2GV5A

Crystal structure of sfi1p/cdc31p complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
b'LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2gv5A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2gv5A01
2QPTA 2JT3A 2K61A 2PVBA 3D0YA 1ZFSA 5AANA 4OV2A 1Y1XA 2JULA 3CR5X 3O4YA 1B8LA 1SCMC 1UURA 2G9BA 2JTZA 1ODBA 3I5GC 2QACA 5TNCA 3MSEB 1TRFA 1G8IA 1ZACA 3SG5A 1QX7A 2CT9A 3LCPC 2Y1NA 5KTYA 2M97A 1WRKA 4N1GA 1PVAA 1TNQA 3CR2A 2LVVA 1RJVA 5CSNA 2BCBA 3SJSA 3IQQA 2NXQA 2HF5A 1QV1A 5DKRA 1JSAA 2ZNDA 1RK9A 3OHMB 3GK1A 4MVFA 1OZOA 2FOTA 1TCOB 1TNXA 3DVEA 2Q4UA 5CSJA 1K90D 1TNPA 1DF0A 2NLNA 1PK0D 3KEVA 1JC2A 1OQPA 2KHNA 1YUUA 4R1EA 1MXEA 1LKJA 3LLEA 2OPOA 4C0JA 1K9KA 1WDCB 2BE4A 4ZCUA 3O78A 4Q04A 1J55A 1X02A 4PALA 3SG3A 3EK4A 2SCPA 1SR6B 4I5NB 2JXLA 3WXAA 1F70A 2PASA 3FWBA 3I5HB 3I5FB 1BMOA 3I5IC 4YI8A 3WHTB 4E68A 1YR5A 1KQMB 1QLKA 1QS7A 1S5GY 4AQIA 5B8IB 2K2AA 1KCYA 5G08A 1NIWA 1MHOA 1NPQA 1YURA 1ZUZA 1S1EA 3FS7A 1M31A 2OS8B 5HYDA 1K2HA 2KFHA 2D8NA 3ICBA 4I5JA 4PHKA 2K7CA 4YGAA 2HPSA 1UHKA 1RECA 1IG5A 3NXAA 1AUIB 1NX3A 4GBAA 1KQVA 3BXKA 1UHJA 1W7IB 2WCBA 4C0KA 1C07A 2H61A 1C7VA 2L98A 3JTDB 1C7WA 1Y1UA 4ZCVA 1QASA 1XFWO 2E6WA 1YRTB 2BKIB 1EXRA 1KSOA 1B1GA 1MR8A 2L51A 2CTNA 1GGWA 2BBMA 1AP4A 1N0YA 1QX5B 1KWOC 2NCPA 3NSOA 2K7OA 2LUCA 1QJTA 3OB2B 3PLFB 3OB1B 1SY9A 1M45A 1A2XA 4HSZA 3VROA 3IQOA 2MRDA 4U8DA 1F4OA 2LUXA 1FPWA 1QV0A 1U5IA 4XYNA 1SL8A 2CXJA 4ICBA 2K2FA 1JFJA 2OTGC 1F8HA 2H2KA 2A4JA 4YRUA 3D10A 1V1GA 1SL7A 2H61C 3D0YB 1A29A 1NYAA 2KI6D 1XFZO 4PE0A 3AAKA 4WQ2A 4HRHA 3JVTC 2NZ0A 4YGCB 1DGUA 4CPVA 2MLEC 3CS1A 2Y5IA 1FBVA 3CZTX 3I5IB 1B7TZ 2ZKMX 4PE4A 5DKNA 3OX6A 1R2UA 4GUKA 1J1EA 1MXLC 5DKQA 2Q91A 5FYXA 2P6BB 1XA5A 2KAVA 4D1EA 1LA3A 1TNWA 3FIAA 2KNEA 2BCAA 1YRUB 1K94A 2K7DA 3PFVA 3BOWB 3VRNA 1N65A 2BL0C 1NWDA 1NX0A 1TN4A 1YVLA 1WRLA 1WRZA 4ORCB 2M7LA 1FI5A 2JPTA 1YX8A 1DJYA 1NP8A 5K89A 1CLMA 1JF0A 5KU1A 5CPVA 2F33A 1NCZA 2KFFA 3KF9A 1F54A 4GAOA 1S6IA 4DCKA 1F4QA 1TCFA 1MUXA 1SW8A 2I7AA 1B47A 1IH0A 4YI9A 1KWOB 2LE9B 1QXPA 4DIRA 2WOSA 2HQ8A 3TUYC 1HQVA 3TZ1A 2GV5A 4HRGA 1UUSA 2KI4B 2KSPA 2RGIA 2CNPA 1LXFC 2O60A 1OOJA 4ETOA 1EG4A 4IL1A 1AJ4A 1SRAA 4QJ5B 2KYFA 1IQ3A 1G33A 5J3XA 1CFCA 4XJKA 1IQ5A 5F6TA 4PE1A 2ZN8A 4MEWA 1NUBA 1KSMA 2JQ6A 3BUXB 4OKHA 1B8RA 4CIDA 1BR1B 2IS9A 3CTNA 4PHNA 1AHRA 4A4CA 2OTGB 4YGEB 1EH2A 4CFQA 2LP2A 2CCMA 2E30A 4N5XA 2PALA 1B7TY 2WNDA 1NCXA 2I18A 2LM5A 3BYAA 1PSRA 1OE9B 1CM4A 2ZRTA 2Y1MA 1L2OC 1NX2A 3DVJA 1SKTA 2F2PA 2R2IA 4OCIA 3QRXA 1XFYO 2L0PA 4OR9B 2MA2A 1HT9A 4OVNF 3AAJA 4ORAB 2M8UA 1WY9A 1A75A 1TOPA 2GGMA 2LC5A 5HLOA 2AAOA 1GQMA 1CFPA 3SIBA 4BY5A 3KHEA 3EVVA 2BBNA 1DJWA 1DTLA 4NDCA 2I2RE 2JRFA 3NSLA 1M39A 5HLVA 2JWWA 1DMOA 1DGVA 2HETA 2MJWB 1J7QA 1EG3A 1KFUS 2JNFA 4GGFA 1FW4A 4MLWA 2BL0B 1F71A 1SL9A 2EHBA 3VRQA 2K0JA 3O2PA 1DJGA 3A4UB 1SK6D 2FJUB 4P2YB 4WRIA 1D1OA 1K93D 1LA0A 4USLA 3HCMA 1M46A 1KFXS 2WCFA 4DUQA 4NQGA 4HREE 1SCMB 3I5GB 3FWCA 4QJ3B 3GK2A 5CSFA 3TUYB 1Y1AA 1CDNA 5HKWA 4M2OA 4CLNA 3M0WA 1XFVO 5D7FA 2KGBC 2LV7A 3EVUA 2NCOA 2F3ZA 1Q80A 1RWYA 1LINA 2HQWA 3PATA 4QJ4B 3AKBA 5I2QA 1BOCA 2MHHA 3RM1A 1J7PA 4YGDB 1BJFA 1S6CA 1RTP1 4GGFC 5ER5A 2KOTA 2B1UA 1V1FA 2KBIA 2L2EA 2JOJA 2ZN9A 1K8UA 1EL4A 1MQ1A 3AKAA 4JPZB 1XVJA 1CMFA 1BF5A 2BCXA 3GK4X 1KK7Z 1DJZA 1N2DA 2SASA 3TDUA 1L2OB 1QLSA 2ZFDA 2M29A 3H4SE 1XO5A 4NDDA 1UHIA 2K8MB 2WCEA 3PM8A 4L9MA 4I5KA 1KFUL 4PHMA 5IBWA 4UPGA 3ZNIA 1UWOA 3DF0A 1QATA 3VGOA 1L7ZA 4F0ZB 1CM1A 1AJ5A 1S26D 1NCYA 2EGDA 3CWGA 1UP5A 1ALWA 2I94A 1KFXL 4GFTA 2KDHA 2M9GA 4GGNA 4MBEA 3F45A 3GOFA 3PN7C 4FQOA 2CBLA 1XK4A 1K96A 2LLTA 1YTZC 1KK8C 1OSAA 1WDCC 3DD4A 3LK1A 1DF0B 1CLLA 2VRGA 3DVKA 3SG6A 2F3YA 1CDMA 3SG2A 1BG1A 3K21A 1Y0VH 2G2BA 4BY4A 1IKUA 5I8NA 4CFRA 1SNLA 2JU0A 4MRYA 1PSBA 4DS7A 4PE7A 2PRUA 1MWNA 1XYDA 4PCWA 5GQQC 2WORA 1JFKA 4TNCA 2LLUA 3TS5C 2KFGA 3TDZA 2COLB 1LVCD 1CTRA 1QTXA 1WLZA 2ZNEA 1A75B 3LK0A 1BODA 2GGZA 3SG7A 1J7RA 1K95A 1SCVA 2WC8A 1YUSA 4PHJA 1S5GZ 5AFPA 1TTXA 1QVIZ 1J1DA 1XFUO 1OZSA 1CB1A 1CDLA 1KK7Y 1YVHA 3RLZA 1TIZA 1S3PA 3JTDC 4MSPA 3KO0A 2LANA 2BKHB 2LVJA 1R6PA 2K7BA 1NX1A 1CMGA 1OMVA 2LMTA 2M7NA 1XK4C 4AQJA 5CSIA 1QIWA 1PVBA 3VRPA 1CDPA 2V53A 1PRWA 2PSRA 2JC2A 2LHLA 1YUTA 3IF7A 1K9UA 2LCPA 1SYMA 5PALA 1J7OA 3JVTB 3TDIA 1Y6WA 2JNXA 2M1UA 5HKZA 1E8AA 3OP0A 1B8CA 1DVIA 1QIVA 5I2LA 3BOWA 4MN0A 1CLBA 1RFJA 2PMYA 4MZLA 3O6BA 1CFDA 3PSRA 1GGZA 1G4YR 2KI6C 1JUOA 1DJXA 1GJYA 3A8RA 5JJGA 1AK8A 3EVRA 4M2PA 2KAXA 1XFXO 4GNKB 3SIAA 1PULA 5AXIA 1U5IB 1IWQA 2BE6A 2AUCA 3E3RA 3PN7B 5JOLA 2KYCA 2F8PA 1KK8B 1WLMA 1JF2A 4DRWA 1SPYA 1DJIA 1W7JB 1ALVA 5D69A 1UHNA 4YBHB 5AEQA 1PALA 4JQ0D 1IRJA 3SG4A 4A4BA 2Y4QA 2JXCA 3EKJA 1QVIY 1K9PA 1IGVA 1UHHA 3LL8B 2MLFC 3KPXA 4N1FA 1SBJA 2L5XB 2LHIA 3TS5B 1CKKA 1QX2A 1B9AA 5BPJA 3CGAA 1A03A 2L4HA 3BUMB 3DVMA 2LAPA 2EC6C 2JT0A 1OMRA 2JT8A 3EK7A 2M49B 2MBXA 4I5LB 2L50A 2LLSA 3DF0B 1MF8B 1H8BA 1EJ3A 2JZIA 5HKYA 1SMGA 2KBMA 4MRXA 1CNPA 4WQ3A 1DT7B 1FF1A 1FI6A 1VRKA 5ER4X 1CFFA 4NDBA 4P5OE 2KGRA 1BU3A 2KQ6A 3ZWHA 3WHUB 2FCEA 3EKHA 1DJHA 1YX7A 4JWQA 4PDZA 4FTGA 1BLQA 2KQYA 1A4PA 3VRRA 2L4IA 1OMDA 2KI4C 2ZRSA 2FCDA 2KAYA 2M3WA 3WNXB 2ISDA 2AMIA 3EK8A 1AVSA 3C1VA 1B4CA 5AERA 1BR4B 1ZOTB 2F2OA 2LVIA 4MZJA 4C0LA 3CR4X 1F55A 2LNKA 1IJ5A 1RROA 1S6JA 2O5GA 4XJKB 2DOQA 2LVKA 1BT6A 2M0RA 2TN4A 4MZKA 2JTTA 2LMUA 4M2QA 3NSKA 4AOMA 3BQ3A 2LMVA 2BECA 5I2OA 1JBAA 1SR6C 2LP3A 3I5HC 3I5FC 1KQMC 2M1KB 2MAZA 3NSIA 1ZMZA 4ORBB 3BUOB 3PALA 1S36A 3HX4A 3CLNA 1NSHA 1IJ6A 2OS8C 1M63B 2EC6B 4GPLB 1H4BA 4YGBB 5KSZA 1JWDA 3OX5A 3BUWB 3BUNB
