2GV5A

Crystal structure of sfi1p/cdc31p complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
LNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Structural role of Sfi1p-centrin filaments in budding yeast spindle pole body duplication.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2gv5A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2gv5A01
2L51A 4GBAA 1SR6B 4I5LB 3SG5A 4XJKB 2K7CA 2KGRA 4I5JA 1S6JA 4ICBA 1B47A 1NX0A 3FWCA 3CR2A 1SL7A 2Y1NA 2BBNA 2LP2A 1LINA 4M2PA 4USLA 1BG1A 1QVIZ 2JOJA 1OZOA 4YBHB 1QX5B 3I5IC 2KAXA 3O2PA 1S3PA 1DJHA 1UURA 2GGZA 3D10A 1Q80A 1RROA 1R2UA 1CLBA 3EK8A 2F2PA 3TUYB 1CTRA 2JU0A 3BYAA 5AERA 3SG6A 1CDPA 1WLZA 4Q04A 3PALA 3KF9A 1KK7Y 3JVTB 5AEQA 1WDCB 2A4JA 2ZRSA 4YGEB 1ALVA 1CKKA 1TNQA 2CNPA 2M1KB 1QX2A 1GQMA 2BL0B 3HCMA 2D8NA 3VRPA 1KCYA 1K94A 1L2OC 3PLFB 4CFQA 3PATA 1F70A 1YUUA 2LLTA 4PHJA 4MSPA 1DMOA 3TDUA 1CDNA 2KAVA 3I5FB 2K0JA 1EG3A 1CMFA 1TTXA 1XA5A 4YI9A 2OS8C 1NSHA 2CTNA 1KWOC 2QPTA 1XFUO 3SG2A 4DCKA 3SG3A 3FIAA 5CSFA 2MRDA 2DOQA 3DF0B 2LMUA 2JT3A 3EVRA 1EL4A 5DKNA 1RK9A 3ZNIA 1MQ1A 2F2OA 1B8RA 4PE7A 1M31A 5ER4X 1SPYA 2L4IA 3CS1A 4YGCB 1DJXA 3CTNA 1CM4A 1XFYO 3PN7B 1RECA 1NCXA 1DJGA 2LV7A 1X02A 3NSLA 1SCVA 2I2RE 2MA2A 2FCEA 1TNPA 1JBAA 2MHHA 1WRKA 4PCWA 5D7FA 1J55A 1UHHA 4QJ5B 3BOWA 2EHBA 2E30A 1QTXA 1AUIB 2M1UA 4PDZA 1MUXA 2ISDA 2L2EA 4F0ZB 1OOJA 2ZNEA 2Y1MA 2BBMA 3IQOA 2WNDA 1SNLA 2FOTA 1YVLA 1KK8C 2KBMA 3SIBA 4WQ3A 3I5GB 4GPLB 3BUOB 1XO5A 3SG4A 3LLEA 4DS7A 1CMGA 4I5NB 1E8AA 4ORBB 3PSRA 2F3ZA 5F6TA 4MRYA 1BODA 4PHNA 1ZMZA 3VGOA 3E3RA 4PE1A 1A03A 1NCYA 2F3YA 1XFXO 1Y6WA 2KFGA 2BE4A 1SKTA 4YGAA 2LAPA 5KU1A 1V1FA 1RWYA 1B7TY 3BOWB 2RGIA 2HF5A 1S6CA 1U5IB 1KQVA 2BECA 3RLZA 4GGNA 4PALA 2JPTA 3OB2B 2KNEA 1FBVA 4BY4A 1UP5A 2HPSA 5TNCA 1SCMB 4CIDA 1S5GY 2KQYA 1JFJA 1OE9B 4U8DA 2PALA 3GK2A 1DVIA 1F4OA 1QLKA 4GAOA 1DJIA 1SMGA 3AKAA 1YUSA 2ZKMX 1QV1A 4YGDB 3LK0A 3SIAA 4NDDA 2AAOA 1F71A 1XK4C 4E68A 2LLUA 1YVHA 3LK1A 1IQ5A 3EVVA 2JTZA 1KFXL 2M7LA 2LNKA 1FI6A 1K95A 4QJ3B 5I2LA 1JWDA 1F4QA 4PHKA 3GK4X 1OZSA 5AXIA 1QIVA 3K21A 2EC6C 1G33A 4DRWA 2PVBA 2WCBA 1A29A 5HKYA 2JNFA 3OB1B 5J3XA 1DJZA 1NYAA 2L98A 4MZJA 1NIWA 2M3WA 1B8LA 1DGUA 3HX4A 3M0WA 2OTGC 3BQ3A 3CR4X 1PK0D 1CFPA 1QASA 2PRUA 1KSMA 2LVIA 1ODBA 1K2HA 1JF2A 5HYDA 2G2BA 3DVEA 4FTGA 1SW8A 3NSOA 2L0PA 2L50A 2LC5A 3EK4A 4HRHA 2KDHA 1S36A 1N65A 3TDZA 5JJGA 1SR6C 1LXFC 2BKIB 4WQ2A 1ZUZA 2MJWB 1S26D 2HQ8A 3I5HB 2P6BB 1PVAA 2WCFA 3OX6A 3WNXB 1WLMA 2JULA 3CZTX 1TIZA 2B1UA 3AAJA 3BUWB 5I2QA 5CSNA 2JT8A 3DVJA 5AFPA 3GK1A 2K2FA 1H4BA 4TNCA 3VROA 1S5GZ 3KHEA 1BLQA 1D1OA 1DF0A 2LE9B 3O6BA 3OHMB 4A4BA 1B4CA 3WXAA 1M63B 4BY5A 2V53A 1BF5A 3TUYC 4NDBA 1KFXS 1G8IA 1BJFA 3OX5A 2TN4A 4JQ0D 1PULA 3EK7A 3WHUB 1OQPA 2MLFC 2LVJA 3JVTC 2KHNA 5IBWA 2CT9A 1QXPA 4C0JA 4HSZA 4HREE 2BL0C 1LKJA 2KSPA 2LMVA 3GOFA 1QATA 1QV0A 1WRLA 3KPXA 4N5XA 2MBXA 1B1GA 1ALWA 3D0YA 1XFWO 3RM1A 1F54A 1EH2A 3DVMA 1ZACA 2KGBC 2KOTA 1DF0B 3IF7A 4QJ4B 2L4HA 2MAZA 3NSKA 1NCZA 5HKWA 1NPQA 1PSBA 1MHOA 1TNXA 1TRFA 4OCIA 3NSIA 4MBEA 2SASA 1FW4A 1CM1A 2ZFDA 1BU3A 1TN4A 1M39A 1UHJA 2K7DA 2WCEA 2BCAA 1PSRA 1IQ3A 4I5KA 1Y1XA 1L7ZA 2KI6D 3CWGA 3MSEB 3KEVA 4GFTA 2NXQA 3F45A 1CB1A 2K7BA 1RFJA 2KI4B 2M7NA 1QIWA 4M2OA 4OV2A 1M46A 1UHKA 2CBLA 2BE6A 2MLEC 3PN7C 1EXRA 4OVNF 1KK7Z 1W7JB 1YTZC 3DD4A 3AAKA 1K9UA 2M97A 2JT0A 3BUMB 2QACA 1M45A 3TS5B 2LHIA 2KBIA 5KTYA 1C07A 1K8UA 1MR8A 2NLNA 5FYXA 3ICBA 1DJYA 1J7QA 1OMDA 1AP4A 1SL9A 2NCPA 1CFCA 4YRUA 1AK8A 1R6PA 2JQ6A 2KQ6A 2O5GA 1NX2A 1XFVO 3BXKA 1GGZA 2IS9A 1HT9A 2Q4UA 1VRKA 3I5GC 2H61C 2OPOA 1K90D 1KQMB 3JTDB 1AJ4A 2ZRTA 1Y0VH 1YX8A 2BCXA 3CR5X 2GGMA 4JPZB 4MZLA 1UWOA 4P2YB 4PE4A 2JRFA 1DGVA 4P5OE 2K8MB 5AANA 3BUXB 4XJKA 3EKJA 4PE0A 1IGVA 2Q91A 1DJWA 1PRWA 5PALA 1BR4B 2G9BA 2LUCA 2KYFA 2VRGA 1KSOA 2LHLA 4C0LA 2PASA 1K9PA 1NP8A 1KFUL 2JTTA 5ER5A 2I94A 4GGFC 4ORAB 3BUNB 4YI8A 1SCMC 4N1GA 4R1EA 5CSIA 2F8PA 1K93D 2CCMA 5JOLA 4MN0A 2AUCA 1JUOA 1MWNA 1BR1B 2JC2A 3TDIA 1BOCA 3PFVA 2H2KA 1SK6D 3I5IB 4C0KA 1EJ3A 1S6IA 1CFDA 1UHIA 1EG4A 2JXCA 5G08A 1A2XA 2COLB 4OR9B 1K9KA 3DVKA 4NQGA 1UHNA 1K96A 3VRQA 4DIRA 1MF8B 2CXJA 1Y1AA 1Y1UA 4MLWA 1JC2A 1OSAA 4ETOA 1LA3A 2K61A 1JSAA 1JFKA 2ZN9A 3EKHA 5CSJA 4WRIA 5BPJA 2L5XB 2JWWA 1OMRA 1A4PA 1XVJA 5HLOA 1B7TZ 2I18A 1IKUA 2LVKA 1J7RA 1CLLA 5K89A 2LP3A 3AKBA 3WHTB 2I7AA 1L2OB 4OKHA 5DKQA 1UUSA 4JWQA 2KFFA 5HKZA 4MEWA 4ZCUA 1CFFA 1AVSA 1IG5A 4HRGA 1RJVA 3O4YA 5DKRA 3TZ1A 1C7WA 2FJUB 2OS8B 1W7IB 1KWOB 3DF0A 1SY9A 1QLSA 1ZFSA 1J7OA 4N1FA 1JF0A 1IJ5A 1YX7A 2F33A 3I5HC 1WDCC 5B8IB 1SRAA 2WOSA 4MZKA 2ZN8A 1KFUS 2KFHA 4CPVA 1N0YA 2NCOA 1B9AA 4IL1A 1QJTA 1H8BA 1A75A 3PM8A 3A4UB 1IH0A 1OMVA 1YR5A 2K2AA 1XFZO 1CDMA 3NXAA 1TCFA 1NX1A 5I8NA 3I5FC 3LL8B 2Y4QA 1C7VA 3SG7A 1TNWA 3KO0A 1CLMA 1XYDA 5HLVA 2BCBA 2WC8A 4GNKB 4GUKA 1F55A 1SL8A 1TOPA 2LUXA 2HQWA 1KK8B 2PSRA 2LMTA 2H61A 1V1GA 2BKHB 4DUQA 3CGAA 2M49B 3A8RA 4ORCB 1NUBA 1CDLA 4AQJA 1IJ6A 1XK4A 1BMOA 2LLSA 1QS7A 4NDCA 1N2DA 5I2OA 1MXLC 4M2QA 3SJSA 2LM5A 1YURA 2O60A 1A75B 3D0YB 2KYCA 1G4YR 2FCDA 1PALA 1U5IA 1WRZA 2R2IA 1NWDA 3O78A 3VRNA 4CLNA 2SCPA 2M9GA 1IRJA 2HETA 2E6WA 2ZNDA 4D1EA 3H4SE 4GGFA 1YRTB 1QVIY 2NZ0A 1F8HA 2GV5A 1J1DA 2M29A 4L9MA 1J7PA 2JXLA 4CFRA 1GJYA 2JZIA 1LVCD 1QX7A 2WORA 2KI4C 1FI5A 1WY9A 4ZCVA 1FF1A 1YUTA 1ZOTB 5D69A 3CLNA 1RTP1 3QRXA 4FQOA 1HQVA 4AOMA 4MVFA 1SYMA 2M0RA 3LCPC 2Y5IA 2JNXA 1PVBA 3FWBA 3VRRA 3C1VA 1DT7B 2EC6B 1SBJA 1BT6A 3TS5C 1GGWA 2EGDA 3FS7A 1CNPA 1NX3A 1LA0A 4PHMA 1MXEA 2PMYA 1S1EA 2KI6C 5GQQC 4A4CA 1J1EA 2K7OA 2OTGB 5CPVA 2LVVA 1B8CA 2KAYA 4UPGA 5KSZA 3ZWHA 3IQQA 1AHRA 4YGBB 4AQIA 4XYNA 1IWQA 1KQMC 1TCOB 1YRUB 2AMIA 2LCPA 1DTLA 3JTDC 4MRXA 1FPWA 3EVUA 2M8UA 3OP0A 1AJ5A 2LANA
