 A;  1TNX A;  4U8D A;  1NX3 A;  2WOR A;  3DF0 A;  3I5I C;  1AJ5 A;  2KNE A;  5D7F A;  2WC8 A;  2MHH A;  3GK2 A;  3BUX B;  2DOQ A;  1UWO A;  1F71 A;  3EK7 A;  1UUS A;  2SAS A;  1BMO A;  1K9K A;  4I5J A;  2R2I A;  1PRW A;  3SG4 A;  1QV0 A;  3LCP C;  5KU1 A;  4DS7 A;  2K2A A;  2LAP A;  1C7W A;  1NP8 A;  2LMU A;  1RWY A;  4I5N B;  1XFW O;  1A2X A;  1BJF A;  3BXK A;  1M39 A;  3WXA A;  1IWQ A;  4AQJ A;  1JSA A;  1QAS A;  1IJ5 A;  1WRZ A;  4GUK A;  4CFR A;  2LC5 A;  5ER4 X;  4GAO A;  3CLN A;  2Y5I A;  2AUC A;  1UHJ A;  1B1G A;  1KQM B;  1CFD A;  1NX1 A;  1A4P A;  2F3Z A;  2G9B A;  2JOJ A;  2L0P A;  5PAL A;  2LM5 A;  1KK8 C;  3DF0 B;  2KFF A;  1IGV A;  1QIW A;  1YX7 A;  4IL1 A;  2KI4 C;  3LLE A;  1ZUZ A;  2NZ0 A;  1DT7 B;  2KDH A;  4FQO A;  4ZCV A;  3SG5 A;  2LP3 A;  1MF8 B;  1EJ3 A;  3CZT X;  3JVT C;  2KFG A;  3VRR A;  2OS8 C;  2LAN A;  1CM4 A;  3BUM B;  2KBI A;  3FWB A;  2I7A A;  3DD4 A;  3GOF A;  2HQW A;  1XA5 A;  2ZRT A;  4WQ2 A;  1KQV A;  3M0W A;  5HKZ A;  3C1V A;  1ALW A;  1JFJ A;  1OZS A;  1TCF A;  2LHI A;  2FJU B;  2KBM A;  3IQQ A;  3OX5 A;  1TTX A;  1XK4 A;  1L2O C;  2ZN9 A;  1B7T Z;  1NIW A;  2Q4U A;  2K7O A;  1B8C A;  1DJY A;  1UHK A;  5AXI A;  1ZFS A;  2KSP A;  1QJT A;  2LUC A;  1K8U A;  3DVE A;  4PDZ A;  1S26 D;  4MEW A;  2LNK A;  5JOL A;  1KFU L;  1MHO A;  1SPY A;  1KWO C;  1SNL A;  5JJG A;  2MJW B;  1SL7 A;  4L9M A;  3LK1 A;  2BKH B;  3IQO A;  5CSJ A;  1RK9 A;  3EVV A;  1PAL A;  3KF9 A;  4OKH A;  1TRF A;  4YGD B;  3ZNI A;  2P6B B;  4AOM A;  1AP4 A;  1GQM A;  1M63 B;  2GGM A;  2KI4 B;  1SYM A;  3HX4 A;  4R1E A;  5AAN A;  1JFK A;  1B47 A;  1K9P A;  4ORB B;  1JF2 A;  1MWN A;  3KPX A;  2CT9 A;  1IKU A;  1LIN A;  2OS8 B;  2KYF A;  1IJ6 A;  4QJ4 B;  1OQP A;  2H61 A;  2JZI A;  2WCF A;  1DJG A;  2K7B A;  4AQI A;  2RGI A;  1WLZ A;  4I5K A;  1EG3 A;  1W7I B;  4PE0 A;  3E3R A;  3KHE A;  2BE4 A;  4YGB B;  1PK0 D;  1Y6W A;  3CGA A;  2MA2 A;  4JWQ A;  2JXL A;  3TDI A;  4NDB A;  1FBV A;  1S5G Y;  2PAS A;  3A4U B;  1QTX A;  2CNP A;  1N2D A;  1NCY A;  1BG1 A;  2KQ6 A;  1KWO B;  3AAJ A;  3AKA A;  2NCO A;  4TNC A;  1XFX O;  4GPL B;  1QLS A;  1Y0V H;  4YGA A;  2PVB A;  5AEQ A;  2LV7 A;  3VRP A;  2LE9 B;  1SBJ A;  4PAL A;  4N5X A;  2G2B A;  1AHR A;  1NSH A;  1PVB A;  4DUQ A;  3NSI A;  1DGU A;  2M7N A;  3GK4 X;  2JQ6 A;  3O2P A;  3HCM A;  1AUI B;  2NXQ A;  5HLV A;  4E68 A;  3D0Y A;  2KYC A;  2QPT A;  1J7R A;  2HQ8 A;  2LLU A;  1KSO A;  1NCX A;  1SR6 C;  2FCE A;  5F6T A;  1K96 A;  4GBA A;  1IQ3 A;  1SCV A;  2JNF A;  4JQ0 D;  1QV1 A;  