chains in the Genus database with same CATH superfamily
2QPTA 2JT3A 2K61A 2PVBA 3BFAA 3D0YA 2H8VA 1ZFSA 5AANA 4OV2A 1Y1XA 2JULA 3CR5X 3O4YA 1B8LA 1SCMC 1UURA 2G9BA 2JTZA 1ODBA 3I5GC 2QACA 5TNCA 3MSEB 1TRFA 1G8IA 1ZACA 3SG5A 1QX7A 2CT9A 3LCPC 2Y1NA 5KTYA 1ORGA 2M97A 1WRKA 4N1GA 1PVAA 1TNQA 3CR2A 2LVVA 1RJVA 5CSNA 2BCBA 3SJSA 3IQQA 2NXQA 2HF5A 1QV1A 5DKRA 1JSAA 2ZNDA 1RK9A 3OHMB 3GK1A 2BAPA 3L47A 4MVFA 1OZOA 2FOTA 1TCOB 1TNXA 3DVEA 2Q4UA 5CSJA 1K90D 1TNPA 1DF0A 2NLNA 1PK0D 3KEVA 4IJ7A 4KYNA 1JC2A 1OQPA 2KHNA 3OGNA 1YUUA 4R1EA 1MXEA 1LKJA 3LLEA 2OPOA 4C0JA 1K9KA 1WDCB 2BE4A 4ZCUA 3O78A 4Q04A 1J55A 1X02A 4PALA 2WCKA 3SG3A 3EK4A 2SCPA 1SR6B 4I5NB 2JXLA 3WXAA 1F70A 2PASA 3FWBA 3I5HB 3SS3A 3I5FB 1BMOA 3I5IC 4YI8A 3WHTB 4E68A 1YR5A 1KQMB 1QLKA 1QS7A 1S5GY 4AQIA 5B8IB 2K2AA 1KCYA 5G08A 1NIWA 1MHOA 1NPQA 1YURA 1ZUZA 1OOGA 1S1EA 3FS7A 1M31A 2OS8B 5HYDA 1K2HA 2KFHA 2D8NA 3ICBA 4I5JA 4PHKA 2K7CA 4YGAA 3QMEA 2HPSA 1UHKA 2PQLA 1RECA 1IG5A 3NXAA 1AUIB 1NX3A 3PM2A 4GBAA 1KQVA 1DELA 3BXKA 1UHJA 1W7IB 2WCBA 4C0KA 1C07A 2H61A 1C7VA 2L98A 3JTDB 1C7WA 3SS4A 1Y1UA 4ZCVA 1QASA 1XFWO 2E6WA 1YRTB 2BKIB 1EXRA 1KSOA 1B1GA 1MR8A 2L51A 2CTNA 1GGWA 2BBMA 1AP4A 1N0YA 1QX5B 2QDIA 1KWOC 2NCPA 3NSOA 2K7OA 2PYQA 3CYZA 3K1EA 2LUCA 1QJTA 3N7HA 3OB2B 3PLFB 3OB1B 3FE6A 4F7FA 3B87A 1C3ZA 1M45A 1A2XA 1SY9A 4HSZA 3VROA 3IQOA 2MRDA 4U8DA 1F4OA 2LUXA 1FPWA 1QV0A 1U5IA 3S0AA 4XYNA 1SL8A 2CXJA 4ICBA 2K2FA 3B88A 1JFJA 2OTGC 1F8HA 2H2KA 2A4JA 4YRUA 3NHTA 2P71A 3D10A 1V1GA 1SL7A 2H61C 3D0YB 1A29A 1NYAA 2KI6D 1XFZO 4PE0A 3AAKA 4WQ2A 4HRHA 3JVTC 2NZ0A 4YGCB 1DGUA 2FJYA 4CPVA 2MLEC 3CS1A 2Y5IA 1FBVA 3CZTX 3I5IB 1B7TZ 2ZKMX 4JD9A 4PE4A 3D74A 5DKNA 2WCLA 4PT1A 3OX6A 1R2UA 4GUKA 1J1EA 2P70A 1MXLC 5DKQA 2Q91A 5FYXA 2P6BB 1XA5A 2KAVA 4D1EA 1LA3A 1XFRA 1TNWA 3FIAA 2KNEA 3S0BA 2BCAA 3S0DA 1YRUB 1K94A 2K7DA 3PFVA 3BOWB 3VRNA 1N65A 1NWDA 1NX0A 1TN4A 1YVLA 2BL0C 1IIOA 1WRLA 1WRZA 4ORCB 2M7LA 5FI7A 1FI5A 2JPTA 1YX8A 1DJYA 1NP8A 5K89A 1CLMA 1JF0A 5KU1A 5CPVA 2F33A 1NCZA 2KFFA 3KF9A 1F54A 4GAOA 1S6IA 4DCKA 1F4QA 1TCFA 1MUXA 1SW8A 2I7AA 2WC5A 1CFPA 4INXA 1B47A 1IH0A 4YI9A 1KWOB 2LE9B 1QXPA 4DIRA 2WOSA 2HQ8A 3TUYC 1HQVA 3TZ1A 1TUZA 2GV5A 4HRGA 1UUSA 2KI4B 2KSPA 2RGIA 2CNPA 1LXFC 2O60A 1OOJA 4ETOA 1EG4A 4IL1A 1AJ4A 1SRAA 4QJ5B 2KYFA 3RZSA 1IQ3A 1G33A 5J3XA 1CFCA 2KLDA 4XJKA 1IQ5A 5F6TA 4PE1A 2ZN8A 4MEWA 1NUBA 1KSMA 2JQ6A 3BUXB 4OKHA 1B8RA 4CIDA 1BR1B 2IS9A 3CTNA 4PHNA 1AHRA 4A4CA 2OTGB 4YGEB 1EH2A 4CFQA 5FI2A 2LP2A 2CCMA 2E30A 4N5XA 2PALA 1DC1A 1B7TY 2WNDA 1NCXA 2I18A 2LM5A 3BYAA 3D76A 1PSRA 1OE9B 1CM4A 2ZRTA 2Y1MA 1L2OC 1NX2A 3DVJA 1SKTA 2F2PA 2R2IA 4OCIA 3QRXA 1XFYO 2L0PA 4OR9B 1C3YA 2MA2A 1HT9A 4OVNF 3AAJA 3R1OA 4ORAB 2M8UA 1WY9A 1A75A 1T14A 1TOPA 2GGMA 2L5YA 2AAOA 1GQMA 2LC5A 5HLOA 3SIBA 3FE8A 3KHEA 3EVVA 4BY5A 2BBNA 1DJWA 1DTLA 4NDCA 2I2RE 2JRFA 3CZ0A 1M39A 3NSLA 5HLVA 2JWWA 1DMOA 1DGVA 2HETA 2MJWB 1J7QA 1EG3A 1KFUS 2JNFA 2ERBA 4GGFA 1FW4A 4MLWA 2BL0B 1F71A 1SL9A 2EHBA 3VRQA 2K0JA 3O2PA 1DJGA 3A4UB 1SK6D 2FJUB 4P2YB 4WRIA 4FQTA 1D1OA 1K93D 1LA0A 4USLA 3HCMA 1M46A 2GTEA 1KFXS 2WCFA 4DUQA 1TUJA 1TWOA 4NQGA 4HREE 1SCMB 3I5GB 5I94A 3FWCA 4QJ3B 3GK2A 5CSFA 3TUYB 1Y1AA 1CDNA 5HKWA 4M2OA 4CLNA 2KLEA 3M0WA 3BJHA 1XFVO 5D7FA 2KGBC 2LV7A 3EVUA 2NCOA 2WCHA 2F3ZA 1Q80A 3EG5B 1RWYA 2QEVA 1LINA 2HQWA 3PATA 4QJ4B 2K60A 3AKBA 5I2QA 1BOCA 2MHHA 3RM1A 1J7PA 4YGDB 1BJFA 1S6CA 1RTP1 4GGFC 5ER5A 2KOTA 2B1UA 1V1FA 2KBIA 4OZDA 2L2EA 2JOJA 5FI6A 2ZN9A 1K8UA 1EL4A 1MQ1A 3AKAA 4JPZB 1XVJA 1CMFA 1BF5A 1GM0A 2BCXA 3GK4X 1KK7Z 1DJZA 1N2DA 3FE9A 2SASA 3TDUA 1L2OB 2JPOA 3BFHA 1QLSA 2ZFDA 2M29A 3H4SE 1XO5A 4NDDA 1UHIA 2K8MB 2WCEA 2BNXA 3PM8A 1OOFA 4I5KA 4L9MA 1KFUL 4PHMA 5IBWA 4UPGA 3ZNIA 1UWOA 3DF0A 1QATA 3VGOA 1L7ZA 3DYEA 1CM1A 4F0ZB 1AJ5A 1S26D 1NCYA 2EGDA 3CWGA 3PJIA 1UP5A 1ALWA 2I94A 1KFXL 4GFTA 2KDHA 2M9GA 4GGNA 4MBEA 3F45A 3GOFA 3PN7C 3R1VA 2CBLA 4FQOA 1XK4A 1K96A 2LLTA 1YTZC 1KK8C 1OSAA 1WDCC 3DD4A 3LK1A 3OBVA 1DF0B 1CLLA 2VRGA 3DVKA 3SG6A 1P28A 2F3YA 1CDMA 3SG2A 1BG1A 3K21A 1Y0VH 2G2BA 3CZ2A 4BY4A 1IKUA 3S0EA 5I8NA 4CFRA 1SNLA 2JU0A 2QEOA 1PSBA 4MRYA 4DS7A 3O4XA 2PRUA 1MWNA 1XYDA 4PE7A 4PCWA 5GQQC 2WORA 1JFKA 3R1PA 4TNCA 2LLUA 3TS5C 2KFGA 3TDZA 3B6XA 2COLB 1LVCD 1CTRA 1QTXA 1WLZA 2ZNEA 3UO9A 2QEBA 1A75B 1Z4HA 3LK0A 1BODA 2GGZA 3SG7A 1J7RA 1K95A 1SCVA 2WC8A 1YUSA 4PHJA 1S5GZ 5AFPA 1TTXA 1QVIZ 1J1DA 1XFUO 1OZSA 1CB1A 1CDLA 1KK7Y 1YVHA 3RLZA 1TIZA 1S3PA 3JTDC 4MSPA 3KO0A 2LANA 2BKHB 2LVJA 1R6PA 5EL2A 2KPHA 2K7BA 1NX1A 1CMGA 1OMVA 2LMTA 3S0GA 2M7NA 1XK4C 4AQJA 5CSIA 1QIWA 3VB1A 1PVBA 3R72A 1SSEB 3VRPA 1CDPA 2V53A 1PRWA 2PSRA 2JC2A 2LHLA 1YUTA 3IF7A 1K9UA 2LCPA 1SYMA 5PALA 1J7OA 3JVTB 3TDIA 4INWA 1Y6WA 2JNXA 2M1UA 5HKZA 1E8AA 3OP0A 1B8CA 1DVIA 1QIVA 3B86A 5I2LA 3BOWA 4MN0A 1CLBA 1RFJA 2PMYA 4MZLA 2L2CA 3O6BA 1CFDA 3PSRA 1OOIX 1GGZA 1G4YR 2KI6C 3CZ1A 1JUOA 1DJXA 1GJYA 3A8RA 2WCMA 3D78A 5JJGA 1AK8A 3EVRA 4M2PA 5HL1A 3IVTA 2KAXA 1OOHA 1XFXO 4GNKB 3SIAA 1PULA 5AXIA 3D75A 1U5IB 1IWQA 2BE6A 2AUCA 3E3RA 3PN7B 5JOLA 2KYCA 2F8PA 1KK8B 1Z2CB 1WLMA 1JF2A 4DRWA 1SPYA 1DJIA 1W7JB 3CDNA 1ALVA 5D69A 