chains in the Genus database with same CATH superfamily
2L51A 4GBAA 1SR6B 4I5LB 3SG5A 4XJKB 2K7CA 2KGRA 1TUJA 1S6JA 4I5JA 4ICBA 1B47A 4JD9A 1NX0A 2WCMA 3FWCA 3CR2A 1OOGA 1SL7A 2Y1NA 2BBNA 2LP2A 1LINA 4M2PA 4USLA 3S0GA 1BG1A 1QVIZ 2JOJA 1OZOA 4YBHB 1QX5B 3I5IC 2KAXA 3O2PA 1S3PA 1DJHA 1SSEB 1UURA 2GGZA 3D10A 4KYNA 1DEKA 2QEHA 2WCLA 1Q80A 1RROA 1R2UA 1CLBA 3EK8A 2F2PA 3TUYB 1CTRA 2JU0A 3BYAA 5AERA 3SG6A 1CDPA 1WLZA 4Q04A 3PALA 3KF9A 1KK7Y 3UNWA 3JVTB 5AEQA 1WDCB 2A4JA 2ZRSA 3SS4A 1C3YA 2JPOA 4YGEB 1ALVA 1CKKA 1TNQA 2CNPA 2M1KB 1QX2A 1GQMA 5FI2A 2BL0B 3HCMA 2D8NA 3VRPA 1KCYA 1K94A 2L5YA 1L2OC 3PLFB 4CFQA 3PATA 1F70A 1YUUA 2LLTA 4PHJA 4MSPA 1DMOA 3TDUA 1CDNA 2KAVA 3I5FB 2K0JA 1EG3A 1CMFA 1TTXA 3B86A 1XA5A 4YI9A 2OS8C 1NSHA 2CTNA 1KWOC 2QPTA 1XFUO 3SG2A 3B88A 4DCKA 3FE6A 3SG3A 3FIAA 5CSFA 2MRDA 2DOQA 3DF0B 2LMUA 2JT3A 1C3ZA 3EVRA 1EL4A 5DKNA 1RK9A 3ZNIA 1MQ1A 4INWA 2F2OA 1B8RA 4PE7A 1M31A 5ER4X 1SPYA 2L4IA 3CDNA 3CS1A 1DJXA 4YGCB 3CABA 3CTNA 1CM4A 3CZ0A 1XFYO 2WCKA 1RECA 1NCXA 3PN7B 1DJGA 2LV7A 1X02A 3NSLA 1SCVA 2I2RE 2MA2A 2FCEA 1TNPA 1JBAA 2MHHA 1WRKA 4PCWA 5D7FA 1J55A 1UHHA 4QJ5B 3BOWA 2EHBA 2E30A 1QTXA 1AUIB 2M1UA 4PDZA 1MUXA 2ISDA 2L2EA 4F0ZB 1OOJA 2ZNEA 2Y1MA 2BBMA 3IQOA 2WNDA 3PJIA 1SNLA 2FOTA 1YVLA 1KK8C 2KBMA 3SIBA 1W9ZA 4WQ3A 3I5GB 4GPLB 3BUOB 1XO5A 3SG4A 3LLEA 4DS7A 1CMGA 4I5NB 1E8AA 4ORBB 3PSRA 2F3ZA 5F6TA 4MRYA 1BODA 4PHNA 1ZMZA 3BJHA 3VGOA 3E3RA 1TWOA 4PE1A 1A03A 1NCYA 2F3YA 1XFXO 1Y6WA 2KFGA 2BE4A 1SKTA 4YGAA 2LAPA 5KU1A 2WC5A 1V1FA 1RWYA 1B7TY 3RZSA 3BOWB 2RGIA 2HF5A 1S6CA 1U5IB 1KQVA 1DC1A 2BECA 3RLZA 4GGNA 4PALA 2JPTA 3OB2B 2KNEA 1FBVA 1QWVA 2KLDA 1UP5A 4BY4A 2HPSA 5TNCA 1SCMB 4CIDA 1S5GY 2KQYA 1JFJA 1DQEA 1OE9B 3R72A 4U8DA 2PALA 3GK2A 1DVIA 1F4OA 1QLKA 4GAOA 1DJIA 1SMGA 3AKAA 1YUSA 2ZKMX 1QV1A 4YGDB 3LK0A 3SIAA 4NDDA 2AAOA 1F71A 1XK4C 4E68A 2LLUA 1YVHA 3LK1A 1IQ5A 3EVVA 2JTZA 1KFXL 2M7LA 2LNKA 1FI6A 1K95A 4QJ3B 5I2LA 1JWDA 1F4QA 4PHKA 3DY9A 3GK4X 1OZSA 5AXIA 1QIVA 3K21A 2EC6C 1G33A 4DRWA 2PVBA 2WCBA 4INXA 1A29A 5HKYA 2JNFA 3OB1B 5J3XA 1DJZA 1NYAA 2L98A 2WCHA 4MZJA 1NIWA 2M3WA 1B8LA 5DICA 1DGUA 3HX4A 3M0WA 2OTGC 3BQ3A 3CR4X 2K60A 5EL2A 1PK0D 1CFPA 1QASA 2PRUA 1KSMA 2LVIA 5I94A 1ODBA 3PM2A 1K2HA 1JF2A 3S0EA 5HYDA 2G2BA 3DVEA 4FTGA 1SW8A 3NSOA 3UO9A 2L0PA 2L50A 2LC5A 3EK4A 4HRHA 2KDHA 1S36A 2PQLA 1N65A 1XFRA 3TDZA 5JJGA 1SR6C 1LXFC 2BKIB 1Z4HA 4WQ2A 1ZUZA 2MJWB 1S26D 2HQ8A 2KLEA 3I5HB 4PT1A 2P6BB 1PVAA 2WCFA 3OX6A 2BAPA 3WNXB 1WLMA 2JULA 3CZTX 1TIZA 2B1UA 3AAJA 2QEOA 3BUWB 5I2QA 3N7HA 5CSNA 2JT8A 3DVJA 5AFPA 3GK1A 2K2FA 1H4BA 4TNCA 3VROA 1S5GZ 3KHEA 1BLQA 3CYZA 1DF0A 2LE9B 1D1OA 3R1OA 3O6BA 3OHMB 4A4BA 1B4CA 3WXAA 1M63B 4BY5A 2V53A 1BF5A 3TUYC 4NDBA 1KFXS 1G8IA 1BJFA 3OX5A 2TN4A 4JQ0D 1OW4A 1PULA 3EK7A 3WHUB 1OQPA 2MLFC 2LVJA 3JVTC 4OZDA 1P28A 2KHNA 5IBWA 2KPHA 2CT9A 1QXPA 4C0JA 4HSZA 4HREE 2BL0C 3SS5A 1LKJA 2KSPA 2LMVA 3GOFA 1QATA 1QV0A 1WRLA 3KPXA 4N5XA 2MBXA 1B1GA 1ALWA 3D0YA 1XFWO 3BFHA 3RM1A 1F54A 1EH2A 2L2CA 3DVMA 1ZACA 2KGBC 2KOTA 1DF0B 3IF7A 4QJ4B 2L4HA 2MAZA 3NSKA 1NCZA 5HKWA 1NPQA 1PSBA 3D74A 2GTEA 1MHOA 1TNXA 1TRFA 3FE8A 3NSIA 4OCIA 4MBEA 2SASA 1FW4A 1CM1A 2ZFDA 1BU3A 1TN4A 1M39A 1UHJA 2K7DA 2WCEA 2BCAA 1PSRA 1IQ3A 4I5KA 1Y1XA 1L7ZA 2KI6D 3CWGA 3MSEB 3KEVA 4GFTA 2NXQA 2QEVA 3F45A 1CB1A 2K7BA 1RFJA 2KI4B 3NGVA 2M7NA 1QIWA 4M2OA 4OV2A 1M46A 1UHKA 2PYQA 3Q8IA 2CBLA 2BE6A 2MLEC 3PN7C 1EXRA 4OVNF 1KK7Z 1W7JB 1YTZC 3DD4A 3AAKA 1K9UA 2M97A 2FJYA 1LS8A 2JT0A 3DYEA 3L4LA 3BUMB 2QACA 3NHIA 1M45A 3TS5B 2LHIA 3R1VA 2KBIA 5KTYA 1C07A 1K8UA 1MR8A 2NLNA 3DXLA 5FYXA 3ICBA 1DJYA 3NHTA 1OMDA 1AP4A 1SL9A 2NCPA 1J7QA 1CFCA 3S0FA 1OOHA 4YRUA 1AK8A 1R6PA 1ORGA 2JQ6A 2KQ6A 2O5GA 1NX2A 1XFVO 3BXKA 1GGZA 2IS9A 1HT9A 2Q4UA 1VRKA 3I5GC 2H61C 2OPOA 1OOFA 1K90D 1KQMB 2QEBA 3JTDB 1AJ4A 2ZRTA 1Y0VH 1YX8A 2BCXA 3CR5X 2GGMA 4JPZB 4MZLA 3BFAA 1UWOA 4P2YB 4PE4A 2JRFA 3V2LA 1DGVA 4P5OE 2K8MB 5AANA 3BUXB 4XJKA 3EKJA 2QDIA 4PE0A 1IGVA 2H8VA 2Q91A 1DJWA 1PRWA 5PALA 1BR4B 2G9BA 2LUCA 2KYFA 2VRGA 4IJ7A 1KSOA 2LHLA 4C0LA 2PASA 1K9PA 1NP8A 1KFUL 2JTTA 5ER5A 2I94A 4GGFC 1OOIX 3BUNB 4ORAB 1SCMC 4N1GA 4R1EA 4YI8A 2F8PA 5CSIA 3S0BA 1K93D 2CCMA 5JOLA 4MN0A 2AUCA 1JUOA 1MWNA 1BR1B 2JC2A 3TDIA 1BOCA 3PFVA 5D3OA 2H2KA 1SK6D 3I5IB 4C0KA 1EJ3A 1S6IA 1CFDA 1UHIA 1EG4A 2JXCA 5G08A 1A2XA 2COLB 4OR9B 1K9KA 3DVKA 4NQGA 1T14A 1UHNA 1K96A 3VRQA 4DIRA 1IIOA 1MF8B 2CXJA 1Y1AA 1DELA 1Y1UA 3CZ1A 1OSAA 3IVTA 4MLWA 1JC2A 4ETOA 1LA3A 2K61A 1JSAA 1JFKA 2ZN9A 3EKHA 5CSJA 3S0DA 4WRIA 5BPJA 2L5XB 2JWWA 1OMRA 1A4PA 1XVJA 5HLOA 1B7TZ 2I18A 1IKUA 2LVKA 1J7RA 1CLLA 5K89A 2LP3A 3O4XA 3AKBA 3WHTB 2I7AA 1L2OB 4OKHA 5DKQA 3R1PA 3S0AA 1UUSA 3L4AA 4JWQA 2KFFA 5HKZA 4MEWA 4ZCUA 1CFFA 1AVSA 1IG5A 4HRGA 1RJVA 3O4YA 5DKRA 3TZ1A 1C7WA 2FJUB 2OS8B 1W7IB 1KWOB 3BFBA 3DF0A 1SY9A 1QLSA 1ZFSA 1J7OA 4N1FA 3B6XA 1JF0A 1IJ5A 1YX7A 1GM0A 2F33A 3I5HC 1WDCC 5B8IB 1SRAA 2WOSA 2YGUA 4MZKA 2ZN8A 1KFUS 2KFHA 4CPVA 1N0YA 2NCOA 1B9AA 4IL1A 1QJTA 1H8BA 1TUZA 1A75A 3PM8A 