2KI6 C;  3CR5 X;  1TOP A;  1E8A A;  2PRU A;  1NX2 A;  1B9A A;  2L50 A;  3PAT A;  1Y1A A;  2LLS A;  3AAK A;  1DJX A;  1SW8 A;  1YRT B;  1B8L A;  1C7V A;  1PUL A;  2L5X B;  3O6B A;  4YBH B;  1DVI A;  1QLK A;  3O4Y A;  1ODB A;  1M31 A;  2ZRS A;  2QAC A;  2F33 A;  2M9G A;  1CLB A;  2M8U A;  5KSZ A;  2BCX A;  3SIA A;  4M2Q A;  1G4Y R;  2V53 A;  3VRQ A;  1XVJ A;  3FS7 A;  4CLN A;  3CWG A;  5I2Q A;  1JC2 A;  3D0Y B;  1FPW A;  1YUU A;  1ZOT B;  2CBL A;  1SCM B;  1XFZ O;  2KOT A;  1CNP A;  1KK7 Z;  3MSE B;  1V1F A;  1WY9 A;  4BY4 A;  1QVI Y;  3ZWH A;  2JPT A;  4MN0 A; 
#chains in the Genus database with same CATH topology
 3AKB A;  4OV2 A;  1IG5 A;  1WRL A;  4GGN A;  1TCO B;  1FI6 A;  1LVC D;  1YVL A;  3B88 A;  1CM1 A;  4P2Y B;  2MAZ A;  2BL0 C;  1ZMZ A;  2L98 A;  1HQV A;  1C07 A;  4CID A;  3VGO A;  3FWC A;  1SR6 B;  3PM8 A;  5I8N A;  1ALV A;  1S1E A;  3I5I B;  3NSL A;  2K2F A;  1CMF A;  2K61 A;  2ZN8 A;  3DYE A;  2HF5 A;  1LXF C;  2GGZ A;  4NDD A;  4YGC B;  1TWO A;  2LMT A;  2A4J A;  1IIO A;  4XJK A;  2FJY A;  5J3X A;  3O78 A;  2ZKM X;  2JU0 A;  1DQE A;  1GM0 A;  3R72 A;  2I2R E;  2WCE A;  1HT9 A;  2VRG A;  1J1D A;  3UO9 A;  2E30 A;  2FOT A;  1TN4 A;  1J7Q A;  4Q04 A;  3TDU A;  2KFH A;  1CDP A;  3BUN B;  3I5G C;  2K8M B;  3RM1 A;  5BPJ A;  1NPQ A;  2IS9 A;  1TNW A;  1CKK A;  1OSA A;  1M46 A;  3BFB A;  3CDN A;  3EK4 A;  2PAL A;  1MR8 A;  4NDC A;  1NYA A;  1K94 A;  1SKT A;  1A75 A;  5KTY A;  1S6C A;  3D76 A;  2BBM A;  3Q8I A;  3F45 A;  4F0Z B;  4MRY A;  4WRI A;  2EGD A;  2K7D A;  3NSK A;  1KK8 B;  1SY9 A;  2BCA A;  2M1K B;  4GFT A;  4M2P A;  4M2O A;  5G08 A;  2BNX A;  5K89 A;  2CXJ A;  2JT8 A;  3BOW A;  4XJK B;  3WNX B;  1OOI X;  2F3Y A;  2L51 A;  5ER5 A;  4A4C A;  3SG6 A;  4PHK A;  3EKJ A;  2I18 A;  3JVT B;  1A29 A;  1DC1 A;  3SS3 A;  5DIC A;  3SS5 A;  4DCK A;  5CPV A;  1ORG A;  1YX8 A;  1TNQ A;  4MZK A;  4YRU A;  3LK0 A;  1QIV A;  1DJH A;  1AJ4 A;  2GTE A;  4PHN A;  1M45 A;  1KFX S;  2O60 A;  3PFV A;  1K9U A;  1FF1 A;  1IRJ A;  2L4I A;  1A75 B;  2LVJ A;  1QX5 B;  1L2O B;  1B7T Y;  1YTZ C;  4N1G A;  4IJ7 A;  3TS5 C;  3D75 A;  3I5F C;  3EVR A;  1DJZ A;  1EL4 A;  2PSR A;  1OMV A;  1GGZ A;  2EC6 C;  1SL8 A;  1Y1U A;  2OPO A;  1F4O A;  3BOW B;  2QEO A;  3PLF B;  4I5L B;  3I5G B;  4C0K A;  2JUL A;  5IBW A;  2JNX A;  3S0E A;  3K1E A;  1SK6 D;  5I2L A;  1CLM A;  1MUX A;  2H8V A;  3TDZ A;  1MXE A;  1BR1 B;  1RTP 1;  1N65 A;  3D74 A;  2PMY A;  3CS1 A;  3GK1 A;  4PE4 A;  5DKN A;  2KLE A;  2BKI B;  3FIA A;  2TN4 A;  1X02 A;  1KFU S;  5HLO