1UHNA 4YBHB 5AEQA 1PALA 4JQ0D 3NGVA 1IRJA 3SG4A 3S0FA 4A4BA 2Y4QA 2JXCA 3EKJA 1QVIY 3L4LA 3DZTA 1K9PA 1IGVA 1UHHA 3LL8B 2MLFC 3KPXA 4N1FA 1SBJA 2L5XB 2LHIA 3TS5B 1CKKA 1QX2A 1B9AA 5BPJA 3CGAA 1A03A 2L4HA 3BUMB 3DVMA 2LAPA 2EC6C 2JT0A 1OMRA 2JT8A 3EK7A 2M49B 2MBXA 3UNWA 4I5LB 3NHIA 2L50A 2LLSA 3DF0B 1MF8B 1H8BA 1EJ3A 2JZIA 3SS5A 5HKYA 1SMGA 2KBMA 4MRXA 1CNPA 4WQ3A 1DT7B 1FF1A 1FI6A 1VRKA 5ER4X 1CFFA 4JKTA 4NDBA 4P5OE 2KGRA 1BU3A 2KQ6A 3ZWHA 3B7AA 3WHUB 2YGUA 2FCEA 3EKHA 1DJHA 1YX7A 4JWQA 4PDZA 4FTGA 1BLQA 3CABA 2KQYA 1A4PA 3VRRA 2L4IA 1OMDA 2KI4C 2ZRSA 3Q8IA 2FCDA 2KAYA 2M3WA 3WNXB 2ISDA 1OW4A 2AMIA 3L4AA 3EK8A 1AVSA 3C1VA 1B4CA 5AERA 1BR4B 1ZOTB 2F2OA 2LVIA 4MZJA 4C0LA 3CR4X 5D3OA 1F55A 2LNKA 5DICA 1IJ5A 1RROA 1S6JA 3DXLA 2O5GA 4XJKB 2DOQA 2LVKA 1BT6A 2M0RA 2TN4A 4MZKA 2JTTA 2LMUA 4M2QA 3NSKA 3BFBA 4AOMA 3BQ3A 2LMVA 2BECA 5I2OA 1JBAA 1SR6C 1LS8A 2LP3A 3I5HC 2WC6A 3I5FC 1KQMC 2M1KB 2MAZA 3NSIA 1W9ZA 1ZMZA 3V2LA 4ORBB 3BUOB 3PALA 1S36A 3D73A 3HX4A 3CLNA 1NSHA 1IJ6A 2OS8C 2QEHA 1DEKA 1M63B 2EC6B 4GPLB 1H4BA 4YGBB 5KSZA 1JWDA 1QWVA 3OX5A 2WCJA 1DQEA 3DY9A 3BUWB 3BUNB 3D77A
chains in the Genus database with same CATH topology
2QPTA 2JT3A 2K61A 2PVBA 3D0YA 1ZFSA 5AANA 4OV2A 1Y1XA 2JULA 3CR5X 3O4YA 1B8LA 1SCMC 1UURA 2G9BA 2JTZA 1ODBA 3I5GC 2QACA 5TNCA 3MSEB 1TRFA 1G8IA 1ZACA 3SG5A 1QX7A 2CT9A 3LCPC 2Y1NA 5KTYA 2M97A 1WRKA 4N1GA 1PVAA 1TNQA 3CR2A 2LVVA 1RJVA 5CSNA 2BCBA 3SJSA 3IQQA 2NXQA 2HF5A 1QV1A 5DKRA 1JSAA 2ZNDA 1RK9A 3OHMB 3GK1A 4MVFA 1OZOA 2FOTA 1TCOB 1TNXA 3DVEA 2Q4UA 5CSJA 1K90D 1TNPA 1DF0A 2NLNA 1PK0D 3KEVA 1JC2A 1OQPA 2KHNA 1YUUA 4R1EA 1MXEA 1LKJA 3LLEA 2OPOA 4C0JA 1K9KA 1WDCB 2BE4A 4ZCUA 3O78A 4Q04A 1J55A 1X02A 4PALA 3SG3A 3EK4A 2SCPA 1SR6B 4I5NB 2JXLA 3WXAA 1F70A 2PASA 3FWBA 3I5HB 3I5FB 1BMOA 3I5IC 4YI8A 3WHTB 4E68A 1YR5A 1KQMB 1QLKA 1QS7A 1S5GY 4AQIA 5B8IB 2K2AA 1KCYA 5G08A 1NIWA 1MHOA 1NPQA 1YURA 1ZUZA 1S1EA 3FS7A 1M31A 2OS8B 5HYDA 1K2HA 2KFHA 2D8NA 3ICBA 4I5JA 4PHKA 2K7CA 4YGAA 2HPSA 1UHKA 1RECA 1IG5A 3NXAA 1AUIB 1NX3A 4GBAA 1KQVA 3BXKA 1UHJA 1W7IB 2WCBA 4C0KA 1C07A 2H61A 1C7VA 2L98A 3JTDB 1C7WA 1Y1UA 4ZCVA 1QASA 1XFWO 2E6WA 1YRTB 2BKIB 1EXRA 1KSOA 1B1GA 1MR8A 2L51A 2CTNA 1GGWA 2BBMA 1AP4A 1N0YA 1QX5B 1KWOC 2NCPA 3NSOA 2K7OA 2LUCA 1QJTA 3OB2B 3PLFB 3OB1B 1SY9A 1M45A 1A2XA 4HSZA 3VROA 3IQOA 2MRDA 4U8DA 1F4OA 2LUXA 1FPWA 1QV0A 1U5IA 4XYNA 1SL8A 2CXJA 4ICBA 2K2FA 1JFJA 2OTGC 1F8HA 2H2KA 2A4JA 4YRUA 3D10A 1V1GA 1SL7A 2H61C 3D0YB 1A29A 1NYAA 2KI6D 1XFZO 4PE0A 3AAKA 4WQ2A 4HRHA 3JVTC 2NZ0A 4YGCB 1DGUA 4CPVA 2MLEC 3CS1A 2Y5IA 1FBVA 3CZTX 3I5IB 1B7TZ 2ZKMX 4PE4A 5DKNA 3OX6A 1R2UA 4GUKA 1J1EA 1MXLC 5DKQA 2Q91A 5FYXA 2P6BB 1XA5A 2KAVA 4D1EA 1LA3A 1TNWA 3FIAA 2KNEA 2BCAA 1YRUB 1K94A 2K7DA 3PFVA 3BOWB 3VRNA 1N65A 2BL0C 1NWDA 1NX0A 1TN4A 1YVLA 1WRLA 1WRZA 4ORCB 2M7LA 1FI5A 2JPTA 1YX8A 1DJYA 1NP8A 5K89A 1CLMA 1JF0A 5KU1A 5CPVA 2F33A 1NCZA 2KFFA 3KF9A 1F54A 4GAOA 1S6IA 4DCKA 1F4QA 1TCFA 1MUXA 1SW8A 2I7AA 1B47A 1IH0A 4YI9A 1KWOB 2LE9B 1QXPA 4DIRA 2WOSA 2HQ8A 3TUYC 1HQVA 3TZ1A 2GV5A 4HRGA 1UUSA 2KI4B 2KSPA 2RGIA 2CNPA 1LXFC 2O60A 1OOJA 4ETOA 1EG4A 4IL1A 1AJ4A 1SRAA 4QJ5B 2KYFA 1IQ3A 1G33A 5J3XA 1CFCA 4XJKA 1IQ5A 5F6TA 4PE1A 2ZN8A 4MEWA 1NUBA 1KSMA 2JQ6A 3BUXB 4OKHA 1B8RA 4CIDA 1BR1B 2IS9A 3CTNA 4PHNA 1AHRA 4A4CA 2OTGB 4YGEB 1EH2A 4CFQA 2LP2A 2CCMA 2E30A 4N5XA 2PALA 1B7TY 2WNDA 1NCXA 2I18A 2LM5A 3BYAA 1PSRA 1OE9B 1CM4A 2ZRTA 2Y1MA 1L2OC 1NX2A 3DVJA 1SKTA 2F2PA 2R2IA 4OCIA 3QRXA 1XFYO 2L0PA 4OR9B 2MA2A 1HT9A 4OVNF 3AAJA 4ORAB 2M8UA 1WY9A 1A75A 1TOPA 2GGMA 2LC5A 5HLOA 2AAOA 1GQMA 1CFPA 3SIBA 4BY5A 3KHEA 3EVVA 2BBNA 1DJWA 1DTLA 4NDCA 2I2RE 2JRFA 3NSLA 1M39A 5HLVA 2JWWA 1DMOA 1DGVA 2HETA 2MJWB 1J7QA 1EG3A 1KFUS 2JNFA 4GGFA 1FW4A 4MLWA 2BL0B 1F71A 1SL9A 2EHBA 3VRQA 2K0JA 3O2PA 1DJGA 3A4UB 1SK6D 2FJUB 4P2YB 4WRIA 1D1OA 1K93D 1LA0A 4USLA 3HCMA 1M46A 1KFXS 2WCFA 4DUQA 4NQGA 4HREE 1SCMB 3I5GB 3FWCA 4QJ3B 3GK2A 5CSFA 3TUYB 1Y1AA 1CDNA 5HKWA 4M2OA 4CLNA 3M0WA 1XFVO 5D7FA 2KGBC 2LV7A 3EVUA 2NCOA 2F3ZA 1Q80A 1RWYA 1LINA 2HQWA 3PATA 4QJ4B 3AKBA 5I2QA 1BOCA 2MHHA 3RM1A 1J7PA 4YGDB 1BJFA 1S6CA 1RTP1 4GGFC 5ER5A 2KOTA 2B1UA 1V1FA 2KBIA 2L2EA 2JOJA 2ZN9A 1K8UA 1EL4A 1MQ1A 3AKAA 4JPZB 1XVJA 1CMFA 1BF5A 2BCXA 3GK4X 1KK7Z 1DJZA 1N2DA 2SASA 3TDUA 1L2OB 1QLSA 2ZFDA 2M29A 3H4SE 1XO5A 4NDDA 1UHIA 2K8MB 2WCEA 3PM8A 4L9MA 4I5KA 1KFUL 4PHMA 5IBWA 4UPGA 3ZNIA 1UWOA 3DF0A 1QATA 3VGOA 1L7ZA 4F0ZB 1CM1A 1AJ5A 1S26D 1NCYA 2EGDA 3CWGA 1UP5A 1ALWA 2I94A 1KFXL 4GFTA 2KDHA 2M9GA 4GGNA 4MBEA 3F45A 3GOFA 3PN7C 4FQOA 2CBLA 1XK4A 1K96A 2LLTA 1YTZC 1KK8C 1OSAA 1WDCC 3DD4A 3LK1A 1DF0B 1CLLA 2VRGA 3DVKA 3SG6A 2F3YA 1CDMA 3SG2A 1BG1A 3K21A 1Y0VH 2G2BA 4BY4A 1IKUA 5I8NA 4CFRA 1SNLA 2JU0A 4MRYA 1PSBA 4DS7A 4PE7A 2PRUA 1MWNA 1XYDA 4PCWA 5GQQC 2WORA 1JFKA 4TNCA 2LLUA 3TS5C 2KFGA 3TDZA 2COLB 1LVCD 1CTRA 1QTXA 1WLZA 2ZNEA 1A75B 3LK0A 1BODA 2GGZA 3SG7A 1J7RA 1K95A 1SCVA 2WC8A 1YUSA 4PHJA 1S5GZ 5AFPA 1TTXA 1QVIZ 1J1DA 1XFUO 1OZSA 1CB1A 1CDLA 1KK7Y 1YVHA 3RLZA 1TIZA 1S3PA 3JTDC 4MSPA 3KO0A 2LANA 2BKHB 2LVJA 1R6PA 2K7BA 1NX1A 1CMGA 1OMVA 2LMTA 2M7NA 1XK4C 4AQJA 5CSIA 1QIWA 1PVBA 3VRPA 1CDPA 2V53A 1PRWA 2PSRA 2JC2A 2LHLA 1YUTA 3IF7A 1K9UA 2LCPA 1SYMA 5PALA 1J7OA 3JVTB 3TDIA 1Y6WA 2JNXA 2M1UA 5HKZA 1E8AA 3OP0A 1B8CA 1DVIA 1QIVA 5I2LA 3BOWA 4MN0A 1CLBA 1RFJA 2PMYA 4MZLA 