3A4UB 1IH0A 1OMVA 1YR5A 2K2AA 1XFZO 1CDMA 3NXAA 1TCFA 1NX1A 5I8NA 3I5FC 3LL8B 2Y4QA 1C7VA 3SG7A 1TNWA 3KO0A 1CLMA 1XYDA 5HLVA 2BCBA 2WC8A 4GNKB 4GUKA 1F55A 1SL8A 1TOPA 2LUXA 3D78A 2HQWA 3D75A 1KK8B 4JKTA 2PSRA 2LMTA 2H61A 1V1GA 2BKHB 4DUQA 3CGAA 2M49B 4F7FA 3A8RA 3FE9A 4ORCB 1NUBA 1CDLA 3CZ2A 4AQJA 3DZTA 1IJ6A 1XK4A 3D77A 1BMOA 2LLSA 1QS7A 2P70A 4NDCA 1N2DA 5HL1A 1MXLC 4M2QA 3SJSA 2LM5A 5I2OA 1YURA 3D76A 5FI7A 2O60A 2P71A 1A75B 3D0YB 2KYCA 3VB1A 1G4YR 2FCDA 1PALA 1U5IA 1WRZA 2R2IA 1NWDA 3O78A 3VRNA 4CLNA 2SCPA 2M9GA 1Z2CB 1IRJA 2HETA 2E6WA 2ZNDA 3K1EA 4D1EA 3H4SE 4GGFA 1YRTB 1QVIY 4FQTA 2NZ0A 1F8HA 2GV5A 1J1DA 2M29A 4L9MA 1J7PA 2JXLA 4CFRA 2WCJA 1GJYA 2JZIA 1LVCD 1QX7A 2WORA 2KI4C 3QMEA 1FI5A 1WY9A 4ZCVA 1FF1A 1YUTA 3B7AA 3L47A 1ZOTB 5D69A 3CLNA 1RTP1 3QRXA 4FQOA 1HQVA 2WC6A 4AOMA 4MVFA 5FI6A 1SYMA 2M0RA 3LCPC 2Y5IA 2JNXA 1PVBA 3B87A 3FWBA 3VRRA 3C1VA 1DT7B 2EC6B 1SBJA 1BT6A 3TS5C 1GGWA 2EGDA 3FS7A 1CNPA 1NX3A 1LA0A 2ERBA 3EG5B 4PHMA 1MXEA 2PMYA 1S1EA 2KI6C 3D73A 5GQQC 2BNXA 4A4CA 1J1EA 2K7OA 2OTGB 5CPVA 2LVVA 1B8CA 2KAYA 4UPGA 5KSZA 3ZWHA 3IQQA 1AHRA 3SS3A 4YGBB 3OGNA 4AQIA 4XYNA 1IWQA 1KQMC 1TCOB 1YRUB 2AMIA 2LCPA 1DTLA 3JTDC 3OBVA 4MRXA 1FPWA 3EVUA 2M8UA 3OP0A 1AJ5A 2LANA
chains in the Genus database with same CATH topology
2L51A 4GBAA 1SR6B 4I5LB 3SG5A 4XJKB 2K7CA 2KGRA 4I5JA 1S6JA 4ICBA 1B47A 1NX0A 3FWCA 3CR2A 1SL7A 2Y1NA 2BBNA 2LP2A 1LINA 4M2PA 4USLA 1BG1A 1QVIZ 2JOJA 1OZOA 4YBHB 1QX5B 3I5IC 2KAXA 3O2PA 1S3PA 1DJHA 1UURA 2GGZA 3D10A 1Q80A 1RROA 1R2UA 1CLBA 3EK8A 2F2PA 3TUYB 1CTRA 2JU0A 3BYAA 5AERA 3SG6A 1CDPA 1WLZA 4Q04A 3PALA 3KF9A 1KK7Y 3JVTB 5AEQA 1WDCB 2A4JA 2ZRSA 4YGEB 1ALVA 1CKKA 1TNQA 2CNPA 2M1KB 1QX2A 1GQMA 2BL0B 3HCMA 2D8NA 3VRPA 1KCYA 1K94A 1L2OC 3PLFB 4CFQA 3PATA 1F70A 1YUUA 2LLTA 4PHJA 4MSPA 1DMOA 3TDUA 1CDNA 2KAVA 3I5FB 2K0JA 1EG3A 1CMFA 1TTXA 1XA5A 4YI9A 2OS8C 1NSHA 2CTNA 1KWOC 2QPTA 1XFUO 3SG2A 4DCKA 3SG3A 3FIAA 5CSFA 2MRDA 2DOQA 3DF0B 2LMUA 2JT3A 3EVRA 1EL4A 5DKNA 1RK9A 3ZNIA 1MQ1A 2F2OA 1B8RA 4PE7A 1M31A 5ER4X 1SPYA 2L4IA 3CS1A 4YGCB 1DJXA 3CTNA 1CM4A 1XFYO 3PN7B 1RECA 1NCXA 1DJGA 2LV7A 1X02A 3NSLA 1SCVA 2I2RE 2MA2A 2FCEA 1TNPA 1JBAA 2MHHA 1WRKA 4PCWA 5D7FA 1J55A 1UHHA 4QJ5B 3BOWA 2EHBA 2E30A 1QTXA 1AUIB 2M1UA 4PDZA 1MUXA 2ISDA 2L2EA 4F0ZB 1OOJA 2ZNEA 2Y1MA 2BBMA 3IQOA 2WNDA 1SNLA 2FOTA 1YVLA 1KK8C 2KBMA 3SIBA 4WQ3A 3I5GB 4GPLB 3BUOB 1XO5A 3SG4A 3LLEA 4DS7A 1CMGA 4I5NB 1E8AA 4ORBB 3PSRA 2F3ZA 5F6TA 4MRYA 1BODA 4PHNA 1ZMZA 3VGOA 3E3RA 4PE1A 1A03A 1NCYA 2F3YA 1XFXO 1Y6WA 2KFGA 2BE4A 1SKTA 4YGAA 2LAPA 5KU1A 1V1FA 1RWYA 1B7TY 3BOWB 2RGIA 2HF5A 1S6CA 1U5IB 1KQVA 2BECA 3RLZA 4GGNA 4PALA 2JPTA 3OB2B 2KNEA 1FBVA 4BY4A 1UP5A 2HPSA 5TNCA 1SCMB 4CIDA 1S5GY 2KQYA 1JFJA 1OE9B 4U8DA 2PALA 3GK2A 1DVIA 1F4OA 1QLKA 4GAOA 1DJIA 1SMGA 3AKAA 1YUSA 2ZKMX 1QV1A 4YGDB 3LK0A 3SIAA 4NDDA 2AAOA 1F71A 1XK4C 4E68A 2LLUA 1YVHA 3LK1A 1IQ5A 3EVVA 2JTZA 1KFXL 2M7LA 2LNKA 1FI6A 1K95A 4QJ3B 5I2LA 1JWDA 1F4QA 4PHKA 3GK4X 1OZSA 5AXIA 1QIVA 3K21A 2EC6C 1G33A 4DRWA 2PVBA 2WCBA 1A29A 5HKYA 2JNFA 3OB1B 5J3XA 1DJZA 1NYAA 2L98A 4MZJA 1NIWA 2M3WA 1B8LA 1DGUA 3HX4A 3M0WA 2OTGC 3BQ3A 3CR4X 1PK0D 1CFPA 1QASA 2PRUA 1KSMA 2LVIA 1ODBA 1K2HA 1JF2A 5HYDA 2G2BA 3DVEA 4FTGA 1SW8A 3NSOA 2L0PA 2L50A 2LC5A 3EK4A 4HRHA 2KDHA 1S36A 1N65A 3TDZA 5JJGA 1SR6C 1LXFC 2BKIB 4WQ2A 1ZUZA 2MJWB 1S26D 2HQ8A 3I5HB 2P6BB 1PVAA 2WCFA 3OX6A 3WNXB 1WLMA 2JULA 3CZTX 1TIZA 2B1UA 3AAJA 3BUWB 5I2QA 5CSNA 2JT8A 3DVJA 5AFPA 3GK1A 2K2FA 1H4BA 4TNCA 3VROA 1S5GZ 3KHEA 1BLQA 1D1OA 1DF0A 2LE9B 3O6BA 3OHMB 4A4BA 1B4CA 3WXAA 1M63B 4BY5A 2V53A 1BF5A 3TUYC 4NDBA 1KFXS 1G8IA 1BJFA 3OX5A 2TN4A 4JQ0D 1PULA 3EK7A 3WHUB 1OQPA 2MLFC 2LVJA 3JVTC 2KHNA 5IBWA 2CT9A 1QXPA 4C0JA 4HSZA 4HREE 2BL0C 1LKJA 2KSPA 2LMVA 3GOFA 1QATA 1QV0A 1WRLA 3KPXA 4N5XA 2MBXA 1B1GA 1ALWA 3D0YA 1XFWO 3RM1A 1F54A 1EH2A 3DVMA 1ZACA 2KGBC 2KOTA 1DF0B 3IF7A 4QJ4B 2L4HA 2MAZA 3NSKA 1NCZA 5HKWA 1NPQA 1PSBA 1MHOA 1TNXA 1TRFA 4OCIA 3NSIA 4MBEA 2SASA 1FW4A 1CM1A 2ZFDA 1BU3A 1TN4A 1M39A 1UHJA 2K7DA 2WCEA 2BCAA 1PSRA 1IQ3A 4I5KA 1Y1XA 1L7ZA 2KI6D 3CWGA 3MSEB 3KEVA 4GFTA 2NXQA 3F45A 1CB1A 2K7BA 1RFJA 2KI4B 2M7NA 1QIWA 4M2OA 4OV2A 1M46A 1UHKA 2CBLA 2BE6A 2MLEC 3PN7C 1EXRA 4OVNF 1KK7Z 1W7JB 1YTZC 3DD4A 3AAKA 1K9UA 2M97A 2JT0A 3BUMB 2QACA 1M45A 3TS5B 2LHIA 2KBIA 5KTYA 1C07A 1K8UA 1MR8A 2NLNA 5FYXA 3ICBA 1DJYA 1J7QA 1OMDA 1AP4A 1SL9A 2NCPA 1CFCA 4YRUA 1AK8A 1R6PA 2JQ6A 2KQ6A 2O5GA 1NX2A 1XFVO 3BXKA 1GGZA 2IS9A 1HT9A 2Q4UA 1VRKA 3I5GC 2H61C 2OPOA 1K90D 1KQMB 3JTDB 1AJ4A 2ZRTA 1Y0VH 1YX8A 2BCXA 3CR5X 2GGMA 4JPZB 4MZLA 1UWOA 4P2YB 4PE4A 2JRFA 1DGVA 4P5OE 2K8MB 5AANA 3BUXB 4XJKA 3EKJA 4PE0A 1IGVA 2Q91A 1DJWA 1PRWA 5PALA 1BR4B 2G9BA 2LUCA 2KYFA 2VRGA 1KSOA 2LHLA 4C0LA 2PASA 1K9PA 1NP8A 1KFUL 2JTTA 5ER5A 2I94A 4GGFC 4ORAB 3BUNB 4YI8A 1SCMC 4N1GA 4R1EA 5CSIA 2F8PA 1K93D 2CCMA 5JOLA 4MN0A 2AUCA 1JUOA 1MWNA 1BR1B 2JC2A 3TDIA 1BOCA 3PFVA 2H2KA 1SK6D 3I5IB 4C0KA 1EJ3A 1S6IA 1CFDA 1UHIA 1EG4A 2JXCA 5G08A 1A2XA 2COLB 4OR9B 1K9KA 3DVKA 4NQGA 1UHNA 1K96A 3VRQA 4DIRA 1MF8B 2CXJA 1Y1AA 1Y1UA 4MLWA 1JC2A 1OSAA 4ETOA 1LA3A 2K61A 1JSAA 1JFKA 2ZN9A 3EKHA 5CSJA 4WRIA 5BPJA 2L5XB 2JWWA 1OMRA 1A4PA 1XVJA 5HLOA 1B7TZ 2I18A 1IKUA 2LVKA 1J7RA 1CLLA 5K89A 2LP3A 3AKBA 3WHTB 2I7AA 1L2OB 4OKHA 5DKQA 1UUSA 4JWQA 2KFFA 5HKZA 4MEWA 4ZCUA 1CFFA 1AVSA 1IG5A 4HRGA 1RJVA 