A;  1JWD A;  5DKQ A;  1SRA A;  2CTN A;  3S0A A;  4FTG A;  3EVU A;  5HKW A;  1TIZ A;  4YI8 A;  4ZCU A;  4MZL A;  3DVK A;  2F8P A;  2JRF A;  2WND A;  1KSM A;  3EG5 B;  1XFV O;  2ZND A;  2QDI A;  3VRO A;  1T14 A;  1F70 A;  5D69 A;  1SSE B;  3RLZ A;  1J7O A;  1BU3 A;  1YRU B;  1XYD A;  1J1E A;  4UPG A;  1R2U A;  3R1P A;  1CMG A;  1U5I A;  1F8H A;  1PSR A;  3D77 A;  4ORC B;  1WDC C;  4D1E A;  5AFP A;  3TS5 B;  1CFF A;  1N0Y A;  5I94 A;  1LKJ A;  1BOD A;  1REC A;  2KI6 D;  1DTL A;  1IQ5 A;  2Y4Q A;  3I5H C;  1CFC A;  1W7J B;  3FE8 A;  5HL1 A;  3CAB A;  2EC6 B;  2ISD A;  3D78 A;  3WHT B;  2JTT A;  4JD9 A;  1EXR A;  2BCB A;  1TNP A;  1V1G A;  4C0L A;  4ETO A;  1LA0 A;  4GGF C;  5D3O A;  3CZ1 A;  1EH2 A;  4ICB A;  1J55 A;  1VRK A;  2KGB C;  2F2P A;  3TZ1 A;  4N1F A;  4NQG A;  2E6W A;  2LLT A;  2QEH A;  3IF7 A;  3LL8 B;  1CLL A;  1K90 D;  4WQ3 A;  2JXC A;  2WCB A;  2F2O A;  2MRD A;  2EHB A;  1U5I B;  1QXP A;  3K21 A;  4JKT A;  1YUR A;  2KQY A;  3OB2 B;  2YGU A;  1WLM A;  1PSB A;  4HSZ A;  5FI6 A;  2KAY A;  2MLF C;  4GGF A;  1BOC A;  1CDM A;  2H2K A;  3PN7 C;  3L47 A;  3TUY C;  1CDN A;  1B4C A;  2QEB A;  1KCY A;  3OHM B;  3PAL A;  4OVN F;  3KO0 A;  2M29 A;  2M97 A;  1MQ1 A;  1YUS A;  4PE7 A;  5CSF A;  3CR4 X;  4HRH A;  2LCP A;  4ORA B;  3SG2 A;  2D8N A;  1OOH A;  2FCD A;  2K0J A;  3D73 A;  5HYD A;  1XK4 C;  2LUX A;  1AVS A;  2Y1N A;  2OTG C;  1KFX L;  4DIR A;  1WDC B;  4OCI A;  1CTR A;  2WC6 A;  1GJY A;  3PSR A;  1FI5 A;  1JF0 A;  1D1O A;  3I5H B;  1Q80 A;  3EKH A;  3RZS A;  1PVA A;  4MLW A;  1S3P A;  1TUJ A;  2MLE C;  2M49 B;  4PHJ A;  5TNC A;  2LHL A;  1QS7 A;  4FQT A;  1L7Z A;  1JUO A;  1R6P A;  2CCM A;  2LP2 A;  1S6I A;  3OB1 B;  3CZ2 A;  2JT3 A;  2KPH A;  4GNK B;  1KK7 Y;  2L5Y A;  3BUO B;  3NGV A;  3SIB A;  3VRN A;  1H8B A;  2L4H A;  4DRW A;  1DF0 A;  1QAT A;  4A4B A;  2BEC A;  2BBN A;  1G33 A;  1S36 A;  2LVV A;  1H4B A;  1K2H A;  1S5G Z;  2JTZ A;  2AAO A;  1CB1 A;  2NLN A;  2BL0 B;  1K93 D;  2LMV A;  1DGV A;  2K60 A;  3S0F A;  2M7L A;  5AER A;  2BAP A;  1BF5 A;  4PHM A;  1NCZ A;  3KEV A;  1DJW A;  4OR9 B;  3PN7 B;  1FW4 A;  2LVI A;  3QRX A;  4P5O E;  3TUY B;  2P71 A;  3CYZ A;  4INW A;  4MVF A;  2H61 C;  1BLQ A;  3R1V A;  1A03 A;  4YGE B;  1Z4H A;  3JTD C;  3DVJ A;  5DKR A;  1OMR A;  4INX A;  5FYX A;  1MXL C;  1QX7 A;  1OMD A;  5B8I B;  4MRX A;  1BT6 A;  1NWD A;  1WRK A;  3DXL A;  3WHU B;  4PE1 A;  4HRG A;  2KGR A;  2OTG B;  3OP0 A;  4MSP A;  1DF0 B;  3O4X A;  3CTN A;  1XFR A;  2GV5 A;  2MBX A;  1UHI A;  5HKY A;  1XFU O;  1SL9 