5GQQC

Structure of alg-2/hebp2 complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
GSDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Heme-binding protein 2
publication title Structural and Functional Study of Apoptosis-linked Gene-2Heme-binding Protein 2 Interactions in HIV-1 Production.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13202 EF-hand_5 EF hand
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5gqqC00
2FCDA 1XVJA 1TIZA 1WY9A 1PALA 1J1DA 2ZRTA 1H4BA 1YR5A 5DKRA 1K8UA 1XFWO 2K7CA 4OKHA 3SG2A 4XYNA 3BUOB 2LNKA 2LP3A 5KSZA 2PRUA 5AEQA 1KWOB 4PCWA 1KWOC 2GGZA 2M49B 4NDCA 5J3XA 1SR6B 4CFRA 1XFYO 1SR6C 2G2BA 2ISDA 1QX2A 2MRDA 1KSMA 1SCVA 4GPLB 2KOTA 1RWYA 2PVBA 1S5GZ 1WRLA 2LANA 2KQYA 1PRWA 1IJ5A 2EC6B 3I5GC 3VGOA 2P6BB 3IF7A 1UHIA 1A4PA 1SY9A 1XK4A 4CFQA 1DF0B 2LMVA 3E3RA 1U5IA 2LVVA 5ER5A 1F54A 1MUXA 1TTXA 2BKHB 2WCFA 2COLB 1BMOA 2KFGA 4N1FA 1XFUO 2MA2A 4JPZB 4WQ3A 1WDCC 3TZ1A 1J55A 1BODA 4FQOA 1KK7Z 4QJ5B 1NX3A 3BUMB 1G33A 3VRNA 3SIAA 2BE6A 1U5IB 3PATA 2ZKMX 1K9KA 2M9GA 2OPOA 1QTXA 1KK8C 3NSLA 1KSOA 3AKBA 1B7TZ 1L7ZA 1YVLA 2IS9A 1ALVA 1LINA 1DJXA 1S36A 4DS7A 1UHKA 3I5IB 3I5IC 2KNEA 1UP5A 4HRGA 1QIWA 2CCMA 2HQ8A 2KI6D 3ICBA 2BECA 1FPWA 2LLSA 1XA5A 1L2OB 2M29A 3JVTB 1L2OC 1QV1A 2JNXA 1BR1B 1UUSA 2KAYA 3NSKA 4A4CA 3CS1A 1EH2A 1J7RA 2CTNA 2BCAA 1M31A 5BPJA 1XFVO 3LK0A 4MSPA 5DKQA 1M45A 1CMFA 1BF5A 5KU1A 1PSBA 3SG5A 3A4UB 3GK1A 3D10A 1AHRA 2LVJA 4Q04A 3SJSA 3CLNA 1EJ3A 2O60A 5CPVA 5I2OA 2OTGB 1CDLA 4HRHA 2K7DA 2OTGC 2WCBA 1K90D 1NPQA 1EG3A 2SASA 2WC8A 2ZN8A 1NYAA 2PALA 1TNQA 4P2YB 4XJKA 3WHTB 3EKHA 2KFHA 3KO0A 4PHMA 1XO5A 2HQWA 4GFTA 2KHNA 1OOJA 3SIBA 1NP8A 4OVNF 1A75A 4AQIA 1OZSA 3TDIA 4R1EA 1AJ4A 1DGVA 2KYCA 