3O6BA 1CFDA 3PSRA 1GGZA 1G4YR 2KI6C 1JUOA 1DJXA 1GJYA 3A8RA 5JJGA 1AK8A 3EVRA 4M2PA 2KAXA 1XFXO 4GNKB 3SIAA 1PULA 5AXIA 1U5IB 1IWQA 2BE6A 2AUCA 3E3RA 3PN7B 5JOLA 2KYCA 2F8PA 1KK8B 1WLMA 1JF2A 4DRWA 1SPYA 1DJIA 1W7JB 1ALVA 5D69A 1UHNA 4YBHB 5AEQA 1PALA 4JQ0D 1IRJA 3SG4A 4A4BA 2Y4QA 2JXCA 3EKJA 1QVIY 1K9PA 1IGVA 1UHHA 3LL8B 2MLFC 3KPXA 4N1FA 1SBJA 2L5XB 2LHIA 3TS5B 1CKKA 1QX2A 1B9AA 5BPJA 3CGAA 1A03A 2L4HA 3BUMB 3DVMA 2LAPA 2EC6C 2JT0A 1OMRA 2JT8A 3EK7A 2M49B 2MBXA 4I5LB 2L50A 2LLSA 3DF0B 1MF8B 1H8BA 1EJ3A 2JZIA 5HKYA 1SMGA 2KBMA 4MRXA 1CNPA 4WQ3A 1DT7B 1FF1A 1FI6A 1VRKA 5ER4X 1CFFA 4NDBA 4P5OE 2KGRA 1BU3A 2KQ6A 3ZWHA 3WHUB 2FCEA 3EKHA 1DJHA 1YX7A 4JWQA 4PDZA 4FTGA 1BLQA 2KQYA 1A4PA 3VRRA 2L4IA 1OMDA 2KI4C 2ZRSA 2FCDA 2KAYA 2M3WA 3WNXB 2ISDA 2AMIA 3EK8A 1AVSA 3C1VA 1B4CA 5AERA 1BR4B 1ZOTB 2F2OA 2LVIA 4MZJA 4C0LA 3CR4X 1F55A 2LNKA 1IJ5A 1RROA 1S6JA 2O5GA 4XJKB 2DOQA 2LVKA 1BT6A 2M0RA 2TN4A 4MZKA 2JTTA 2LMUA 4M2QA 3NSKA 4AOMA 3BQ3A 2LMVA 2BECA 5I2OA 1JBAA 1SR6C 2LP3A 3I5HC 3I5FC 1KQMC 2M1KB 2MAZA 3NSIA 1ZMZA 4ORBB 3BUOB 3PALA 1S36A 3HX4A 3CLNA 1NSHA 1IJ6A 2OS8C 1M63B 2EC6B 4GPLB 1H4BA 4YGBB 5KSZA 1JWDA 3OX5A 3BUWB 3BUNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPT A;  2JT3 A;  2K61 A;  2PVB A;  3D0Y A;  1ZFS A;  5AAN A;  4OV2 A;  1Y1X A;  2JUL A;  3CR5 X;  3O4Y A;  1B8L A;  1SCM C;  1UUR A;  2G9B A;  2JTZ A;  1ODB A;  3I5G C;  2QAC A;  5TNC A;  3MSE B;  1TRF A;  1G8I A;  1ZAC A;  3SG5 A;  1QX7 A;  2CT9 A;  3LCP C;  2Y1N A;  5KTY A;  2M97 A;  1WRK A;  4N1G A;  1PVA A;  1TNQ A;  3CR2 A;  2LVV A;  1RJV A;  5CSN A;  2BCB A;  3SJS A;  3IQQ A;  2NXQ A;  2HF5 A;  1QV1 A;  5DKR A;  1JSA A;  2ZND A;  1RK9 A;  3OHM B;  3GK1 A;  4MVF A;  1OZO A;  2FOT A;  1TCO B;  1TNX A;  3DVE A;  2Q4U A;  5CSJ A;  1K90 D;  1TNP A;  1DF0 A;  2NLN A;  1PK0 D;  3KEV A;  1JC2 A;  1OQP A;  2KHN A;  1YUU A;  4R1E A;  1MXE A;  1LKJ A;  3LLE A;  2OPO A;  4C0J A;  1K9K A;  1WDC B;  2BE4 A;  4ZCU A;  3O78 A;  4Q04 A;  1J55 A;  1X02 A;  4PAL A;  3SG3 A;  3EK4 A;  2SCP A;  1SR6 B;  4I5N B;  2JXL A;  3WXA A;  1F70 A;  2PAS A;  3FWB A;  3I5H B;  3I5F B;  1BMO A;  3I5I C;  4YI8 A;  3WHT B;  4E68 A;  1YR5 A;  1KQM B;  1QLK A;  1QS7 A;  1S5G Y;  4AQI A;  5B8I B;  2K2A A;  1KCY A;  5G08 A;  1NIW A;  1MHO A;  1NPQ A;  1YUR A;  1ZUZ A;  1S1E A;  3FS7 A;  1M31 A;  2OS8 B;  5HYD A;  1K2H A;  2KFH A;  2D8N A;  3ICB A;  4I5J A;  4PHK A;  2K7C A;  4YGA A;  2HPS A;  1UHK A;  1REC A;  1IG5 A;  3NXA A;  1AUI B;  1NX3 A;  4GBA A;  1KQV A;  3BXK A;  1UHJ A;  1W7I B;  2WCB A;  4C0K A;  1C07 A;  2H61 A;  1C7V A;  2L98 A;  3JTD B;  1C7W A;  1Y1U A;  4ZCV A;  1QAS A;  1XFW O;  2E6W A;  1YRT B;  2BKI B;  1EXR A;  1KSO A;  1B1G A;  1MR8 A;  2L51 A;  2CTN A;  1GGW A;  2BBM A;  1AP4 A;  1N0Y A;  1QX5 B;  1KWO C;  2NCP A;  3NSO A;  2K7O A;  2LUC A;  1QJT A;  3OB2 B;  3PLF B;  3OB1 B;  1SY9 A;  1M45 A;  1A2X A;  4HSZ A;  3VRO A;  3IQO A;  2MRD A;  4U8D A;  1F4O A;  2LUX A;  1FPW A;  1QV0 A;  1U5I A;  4XYN A;  1SL8 A;  2CXJ A;  4ICB A;  2K2F A;  1JFJ A;  2OTG C;  1F8H A;  2H2K A;  2A4J A;  4YRU A;  3D10 A;  1V1G A;  1SL7 A;  2H61 C;  3D0Y B;  1A29 A;  1NYA A;  2KI6 D;  1XFZ O;  4PE0 A;  3AAK A;  4WQ2 A;  4HRH A;  3JVT C;  2NZ0 A;  4YGC B;  1DGU A;  4CPV A;  2MLE C;  3CS1 A;  2Y5I A;  1FBV A;  3CZT X;  3I5I B;  1B7T Z;  2ZKM X;  4PE4 A;  5DKN A;  3OX6 A;  1R2U A;  4GUK A;  1J1E A;  1MXL C;  5DKQ A;  2Q91 A;  5FYX A;  2P6B B;  1XA5 A;  2KAV A;  4D1E A;  1LA3 A;  1TNW A;  3FIA A;  2KNE A;  2BCA A;  1YRU B;  1K94 A;  2K7D A;  3PFV A;  3BOW B;  3VRN A;  1N65 A;  2BL0 C;  1NWD A;  1NX0 A;  1TN4 A;  1YVL A;  1WRL A;  1WRZ A;  4ORC B;  2M7L A;  1FI5 A;  2JPT A;  1YX8 A;  1DJY A;  1NP8 A;  5K89 A;  1CLM A;  1JF0 A;  5KU1 A;  5CPV A;  2F33 A;  1NCZ A;  2KFF A;  3KF9 A;  1F54 A;  4GAO A;  1S6I A;  4DCK A;  1F4Q A;  1TCF A;  1MUX A;  1SW8 A;  2I7A A;  1B47 A;  1IH0 A;  4YI9 A;  1KWO B;  2LE9 B;  1QXP A;  4DIR A;  2WOS A;  2HQ8 A;  3TUY C;  1HQV A;  3TZ1 A;  2GV5 A;  4HRG A;  1UUS A;  2KI4 B;  2KSP A;  2RGI A;  2CNP A;  1LXF C;  2O60 A;  1OOJ A;  4ETO A;  1EG4 A;  4IL1 A;  1AJ4 A;  1SRA A;  4QJ5 B;  2KYF A;  1IQ3 A;  1G33 A;  5J3X A;  1CFC A;  4XJK A;  1IQ5 A;  5F6T A;  4PE1 A;  2ZN8 A;  4MEW A;  1NUB A;  1KSM A;  2JQ6 A;  3BUX B;  4OKH A;  1B8R A;  4CID A;  1BR1 B;  2IS9 A;  3CTN A;  4PHN A;  1AHR A;  4A4C A;  2OTG B;  4YGE B;  1EH2 A;  4CFQ A;  2LP2 A;  2CCM A;  2E30 A;  4N5X A;  2PAL A;  1B7T Y;  2WND A;  1NCX A;  2I18 A;  2LM5 A;  3BYA A;  1PSR A;  1OE9 B;  1CM4 A;  2ZRT A;  2Y1M A;  1L2O C;  1NX2 A;  3DVJ A;  1SKT A;  2F2P A;  2R2I A;  4OCI A;  3QRX A;  1XFY O;  2L0P A;  4OR9 B;  2MA2 A;  1HT9 A;  4OVN F;  3AAJ A;  4ORA B;  2M8U A;  1WY9 A;  1A75 A;  1TOP A;  2GGM A;  2LC5 A;  5HLO A;  2AAO A;  1GQM A;  1CFP A;  3SIB A;  4BY5 A;  3KHE A;  3EVV A;  2BBN A;  1DJW A;  1DTL A;  4NDC A;  2I2R E;  2JRF A;  3NSL A;  1M39 A;  5HLV A;  2JWW A;  1DMO A;  1DGV A;  2HET A;  2MJW B;  1J7Q A;  1EG3 A;  1KFU S;  2JNF A;  4GGF A;  1FW4 A;  4MLW A;  2BL0 B;  1F71 A;  1SL9 A;  2EHB A;  3VRQ A;  2K0J A;  3O2P A;  1DJG A;  3A4U B;  1SK6 D;  2FJU B;  4P2Y B;  4WRI A;  1D1O A;  1K93 D;  1LA0 A;  4USL A;  3HCM A;  1M46 A;  1KFX S;  2WCF A;  4DUQ A;  4NQG A;  4HRE E;  1SCM B;  3I5G B;  3FWC A;  