A;  1OOG A;  3OX6 A;  1RRO A;  1Y1X A;  2ZNE A;  3FE6 A;  4BY5 A;  1BR4 B;  4CFQ A;  1S6J A;  3S0B A;  1F55 A;  4CPV A;  1DMO A;  2JWW A;  2KHN A;  4HRE E;  3SS4 A;  1F4Q A;  1YR5 A;  3D10 A;  1UP5 A;  1JBA A;  1GGW A;  4JPZ B;  2L2E A;  2Q91 A;  1CDL A;  2HET A;  2LVK A;  3BUW B;  3FE9 A;  2COL B;  3NSO A;  4MBE A;  3DVM A;  4USL A;  1IH0 A;  3PM2 A;  2JC2 A;  3SJS A;  2WOS A;  2Y1M A;  1QX2 A;  2PYQ A;  1ZAC A;  2HPS A;  3SG7 A;  2QEV A;  1J7P A;  4KYN A;  4QJ5 B;  3H4S E;  4QJ3 B;  1K95 A;  3BFH A;  2O5G A;  3BQ3 A;  1LS8 A;  1KQM C;  2KAV A;  4PCW A;  3EK8 A;  1NUB A;  1SCM C;  1XFY O;  2ZFD A;  3B86 A;  3NXA A;  5CSN A;  5EL2 A;  1OOJ A;  2I94 A;  2M3W A;  1UHN A;  1OZO A;  1RJV A;  1UUR A;  1QVI Z;  1CFP A;  1W9Z A;  1XO5 A;  3BFA A;  2M1U A;  1G8I A;  3ICB A;  2NCP A;  3JTD B;  3SG3 A;  3CR2 A;  1LA3 A;  2KLD A;  3IVT A;  5CSI A;  2JT0 A;  2B1U A;  2P70 A;  1C3Y A;  2KAX A;  1RFJ A;  2M0R A;  3I5F B;  2SCP A;  4XYN A;  1EG4 A;  1F54 A;  1B8R A;  2K7C A;  2AMI A;  4MZJ A;  1NX0 A;  3S0G A;  1DJI A;  1SMG A;  1YVH A;  4C0J A;  3R1O A;  3A8R A;  1TUZ A;  1OE9 B;  1YUT A;  2BE6 A;  3BYA A;  3S0D A;  1UHH A;  5I2O A;  5GQQ C;  1AK8 A;  3DY9 A;  1TNX A;  4U8D A;  1NX3 A;  2WOR A;  3DF0 A;  3I5I C;  1AJ5 A;  2KNE A;  5D7F A;  2WC8 A;  3B7A A;  2MHH A;  3GK2 A;  3BUX B;  2DOQ A;  1UWO A;  1F71 A;  3EK7 A;  1UUS A;  2SAS A;  3NHI A;  1BMO A;  1K9K A;  4I5J A;  3UNW A;  2R2I A;  1PRW A;  3SG4 A;  1QV0 A;  3LCP C;  5KU1 A;  4DS7 A;  2K2A A;  2LAP A;  1C7W A;  1NP8 A;  2LMU A;  1RWY A;  3CZ0 A;  4I5N B;  1XFW O;  1A2X A;  1BJF A;  3BXK A;  1M39 A;  3WXA A;  1IWQ A;  2WCM A;  4AQJ A;  1JSA A;  1WRZ A;  1QAS A;  1IJ5 A;  4GUK A;  4CFR A;  2LC5 A;  5ER4 X;  4GAO A;  3CLN A;  2Y5I A;  3L4A A;  2AUC A;  1UHJ A;  1B1G A;  1KQM B;  1CFD A;  1NX1 A;  3QME A;  1A4P A;  2F3Z A;  2G9B A;  2JOJ A;  2L0P A;  5PAL A;  2LM5 A;  1KK8 C;  3B87 A;  3DF0 B;  2KFF A;  1IGV A;  1QIW A;  1YX7 A;  3N7H A;  4IL1 A;  2KI4 C;  3LLE A;  1ZUZ A;  2PQL A;  2NZ0 A;  1DT7 B;  2KDH A;  4FQO A;  4ZCV A;  3SG5 A;  2LP3 A;  1MF8 B;  1EJ3 A;  5FI2 A;  3CZT X;  3JVT C;  2KFG A;  3VRR A;  2OS8 C;  2LAN A;  1CM4 A;  3BUM B;  2KBI A;  3FWB A;  2I7A A;  3DD4 A;  3GOF A;  2HQW A;  1XA5 A;  2ZRT A;  4WQ2 A;  1KQV A;  3M0W A;  5HKZ A;  3C1V A;  1ALW A;  1JFJ A;  1OZS A;  1TCF A;  2LHI A;  2FJU B;  2KBM A;  3IQQ A;  3OX5 A;  1TTX A;  1XK4 A;  5FI7 A;  1P28 A;  1L2O C;  2ERB A;  2ZN9 A;  1B7T Z;  1NIW A;  2Q4U A;  2K7O A;  1B8C A;  1DJY A;  1UHK A;  5AXI A;  1ZFS A;  