3O4YA 5DKRA 3TZ1A 1C7WA 2FJUB 2OS8B 1W7IB 1KWOB 3DF0A 1SY9A 1QLSA 1ZFSA 1J7OA 4N1FA 1JF0A 1IJ5A 1YX7A 2F33A 3I5HC 1WDCC 5B8IB 1SRAA 2WOSA 4MZKA 2ZN8A 1KFUS 2KFHA 4CPVA 1N0YA 2NCOA 1B9AA 4IL1A 1QJTA 1H8BA 1A75A 3PM8A 3A4UB 1IH0A 1OMVA 1YR5A 2K2AA 1XFZO 1CDMA 3NXAA 1TCFA 1NX1A 5I8NA 3I5FC 3LL8B 2Y4QA 1C7VA 3SG7A 1TNWA 3KO0A 1CLMA 1XYDA 5HLVA 2BCBA 2WC8A 4GNKB 4GUKA 1F55A 1SL8A 1TOPA 2LUXA 2HQWA 1KK8B 2PSRA 2LMTA 2H61A 1V1GA 2BKHB 4DUQA 3CGAA 2M49B 3A8RA 4ORCB 1NUBA 1CDLA 4AQJA 1IJ6A 1XK4A 1BMOA 2LLSA 1QS7A 4NDCA 1N2DA 5I2OA 1MXLC 4M2QA 3SJSA 2LM5A 1YURA 2O60A 1A75B 3D0YB 2KYCA 1G4YR 2FCDA 1PALA 1U5IA 1WRZA 2R2IA 1NWDA 3O78A 3VRNA 4CLNA 2SCPA 2M9GA 1IRJA 2HETA 2E6WA 2ZNDA 4D1EA 3H4SE 4GGFA 1YRTB 1QVIY 2NZ0A 1F8HA 2GV5A 1J1DA 2M29A 4L9MA 1J7PA 2JXLA 4CFRA 1GJYA 2JZIA 1LVCD 1QX7A 2WORA 2KI4C 1FI5A 1WY9A 4ZCVA 1FF1A 1YUTA 1ZOTB 5D69A 3CLNA 1RTP1 3QRXA 4FQOA 1HQVA 4AOMA 4MVFA 1SYMA 2M0RA 3LCPC 2Y5IA 2JNXA 1PVBA 3FWBA 3VRRA 3C1VA 1DT7B 2EC6B 1SBJA 1BT6A 3TS5C 1GGWA 2EGDA 3FS7A 1CNPA 1NX3A 1LA0A 4PHMA 1MXEA 2PMYA 1S1EA 2KI6C 5GQQC 4A4CA 1J1EA 2K7OA 2OTGB 5CPVA 2LVVA 1B8CA 2KAYA 4UPGA 5KSZA 3ZWHA 3IQQA 1AHRA 4YGBB 4AQIA 4XYNA 1IWQA 1KQMC 1TCOB 1YRUB 2AMIA 2LCPA 1DTLA 3JTDC 4MRXA 1FPWA 3EVUA 2M8UA 3OP0A 1AJ5A 2LANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L51 A;  4GBA A;  1SR6 B;  4I5L B;  3SG5 A;  4XJK B;  2K7C A;  2KGR A;  4I5J A;  1S6J A;  4ICB A;  1B47 A;  1NX0 A;  3FWC A;  3CR2 A;  1SL7 A;  2Y1N A;  2BBN A;  2LP2 A;  1LIN A;  4M2P A;  4USL A;  1BG1 A;  1QVI Z;  2JOJ A;  1OZO A;  4YBH B;  1QX5 B;  3I5I C;  2KAX A;  3O2P A;  1S3P A;  1DJH A;  1UUR A;  2GGZ A;  3D10 A;  1Q80 A;  1RRO A;  1R2U A;  1CLB A;  3EK8 A;  2F2P A;  3TUY B;  1CTR A;  2JU0 A;  3BYA A;  5AER A;  3SG6 A;  1CDP A;  1WLZ A;  4Q04 A;  3PAL A;  3KF9 A;  1KK7 Y;  3JVT B;  5AEQ A;  1WDC B;  2A4J A;  2ZRS A;  4YGE B;  1ALV A;  1CKK A;  1TNQ A;  2CNP A;  2M1K B;  1QX2 A;  1GQM A;  2BL0 B;  3HCM A;  2D8N A;  3VRP A;  1KCY A;  1K94 A;  1L2O C;  3PLF B;  4CFQ A;  3PAT A;  1F70 A;  1YUU A;  2LLT A;  4PHJ A;  4MSP A;  1DMO A;  3TDU A;  1CDN A;  2KAV A;  3I5F B;  2K0J A;  1EG3 A;  1CMF A;  1TTX A;  1XA5 A;  4YI9 A;  2OS8 C;  1NSH A;  2CTN A;  1KWO C;  2QPT A;  1XFU O;  3SG2 A;  4DCK A;  3SG3 A;  3FIA A;  5CSF A;  2MRD A;  2DOQ A;  3DF0 B;  2LMU A;  2JT3 A;  3EVR A;  1EL4 A;  5DKN A;  1RK9 A;  3ZNI A;  1MQ1 A;  2F2O A;  1B8R A;  4PE7 A;  1M31 A;  5ER4 X;  1SPY A;  2L4I A;  3CS1 A;  4YGC B;  1DJX A;  3CTN A;  1CM4 A;  1XFY O;  3PN7 B;  1REC A;  1NCX A;  1DJG A;  2LV7 A;  1X02 A;  3NSL A;  1SCV A;  2I2R E;  2MA2 A;  2FCE A;  1TNP A;  1JBA A;  2MHH A;  1WRK A;  4PCW A;  5D7F A;  1J55 A;  1UHH A;  4QJ5 B;  3BOW A;  2EHB A;  2E30 A;  1QTX A;  1AUI B;  2M1U A;  4PDZ A;  1MUX A;  2ISD A;  2L2E A;  4F0Z B;  1OOJ A;  2ZNE A;  2Y1M A;  2BBM A;  3IQO A;  2WND A;  1SNL A;  2FOT A;  1YVL A;  1KK8 C;  2KBM A;  3SIB A;  4WQ3 A;  3I5G B;  4GPL B;  3BUO B;  1XO5 A;  3SG4 A;  3LLE A;  4DS7 A;  1CMG A;  4I5N B;  1E8A A;  4ORB B;  3PSR A;  2F3Z A;  5F6T A;  4MRY A;  1BOD A;  4PHN A;  1ZMZ A;  3VGO A;  3E3R A;  4PE1 A;  1A03 A;  1NCY A;  2F3Y A;  1XFX O;  1Y6W A;  2KFG A;  2BE4 A;  1SKT A;  4YGA A;  2LAP A;  5KU1 A;  1V1F A;  1RWY A;  1B7T Y;  3BOW B;  2RGI A;  2HF5 A;  1S6C A;  1U5I B;  1KQV A;  2BEC A;  3RLZ A;  4GGN A;  4PAL A;  2JPT A;  3OB2 B;  2KNE A;  1FBV A;  4BY4 A;  1UP5 A;  2HPS A;  5TNC A;  1SCM B;  4CID A;  1S5G Y;  2KQY A;  1JFJ A;  1OE9 B;  4U8D A;  2PAL A;  3GK2 A;  1DVI A;  1F4O A;  1QLK A;  4GAO A;  1DJI A;  1SMG A;  3AKA A;  1YUS A;  2ZKM X;  1QV1 A;  4YGD B;  3LK0 A;  3SIA A;  4NDD A;  2AAO A;  1F71 A;  1XK4 C;  4E68 A;  2LLU A;  1YVH A;  3LK1 A;  1IQ5 A;  3EVV A;  2JTZ A;  1KFX L;  2M7L A;  2LNK A;  1FI6 A;  1K95 A;  4QJ3 B;  5I2L A;  1JWD A;  1F4Q A;  4PHK A;  3GK4 X;  1OZS A;  5AXI A;  1QIV A;  3K21 A;  2EC6 C;  1G33 A;  4DRW A;  2PVB A;  2WCB A;  1A29 A;  5HKY A;  2JNF A;  3OB1 B;  5J3X A;  1DJZ A;  1NYA A;  2L98 A;  4MZJ A;  1NIW A;  2M3W A;  1B8L A;  1DGU A;  3HX4 A;  3M0W A;  2OTG C;  3BQ3 A;  3CR4 X;  1PK0 D;  1CFP A;  1QAS A;  2PRU A;  1KSM A;  2LVI A;  1ODB A;  1K2H A;  1JF2 A;  5HYD A;  2G2B A;  3DVE A;  4FTG A;  1SW8 A;  3NSO A;  2L0P A;  2L50 A;  2LC5 A;  3EK4 A;  4HRH A;  2KDH A;  1S36 A;  1N65 A;  3TDZ A;  5JJG A;  1SR6 C;  1LXF C;  2BKI B;  4WQ2 A;  1ZUZ A;  2MJW B;  1S26 D;  2HQ8 A;  3I5H B;  2P6B B;  1PVA A;  2WCF A;  3OX6 A;  3WNX B;  1WLM A;  2JUL A;  3CZT X;  1TIZ A;  2B1U A;  3AAJ A;  3BUW B;  5I2Q A;  5CSN A;  2JT8 A;  3DVJ A;  5AFP A;  3GK1 A;  2K2F A;  1H4B A;  4TNC A;  3VRO A;  1S5G Z;  3KHE A;  1BLQ A;  1D1O A;  1DF0 A;  2LE9 B;  3O6B A;  3OHM B;  4A4B A;  1B4C A;  3WXA A;  1M63 B;  4BY5 A;  2V53 A;  1BF5 A;  3TUY C;  4NDB A;  1KFX S;  1G8I A;  1BJF A;  3OX5 A;  2TN4 A;  4JQ0 D;  1PUL A;  3EK7 A;  3WHU B;  1OQP A;  2MLF C;  2LVJ A;  3JVT C;  2KHN A;  5IBW A;  2CT9 A;  1QXP A;  4C0J A;  4HSZ A;  4HRE E;  2BL0 C;  1LKJ A;  2KSP A;  2LMV A;  3GOF A;  1QAT A;  1QV0 A;  1WRL A;  3KPX A;  4N5X A;  2MBX A;  1B1G A;  1ALW A;  3D0Y A;  1XFW O;  3RM1 A;  1F54 A;  1EH2 A;  3DVM A;  1ZAC A;  2KGB C;  2KOT A;  1DF0 B;  3IF7 A;  4QJ4 B;  2L4H A;  2MAZ A;  3NSK A;  1NCZ A;  5HKW A;  1NPQ A;  1PSB A;  1MHO A;  1TNX A;  1TRF A;  4OCI A;  3NSI A;  4MBE A;  