4QJ3 B;  3GK2 A;  5CSF A;  3TUY B;  1Y1A A;  1CDN A;  5HKW A;  4M2O A;  4CLN A;  3M0W A;  1XFV O;  5D7F A;  2KGB C;  2LV7 A;  3EVU A;  2NCO A;  2F3Z A;  1Q80 A;  1RWY A;  1LIN A;  2HQW A;  3PAT A;  4QJ4 B;  3AKB A;  5I2Q A;  1BOC A;  2MHH A;  3RM1 A;  1J7P A;  4YGD B;  1BJF A;  1S6C A;  1RTP 1;  4GGF C;  5ER5 A;  2KOT A;  2B1U A;  1V1F A;  2KBI A;  2L2E A;  2JOJ A;  2ZN9 A;  1K8U A;  1EL4 A;  1MQ1 A;  3AKA A;  4JPZ B;  1XVJ A;  1CMF A;  1BF5 A;  2BCX A;  3GK4 X;  1KK7 Z;  1DJZ A;  1N2D A;  2SAS A;  3TDU A;  1L2O B;  1QLS A;  2ZFD A;  2M29 A;  3H4S E;  1XO5 A;  4NDD A;  1UHI A;  2K8M B;  2WCE A;  3PM8 A;  4L9M A;  4I5K A;  1KFU L;  4PHM A;  5IBW A;  4UPG A;  3ZNI A;  1UWO A;  3DF0 A;  1QAT A;  3VGO A;  1L7Z A;  4F0Z B;  1CM1 A;  1AJ5 A;  1S26 D;  1NCY A;  2EGD A;  3CWG A;  1UP5 A;  1ALW A;  2I94 A;  1KFX L;  4GFT A;  2KDH A;  2M9G A;  4GGN A;  4MBE A;  3F45 A;  3GOF A;  3PN7 C;  4FQO A;  2CBL A;  1XK4 A;  1K96 A;  2LLT A;  1YTZ C;  1KK8 C;  1OSA A;  1WDC C;  3DD4 A;  3LK1 A;  1DF0 B;  1CLL A;  2VRG A;  3DVK A;  3SG6 A;  2F3Y A;  1CDM A;  3SG2 A;  1BG1 A;  3K21 A;  1Y0V H;  2G2B A;  4BY4 A;  1IKU A;  5I8N A;  4CFR A;  1SNL A;  2JU0 A;  4MRY A;  1PSB A;  4DS7 A;  4PE7 A;  2PRU A;  1MWN A;  1XYD A;  4PCW A;  5GQQ C;  2WOR A;  1JFK A;  4TNC A;  2LLU A;  3TS5 C;  2KFG A;  3TDZ A;  2COL B;  1LVC D;  1CTR A;  1QTX A;  1WLZ A;  2ZNE A;  1A75 B;  3LK0 A;  1BOD A;  2GGZ A;  3SG7 A;  1J7R A;  1K95 A;  1SCV A;  2WC8 A;  1YUS A;  4PHJ A;  1S5G Z;  5AFP A;  1TTX A;  1QVI Z;  1J1D A;  1XFU O;  1OZS A;  1CB1 A;  1CDL A;  1KK7 Y;  1YVH A;  3RLZ A;  1TIZ A;  1S3P A;  3JTD C;  4MSP A;  3KO0 A;  2LAN A;  2BKH B;  2LVJ A;  1R6P A;  2K7B A;  1NX1 A;  1CMG A;  1OMV A;  2LMT A;  2M7N A;  1XK4 C;  4AQJ A;  5CSI A;  1QIW A;  1PVB A;  3VRP A;  1CDP A;  2V53 A;  1PRW A;  2PSR A;  2JC2 A;  2LHL A;  1YUT A;  3IF7 A;  1K9U A;  2LCP A;  1SYM A;  5PAL A;  1J7O A;  3JVT B;  3TDI A;  1Y6W A;  2JNX A;  2M1U A;  5HKZ A;  1E8A A;  3OP0 A;  1B8C A;  1DVI A;  1QIV A;  5I2L A;  3BOW A;  4MN0 A;  1CLB A;  1RFJ A;  2PMY A;  4MZL A;  3O6B A;  1CFD A;  3PSR A;  1GGZ A;  1G4Y R;  2KI6 C;  1JUO A;  1DJX A;  1GJY A;  3A8R A;  5JJG A;  1AK8 A;  3EVR A;  4M2P A;  2KAX A;  1XFX O;  4GNK B;  3SIA A;  1PUL A;  5AXI A;  1U5I B;  1IWQ A;  2BE6 A;  2AUC A;  3E3R A;  3PN7 B;  5JOL A;  2KYC A;  2F8P A;  1KK8 B;  1WLM A;  1JF2 A;  4DRW A;  1SPY A;  1DJI A;  1W7J B;  1ALV A;  5D69 A;  1UHN A;  4YBH B;  5AEQ A;  1PAL A;  4JQ0 D;  1IRJ A;  3SG4 A;  4A4B A;  2Y4Q A;  2JXC A;  3EKJ A;  1QVI Y;  1K9P A;  1IGV A;  1UHH A;  3LL8 B;  2MLF C;  3KPX A;  4N1F A;  1SBJ A;  2L5X B;  2LHI A;  3TS5 B;  1CKK A;  1QX2 A;  1B9A A;  5BPJ A;  3CGA A;  1A03 A;  2L4H A;  3BUM B;  3DVM A;  2LAP A;  2EC6 C;  2JT0 A;  1OMR A;  2JT8 A;  3EK7 A;  2M49 B;  2MBX A;  4I5L B;  2L50 A;  2LLS A;  3DF0 B;  1MF8 B;  1H8B A;  1EJ3 A;  2JZI A;  5HKY A;  1SMG A;  2KBM A;  4MRX A;  1CNP A;  4WQ3 A;  1DT7 B;  1FF1 A;  1FI6 A;  1VRK A;  5ER4 X;  1CFF A;  4NDB A;  4P5O E;  2KGR A;  1BU3 A;  2KQ6 A;  3ZWH A;  3WHU B;  2FCE A;  3EKH A;  1DJH A;  1YX7 A;  4JWQ A;  4PDZ A;  4FTG A;  1BLQ A;  2KQY A;  1A4P A;  3VRR A;  2L4I A;  1OMD A;  2KI4 C;  2ZRS A;  2FCD A;  2KAY A;  2M3W A;  3WNX B;  2ISD A;  2AMI A;  3EK8 A;  1AVS A;  3C1V A;  1B4C A;  5AER A;  1BR4 B;  1ZOT B;  2F2O A;  2LVI A;  4MZJ A;  4C0L A;  3CR4 X;  1F55 A;  2LNK A;  1IJ5 A;  1RRO A;  1S6J A;  2O5G A;  4XJK B;  2DOQ A;  2LVK A;  1BT6 A;  2M0R A;  2TN4 A;  4MZK A;  2JTT A;  2LMU A;  4M2Q A;  3NSK A;  4AOM A;  3BQ3 A;  2LMV A;  2BEC A;  5I2O A;  1JBA A;  1SR6 C;  2LP3 A;  3I5H C;  3I5F C;  1KQM C;  2M1K B;  2MAZ A;  3NSI A;  1ZMZ A;  4ORB B;  3BUO B;  3PAL A;  1S36 A;  3HX4 A;  3CLN A;  1NSH A;  1IJ6 A;  2OS8 C;  1M63 B;  2EC6 B;  4GPL B;  1H4B A;  4YGB B;  5KSZ A;  1JWD A;  3OX5 A;  3BUW B;  3BUN B; 
#chains in the Genus database with same CATH topology
 2QPT A;  2JT3 A;  2K61 A;  2PVB A;  3BFA A;  3D0Y A;  2H8V A;  1ZFS A;  5AAN A;  4OV2 A;  1Y1X A;  2JUL A;  3CR5 X;  3O4Y A;  1B8L A;  1SCM C;  1UUR A;  2G9B A;  2JTZ A;  1ODB A;  3I5G C;  2QAC A;  5TNC A;  3MSE B;  1TRF A;  1G8I A;  1ZAC A;  3SG5 A;  1QX7 A;  2CT9 A;  3LCP C;  2Y1N A;  5KTY A;  1ORG A;  2M97 A;  1WRK A;  4N1G A;  1PVA A;  1TNQ A;  3CR2 A;  2LVV A;  1RJV A;  5CSN A;  2BCB A;  3SJS A;  3IQQ A;  2NXQ A;  2HF5 A;  1QV1 A;  5DKR A;  1JSA A;  2ZND A;  1RK9 A;  3OHM B;  3GK1 A;  2BAP A;  3L47 A;  4MVF A;  1OZO A;  2FOT A;  1TCO B;  1TNX A;  3DVE A;  2Q4U A;  5CSJ A;  1K90 D;  1TNP A;  1DF0 A;  2NLN A;  1PK0 D;  3KEV A;  4IJ7 A;  4KYN A;  1JC2 A;  1OQP A;  2KHN A;  3OGN A;  1YUU A;  4R1E A;  1MXE A;  1LKJ A;  3LLE A;  2OPO A;  4C0J A;  1K9K A;  1WDC B;  2BE4 A;  4ZCU A;  3O78 A;  4Q04 A;  1J55 A;  1X02 A;  4PAL A;  2WCK A;  3SG3 A;  3EK4 A;  2SCP A;  1SR6 B;  4I5N B;  2JXL A;  3WXA A;  1F70 A;  2PAS A;  3FWB A;  3I5H B;  3SS3 A;  3I5F B;  1BMO A;  3I5I C;  4YI8 A;  3WHT B;  4E68 A;  1YR5 A;  1KQM B;  1QLK A;  1QS7 A;  1S5G Y;  4AQI A;  5B8I B;  2K2A A;  1KCY A;  5G08 A;  1NIW A;  1MHO A;  1NPQ A;  1YUR A;  1ZUZ A;  1OOG A;  1S1E A;  3FS7 A;  1M31 A;  2OS8 B;  5HYD A;  1K2H A;  2KFH A;  2D8N A;  3ICB A;  4I5J A;  4PHK A;  2K7C A;  4YGA A;  3QME A;  2HPS A;  1UHK A;  2PQL A;  1REC A;  1IG5 