2KSP A;  1QJT A;  2LUC A;  3VB1 A;  1K8U A;  3DVE A;  4PDZ A;  1S26 D;  4MEW A;  2LNK A;  5JOL A;  1KFU L;  1MHO A;  3OGN A;  1SPY A;  1KWO C;  1SNL A;  2WCJ A;  5JJG A;  1OOF A;  2MJW B;  1SL7 A;  4L9M A;  3LK1 A;  2BKH B;  3IQO A;  1DEL A;  5CSJ A;  1RK9 A;  3EVV A;  1PAL A;  3KF9 A;  4OKH A;  1TRF A;  4YGD B;  3ZNI A;  1OW4 A;  2P6B B;  4AOM A;  1AP4 A;  1GQM A;  1M63 B;  2GGM A;  2KI4 B;  1SYM A;  3HX4 A;  4R1E A;  5AAN A;  1QWV A;  1JFK A;  1B47 A;  1K9P A;  4ORB B;  1JF2 A;  1MWN A;  2L2C A;  3KPX A;  2CT9 A;  1IKU A;  1LIN A;  2OS8 B;  3PJI A;  2KYF A;  1IJ6 A;  4QJ4 B;  4F7F A;  1OQP A;  2H61 A;  2JZI A;  2WCF A;  1DJG A;  2K7B A;  4AQI A;  2RGI A;  1WLZ A;  3BJH A;  2WCH A;  3DZT A;  4I5K A;  1EG3 A;  1W7I B;  4PE0 A;  3E3R A;  3KHE A;  2BE4 A;  4YGB B;  1PK0 D;  1Y6W A;  3CGA A;  2MA2 A;  4JWQ A;  2JXL A;  4PT1 A;  3TDI A;  1DEK A;  3L4L A;  4NDB A;  1FBV A;  1S5G Y;  2PAS A;  3A4U B;  1QTX A;  2CNP A;  1N2D A;  1NCY A;  1BG1 A;  2KQ6 A;  1KWO B;  2WC5 A;  3OBV A;  3AAJ A;  3AKA A;  2NCO A;  4YI9 A;  4TNC A;  1XFX O;  4GPL B;  1QLS A;  1Y0V H;  2WCK A;  4YGA A;  2PVB A;  5AEQ A;  2LV7 A;  3VRP A;  2LE9 B;  1SBJ A;  4PAL A;  4N5X A;  2G2B A;  1AHR A;  1NSH A;  1PVB A;  4DUQ A;  2JPO A;  3NSI A;  1C3Z A;  1DGU A;  2M7N A;  3GK4 X;  2JQ6 A;  3O2P A;  3HCM A;  1AUI B;  2NXQ A;  5HLV A;  4E68 A;  3D0Y A;  2KYC A;  2QPT A;  1J7R A;  2HQ8 A;  2LLU A;  1KSO A;  1NCX A;  1SR6 C;  2FCE A;  5F6T A;  1K96 A;  4GBA A;  1IQ3 A;  1SCV A;  2JNF A;  4JQ0 D;  1QV1 A;  2KI6 C;  3CR5 X;  1TOP A;  1E8A A;  2PRU A;  1NX2 A;  1B9A A;  2L50 A;  3PAT A;  1Y1A A;  2LLS A;  3NHT A;  3AAK A;  1Z2C B;  1DJX A;  1SW8 A;  1YRT B;  1B8L A;  1C7V A;  1PUL A;  2L5X B;  3O6B A;  4YBH B;  1DVI A;  1QLK A;  3B6X A;  3O4Y A;  1ODB A;  1M31 A;  2ZRS A;  2QAC A;  2F33 A;  2M9G A;  1CLB A;  2M8U A;  2WCL A;  4OZD A;  5KSZ A;  2BCX A;  3SIA A;  4M2Q A;  1G4Y R;  2V53 A;  3VRQ A;  1XVJ A;  3FS7 A;  4CLN A;  3V2L A;  3CWG A;  5I2Q A;  1JC2 A;  3D0Y B;  1FPW A;  1YUU A;  1ZOT B;  2CBL A;  1XFZ O;  1SCM B;  2KOT A;  1CNP A;  1KK7 Z;  3MSE B;  1V1F A;  1WY9 A;  4BY4 A;  1QVI Y;  3ZWH A;  2JPT A;  4MN0 A; 
#chains in the Genus database with same CATH homology