2K2FA 1DTLA 2F8PA 1IGVA 1OMVA 5JJGA 2JPTA 4C0JA 4L9MA 2KDHA 1DJZA 1OQPA 2LE9B 1YUUA 2JU0A 2M3WA 4P5OE 1ZOTB 4USLA 2OS8C 1V1GA 5TNCA 1QLKA 3KF9A 2JULA 2JTZA 3WNXB 2MHHA 1IRJA 1FW4A 4WRIA 1YUTA 1A75B 1QX5B 2O5GA 1CM4A 3BOWA 1K94A 2PSRA 3CGAA 3D0YA 4AQJA 1E8AA 2WORA 5B8IB 5G08A 5HKWA 2H2KA 1G8IA 2LAPA 1VRKA 2AAOA 2I7AA 1F55A 3EK8A 1AP4A 4I5NB 4YGDB 2JC2A 2JQ6A 1H8BA 3VROA 1CTRA 1B4CA 1CMGA 4GGFC 1BOCA 2F2PA 3SG4A 1IG5A 2BCXA 1S5GY 1IQ5A 4I5KA 3FIAA 3BOWB 2JWWA 3D0YB 1DGUA 4GBAA 3TDZA 1TCFA 3DF0B 2L4HA 3RM1A 2KFFA 4MRYA 1A03A 2EHBA 1DF0A 1KCYA 1UWOA 2LV7A 1XYDA 2JXCA 2F3ZA 2ZN9A 3EKJA 3JTDB 1S26D 3JTDC 1NCZA 2NCOA 3EK4A 4MRXA 3VRPA 1Y1XA 2LVIA 3SG3A 1B9AA 2TN4A 3I5GB 5D69A 3CR4X 2JXLA 1BT6A 1N2DA 5JOLA 1JSAA 2QPTA 3AKAA 1KK7Y 3CWGA 1F4OA 1WRKA 1NX2A 2JT0A 4OV2A 1JBAA 4M2OA 1W7IB 1EXRA 2A4JA 2M1UA 1PVBA 3M0WA 4YGEB 4DCKA 4CIDA 1EG4A 2MLEC 4DIRA 2I18A 1F8HA 1IJ6A 1WDCB 5HKZA 1B7TY 1G4YR 2PMYA 2M0RA 2Y5IA 4PE1A 1F71A 3LCPC 2LCPA 3LL8B 5I2LA 3PFVA 1YX8A 1QS7A 2KI4B 2KI4C 1CLBA 3NSOA 2BCBA 3F45A 3PN7B 3FWCA 3PN7C 3VRQA 1KK8B 1UURA 1NCXA 5AANA 1UHNA 2CT9A 2KBIA 4PE4A 2MJWB 1CFPA 3BQ3A 1QATA 3OP0A 1R2UA 2KAVA 1PULA 2M1KB 4ZCUA 1LVCD 1QIVA 2KGBC 2EGDA 2RGIA 1B47A 1QASA 3O2PA 4NQGA 2K7BA 1JF0A 2E30A 4GUKA 1OE9B 2KSPA 4YBHB 1J7QA 1GQMA 2H61A 1JF2A 2JNFA 4JQ0D 2Y1NA 1DJGA 3DVJA 1IWQA 4PE7A 1QJTA 3EVVA 4HREE 4CPVA 4F0ZB 3OHMB 1CLMA 1RFJA 1AUIB 2Y4QA 4OCIA 1IH0A 5CSJA 1B8RA 1OMRA 3TUYC 3NXAA 1YURA 4ZCVA 3RLZA 1NIWA 3A8RA 1ALWA 2JTTA 1WLZA 3GK2A 5KTYA 1DMOA 2H61C 4PE0A 1V1FA 2K61A 4PDZA 1C7VA 1DJHA 1F4QA 2KI6C 3OB1B 2KQ6A 1DT7B 1K96A 1KQVA 1CM1A 1YX7A 2ZFDA 1MXEA 5I8NA 1SYMA 2F33A 1W7JB 1J1EA 4ORCB 3O4YA 1ODBA 4MZJA 1YTZC 1YUSA 1S6JA 4NDBA 3DVMA 2MLFC 