2SAS A;  1FW4 A;  1CM1 A;  2ZFD A;  1BU3 A;  1TN4 A;  1M39 A;  1UHJ A;  2K7D A;  2WCE A;  2BCA A;  1PSR A;  1IQ3 A;  4I5K A;  1Y1X A;  1L7Z A;  2KI6 D;  3CWG A;  3MSE B;  3KEV A;  4GFT A;  2NXQ A;  3F45 A;  1CB1 A;  2K7B A;  1RFJ A;  2KI4 B;  2M7N A;  1QIW A;  4M2O A;  4OV2 A;  1M46 A;  1UHK A;  2CBL A;  2BE6 A;  2MLE C;  3PN7 C;  1EXR A;  4OVN F;  1KK7 Z;  1W7J B;  1YTZ C;  3DD4 A;  3AAK A;  1K9U A;  2M97 A;  2JT0 A;  3BUM B;  2QAC A;  1M45 A;  3TS5 B;  2LHI A;  2KBI A;  5KTY A;  1C07 A;  1K8U A;  1MR8 A;  2NLN A;  5FYX A;  3ICB A;  1DJY A;  1J7Q A;  1OMD A;  1AP4 A;  1SL9 A;  2NCP A;  1CFC A;  4YRU A;  1AK8 A;  1R6P A;  2JQ6 A;  2KQ6 A;  2O5G A;  1NX2 A;  1XFV O;  3BXK A;  1GGZ A;  2IS9 A;  1HT9 A;  2Q4U A;  1VRK A;  3I5G C;  2H61 C;  2OPO A;  1K90 D;  1KQM B;  3JTD B;  1AJ4 A;  2ZRT A;  1Y0V H;  1YX8 A;  2BCX A;  3CR5 X;  2GGM A;  4JPZ B;  4MZL A;  1UWO A;  4P2Y B;  4PE4 A;  2JRF A;  1DGV A;  4P5O E;  2K8M B;  5AAN A;  3BUX B;  4XJK A;  3EKJ A;  4PE0 A;  1IGV A;  2Q91 A;  1DJW A;  1PRW A;  5PAL A;  1BR4 B;  2G9B A;  2LUC A;  2KYF A;  2VRG A;  1KSO A;  2LHL A;  4C0L A;  2PAS A;  1K9P A;  1NP8 A;  1KFU L;  2JTT A;  5ER5 A;  2I94 A;  4GGF C;  4ORA B;  3BUN B;  4YI8 A;  1SCM C;  4N1G A;  4R1E A;  5CSI A;  2F8P A;  1K93 D;  2CCM A;  5JOL A;  4MN0 A;  2AUC A;  1JUO A;  1MWN A;  1BR1 B;  2JC2 A;  3TDI A;  1BOC A;  3PFV A;  2H2K A;  1SK6 D;  3I5I B;  4C0K A;  1EJ3 A;  1S6I A;  1CFD A;  1UHI A;  1EG4 A;  2JXC A;  5G08 A;  1A2X A;  2COL B;  4OR9 B;  1K9K A;  3DVK A;  4NQG A;  1UHN A;  1K96 A;  3VRQ A;  4DIR A;  1MF8 B;  2CXJ A;  1Y1A A;  1Y1U A;  4MLW A;  1JC2 A;  1OSA A;  4ETO A;  1LA3 A;  2K61 A;  1JSA A;  1JFK A;  2ZN9 A;  3EKH A;  5CSJ A;  4WRI A;  5BPJ A;  2L5X B;  2JWW A;  1OMR A;  1A4P A;  1XVJ A;  5HLO A;  1B7T Z;  2I18 A;  1IKU A;  2LVK A;  1J7R A;  1CLL A;  5K89 A;  2LP3 A;  3AKB A;  3WHT B;  2I7A A;  1L2O B;  4OKH A;  5DKQ A;  1UUS A;  4JWQ A;  2KFF A;  5HKZ A;  4MEW A;  4ZCU A;  1CFF A;  1AVS A;  1IG5 A;  4HRG A;  1RJV A;  3O4Y A;  5DKR A;  3TZ1 A;  1C7W A;  2FJU B;  2OS8 B;  1W7I B;  1KWO B;  3DF0 A;  1SY9 A;  1QLS A;  1ZFS A;  1J7O A;  4N1F A;  1JF0 A;  1IJ5 A;  1YX7 A;  2F33 A;  3I5H C;  1WDC C;  5B8I B;  1SRA A;  2WOS A;  4MZK A;  2ZN8 A;  1KFU S;  2KFH A;  4CPV A;  1N0Y A;  2NCO A;  1B9A A;  4IL1 A;  1QJT A;  1H8B A;  1A75 A;  3PM8 A;  3A4U B;  1IH0 A;  1OMV A;  1YR5 A;  2K2A A;  1XFZ O;  1CDM A;  3NXA A;  1TCF A;  1NX1 A;  5I8N A;  3I5F C;  3LL8 B;  2Y4Q A;  1C7V A;  3SG7 A;  1TNW A;  3KO0 A;  1CLM A;  1XYD A;  5HLV A;  2BCB A;  2WC8 A;  4GNK B;  4GUK A;  1F55 A;  1SL8 A;  1TOP A;  2LUX A;  2HQW A;  1KK8 B;  2PSR A;  2LMT A;  2H61 A;  1V1G A;  2BKH B;  4DUQ A;  3CGA A;  2M49 B;  3A8R A;  4ORC B;  1NUB A;  1CDL A;  4AQJ A;  1IJ6 A;  1XK4 A;  1BMO A;  2LLS A;  1QS7 A;  4NDC A;  1N2D A;  5I2O A;  1MXL C;  4M2Q A;  3SJS A;  2LM5 A;  1YUR A;  2O60 A;  1A75 B;  3D0Y B;  2KYC A;  1G4Y R;  2FCD A;  1PAL A;  1U5I A;  1WRZ A;  2R2I A;  1NWD A;  3O78 A;  3VRN A;  4CLN A;  2SCP A;  2M9G A;  1IRJ A;  2HET A;  2E6W A;  2ZND A;  4D1E A;  3H4S E;  4GGF A;  1YRT B;  1QVI Y;  2NZ0 A;  1F8H A;  2GV5 A;  1J1D A;  2M29 A;  4L9M A;  1J7P A;  2JXL A;  4CFR A;  1GJY A;  2JZI A;  1LVC D;  1QX7 A;  2WOR A;  2KI4 C;  1FI5 A;  1WY9 A;  4ZCV A;  1FF1 A;  1YUT A;  1ZOT B;  5D69 A;  3CLN A;  1RTP 1;  3QRX A;  4FQO A;  1HQV A;  4AOM A;  4MVF A;  1SYM A;  2M0R A;  3LCP C;  2Y5I A;  2JNX A;  1PVB A;  3FWB A;  3VRR A;  3C1V A;  1DT7 B;  2EC6 B;  1SBJ A;  1BT6 A;  3TS5 C;  1GGW A;  2EGD A;  3FS7 A;  1CNP A;  1NX3 A;  1LA0 A;  4PHM A;  1MXE A;  2PMY A;  1S1E A;  2KI6 C;  5GQQ C;  4A4C A;  1J1E A;  2K7O A;  2OTG B;  5CPV A;  2LVV A;  1B8C A;  2KAY A;  4UPG A;  5KSZ A;  3ZWH A;  3IQQ A;  1AHR A;  4YGB B;  4AQI A;  4XYN A;  1IWQ A;  1KQM C;  1TCO B;  1YRU B;  2AMI A;  2LCP A;  1DTL A;  3JTD C;  4MRX A;  1FPW A;  3EVU A;  2M8U A;  3OP0 A;  1AJ5 A;  2LAN A; 
#chains in the Genus database with same CATH topology
 2L51 A;  4GBA A;  1SR6 B;  4I5L B;  3SG5 A;  4XJK B;  2K7C A;  2KGR A;  1TUJ A;  1S6J A;  4I5J A;  4ICB A;  1B47 A;  4JD9 A;  1NX0 A;  2WCM A;  3FWC A;  3CR2 A;  1OOG A;  1SL7 A;  2Y1N A;  2BBN A;  2LP2 A;  1LIN A;  4M2P A;  4USL A;  3S0G A;  1BG1 A;  1QVI Z;  2JOJ A;  1OZO A;  4YBH B;  1QX5 B;  3I5I C;  2KAX A;  3O2P A;  1S3P A;  1DJH A;  1SSE B;  1UUR A;  2GGZ A;  3D10 A;  4KYN A;  1DEK A;  2QEH A;  2WCL A;  1Q80 A;  1RRO A;  1R2U A;  1CLB A;  3EK8 A;  2F2P A;  3TUY B;  1CTR A;  2JU0 A;  3BYA A;  5AER A;  3SG6 A;  1CDP A;  1WLZ A;  4Q04 A;  3PAL A;  3KF9 A;  1KK7 Y;  3UNW A;  3JVT B;  5AEQ A;  1WDC B;  2A4J A;  2ZRS A;  3SS4 A;  1C3Y A;  2JPO A;  4YGE B;  1ALV A;  1CKK A;  1TNQ A;  2CNP A;  2M1K B;  1QX2 A;  1GQM A;  5FI2 A;  2BL0 B;  3HCM A;  2D8N A;  3VRP A;  1KCY A;  1K94 A;  2L5Y A;  1L2O C;  3PLF B;  4CFQ A;  3PAT A;  1F70 A;  1YUU A;  2LLT A;  4PHJ A;  4MSP A;  1DMO A;  3TDU A;  1CDN A;  2KAV A;  3I5F B;  2K0J A;  1EG3 A;  1CMF A;  1TTX A;  3B86 A;  1XA5 A;  4YI9 A;  2OS8 C;  1NSH A;  2CTN A;  1KWO C;  2QPT A;  1XFU O;  3SG2 A;  3B88 A;  4DCK A;  3FE6 A;  3SG3 A;  3FIA A;  5CSF A;  2MRD A;  2DOQ A;  3DF0 B;  2LMU A;  2JT3 A;  1C3Z A;  3EVR A;  1EL4 A;  5DKN A;  1RK9 A;  3ZNI A;  1MQ1 A;  4INW A;  2F2O A;  1B8R A;  4PE7 A;  1M31 A;  5ER4 