A;  3NXA A;  1AUI B;  1NX3 A;  3PM2 A;  4GBA A;  1KQV A;  1DEL A;  3BXK A;  1UHJ A;  1W7I B;  2WCB A;  4C0K A;  1C07 A;  2H61 A;  1C7V A;  2L98 A;  3JTD B;  1C7W A;  3SS4 A;  1Y1U A;  4ZCV A;  1QAS A;  1XFW O;  2E6W A;  1YRT B;  2BKI B;  1EXR A;  1KSO A;  1B1G A;  1MR8 A;  2L51 A;  2CTN A;  1GGW A;  2BBM A;  1AP4 A;  1N0Y A;  1QX5 B;  2QDI A;  1KWO C;  2NCP A;  3NSO A;  2K7O A;  2PYQ A;  3CYZ A;  3K1E A;  2LUC A;  1QJT A;  3N7H A;  3OB2 B;  3PLF B;  3OB1 B;  3FE6 A;  4F7F A;  3B87 A;  1C3Z A;  1M45 A;  1A2X A;  1SY9 A;  4HSZ A;  3VRO A;  3IQO A;  2MRD A;  4U8D A;  1F4O A;  2LUX A;  1FPW A;  1QV0 A;  1U5I A;  3S0A A;  4XYN A;  1SL8 A;  2CXJ A;  4ICB A;  2K2F A;  3B88 A;  1JFJ A;  2OTG C;  1F8H A;  2H2K A;  2A4J A;  4YRU A;  3NHT A;  2P71 A;  3D10 A;  1V1G A;  1SL7 A;  2H61 C;  3D0Y B;  1A29 A;  1NYA A;  2KI6 D;  1XFZ O;  4PE0 A;  3AAK A;  4WQ2 A;  4HRH A;  3JVT C;  2NZ0 A;  4YGC B;  1DGU A;  2FJY A;  4CPV A;  2MLE C;  3CS1 A;  2Y5I A;  1FBV A;  3CZT X;  3I5I B;  1B7T Z;  2ZKM X;  4JD9 A;  4PE4 A;  3D74 A;  5DKN A;  2WCL A;  4PT1 A;  3OX6 A;  1R2U A;  4GUK A;  1J1E A;  2P70 A;  1MXL C;  5DKQ A;  2Q91 A;  5FYX A;  2P6B B;  1XA5 A;  2KAV A;  4D1E A;  1LA3 A;  1XFR A;  1TNW A;  3FIA A;  2KNE A;  3S0B A;  2BCA A;  3S0D A;  1YRU B;  1K94 A;  2K7D A;  3PFV A;  3BOW B;  3VRN A;  1N65 A;  1NWD A;  1NX0 A;  1TN4 A;  1YVL A;  2BL0 C;  1IIO A;  1WRL A;  1WRZ A;  4ORC B;  2M7L A;  5FI7 A;  1FI5 A;  2JPT A;  1YX8 A;  1DJY A;  1NP8 A;  5K89 A;  1CLM A;  1JF0 A;  5KU1 A;  5CPV A;  2F33 A;  1NCZ A;  2KFF A;  3KF9 A;  1F54 A;  4GAO A;  1S6I A;  4DCK A;  1F4Q A;  1TCF A;  1MUX A;  1SW8 A;  2I7A A;  2WC5 A;  1CFP A;  4INX A;  1B47 A;  1IH0 A;  4YI9 A;  1KWO B;  2LE9 B;  1QXP A;  4DIR A;  2WOS A;  2HQ8 A;  3TUY C;  1HQV A;  3TZ1 A;  1TUZ A;  2GV5 A;  4HRG A;  1UUS A;  2KI4 B;  2KSP A;  2RGI A;  2CNP A;  1LXF C;  2O60 A;  1OOJ A;  4ETO A;  1EG4 A;  4IL1 A;  1AJ4 A;  1SRA A;  4QJ5 B;  2KYF A;  3RZS A;  1IQ3 A;  1G33 A;  5J3X A;  1CFC A;  2KLD A;  4XJK A;  1IQ5 A;  5F6T A;  4PE1 A;  2ZN8 A;  4MEW A;  1NUB A;  1KSM A;  2JQ6 A;  3BUX B;  4OKH A;  1B8R A;  4CID A;  1BR1 B;  2IS9 A;  3CTN A;  4PHN A;  1AHR A;  4A4C A;  2OTG B;  4YGE B;  1EH2 A;  4CFQ A;  5FI2 A;  2LP2 A;  2CCM A;  2E30 A;  4N5X A;  2PAL A;  1DC1 A;  1B7T Y;  2WND A;  1NCX A;  2I18 A;  2LM5 A;  3BYA A;  3D76 A;  1PSR A;  1OE9 B;  1CM4 A;  2ZRT A;  2Y1M A;  1L2O C;  1NX2 A;  3DVJ A;  1SKT A;  2F2P A;  2R2I A;  4OCI A;  3QRX A;  1XFY O;  2L0P A;  4OR9 B;  1C3Y A;  2MA2 A;  1HT9 A;  4OVN F;  3AAJ A;  3R1O A;  4ORA B;  2M8U A;  1WY9 A;  1A75 A;  1T14 A;  1TOP A;  2GGM A;  2L5Y A;  2AAO A;  1GQM A;  2LC5 A;  5HLO A;  3SIB A;  3FE8 A;  3KHE A;  3EVV A;  4BY5 A;  2BBN A;  1DJW A;  1DTL A;  4NDC A;  2I2R E;  2JRF A;  3CZ0 A;  1M39 A;  3NSL A;  5HLV A;  2JWW A;  1DMO A;  1DGV A;  2HET A;  2MJW B;  1J7Q A;  1EG3 A;  1KFU S;  2JNF A;  2ERB A;  4GGF A;  1FW4 A;  4MLW A;  2BL0 B;  1F71 A;  1SL9 A;  2EHB A;  3VRQ A;  2K0J A;  3O2P A;  1DJG A;  3A4U B;  1SK6 D;  2FJU B;  4P2Y B;  4WRI A;  4FQT A;  1D1O A;  1K93 D;  1LA0 A;  4USL A;  3HCM A;  1M46 A;  2GTE A;  1KFX S;  2WCF A;  4DUQ A;  1TUJ A;  1TWO A;  4NQG A;  4HRE E;  1SCM B;  3I5G B;  5I94 A;  3FWC A;  4QJ3 B;  3GK2 A;  5CSF A;  3TUY B;  1Y1A A;  1CDN A;  5HKW A;  4M2O A;  4CLN A;  2KLE A;  3M0W A;  3BJH A;  1XFV O;  5D7F A;  2KGB C;  2LV7 A;  3EVU A;  2NCO A;  2WCH A;  2F3Z A;  1Q80 A;  3EG5 B;  1RWY A;  2QEV A;  1LIN A;  2HQW A;  3PAT A;  4QJ4 B;  2K60 A;  3AKB A;  5I2Q A;  1BOC A;  2MHH A;  3RM1 A;  1J7P A;  4YGD B;  1BJF A;  1S6C A;  1RTP 1;  4GGF C;  5ER5 A;  2KOT A;  2B1U A;  1V1F A;  2KBI A;  4OZD A;  2L2E A;  2JOJ A;  5FI6 A;  2ZN9 A;  1K8U A;  1EL4 A;  1MQ1 A;  3AKA A;  4JPZ B;  1XVJ A;  1CMF A;  1BF5 A;  1GM0 A;  2BCX A;  3GK4 X;  1KK7 Z;  1DJZ A;  1N2D A;  3FE9 A;  2SAS A;  3TDU A;  1L2O B;  2JPO A;  3BFH A;  1QLS A;  2ZFD A;  2M29 A;  3H4S E;  1XO5 A;  4NDD A;  1UHI A;  2K8M B;  2WCE A;  2BNX A;  3PM8 A;  1OOF A;  4I5K A;  4L9M A;  1KFU L;  4PHM A;  5IBW A;  4UPG A;  3ZNI A;  1UWO A;  3DF0 A;  1QAT A;  3VGO A;  1L7Z A;  3DYE A;  1CM1 A;  4F0Z B;  1AJ5 A;  1S26 D;  1NCY A;  2EGD A;  3CWG A;  3PJI A;  1UP5 A;  1ALW A;  2I94 A;  1KFX L;  4GFT A;  2KDH A;  2M9G A;  4GGN A;  4MBE A;  3F45 A;  3GOF A;  3PN7 C;  3R1V A;  2CBL A;  4FQO A;  1XK4 A;  1K96 A;  2LLT A;  1YTZ C;  1KK8 C;  1OSA A;  1WDC C;  3DD4 A;  3LK1 A;  3OBV A;  1DF0 B;  1CLL A;  2VRG A;  3DVK A;  3SG6 A;  1P28 A;  2F3Y A;  1CDM A;  3SG2 A;  1BG1 A;  3K21 A;  1Y0V H;  2G2B A;  3CZ2 A;  4BY4 A;  1IKU A;  3S0E A;  5I8N A;  4CFR A;  1SNL A;  2JU0 A;  2QEO A;  1PSB A;  4MRY A;  4DS7 A;  3O4X A;  2PRU A;  1MWN A;  1XYD A;  4PE7 A;  4PCW A;  5GQQ C;  2WOR A;  1JFK A;  3R1P A;  4TNC A;  2LLU A;  3TS5 C;  2KFG A;  3TDZ A;  3B6X A;  2COL B;  1LVC D;  1CTR A;  1QTX A;  1WLZ A;  2ZNE A;  3UO9 A;  2QEB A;  1A75 B;  1Z4H A;  3LK0 A;  1BOD A;  2GGZ A;  3SG7 A;  1J7R A;  1K95 A;  1SCV A;  2WC8 A;  1YUS A;  4PHJ A;  1S5G Z;  5AFP A;  1TTX A;  1QVI Z;  1J1D A;  1XFU O;  1OZS A;  1CB1 A;  1CDL A;  1KK7 Y;  1YVH A;  3RLZ A;  1TIZ A;  1S3P A;  3JTD C;  4MSP A;  3KO0 A;  2LAN A;  2BKH B;  2LVJ A;  1R6P A;  5EL2 A;  2KPH A;  2K7B A;  1NX1 A;  1CMG A;  1OMV A;  2LMT A;  3S0G A;  2M7N