 3AKB A;  4OV2 A;  1IG5 A;  1WRL A;  4GGN A;  1TCO B;  1FI6 A;  1LVC D;  1YVL A;  1CM1 A;  4P2Y B;  2MAZ A;  2BL0 C;  1ZMZ A;  2L98 A;  1HQV A;  1C07 A;  4CID A;  3VGO A;  3FWC A;  1SR6 B;  3PM8 A;  5I8N A;  1ALV A;  1S1E A;  3I5I B;  3NSL A;  2K2F A;  1CMF A;  2K61 A;  2ZN8 A;  2HF5 A;  1LXF C;  2GGZ A;  4NDD A;  4YGC B;  2LMT A;  2A4J A;  4XJK A;  5J3X A;  3O78 A;  2ZKM X;  2JU0 A;  2I2R E;  2WCE A;  1HT9 A;  2VRG A;  1J1D A;  2E30 A;  2FOT A;  1TN4 A;  1J7Q A;  4Q04 A;  3TDU A;  2KFH A;  1CDP A;  3BUN B;  3I5G C;  2K8M B;  3RM1 A;  5BPJ A;  1NPQ A;  2IS9 A;  1TNW A;  1CKK A;  1OSA A;  1M46 A;  3EK4 A;  2PAL A;  1MR8 A;  4NDC A;  1NYA A;  1K94 A;  1SKT A;  1A75 A;  5KTY A;  1S6C A;  2BBM A;  3F45 A;  4F0Z B;  4MRY A;  4WRI A;  2EGD A;  2K7D A;  3NSK A;  1KK8 B;  1SY9 A;  2BCA A;  2M1K B;  4GFT A;  4M2P A;  4M2O A;  5G08 A;  5K89 A;  2CXJ A;  2JT8 A;  3BOW A;  4XJK B;  3WNX B;  2F3Y A;  2L51 A;  5ER5 A;  4A4C A;  3SG6 A;  4PHK A;  3EKJ A;  2I18 A;  3JVT B;  1A29 A;  4DCK A;  5CPV A;  1YX8 A;  1TNQ A;  4MZK A;  4YRU A;  3LK0 A;  1QIV A;  1DJH A;  1AJ4 A;  4PHN A;  1M45 A;  1KFX S;  2O60 A;  3PFV A;  1K9U A;  1FF1 A;  1IRJ A;  2L4I A;  1A75 B;  2LVJ A;  1QX5 B;  1L2O B;  1B7T Y;  1YTZ C;  4N1G A;  3TS5 C;  3I5F C;  3EVR A;  1DJZ A;  1EL4 A;  2PSR A;  1OMV A;  1GGZ A;  2EC6 C;  1SL8 A;  1Y1U A;  2OPO A;  1F4O A;  3BOW B;  3PLF B;  4I5L B;  3I5G B;  4C0K A;  2JUL A;  5IBW A;  2JNX A;  5I2L A;  1SK6 D;  1CLM A;  1MUX A;  3TDZ A;  1MXE A;  1BR1 B;  1RTP 1;  1N65 A;  3GK1 A;  2PMY A;  3CS1 A;  4PE4 A;  5DKN A;  3FIA A;  2BKI B;  2TN4 A;  1X02 A;  1KFU S;  5HLO A;  1JWD A;  5DKQ A;  1SRA A;  2CTN A;  4FTG A;  3EVU A;  5HKW A;  1TIZ A;  4YI8 A;  4ZCU A;  4MZL A;  3DVK A;  2F8P A;  2JRF A;  2WND A;  1KSM A;  1XFV O;  2ZND A;  3VRO A;  1F70 A;  5D69 A;  3RLZ A;  1J7O A;  1BU3 A;  1YRU B;  1XYD A;  1J1E A;  4UPG A;  1R2U A;  1CMG A;  1U5I A;  1F8H A;  1PSR A;  4ORC B;  1WDC C;  4D1E A;  5AFP A;  3TS5 B;  1CFF A;  1N0Y A;  1LKJ A;  1BOD A;  1REC A;  2KI6 D;  1DTL A;  1IQ5 A;  2Y4Q A;  3I5H C;  1CFC A;  1W7J B;  2ISD A;  2EC6 B;  3WHT B;  2JTT A;  1EXR A;  2BCB A;  1TNP A;  1V1G A;  4C0L A;  4ETO A;  1LA0 A;  4GGF C;  1EH2 A;  4ICB A;  1J55 A;  1VRK A;  2KGB C;  2F2P A;  3TZ1 A;  4N1F A;  4NQG A;  2E6W A;  2LLT A;  3IF7 A;  3LL8 B;  1CLL A;  1K90 D;  4WQ3 A;  2JXC A;  2WCB A;  2F2O A;  2MRD A;  2EHB A;  1U5I B;  1QXP A;  3K21 A;  1YUR A;  2KQY A;  3OB2 B;  1WLM A;  1PSB A;  4HSZ A;  2KAY A;  2MLF C;  4GGF A;  1BOC A;  1CDM A;  2H2K A;  3PN7 C;  3TUY C;  1CDN A;  1B4C A;  1KCY A;  3OHM B;  3PAL A;  4OVN F;  3KO0 A;  2M29 A;  2M97 A;  1MQ1 A;  1YUS A;  4PE7 A;  5CSF A;  3CR4 X;  4HRH A;  2LCP A;  4ORA B;  3SG2 A;  2D8N A;  2K0J A;  2FCD A;  5HYD A;  1XK4 C;  2LUX A;  1AVS A;  2Y1N A;  2OTG C;  1KFX L;  4DIR A;  1WDC B;  4OCI A;  