X;  1SPY A;  2L4I A;  3CDN A;  3CS1 A;  1DJX A;  4YGC B;  3CAB A;  3CTN A;  1CM4 A;  3CZ0 A;  1XFY O;  2WCK A;  1REC A;  1NCX A;  3PN7 B;  1DJG A;  2LV7 A;  1X02 A;  3NSL A;  1SCV A;  2I2R E;  2MA2 A;  2FCE A;  1TNP A;  1JBA A;  2MHH A;  1WRK A;  4PCW A;  5D7F A;  1J55 A;  1UHH A;  4QJ5 B;  3BOW A;  2EHB A;  2E30 A;  1QTX A;  1AUI B;  2M1U A;  4PDZ A;  1MUX A;  2ISD A;  2L2E A;  4F0Z B;  1OOJ A;  2ZNE A;  2Y1M A;  2BBM A;  3IQO A;  2WND A;  3PJI A;  1SNL A;  2FOT A;  1YVL A;  1KK8 C;  2KBM A;  3SIB A;  1W9Z A;  4WQ3 A;  3I5G B;  4GPL B;  3BUO B;  1XO5 A;  3SG4 A;  3LLE A;  4DS7 A;  1CMG A;  4I5N B;  1E8A A;  4ORB B;  3PSR A;  2F3Z A;  5F6T A;  4MRY A;  1BOD A;  4PHN A;  1ZMZ A;  3BJH A;  3VGO A;  3E3R A;  1TWO A;  4PE1 A;  1A03 A;  1NCY A;  2F3Y A;  1XFX O;  1Y6W A;  2KFG A;  2BE4 A;  1SKT A;  4YGA A;  2LAP A;  5KU1 A;  2WC5 A;  1V1F A;  1RWY A;  1B7T Y;  3RZS A;  3BOW B;  2RGI A;  2HF5 A;  1S6C A;  1U5I B;  1KQV A;  1DC1 A;  2BEC A;  3RLZ A;  4GGN A;  4PAL A;  2JPT A;  3OB2 B;  2KNE A;  1FBV A;  1QWV A;  2KLD A;  1UP5 A;  4BY4 A;  2HPS A;  5TNC A;  1SCM B;  4CID A;  1S5G Y;  2KQY A;  1JFJ A;  1DQE A;  1OE9 B;  3R72 A;  4U8D A;  2PAL A;  3GK2 A;  1DVI A;  1F4O A;  1QLK A;  4GAO A;  1DJI A;  1SMG A;  3AKA A;  1YUS A;  2ZKM X;  1QV1 A;  4YGD B;  3LK0 A;  3SIA A;  4NDD A;  2AAO A;  1F71 A;  1XK4 C;  4E68 A;  2LLU A;  1YVH A;  3LK1 A;  1IQ5 A;  3EVV A;  2JTZ A;  1KFX L;  2M7L A;  2LNK A;  1FI6 A;  1K95 A;  4QJ3 B;  5I2L A;  1JWD A;  1F4Q A;  4PHK A;  3DY9 A;  3GK4 X;  1OZS A;  5AXI A;  1QIV A;  3K21 A;  2EC6 C;  1G33 A;  4DRW A;  2PVB A;  2WCB A;  4INX A;  1A29 A;  5HKY A;  2JNF A;  3OB1 B;  5J3X A;  1DJZ A;  1NYA A;  2L98 A;  2WCH A;  4MZJ A;  1NIW A;  2M3W A;  1B8L A;  5DIC A;  1DGU A;  3HX4 A;  3M0W A;  2OTG C;  3BQ3 A;  3CR4 X;  2K60 A;  5EL2 A;  1PK0 D;  1CFP A;  1QAS A;  2PRU A;  1KSM A;  2LVI A;  5I94 A;  1ODB A;  3PM2 A;  1K2H A;  1JF2 A;  3S0E A;  5HYD A;  2G2B A;  3DVE A;  4FTG A;  1SW8 A;  3NSO A;  3UO9 A;  2L0P A;  2L50 A;  2LC5 A;  3EK4 A;  4HRH A;  2KDH A;  1S36 A;  2PQL A;  1N65 A;  1XFR A;  3TDZ A;  5JJG A;  1SR6 C;  1LXF C;  2BKI B;  1Z4H A;  4WQ2 A;  1ZUZ A;  2MJW B;  1S26 D;  2HQ8 A;  2KLE A;  3I5H B;  4PT1 A;  2P6B B;  1PVA A;  2WCF A;  3OX6 A;  2BAP A;  3WNX B;  1WLM A;  2JUL A;  3CZT X;  1TIZ A;  2B1U A;  3AAJ A;  2QEO A;  3BUW B;  5I2Q A;  3N7H A;  5CSN A;  2JT8 A;  3DVJ A;  5AFP A;  3GK1 A;  2K2F A;  1H4B A;  4TNC A;  3VRO A;  1S5G Z;  3KHE A;  1BLQ A;  3CYZ A;  1DF0 A;  2LE9 B;  1D1O A;  3R1O A;  3O6B A;  3OHM B;  4A4B A;  1B4C A;  3WXA A;  1M63 B;  4BY5 A;  2V53 A;  1BF5 A;  3TUY C;  4NDB A;  1KFX S;  1G8I A;  1BJF A;  3OX5 A;  2TN4 A;  4JQ0 D;  1OW4 A;  1PUL A;  3EK7 A;  3WHU B;  1OQP A;  2MLF C;  2LVJ A;  3JVT C;  4OZD A;  1P28 A;  2KHN A;  5IBW A;  2KPH A;  2CT9 A;  1QXP A;  4C0J A;  4HSZ A;  4HRE E;  2BL0 C;  3SS5 A;  1LKJ A;  2KSP A;  2LMV A;  3GOF A;  1QAT A;  1QV0 A;  1WRL A;  3KPX A;  4N5X A;  2MBX A;  1B1G A;  1ALW A;  3D0Y A;  1XFW O;  3BFH A;  3RM1 A;  1F54 A;  1EH2 A;  2L2C A;  3DVM A;  1ZAC A;  2KGB C;  2KOT A;  1DF0 B;  3IF7 A;  4QJ4 B;  2L4H A;  2MAZ A;  3NSK A;  1NCZ A;  5HKW A;  1NPQ A;  1PSB A;  3D74 A;  2GTE A;  1MHO A;  1TNX A;  1TRF A;  3FE8 A;  3NSI A;  4OCI A;  4MBE A;  2SAS A;  1FW4 A;  1CM1 A;  2ZFD A;  1BU3 A;  1TN4 A;  1M39 A;  1UHJ A;  2K7D A;  2WCE A;  2BCA A;  1PSR A;  1IQ3 A;  4I5K A;  1Y1X A;  1L7Z A;  2KI6 D;  3CWG A;  3MSE B;  3KEV A;  4GFT A;  2NXQ A;  2QEV A;  3F45 A;  1CB1 A;  2K7B A;  1RFJ A;  2KI4 B;  3NGV A;  2M7N A;  1QIW A;  4M2O A;  4OV2 A;  1M46 A;  1UHK A;  2PYQ A;  3Q8I A;  2CBL A;  2BE6 A;  2MLE C;  3PN7 C;  1EXR A;  4OVN F;  1KK7 Z;  1W7J B;  1YTZ C;  3DD4 A;  3AAK A;  1K9U A;  2M97 A;  2FJY A;  1LS8 A;  2JT0 A;  3DYE A;  3L4L A;  3BUM B;  2QAC A;  3NHI A;  1M45 A;  3TS5 B;  2LHI A;  3R1V A;  2KBI A;  5KTY A;  1C07 A;  1K8U A;  1MR8 A;  2NLN A;  3DXL A;  5FYX A;  3ICB A;  1DJY A;  3NHT A;  1OMD A;  1AP4 A;  1SL9 A;  2NCP A;  1J7Q A;  1CFC A;  3S0F A;  1OOH A;  4YRU A;  1AK8 A;  1R6P A;  1ORG A;  2JQ6 A;  2KQ6 A;  2O5G A;  1NX2 A;  1XFV O;  3BXK A;  1GGZ A;  2IS9 A;  1HT9 A;  2Q4U A;  1VRK A;  3I5G C;  2H61 C;  2OPO A;  1OOF A;  1K90 D;  1KQM B;  2QEB A;  3JTD B;  1AJ4 A;  2ZRT A;  1Y0V H;  1YX8 A;  2BCX A;  3CR5 X;  2GGM A;  4JPZ B;  4MZL A;  3BFA A;  1UWO A;  4P2Y B;  4PE4 A;  2JRF A;  3V2L A;  1DGV A;  4P5O E;  2K8M B;  5AAN A;  3BUX B;  4XJK A;  3EKJ A;  2QDI A;  4PE0 A;  1IGV A;  2H8V A;  2Q91 A;  1DJW A;  1PRW A;  5PAL A;  1BR4 B;  2G9B A;  2LUC A;  2KYF A;  2VRG A;  4IJ7 A;  1KSO A;  2LHL A;  4C0L A;  2PAS A;  1K9P A;  1NP8 A;  1KFU L;  2JTT A;  5ER5 A;  2I94 A;  4GGF C;  1OOI X;  3BUN B;  4ORA B;  1SCM C;  4N1G A;  4R1E A;  4YI8 A;  2F8P A;  5CSI A;  3S0B A;  1K93 D;  2CCM A;  5JOL A;  4MN0 A;  2AUC A;  1JUO A;  1MWN A;  1BR1 B;  2JC2 A;  3TDI A;  1BOC A;  3PFV A;  5D3O A;  2H2K A;  1SK6 D;  3I5I B;  4C0K A;  1EJ3 A;  1S6I A;  1CFD A;  1UHI A;  1EG4 A;  2JXC A;  5G08 A;  1A2X A;  2COL B;  4OR9 B;  1K9K A;  3DVK A;  4NQG A;  1T14 A;  1UHN A;  1K96 A;  3VRQ A;  4DIR A;  1IIO A;  1MF8 B;  2CXJ A;  1Y1A A;  1DEL A;  1Y1U A;  3CZ1 A;  1OSA A;  3IVT A;  4MLW A;  1JC2 A;  4ETO A;  1LA3 A;  2K61 A;  1JSA A;  1JFK A;  2ZN9 A;  3EKH A;  5CSJ A;  3S0D A;  4WRI