A;  1XK4 C;  4AQJ A;  5CSI A;  1QIW A;  3VB1 A;  1PVB A;  3R72 A;  1SSE B;  3VRP A;  1CDP A;  2V53 A;  1PRW A;  2PSR A;  2JC2 A;  2LHL A;  1YUT A;  3IF7 A;  1K9U A;  2LCP A;  1SYM A;  5PAL A;  1J7O A;  3JVT B;  3TDI A;  4INW A;  1Y6W A;  2JNX A;  2M1U A;  5HKZ A;  1E8A A;  3OP0 A;  1B8C A;  1DVI A;  1QIV A;  3B86 A;  5I2L A;  3BOW A;  4MN0 A;  1CLB A;  1RFJ A;  2PMY A;  4MZL A;  2L2C A;  3O6B A;  1CFD A;  3PSR A;  1OOI X;  1GGZ A;  1G4Y R;  2KI6 C;  3CZ1 A;  1JUO A;  1DJX A;  1GJY A;  3A8R A;  2WCM A;  3D78 A;  5JJG A;  1AK8 A;  3EVR A;  4M2P A;  5HL1 A;  3IVT A;  2KAX A;  1OOH A;  1XFX O;  4GNK B;  3SIA A;  1PUL A;  5AXI A;  3D75 A;  1U5I B;  1IWQ A;  2BE6 A;  2AUC A;  3E3R A;  3PN7 B;  5JOL A;  2KYC A;  2F8P A;  1KK8 B;  1Z2C B;  1WLM A;  1JF2 A;  4DRW A;  1SPY A;  1DJI A;  1W7J B;  3CDN A;  1ALV A;  5D69 A;  1UHN A;  4YBH B;  5AEQ A;  1PAL A;  4JQ0 D;  3NGV A;  1IRJ A;  3SG4 A;  3S0F A;  4A4B A;  2Y4Q A;  2JXC A;  3EKJ A;  1QVI Y;  3L4L A;  3DZT A;  1K9P A;  1IGV A;  1UHH A;  3LL8 B;  2MLF C;  3KPX A;  4N1F A;  1SBJ A;  2L5X B;  2LHI A;  3TS5 B;  1CKK A;  1QX2 A;  1B9A A;  5BPJ A;  3CGA A;  1A03 A;  2L4H A;  3BUM B;  3DVM A;  2LAP A;  2EC6 C;  2JT0 A;  1OMR A;  2JT8 A;  3EK7 A;  2M49 B;  2MBX A;  3UNW A;  4I5L B;  3NHI A;  2L50 A;  2LLS A;  3DF0 B;  1MF8 B;  1H8B A;  1EJ3 A;  2JZI A;  3SS5 A;  5HKY A;  1SMG A;  2KBM A;  4MRX A;  1CNP A;  4WQ3 A;  1DT7 B;  1FF1 A;  1FI6 A;  1VRK A;  5ER4 X;  1CFF A;  4JKT A;  4NDB A;  4P5O E;  2KGR A;  1BU3 A;  2KQ6 A;  3ZWH A;  3B7A A;  3WHU B;  2YGU A;  2FCE A;  3EKH A;  1DJH A;  1YX7 A;  4JWQ A;  4PDZ A;  4FTG A;  1BLQ A;  3CAB A;  2KQY A;  1A4P A;  3VRR A;  2L4I A;  1OMD A;  2KI4 C;  2ZRS A;  3Q8I A;  2FCD A;  2KAY A;  2M3W A;  3WNX B;  2ISD A;  1OW4 A;  2AMI A;  3L4A A;  3EK8 A;  1AVS A;  3C1V A;  1B4C A;  5AER A;  1BR4 B;  1ZOT B;  2F2O A;  2LVI A;  4MZJ A;  4C0L A;  3CR4 X;  5D3O A;  1F55 A;  2LNK A;  5DIC A;  1IJ5 A;  1RRO A;  1S6J A;  3DXL A;  2O5G A;  4XJK B;  2DOQ A;  2LVK A;  1BT6 A;  2M0R A;  2TN4 A;  4MZK A;  2JTT A;  2LMU A;  4M2Q A;  3NSK A;  3BFB A;  4AOM A;  3BQ3 A;  2LMV A;  2BEC A;  5I2O A;  1JBA A;  1SR6 C;  1LS8 A;  2LP3 A;  3I5H C;  2WC6 A;  3I5F C;  1KQM C;  2M1K B;  2MAZ A;  3NSI A;  1W9Z A;  1ZMZ A;  3V2L A;  4ORB B;  3BUO B;  3PAL A;  1S36 A;  3D73 A;  3HX4 A;  3CLN A;  1NSH A;  1IJ6 A;  2OS8 C;  2QEH A;  1DEK A;  1M63 B;  2EC6 B;  4GPL B;  1H4B A;  4YGB B;  5KSZ A;  1JWD A;  1QWV A;  3OX5 A;  2WCJ A;  1DQE A;  3DY9 A;  3BUW B;  3BUN B;  3D77 A; 
#chains in the Genus database with same CATH homology
 2QPT A;  2JT3 A;  2K61 A;  2PVB A;  3D0Y A;  1ZFS A;  5AAN A;  4OV2 A;  1Y1X A;  2JUL A;  3CR5 X;  3O4Y A;  1B8L A;  1SCM C;  1UUR A;  2G9B A;  2JTZ A;  1ODB A;  3I5G C;  2QAC A;  5TNC A;  3MSE B;  1TRF A;  1G8I A;  1ZAC A;  3SG5 A;  1QX7 A;  2CT9 A;  3LCP C;  2Y1N A;  5KTY A;  2M97 A;  1WRK A;  4N1G A;  1PVA A;  1TNQ A;  3CR2 A;  2LVV A;  1RJV A;  5CSN A;  2BCB A;  3SJS A;  3IQQ A;  2NXQ A;  2HF5 A;  1QV1 A;  5DKR A;  1JSA A;  2ZND A;  1RK9 A;  3OHM B;  3GK1 A;  4MVF A;  1OZO A;  2FOT A;  1TCO B;  1TNX A;  3DVE A;  2Q4U A;  5CSJ A;  1K90 D;  1TNP A;  1DF0 A;  2NLN A;  1PK0 D;  3KEV A;  1JC2 A;  1OQP A;  2KHN A;  1YUU A;  4R1E A;  1MXE A;  1LKJ A;  3LLE A;  2OPO A;  4C0J A;  1K9K A;  1WDC B;  2BE4 A;  4ZCU A;  3O78 A;  4Q04 A;  1J55 A;  1X02 A;  4PAL A;  3SG3 A;  3EK4 A;  2SCP A;  1SR6 B;  4I5N B;  2JXL A;  3WXA A;  1F70 A;  2PAS A;  3FWB A;  3I5H B;  3I5F B;  1BMO A;  3I5I C;  4YI8 A;  3WHT B;  4E68 A;  1YR5 A;  1KQM B;  1QLK A;  1QS7 A;  1S5G Y;  4AQI A;  5B8I B;  2K2A A;  1KCY A;  5G08 A;  1NIW A;  1MHO A;  1NPQ A;  1YUR A;  1ZUZ A;  1S1E A;  3FS7 A;  1M31 A;  2OS8 B;  5HYD A;  1K2H A;  2KFH A;  2D8N A;  3ICB A;  4I5J A;  4PHK A;  2K7C A;  4YGA A;  2HPS A;  1UHK A;  1REC A;  1IG5 A;  3NXA A;  1AUI B;  1NX3 A;  4GBA A;  1KQV A;  3BXK A;  1UHJ A;  1W7I B;  2WCB A;  4C0K A;  1C07 A;  2H61 A;  1C7V A;  2L98 A;  3JTD B;  1C7W A;  1Y1U A;  4ZCV A;  1QAS A;  1XFW O;  2E6W A;  1YRT B;  2BKI B;  1EXR A;  1KSO A;  1B1G A;  1MR8 A;  2L51 A;  2CTN A;  1GGW A;  2BBM A;  1AP4 A;  1N0Y A;  1QX5 B;  1KWO C;  2NCP A;  3NSO A;  2K7O A;  2LUC A;  1QJT A;  3OB2 B;  3PLF B;  3OB1 B;  1SY9 A;  1M45 A;  1A2X A;  4HSZ A;  3VRO A;  3IQO A;  2MRD A;  4U8D A;  1F4O A;  2LUX A;  1FPW A;  1QV0 A;  1U5I A;  4XYN A;  1SL8 A;  2CXJ A;  4ICB A;  2K2F A;  1JFJ A;  2OTG C;  1F8H A;  2H2K A;  2A4J A;  4YRU A;  3D10 A;  1V1G A;  1SL7 A;  2H61 C;  3D0Y B;  1A29 A;  1NYA A;  2KI6 D;  1XFZ O;  4PE0 A;  3AAK A;  4WQ2 A;  4HRH A;  3JVT C;  2NZ0 A;  4YGC B;  1DGU A;  4CPV A;  2MLE C;  3CS1 A;  2Y5I A;  1FBV A;  3CZT X;  3I5I B;  1B7T Z;  2ZKM X;  4PE4 A;  5DKN A;  3OX6 A;  1R2U A;  4GUK A;  1J1E A;  1MXL C;  5DKQ A;  2Q91 A;  5FYX A;  2P6B B;  1XA5 A;  2KAV A;  4D1E A;  1LA3 A;  1TNW A;  3FIA A;  2KNE A;  2BCA A;  1YRU B;  1K94 A;  2K7D A;  3PFV A;  3BOW B;  3VRN A;  1N65 A;  2BL0 C;  1NWD A;  1NX0 A;  1TN4 A;  1YVL A;  1WRL A;  1WRZ A;  4ORC B;  2M7L A;  1FI5 A;  2JPT A;  1YX8 A;  1DJY A;  1NP8 A;  5K89 A;  1CLM A;  1JF0 A;  5KU1 A;  5CPV A;  2F33 A;  1NCZ A;  2KFF A;  3KF9 A;  1F54 A;  4GAO A;  1S6I A;  4DCK A;  1F4Q A;  1TCF A;  1MUX A;  1SW8 A;  2I7A A;  1B47 A;  1IH0 A;  4YI9 A;  