2BBMA 1CFCA 1R6PA 3ZNIA 1CDNA 1CDMA 2JOJA 1FI6A 3BUWB 1GJYA 3PALA 2M7NA 2BL0B 5AXIA 2BL0C 2KAXA 3I5HB 3I5HC 2OS8B 4PHJA 4YGBB 3I5FC 2M8UA 1A2XA 4AOMA 1B8LA 1GGZA 1MQ1A 2F2OA 2M7LA 1K2HA 2G9BA 4GGFA 1ZACA 1SK6D 2LHIA 5HLOA 4QJ4B 1YRUB 1FBVA 4PHKA 2JRFA 2L4IA 4MEWA 1B1GA 3DF0A 1KFUS 1WRZA 3PSRA 1Y1UA 5K89A 4D1EA 3TDUA 1J7PA 3SG7A 4ORBB 1Q80A 2L50A 4QJ3B 1IKUA 1CB1A 2WNDA 2R2IA 3H4SE 1BU3A 1JFKA 3CR2A 2LLTA 3AAKA 4N1GA 1FI5A 3EK7A 3MSEB 3NSIA 3KEVA 2Y1MA 2L0PA 1AJ5A 3CZTX 4C0LA 1LXFC 4IL1A 1IQ3A 1CNPA 2L5XB 1LKJA 2Q4UA 2GV5A 1SNLA 4PALA 3FWBA 1KFXS 1Y1AA 3CR5X 1SPYA 5CSIA 1GGWA 1CLLA 3ZWHA 1QVIZ 2I94A 3GOFA 2PASA 2SCPA 1B8CA 1MWNA 1M46A 3PLFB 1PVAA 1K9UA 3HCMA 1QXPA 2GGMA 1KQMB 1M63B 1KQMC 1C07A 2CBLA 2ZNDA 2BBNA 2LVKA 3BUXB 3IQQA 5F6TA 1RTP1 3LK1A 3KHEA 1SRAA 2WCEA 2L2EA 4GNKB 5HLVA 2KYFA 1N65A 3DVEA 5FYXA 4UPGA 3OB2B 4YGCB 5AFPA 1QLSA 2AUCA 4C0KA 1TNPA 2JZIA 5GQQC 2EC6C 3O6BA 4I5JA 1K9PA 2NXQA 1NWDA 1JFJA 3BUNB 3K21A 1S1EA 1N0YA 1K93D 5PALA 2AMIA 3C1VA 4ICBA 5CSNA 2FOTA 1MHOA 3QRXA 3SG6A 1QV0A 2V53A 2F3YA 1SBJA 4MVFA 1TN4A 3WHUB 3AAJA 4WQ2A 5HKYA 1TOPA 1OSAA 1PSRA 2ZNEA 1NCYA 2L98A 4MLWA 2HPSA 2FJUB 2E6WA 1SCMB 1YRTB 3EVUA 1SCMC 2K2AA 4PHNA 5DKNA 1ZFSA 5IBWA 4OR9B 1RECA 1UHHA 1CFFA 4CLNA 1XK4C 2BE4A 1AK8A 1S3PA 2L51A 1M39A 3EVRA 4I5LB 1ZUZA 1NX1A 1F70A 1KFUL 2LP2A 4E68A 2NCPA 1OZOA 4MN0A 4ETOA 1C7WA 1SL7A 2K7OA 2WOSA 1A29A 1TCOB 1SL8A 3TUYB 3DVKA 4YRUA 1FF1A 1ZMZA 1BR4B 4MBEA 5HYDA 1OMDA 2KBMA 2Q91A 2JT8A 1CDPA 3BYAA 3JVTC 1MF8B 2VRGA 4M2QA 1BG1A 1MR8A 1AVSA 2LC5A 4YI8A 1TNXA 2D8NA 3GK4X 2JT3A 1S6CA 5CSFA 3O78A 1EL4A 3FS7A 4A4BA 1X02A 2LMTA 1KFXL 2HF5A 1NX0A 2MAZA 2K0JA 1PK0D 1HQVA 1Y0VH 1WLMA 4U8DA 3VRRA 4BY5A 2MBXA 1DVIA 3OX5A 4FTGA 