A;  5BPJ A;  2L5X B;  2JWW A;  1OMR A;  1A4P A;  1XVJ A;  5HLO A;  1B7T Z;  2I18 A;  1IKU A;  2LVK A;  1J7R A;  1CLL A;  5K89 A;  2LP3 A;  3O4X A;  3AKB A;  3WHT B;  2I7A A;  1L2O B;  4OKH A;  5DKQ A;  3R1P A;  3S0A A;  1UUS A;  3L4A A;  4JWQ A;  2KFF A;  5HKZ A;  4MEW A;  4ZCU A;  1CFF A;  1AVS A;  1IG5 A;  4HRG A;  1RJV A;  3O4Y A;  5DKR A;  3TZ1 A;  1C7W A;  2FJU B;  2OS8 B;  1W7I B;  1KWO B;  3BFB A;  3DF0 A;  1SY9 A;  1QLS A;  1ZFS A;  1J7O A;  4N1F A;  3B6X A;  1JF0 A;  1IJ5 A;  1YX7 A;  1GM0 A;  2F33 A;  3I5H C;  1WDC C;  5B8I B;  1SRA A;  2WOS A;  2YGU A;  4MZK A;  2ZN8 A;  1KFU S;  2KFH A;  4CPV A;  1N0Y A;  2NCO A;  1B9A A;  4IL1 A;  1QJT A;  1H8B A;  1TUZ A;  1A75 A;  3PM8 A;  3A4U B;  1IH0 A;  1OMV A;  1YR5 A;  2K2A A;  1XFZ O;  1CDM A;  3NXA A;  1TCF A;  1NX1 A;  5I8N A;  3I5F C;  3LL8 B;  2Y4Q A;  1C7V A;  3SG7 A;  1TNW A;  3KO0 A;  1CLM A;  1XYD A;  5HLV A;  2BCB A;  2WC8 A;  4GNK B;  4GUK A;  1F55 A;  1SL8 A;  1TOP A;  2LUX A;  3D78 A;  2HQW A;  3D75 A;  1KK8 B;  4JKT A;  2PSR A;  2LMT A;  2H61 A;  1V1G A;  2BKH B;  4DUQ A;  3CGA A;  2M49 B;  4F7F A;  3A8R A;  3FE9 A;  4ORC B;  1NUB A;  1CDL A;  3CZ2 A;  4AQJ A;  3DZT A;  1IJ6 A;  1XK4 A;  3D77 A;  1BMO A;  2LLS A;  1QS7 A;  2P70 A;  4NDC A;  1N2D A;  5HL1 A;  1MXL C;  4M2Q A;  3SJS A;  2LM5 A;  5I2O A;  1YUR A;  3D76 A;  5FI7 A;  2O60 A;  2P71 A;  1A75 B;  3D0Y B;  2KYC A;  3VB1 A;  1G4Y R;  2FCD A;  1PAL A;  1U5I A;  1WRZ A;  2R2I A;  1NWD A;  3O78 A;  3VRN A;  4CLN A;  2SCP A;  2M9G A;  1Z2C B;  1IRJ A;  2HET A;  2E6W A;  2ZND A;  3K1E A;  4D1E A;  3H4S E;  4GGF A;  1YRT B;  1QVI Y;  4FQT A;  2NZ0 A;  1F8H A;  2GV5 A;  1J1D A;  2M29 A;  4L9M A;  1J7P A;  2JXL A;  4CFR A;  2WCJ A;  1GJY A;  2JZI A;  1LVC D;  1QX7 A;  2WOR A;  2KI4 C;  3QME A;  1FI5 A;  1WY9 A;  4ZCV A;  1FF1 A;  1YUT A;  3B7A A;  3L47 A;  1ZOT B;  5D69 A;  3CLN A;  1RTP 1;  3QRX A;  4FQO A;  1HQV A;  2WC6 A;  4AOM A;  4MVF A;  5FI6 A;  1SYM A;  2M0R A;  3LCP C;  2Y5I A;  2JNX A;  1PVB A;  3B87 A;  3FWB A;  3VRR A;  3C1V A;  1DT7 B;  2EC6 B;  1SBJ A;  1BT6 A;  3TS5 C;  1GGW A;  2EGD A;  3FS7 A;  1CNP A;  1NX3 A;  1LA0 A;  2ERB A;  3EG5 B;  4PHM A;  1MXE A;  2PMY A;  1S1E A;  2KI6 C;  3D73 A;  5GQQ C;  2BNX A;  4A4C A;  1J1E A;  2K7O A;  2OTG B;  5CPV A;  2LVV A;  1B8C A;  2KAY A;  4UPG A;  5KSZ A;  3ZWH A;  3IQQ A;  1AHR A;  3SS3 A;  4YGB B;  3OGN A;  4AQI A;  4XYN A;  1IWQ A;  1KQM C;  1TCO B;  1YRU B;  2AMI A;  2LCP A;  1DTL A;  3JTD C;  3OBV A;  4MRX A;  1FPW A;  3EVU A;  2M8U A;  3OP0 A;  1AJ5 A;  2LAN A; 
#chains in the Genus database with same CATH homology
 2L51 A;  4GBA A;  1SR6 B;  4I5L B;  3SG5 A;  4XJK B;  2K7C A;  2KGR A;  4I5J A;  1S6J A;  4ICB A;  1B47 A;  1NX0 A;  3FWC A;  3CR2 A;  1SL7 A;  2Y1N A;  2BBN A;  2LP2 A;  1LIN A;  4M2P A;  4USL A;  1BG1 A;  1QVI Z;  2JOJ A;  1OZO A;  4YBH B;  1QX5 B;  3I5I C;  2KAX A;  3O2P A;  1S3P A;  1DJH A;  1UUR A;  2GGZ A;  3D10 A;  1Q80 A;  1RRO A;  1R2U A;  1CLB A;  3EK8 A;  2F2P A;  3TUY B;  1CTR A;  2JU0 A;  3BYA A;  5AER A;  3SG6 A;  1CDP A;  1WLZ A;  4Q04 A;  3PAL A;  3KF9 A;  1KK7 Y;  3JVT B;  5AEQ A;  1WDC B;  2A4J A;  2ZRS A;  4YGE B;  1ALV A;  1CKK A;  1TNQ A;  2CNP A;  2M1K B;  1QX2 A;  1GQM A;  2BL0 B;  3HCM A;  2D8N A;  3VRP A;  1KCY A;  1K94 A;  1L2O C;  3PLF B;  4CFQ A;  3PAT A;  1F70 A;  1YUU A;  2LLT A;  4PHJ A;  4MSP A;  1DMO A;  3TDU A;  1CDN A;  2KAV A;  3I5F B;  2K0J A;  1EG3 A;  1CMF A;  1TTX A;  1XA5 A;  4YI9 A;  2OS8 C;  1NSH A;  2CTN A;  1KWO C;  2QPT A;  1XFU O;  3SG2 A;  4DCK A;  3SG3 A;  3FIA A;  5CSF A;  2MRD A;  2DOQ A;  3DF0 B;  2LMU A;  2JT3 A;  3EVR A;  1EL4 A;  5DKN A;  1RK9 A;  3ZNI A;  1MQ1 A;  2F2O A;  1B8R A;  4PE7 A;  1M31 A;  5ER4 X;  1SPY A;  2L4I A;  3CS1 A;  4YGC B;  1DJX A;  3CTN A;  1CM4 A;  1XFY O;  3PN7 B;  1REC A;  1NCX A;  1DJG A;  2LV7 A;  1X02 A;  3NSL A;  1SCV A;  2I2R E;  2MA2 A;  2FCE A;  1TNP A;  1JBA A;  2MHH A;  1WRK A;  4PCW A;  5D7F A;  1J55 A;  1UHH A;  4QJ5 B;  3BOW A;  2EHB A;  2E30 A;  1QTX A;  1AUI B;  2M1U A;  4PDZ A;  1MUX A;  2ISD A;  2L2E A;  4F0Z B;  1OOJ A;  2ZNE A;  2Y1M A;  2BBM A;  3IQO A;  2WND A;  1SNL A;  2FOT A;  1YVL A;  1KK8 C;  2KBM A;  3SIB A;  4WQ3 A;  3I5G B;  4GPL B;  3BUO B;  1XO5 A;  3SG4 A;  3LLE A;  4DS7 A;  1CMG A;  4I5N B;  1E8A A;  4ORB B;  3PSR A;  2F3Z A;  5F6T A;  4MRY A;  1BOD A;  4PHN A;  1ZMZ A;  3VGO A;  3E3R A;  4PE1 A;  1A03 A;  1NCY A;  2F3Y A;  1XFX O;  1Y6W A;  2KFG A;  2BE4 A;  1SKT A;  4YGA A;  2LAP A;  5KU1 A;  1V1F A;  1RWY A;  1B7T Y;  3BOW B;  2RGI A;  2HF5 A;  1S6C A;  1U5I B;  1KQV A;  2BEC A;  3RLZ A;  4GGN A;  4PAL A;  2JPT A;  3OB2 B;  2KNE A;  1FBV A;  4BY4 A;  1UP5 A;  2HPS A;  5TNC A;  1SCM B;  4CID A;  1S5G Y;  2KQY A;  1JFJ A;  1OE9 B;  4U8D A;  2PAL A;  3GK2 A;  1DVI A;  1F4O A;  1QLK A;  4GAO A;  1DJI A;  1SMG A;  3AKA A;  1YUS A;  2ZKM X;  1QV1 A;  4YGD B;  3LK0 A;  3SIA A;  4NDD A;  2AAO A;  1F71 A;  1XK4 C;  4E68 A;  2LLU A;  1YVH A;  3LK1 A;  1IQ5 A;  3EVV A;  2JTZ A;  1KFX L;  2M7L A;  2LNK A;  1FI6 A;  1K95 A;  4QJ3 B;  5I2L A;  1JWD A;  1F4Q A;  4PHK A;  3GK4 X;  1OZS A;  5AXI A;  1QIV A;  3K21 A;  2EC6 C;  1G33 A;  4DRW A;  2PVB A;  2WCB A;  1A29 A;  5HKY A;  2JNF A;  3OB1 B;  5J3X A;  1DJZ A;  1NYA A;  2L98 A;  