1KWO B;  2LE9 B;  1QXP A;  4DIR A;  2WOS A;  2HQ8 A;  3TUY C;  1HQV A;  3TZ1 A;  2GV5 A;  4HRG A;  1UUS A;  2KI4 B;  2KSP A;  2RGI A;  2CNP A;  1LXF C;  2O60 A;  1OOJ A;  4ETO A;  1EG4 A;  4IL1 A;  1AJ4 A;  1SRA A;  4QJ5 B;  2KYF A;  1IQ3 A;  1G33 A;  5J3X A;  1CFC A;  4XJK A;  1IQ5 A;  5F6T A;  4PE1 A;  2ZN8 A;  4MEW A;  1NUB A;  1KSM A;  2JQ6 A;  3BUX B;  4OKH A;  1B8R A;  4CID A;  1BR1 B;  2IS9 A;  3CTN A;  4PHN A;  1AHR A;  4A4C A;  2OTG B;  4YGE B;  1EH2 A;  4CFQ A;  2LP2 A;  2CCM A;  2E30 A;  4N5X A;  2PAL A;  1B7T Y;  2WND A;  1NCX A;  2I18 A;  2LM5 A;  3BYA A;  1PSR A;  1OE9 B;  1CM4 A;  2ZRT A;  2Y1M A;  1L2O C;  1NX2 A;  3DVJ A;  1SKT A;  2F2P A;  2R2I A;  4OCI A;  3QRX A;  1XFY O;  2L0P A;  4OR9 B;  2MA2 A;  1HT9 A;  4OVN F;  3AAJ A;  4ORA B;  2M8U A;  1WY9 A;  1A75 A;  1TOP A;  2GGM A;  2LC5 A;  5HLO A;  2AAO A;  1GQM A;  1CFP A;  3SIB A;  4BY5 A;  3KHE A;  3EVV A;  2BBN A;  1DJW A;  1DTL A;  4NDC A;  2I2R E;  2JRF A;  3NSL A;  1M39 A;  5HLV A;  2JWW A;  1DMO A;  1DGV A;  2HET A;  2MJW B;  1J7Q A;  1EG3 A;  1KFU S;  2JNF A;  4GGF A;  1FW4 A;  4MLW A;  2BL0 B;  1F71 A;  1SL9 A;  2EHB A;  3VRQ A;  2K0J A;  3O2P A;  1DJG A;  3A4U B;  1SK6 D;  2FJU B;  4P2Y B;  4WRI A;  1D1O A;  1K93 D;  1LA0 A;  4USL A;  3HCM A;  1M46 A;  1KFX S;  2WCF A;  4DUQ A;  4NQG A;  4HRE E;  1SCM B;  3I5G B;  3FWC A;  4QJ3 B;  3GK2 A;  5CSF A;  3TUY B;  1Y1A A;  1CDN A;  5HKW A;  4M2O A;  4CLN A;  3M0W A;  1XFV O;  5D7F A;  2KGB C;  2LV7 A;  3EVU A;  2NCO A;  2F3Z A;  1Q80 A;  1RWY A;  1LIN A;  2HQW A;  3PAT A;  4QJ4 B;  3AKB A;  5I2Q A;  1BOC A;  2MHH A;  3RM1 A;  1J7P A;  4YGD B;  1BJF A;  1S6C A;  1RTP 1;  4GGF C;  5ER5 A;  2KOT A;  2B1U A;  1V1F A;  2KBI A;  2L2E A;  2JOJ A;  2ZN9 A;  1K8U A;  1EL4 A;  1MQ1 A;  3AKA A;  4JPZ B;  1XVJ A;  1CMF A;  1BF5 A;  2BCX A;  3GK4 X;  1KK7 Z;  1DJZ A;  1N2D A;  2SAS A;  3TDU A;  1L2O B;  1QLS A;  2ZFD A;  2M29 A;  3H4S E;  1XO5 A;  4NDD A;  1UHI A;  2K8M B;  2WCE A;  3PM8 A;  4L9M A;  4I5K A;  1KFU L;  4PHM A;  5IBW A;  4UPG A;  3ZNI A;  1UWO A;  3DF0 A;  1QAT A;  3VGO A;  1L7Z A;  4F0Z B;  1CM1 A;  1AJ5 A;  1S26 D;  1NCY A;  2EGD A;  3CWG A;  1UP5 A;  1ALW A;  2I94 A;  1KFX L;  4GFT A;  2KDH A;  2M9G A;  4GGN A;  4MBE A;  3F45 A;  3GOF A;  3PN7 C;  4FQO A;  2CBL A;  1XK4 A;  1K96 A;  2LLT A;  1YTZ C;  1KK8 C;  1OSA A;  1WDC C;  3DD4 A;  3LK1 A;  1DF0 B;  1CLL A;  2VRG A;  3DVK A;  3SG6 A;  2F3Y A;  1CDM A;  3SG2 A;  1BG1 A;  3K21 A;  1Y0V H;  2G2B A;  4BY4 A;  1IKU A;  5I8N A;  4CFR A;  1SNL A;  2JU0 A;  4MRY A;  1PSB A;  4DS7 A;  4PE7 A;  2PRU A;  1MWN A;  1XYD A;  4PCW A;  5GQQ C;  2WOR A;  1JFK A;  4TNC A;  2LLU A;  3TS5 C;  2KFG A;  3TDZ A;  2COL B;  1LVC D;  1CTR A;  1QTX A;  1WLZ A;  2ZNE A;  1A75 B;  3LK0 A;  1BOD A;  2GGZ A;  3SG7 A;  1J7R A;  1K95 A;  1SCV A;  2WC8 A;  1YUS A;  4PHJ A;  1S5G Z;  5AFP A;  1TTX A;  1QVI Z;  1J1D A;  1XFU O;  1OZS A;  1CB1 A;  1CDL A;  1KK7 Y;  1YVH A;  3RLZ A;  1TIZ A;  1S3P A;  3JTD C;  4MSP A;  3KO0 A;  2LAN A;  2BKH B;  2LVJ A;  1R6P A;  2K7B A;  1NX1 A;  1CMG A;  1OMV A;  2LMT A;  2M7N A;  1XK4 C;  4AQJ A;  5CSI A;  1QIW A;  1PVB A;  3VRP A;  1CDP A;  2V53 A;  1PRW A;  2PSR A;  2JC2 A;  2LHL A;  1YUT A;  3IF7 A;  1K9U A;  2LCP A;  1SYM A;  5PAL A;  1J7O A;  3JVT B;  3TDI A;  1Y6W A;  2JNX A;  2M1U A;  5HKZ A;  1E8A A;  3OP0 A;  1B8C A;  1DVI A;  1QIV A;  5I2L A;  3BOW A;  4MN0 A;  1CLB A;  1RFJ A;  2PMY A;  4MZL A;  3O6B A;  1CFD A;  3PSR A;  1GGZ A;  1G4Y R;  2KI6 C;  1JUO A;  1DJX A;  1GJY A;  3A8R A;  5JJG A;  1AK8 A;  3EVR A;  4M2P A;  2KAX A;  1XFX O;  4GNK B;  3SIA A;  1PUL A;  5AXI A;  1U5I B;  1IWQ A;  2BE6 A;  2AUC A;  3E3R A;  3PN7 B;  5JOL A;  2KYC A;  2F8P A;  1KK8 B;  1WLM A;  1JF2 A;  4DRW A;  1SPY A;  1DJI A;  1W7J B;  1ALV A;  5D69 A;  1UHN A;  4YBH B;  5AEQ A;  1PAL A;  4JQ0 D;  1IRJ A;  3SG4 A;  4A4B A;  2Y4Q A;  2JXC A;  3EKJ A;  1QVI Y;  1K9P A;  1IGV A;  1UHH A;  3LL8 B;  2MLF C;  3KPX A;  4N1F A;  1SBJ A;  2L5X B;  2LHI A;  3TS5 B;  1CKK A;  1QX2 A;  1B9A A;  5BPJ A;  3CGA A;  1A03 A;  2L4H A;  3BUM B;  3DVM A;  2LAP A;  2EC6 C;  2JT0 A;  1OMR A;  2JT8 A;  3EK7 A;  2M49 B;  2MBX A;  4I5L B;  2L50 A;  2LLS A;  3DF0 B;  1MF8 B;  1H8B A;  1EJ3 A;  2JZI A;  5HKY A;  1SMG A;  2KBM A;  4MRX A;  1CNP A;  4WQ3 A;  1DT7 B;  1FF1 A;  1FI6 A;  1VRK A;  5ER4 X;  1CFF A;  4NDB A;  4P5O E;  2KGR A;  1BU3 A;  2KQ6 A;  3ZWH A;  3WHU B;  2FCE A;  3EKH A;  1DJH A;  1YX7 A;  4JWQ A;  4PDZ A;  4FTG A;  1BLQ A;  2KQY A;  1A4P A;  3VRR A;  2L4I A;  1OMD A;  2KI4 C;  2ZRS A;  2FCD A;  2KAY A;  2M3W A;  3WNX B;  2ISD A;  2AMI A;  3EK8 A;  1AVS A;  3C1V A;  1B4C A;  5AER A;  1BR4 B;  1ZOT B;  2F2O A;  2LVI A;  4MZJ A;  4C0L A;  3CR4 X;  1F55 A;  2LNK A;  1IJ5 A;  1RRO A;  1S6J A;  2O5G A;  4XJK B;  2DOQ A;  2LVK A;  1BT6 A;  2M0R A;  2TN4 A;  4MZK A;  2JTT A;  2LMU A;  4M2Q A;  3NSK A;  4AOM A;  3BQ3 A;  2LMV A;  2BEC A;  5I2O A;  1JBA A;  1SR6 C;  2LP3 A;  3I5H C;  3I5F C;  1KQM C;  2M1K B;  2MAZ A;  3NSI A;  1ZMZ A;  4ORB B;  3BUO B;  3PAL A;  1S36 A;  3HX4 A;  3CLN A;  1NSH A;  1IJ6 A;  2OS8 C;  1M63 B;  2EC6 B;  4GPL B;  1H4B A;  4YGB B;  5KSZ A;  1JWD A;  3OX5 A;  3BUW B;  3BUN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...