2LM5A 4YGAA 1RROA 4HSZA 3WXAA 2BKIB 5D7FA 2CNPA 4ORAB 1QX7A 1DJYA 5AERA 2LMUA 4MZLA 1DJIA 1RK9A 1DJWA 3I5FB 2K8MB 3CTNA 2NLNA 3KPXA 1CKKA 2CXJA 1LA3A 1LA0A 2I2RE 2LLUA 2LUXA 1CFDA 1SW8A 5I2QA 4DRWA 4DUQA 1JWDA 1RJVA 1NUBA 1BLQA 2KGRA 2LUCA 1SL9A 3HX4A 2HETA 2NZ0A 3IQOA 3OX6A 4M2PA 4YI9A 1MXLC 1NSHA 4BY4A 4XJKB 1JUOA 1YVHA 1SMGA 1Y6WA 3BXKA 1XFZO 4MZKA 4GAOA 1QVIY 2ZRSA 2B1UA 4JWQA 1TRFA 2M97A 4N5XA 1D1OA 2QACA 4GGNA 1S6IA 1TNWA 1JC2A 2DOQA 2FCEA 3DD4A 5ER4X 3TS5B 1J7OA 3TS5C 3LLEA 1HT9A 1BJFA 2LHLA 4NDDA 1XFXO 1SKTA 4TNCA 3PM8A 1K95A 1UHJA
chains in the Genus database with same CATH superfamily
2FCDA 1XVJA 1TUZA 1TIZA 1WY9A 1PALA 1J1DA 2KLDA 2ZRTA 1YR5A 1H4BA 5DKRA 1K8UA 1XFWO 2K7CA 4OKHA 3SG2A 4XYNA 3BUOB 3UNWA 2LNKA 2LP3A 5KSZA 2PRUA 5AEQA 1T14A 2JPOA 1KWOB 4PCWA 1KWOC 2GGZA 2M49B 4NDCA 5J3XA 1SR6B 4CFRA 1XFYO 1SR6C 2G2BA 2ISDA 1QX2A 3DY9A 2MRDA 3IVTA 1KSMA 1SCVA 4GPLB 2KOTA 3NGVA 1RWYA 2PVBA 1S5GZ 1WRLA 2LANA 2BAPA 2QEVA 2KQYA 1PRWA 4PT1A 1IJ5A 5DICA 3B87A 2EC6B 3I5GC 3VGOA 1C3YA 2P6BB 3R1PA 3IF7A 5HL1A 3FE8A 1UHIA 1A4PA 1SY9A 1XK4A 4CFQA 1DF0B 2LMVA 3E3RA 1U5IA 2LVVA 5ER5A 1F54A 3PJIA 1MUXA 1TTXA 2BKHB 2WCFA 2COLB 1BMOA 2KFGA 3L4AA 4N1FA 2WC6A 1XFUO 2MA2A 4JPZB 4WQ3A 3SS4A 1WDCC 3TZ1A 1DC1A 1J55A 1BODA 4FQOA 1XFRA 1KK7Z 4QJ5B 1NX3A 1W9ZA 3BUMB 1G33A 3VRNA 3SIAA 2BE6A 1Z4HA 1U5IB 3PATA 2ZKMX 1K9KA 2M9GA 2OPOA 1QTXA 1KK8C 3NSLA 1KSOA 3SS3A 3AKBA 1B7TZ 1L7ZA 1YVLA 2IS9A 1ALVA 1LINA 1DJXA 1S36A 4DS7A 1UHKA 3I5IB 3I5IC 2KNEA 1UP5A 4HRGA 1QIWA 2CCMA 2HQ8A 2KI6D 3ICBA 2BECA 1FPWA 2LLSA 1XA5A 1L2OB 2M29A 3JVTB 1L2OC 3UO9A 1QV1A 2JNXA 1BR1B 1UUSA 2KAYA 3NSKA 3OBVA 4A4CA 3L47A 3CS1A 1EH2A 1J7RA 2FJYA 3PM2A 2CTNA 2BCAA 1M31A 5BPJA 1XFVO 3LK0A 