1CTR A;  1GJY A;  3PSR A;  1FI5 A;  1JF0 A;  1D1O A;  3I5H B;  1Q80 A;  3EKH A;  1PVA A;  4MLW A;  1S3P A;  2MLE C;  2M49 B;  4PHJ A;  5TNC A;  2LHL A;  1QS7 A;  1L7Z A;  1JUO A;  1R6P A;  2CCM A;  2LP2 A;  1S6I A;  3OB1 B;  2JT3 A;  4GNK B;  1KK7 Y;  3BUO B;  3SIB A;  3VRN A;  1H8B A;  2L4H A;  4DRW A;  1DF0 A;  1QAT A;  4A4B A;  2BEC A;  2BBN A;  1G33 A;  1S36 A;  2LVV A;  1H4B A;  1K2H A;  1S5G Z;  2JTZ A;  2AAO A;  1CB1 A;  2NLN A;  2BL0 B;  1K93 D;  2LMV A;  1DGV A;  2M7L A;  5AER A;  1BF5 A;  4PHM A;  1NCZ A;  3KEV A;  1DJW A;  4OR9 B;  3PN7 B;  1FW4 A;  2LVI A;  3QRX A;  4P5O E;  3TUY B;  4MVF A;  2H61 C;  1BLQ A;  1A03 A;  4YGE B;  3JTD C;  3DVJ A;  5DKR A;  1OMR A;  5B8I B;  5FYX A;  1MXL C;  1QX7 A;  1OMD A;  4MRX A;  1BT6 A;  1NWD A;  1WRK A;  3WHU B;  4PE1 A;  4HRG A;  2KGR A;  2OTG B;  3OP0 A;  4MSP A;  1DF0 B;  3CTN A;  2GV5 A;  2MBX A;  1UHI A;  5HKY A;  1XFU O;  1SL9 A;  3OX6 A;  1RRO A;  1Y1X A;  2ZNE A;  4BY5 A;  4CFQ A;  1BR4 B;  1F55 A;  1S6J A;  4CPV A;  1DMO A;  2JWW A;  2KHN A;  4HRE E;  1F4Q A;  1YR5 A;  3D10 A;  1UP5 A;  1JBA A;  1GGW A;  4JPZ B;  2L2E A;  2Q91 A;  1CDL A;  2HET A;  2LVK A;  3BUW B;  3NSO A;  2COL B;  4MBE A;  4USL A;  3DVM A;  4YI9 A;  1IH0 A;  2JC2 A;  3SJS A;  2WOS A;  2Y1M A;  1QX2 A;  3SG7 A;  1ZAC A;  2HPS A;  1J7P A;  4QJ5 B;  3H4S E;  4QJ3 B;  1K95 A;  2O5G A;  3BQ3 A;  1KQM C;  2KAV A;  4PCW A;  3EK8 A;  1NUB A;  1SCM C;  1XFY O;  2ZFD A;  3NXA A;  5CSN A;  1OOJ A;  2I94 A;  2M3W A;  1UHN A;  1OZO A;  1RJV A;  1UUR A;  1QVI Z;  1CFP A;  1XO5 A;  3SG3 A;  2M1U A;  1G8I A;  3ICB A;  2NCP A;  3JTD B;  3CR2 A;  1LA3 A;  5CSI A;  2JT0 A;  2B1U A;  2KAX A;  1RFJ A;  2M0R A;  3I5F B;  2SCP A;  4XYN A;  1EG4 A;  1F54 A;  1B8R A;  2K7C A;  2AMI A;  4MZJ A;  1NX0 A;  1DJI A;  1SMG A;  1YVH A;  4C0J A;  3A8R A;  1YUT A;  1OE9 B;  5I2O A;  2BE6 A;  3BYA A;  1UHH A;  5GQQ C;  1AK8 A;  1TNX A;  4U8D A;  1NX3 A;  2WOR A;  3DF0 A;  3I5I C;  1AJ5 A;  2KNE A;  5D7F A;  2WC8 A;  2MHH A;  3GK2 A;  3BUX B;  2DOQ A;  1UWO A;  1F71 A;  3EK7 A;  1UUS A;  2SAS A;  1BMO A;  1K9K A;  4I5J A;  2R2I A;  1PRW A;  3SG4 A;  1QV0 A;  3LCP C;  5KU1 A;  4DS7 A;  2K2A A;  2LAP A;  1C7W A;  1NP8 A;  2LMU A;  1RWY A;  4I5N B;  1XFW O;  1A2X A;  1BJF A;  3BXK A;  1M39 A;  3WXA A;  1IWQ A;  4AQJ A;  1JSA A;  1QAS A;  1IJ5 A;  1WRZ A;  4GUK A;  4CFR A;  2LC5 A;  5ER4 X;  4GAO A;  3CLN A;  2Y5I A;  2AUC A;  1UHJ A;  1B1G A;  1KQM B;  1CFD A;  1NX1 A;  1A4P A;  2F3Z A;  2G9B A;  2JOJ A;  2L0P A;  5PAL A;  2LM5 A;  