4MZJ A;  1NIW A;  2M3W A;  1B8L A;  1DGU A;  3HX4 A;  3M0W A;  2OTG C;  3BQ3 A;  3CR4 X;  1PK0 D;  1CFP A;  1QAS A;  2PRU A;  1KSM A;  2LVI A;  1ODB A;  1K2H A;  1JF2 A;  5HYD A;  2G2B A;  3DVE A;  4FTG A;  1SW8 A;  3NSO A;  2L0P A;  2L50 A;  2LC5 A;  3EK4 A;  4HRH A;  2KDH A;  1S36 A;  1N65 A;  3TDZ A;  5JJG A;  1SR6 C;  1LXF C;  2BKI B;  4WQ2 A;  1ZUZ A;  2MJW B;  1S26 D;  2HQ8 A;  3I5H B;  2P6B B;  1PVA A;  2WCF A;  3OX6 A;  3WNX B;  1WLM A;  2JUL A;  3CZT X;  1TIZ A;  2B1U A;  3AAJ A;  3BUW B;  5I2Q A;  5CSN A;  2JT8 A;  3DVJ A;  5AFP A;  3GK1 A;  2K2F A;  1H4B A;  4TNC A;  3VRO A;  1S5G Z;  3KHE A;  1BLQ A;  1D1O A;  1DF0 A;  2LE9 B;  3O6B A;  3OHM B;  4A4B A;  1B4C A;  3WXA A;  1M63 B;  4BY5 A;  2V53 A;  1BF5 A;  3TUY C;  4NDB A;  1KFX S;  1G8I A;  1BJF A;  3OX5 A;  2TN4 A;  4JQ0 D;  1PUL A;  3EK7 A;  3WHU B;  1OQP A;  2MLF C;  2LVJ A;  3JVT C;  2KHN A;  5IBW A;  2CT9 A;  1QXP A;  4C0J A;  4HSZ A;  4HRE E;  2BL0 C;  1LKJ A;  2KSP A;  2LMV A;  3GOF A;  1QAT A;  1QV0 A;  1WRL A;  3KPX A;  4N5X A;  2MBX A;  1B1G A;  1ALW A;  3D0Y A;  1XFW O;  3RM1 A;  1F54 A;  1EH2 A;  3DVM A;  1ZAC A;  2KGB C;  2KOT A;  1DF0 B;  3IF7 A;  4QJ4 B;  2L4H A;  2MAZ A;  3NSK A;  1NCZ A;  5HKW A;  1NPQ A;  1PSB A;  1MHO A;  1TNX A;  1TRF A;  4OCI A;  3NSI A;  4MBE A;  2SAS A;  1FW4 A;  1CM1 A;  2ZFD A;  1BU3 A;  1TN4 A;  1M39 A;  1UHJ A;  2K7D A;  2WCE A;  2BCA A;  1PSR A;  1IQ3 A;  4I5K A;  1Y1X A;  1L7Z A;  2KI6 D;  3CWG A;  3MSE B;  3KEV A;  4GFT A;  2NXQ A;  3F45 A;  1CB1 A;  2K7B A;  1RFJ A;  2KI4 B;  2M7N A;  1QIW A;  4M2O A;  4OV2 A;  1M46 A;  1UHK A;  2CBL A;  2BE6 A;  2MLE C;  3PN7 C;  1EXR A;  4OVN F;  1KK7 Z;  1W7J B;  1YTZ C;  3DD4 A;  3AAK A;  1K9U A;  2M97 A;  2JT0 A;  3BUM B;  2QAC A;  1M45 A;  3TS5 B;  2LHI A;  2KBI A;  5KTY A;  1C07 A;  1K8U A;  1MR8 A;  2NLN A;  5FYX A;  3ICB A;  1DJY A;  1J7Q A;  1OMD A;  1AP4 A;  1SL9 A;  2NCP A;  1CFC A;  4YRU A;  1AK8 A;  1R6P A;  2JQ6 A;  2KQ6 A;  2O5G A;  1NX2 A;  1XFV O;  3BXK A;  1GGZ A;  2IS9 A;  1HT9 A;  2Q4U A;  1VRK A;  3I5G C;  2H61 C;  2OPO A;  1K90 D;  1KQM B;  3JTD B;  1AJ4 A;  2ZRT A;  1Y0V H;  1YX8 A;  2BCX A;  3CR5 X;  2GGM A;  4JPZ B;  4MZL A;  1UWO A;  4P2Y B;  4PE4 A;  2JRF A;  1DGV A;  4P5O E;  2K8M B;  5AAN A;  3BUX B;  4XJK A;  3EKJ A;  4PE0 A;  1IGV A;  2Q91 A;  1DJW A;  1PRW A;  5PAL A;  1BR4 B;  2G9B A;  2LUC A;  2KYF A;  2VRG A;  1KSO A;  2LHL A;  4C0L A;  2PAS A;  1K9P A;  1NP8 A;  1KFU L;  2JTT A;  5ER5 A;  2I94 A;  4GGF C;  4ORA B;  3BUN B;  4YI8 A;  1SCM C;  4N1G A;  4R1E A;  5CSI A;  2F8P A;  1K93 D;  2CCM A;  5JOL A;  4MN0 A;  2AUC A;  1JUO A;  1MWN A;  1BR1 B;  2JC2 A;  3TDI A;  1BOC A;  3PFV A;  2H2K A;  1SK6 D;  3I5I B;  4C0K A;  1EJ3 A;  1S6I A;  1CFD A;  1UHI A;  1EG4 A;  2JXC A;  5G08 A;  1A2X A;  2COL B;  4OR9 B;  1K9K A;  3DVK A;  4NQG A;  1UHN A;  1K96 A;  3VRQ A;  4DIR A;  1MF8 B;  2CXJ A;  1Y1A A;  1Y1U A;  4MLW A;  1JC2 A;  1OSA A;  4ETO A;  1LA3 A;  2K61 A;  1JSA A;  1JFK A;  2ZN9 A;  3EKH A;  5CSJ A;  4WRI A;  5BPJ A;  2L5X B;  2JWW A;  1OMR A;  1A4P A;  1XVJ A;  5HLO A;  1B7T Z;  2I18 A;  1IKU A;  2LVK A;  1J7R A;  1CLL A;  5K89 A;  2LP3 A;  3AKB A;  3WHT B;  2I7A A;  1L2O B;  4OKH A;  5DKQ A;  1UUS A;  4JWQ A;  2KFF A;  5HKZ A;  4MEW A;  4ZCU A;  1CFF A;  1AVS A;  1IG5 A;  4HRG A;  1RJV A;  3O4Y A;  5DKR A;  3TZ1 A;  1C7W A;  2FJU B;  2OS8 B;  1W7I B;  1KWO B;  3DF0 A;  1SY9 A;  1QLS A;  1ZFS A;  1J7O A;  4N1F A;  1JF0 A;  1IJ5 A;  1YX7 A;  2F33 A;  3I5H C;  1WDC C;  5B8I B;  1SRA A;  2WOS A;  4MZK A;  2ZN8 A;  1KFU S;  2KFH A;  4CPV A;  1N0Y A;  2NCO A;  1B9A A;  4IL1 A;  1QJT A;  1H8B A;  1A75 A;  3PM8 A;  3A4U B;  1IH0 A;  1OMV A;  1YR5 A;  2K2A A;  1XFZ O;  1CDM A;  3NXA A;  1TCF A;  1NX1 A;  5I8N A;  3I5F C;  3LL8 B;  2Y4Q A;  1C7V A;  3SG7 A;  1TNW A;  3KO0 A;  1CLM A;  1XYD A;  5HLV A;  2BCB A;  2WC8 A;  4GNK B;  4GUK A;  1F55 A;  1SL8 A;  1TOP A;  2LUX A;  2HQW A;  1KK8 B;  2PSR A;  2LMT A;  2H61 A;  1V1G A;  2BKH B;  4DUQ A;  3CGA A;  2M49 B;  3A8R A;  4ORC B;  1NUB A;  1CDL A;  4AQJ A;  1IJ6 A;  1XK4 A;  1BMO A;  2LLS A;  1QS7 A;  4NDC A;  1N2D A;  5I2O A;  1MXL C;  4M2Q A;  3SJS A;  2LM5 A;  1YUR A;  2O60 A;  1A75 B;  3D0Y B;  2KYC A;  1G4Y R;  2FCD A;  1PAL A;  1U5I A;  1WRZ A;  2R2I A;  1NWD A;  3O78 A;  3VRN A;  4CLN A;  2SCP A;  2M9G A;  1IRJ A;  2HET A;  2E6W A;  2ZND A;  4D1E A;  3H4S E;  4GGF A;  1YRT B;  1QVI Y;  2NZ0 A;  1F8H A;  2GV5 A;  1J1D A;  2M29 A;  4L9M A;  1J7P A;  2JXL A;  4CFR A;  1GJY A;  2JZI A;  1LVC D;  1QX7 A;  2WOR A;  2KI4 C;  1FI5 A;  1WY9 A;  4ZCV A;  1FF1 A;  1YUT A;  1ZOT B;  5D69 A;  3CLN A;  1RTP 1;  3QRX A;  4FQO A;  1HQV A;  4AOM A;  4MVF A;  1SYM A;  2M0R A;  3LCP C;  2Y5I A;  2JNX A;  1PVB A;  3FWB A;  3VRR A;  3C1V A;  1DT7 B;  2EC6 B;  1SBJ A;  1BT6 A;  3TS5 C;  1GGW A;  2EGD A;  3FS7 A;  1CNP A;  1NX3 A;  1LA0 A;  4PHM A;  1MXE A;  2PMY A;  1S1E A;  2KI6 C;  5GQQ C;  4A4C A;  1J1E A;  2K7O A;  2OTG B;  5CPV A;  2LVV A;  1B8C A;  2KAY A;  4UPG A;  5KSZ A;  3ZWH A;  3IQQ A;  1AHR A;  4YGB B;  4AQI A;  4XYN A;  1IWQ A;  1KQM C;  1TCO B;  1YRU B;  2AMI A;  2LCP A;  1DTL A;  3JTD C;  4MRX A;  1FPW A;  3EVU A;  2M8U A;  3OP0 A;  1AJ5 A;  2LAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...