4MSPA 5DKQA 1M45A 1CMFA 1BF5A 5KU1A 1PSBA 3SG5A 3A4UB 1OOIX 3D10A 3GK1A 1AHRA 2L2CA 2LVJA 4Q04A 3SJSA 3CLNA 3R72A 1EJ3A 2O60A 5CPVA 5I2OA 2OTGB 1CDLA 4HRHA 2K7DA 2OTGC 2WCBA 1K90D 1NPQA 1EG3A 2SASA 2WC8A 2ZN8A 1NYAA 2PALA 1TNQA 4P2YB 4XJKA 3WHTB 3EKHA 2KFHA 3KO0A 4PHMA 1XO5A 2HQWA 4GFTA 2KHNA 1OOJA 3SIBA 1NP8A 4OVNF 1A75A 4AQIA 1OZSA 4KYNA 3TDIA 3SS5A 4R1EA 1AJ4A 1DGVA 2KYCA 2K2FA 1DTLA 2F8PA 2GTEA 1IGVA 1OMVA 5FI2A 5JJGA 2L5YA 2JPTA 3DZTA 4C0JA 4L9MA 2KDHA 1DJZA 1OQPA 2LE9B 3D73A 1YUUA 2JU0A 2M3WA 4P5OE 1ZOTB 4USLA 2OS8C 1V1GA 5TNCA 1QLKA 3KF9A 2JULA 2JTZA 3WNXB 5I94A 2MHHA 1IRJA 1FW4A 3BFHA 1YUTA 1A75B 1QX5B 2O5GA 4WRIA 1CM4A 3BOWA 3R1OA 1K94A 2PSRA 3CGAA 3D0YA 4AQJA 1E8AA 2WORA 5B8IB 5G08A 5HKWA 2H2KA 1G8IA 2LAPA 1VRKA 2AAOA 2I7AA 3S0FA 3EK8A 1AP4A 1F55A 4I5NB 3BFBA 4YGDB 2JC2A 2JQ6A 4FQTA 2WCKA 3VROA 1CTRA 1H8BA 1B4CA 1CMGA 4GGFC 1BOCA 2F2PA 3SG4A 1IG5A 2BCXA 1S5GY 1IQ5A 4I5KA 3FIAA 3BOWB 2JWWA 3D0YB 1DGUA 4GBAA 3TDZA 1TCFA 3DF0B 2L4HA 3RM1A 2KFFA 4MRYA 1A03A 2EHBA 1DF0A 2ERBA 1IIOA 1KCYA 1UWOA 2LV7A 1XYDA 2JXCA 2F3ZA 2ZN9A 3EKJA 3JTDB 1S26D 3JTDC 1GM0A 2P71A 1NCZA 2NCOA 3EK4A 4MRXA 3VRPA 1Y1XA 2LVIA 3SG3A 1B9AA 2TN4A 3CABA 3I5GB 3L4LA 5D69A 3CR4X 2JXLA 1BT6A 1N2DA 5JOLA 1JSAA 3CZ1A 2QPTA 2QEHA 1KK7Y 3AKAA 3CWGA 1F4OA 1WRKA 1NX2A 2JT0A 4OV2A 1JBAA 4M2OA 1W7IB 1EXRA 2A4JA 3S0BA 2M1UA 1PVBA 3M0WA 4YGEB 3S0DA 4DCKA 4CIDA 1EG4A 2MLEC 4DIRA 2I18A 1F8HA 1IJ6A 1WDCB 5HKZA 1B7TY 1G4YR 2PMYA 2M0RA 2Y5IA 4JD9A 3DYEA 4PE1A 1F71A 3LCPC 2LCPA 3LL8B 5I2LA 3PFVA 1YX8A 2WCLA 4JKTA 1QS7A 2KI4B 2KI4C 1CLBA 3NSOA 2BCBA 3F45A 3PN7B 3BFAA 3FWCA 3PN7C 3VRQA 1KK8B 1UURA 1NCXA 5AANA 1UHNA 2CT9A 2KBIA 4PE4A 3N7HA 2MJWB 1QWVA 1CFPA 3BQ3A 1QATA 3OP0A 1R2UA 