1KK8 C;  3DF0 B;  2KFF A;  1IGV A;  1QIW A;  1YX7 A;  4IL1 A;  2KI4 C;  3LLE A;  1ZUZ A;  2NZ0 A;  1DT7 B;  2KDH A;  4FQO A;  4ZCV A;  3SG5 A;  2LP3 A;  1MF8 B;  1EJ3 A;  3CZT X;  3JVT C;  2KFG A;  3VRR A;  2OS8 C;  2LAN A;  1CM4 A;  3BUM B;  2KBI A;  3FWB A;  2I7A A;  3DD4 A;  3GOF A;  2HQW A;  1XA5 A;  2ZRT A;  4WQ2 A;  1KQV A;  3M0W A;  5HKZ A;  3C1V A;  1ALW A;  1JFJ A;  1OZS A;  1TCF A;  2LHI A;  2FJU B;  2KBM A;  3IQQ A;  3OX5 A;  1TTX A;  1XK4 A;  1L2O C;  2ZN9 A;  1B7T Z;  1NIW A;  2Q4U A;  2K7O A;  1B8C A;  1DJY A;  1UHK A;  5AXI A;  1ZFS A;  2KSP A;  1QJT A;  2LUC A;  1K8U A;  3DVE A;  4PDZ A;  1S26 D;  4MEW A;  2LNK A;  5JOL A;  1KFU L;  1MHO A;  1SPY A;  1KWO C;  1SNL A;  5JJG A;  2MJW B;  1SL7 A;  4L9M A;  3LK1 A;  2BKH B;  3IQO A;  5CSJ A;  1RK9 A;  3EVV A;  1PAL A;  3KF9 A;  4OKH A;  1TRF A;  4YGD B;  3ZNI A;  2P6B B;  4AOM A;  1AP4 A;  1GQM A;  1M63 B;  2GGM A;  2KI4 B;  1SYM A;  3HX4 A;  4R1E A;  5AAN A;  1JFK A;  1B47 A;  1K9P A;  4ORB B;  1JF2 A;  1MWN A;  3KPX A;  2CT9 A;  1IKU A;  1LIN A;  2OS8 B;  2KYF A;  1IJ6 A;  4QJ4 B;  1OQP A;  2H61 A;  2JZI A;  2WCF A;  1DJG A;  2K7B A;  4AQI A;  2RGI A;  1WLZ A;  4I5K A;  1EG3 A;  1W7I B;  4PE0 A;  3E3R A;  3KHE A;  2BE4 A;  4YGB B;  1PK0 D;  1Y6W A;  3CGA A;  2MA2 A;  4JWQ A;  2JXL A;  3TDI A;  4NDB A;  1FBV A;  1S5G Y;  2PAS A;  3A4U B;  1QTX A;  2CNP A;  1N2D A;  1NCY A;  1BG1 A;  2KQ6 A;  1KWO B;  3AAJ A;  3AKA A;  2NCO A;  4TNC A;  1XFX O;  4GPL B;  1QLS A;  1Y0V H;  4YGA A;  2PVB A;  5AEQ A;  2LV7 A;  3VRP A;  2LE9 B;  1SBJ A;  4PAL A;  4N5X A;  2G2B A;  1AHR A;  1NSH A;  1PVB A;  4DUQ A;  3NSI A;  1DGU A;  2M7N A;  3GK4 X;  2JQ6 A;  3O2P A;  3HCM A;  1AUI B;  2NXQ A;  5HLV A;  4E68 A;  3D0Y A;  2KYC A;  2QPT A;  1J7R A;  2HQ8 A;  2LLU A;  1KSO A;  1NCX A;  1SR6 C;  2FCE A;  5F6T A;  1K96 A;  4GBA A;  1IQ3 A;  1SCV A;  2JNF A;  4JQ0 D;  1QV1 A;  2KI6 C;  3CR5 X;  1TOP A;  1E8A A;  2PRU A;  1NX2 A;  1B9A A;  2L50 A;  3PAT A;  1Y1A A;  2LLS A;  3AAK A;  1DJX A;  1SW8 A;  1YRT B;  1B8L A;  1C7V A;  1PUL A;  2L5X B;  3O6B A;  4YBH B;  1DVI A;  1QLK A;  3O4Y A;  1ODB A;  1M31 A;  2ZRS A;  2QAC A;  2F33 A;  2M9G A;  1CLB A;  2M8U A;  5KSZ A;  2BCX A;  3SIA A;  4M2Q A;  1G4Y R;  2V53 A;  3VRQ A;  1XVJ A;  3FS7 A;  4CLN A;  3CWG A;  5I2Q A;  1JC2 A;  3D0Y B;  1FPW A;  1YUU A;  1ZOT B;  2CBL A;  1SCM B;  1XFZ O;  2KOT A;  1CNP A;  1KK7 Z;  3MSE B;  1V1F A;  1WY9 A;  4BY4 A;  1QVI Y;  3ZWH A;  2JPT A;  4MN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...