2KAVA 1PULA 2M1KB 4ZCUA 1LVCD 3D74A 1QIVA 2KGBC 2EGDA 2RGIA 1B47A 1QASA 3O2PA 4NQGA 2K7BA 1JF0A 2E30A 4GUKA 1OE9B 2KSPA 4YBHB 1J7QA 1GQMA 2H61A 2H8VA 1JF2A 2JNFA 4JQ0D 2Y1NA 1DJGA 3DVJA 1IWQA 2WC5A 4PE7A 1QJTA 3EVVA 4HREE 3B86A 2QEOA 4CPVA 3B6XA 4F0ZB 3OHMB 1CLMA 1RFJA 1AUIB 2Y4QA 4OCIA 1IH0A 1DEKA 1B8RA 1OMRA 3B7AA 5CSJA 3NXAA 3TUYC 1YURA 4ZCVA 3RLZA 1NIWA 3A8RA 3R1VA 1ALWA 2JTTA 1WLZA 3GK2A 5KTYA 1DMOA 2H61C 4PE0A 1V1FA 2K61A 3NHTA 4PDZA 1C7VA 1DJHA 1F4QA 2KI6C 3OB1B 2KQ6A 1DT7B 1K96A 1KQVA 1CM1A 1YX7A 2ZFDA 1MXEA 5I8NA 4F7FA 1SYMA 2F33A 1W7JB 3S0GA 1J1EA 4ORCB 2YGUA 1C3ZA 1ODBA 3O4YA 4MZJA 1YTZC 1YUSA 1S6JA 4NDBA 3DVMA 2MLFC 2BBMA 1CFCA 1R6PA 3ZNIA 1CDNA 1CDMA 3D75A 2JOJA 1FI6A 3BUWB 1GJYA 3B88A 3PALA 2M7NA 2BL0B 5AXIA 2BL0C 2KAXA 3D76A 3I5HB 2OS8B 3I5HC 4PHJA 4YGBB 1DELA 3I5FC 2M8UA 1A2XA 3QMEA 1B8LA 1GGZA 1MQ1A 2F2OA 2M7LA 4AOMA 2G9BA 4GGFA 1K2HA 1ZACA 1SK6D 2LHIA 5HLOA 4QJ4B 1YRUB 1FBVA 5EL2A 4PHKA 2JRFA 2L4IA 4MEWA 1B1GA 3DF0A 1KFUS 1WRZA 3PSRA 1Y1UA 5K89A 4D1EA 3TDUA 3V2LA 1J7PA 3SG7A 4ORBB 1Q80A 2L50A 4QJ3B 1IKUA 1CB1A 2WNDA 2R2IA 3H4SE 1BU3A 1JFKA 3CR2A 2LLTA 3AAKA 4N1GA 1FI5A 3S0AA 3EK7A 2PYQA 3MSEB 3NSIA 3KEVA 2Y1MA 2L0PA 2WCHA 1AJ5A 3CZTX 4C0LA 1LXFC 4IL1A 1IQ3A 1CNPA 2L5XB 1LKJA 2Q4UA 3Q8IA 2GV5A 1SNLA 4PALA 3FWBA 1KFXS 1Y1AA 3CR5X 1SPYA 5CSIA 1GGWA 1CLLA 3ZWHA 1QVIZ 2I94A 3GOFA 3O4XA 1LS8A 2PASA 2SCPA 1B8CA 3D78A 3EG5B 1MWNA 1M46A 1OW4A 3PLFB 1PVAA 1K9UA 3HCMA 1QXPA 3CDNA 2GGMA 1KQMB 1M63B 1KQMC 1C07A 2CBLA 2ZNDA 2BBNA 2LVKA 3BUXB 3IQQA 5F6TA 1RTP1 3LK1A 1P28A 3KHEA 2BNXA 1SRAA 2WCEA 2L2EA 3K1EA 4GNKB 5HLVA 2KYFA 1N65A 3DVEA 5FYXA 4UPGA 3OB2B 4YGCB 5AFPA 1QLSA 2AUCA 4C0KA 1ORGA 1TNPA 1DQEA 2JZIA 5GQQC 2EC6C 3O6BA 4I5JA 3CYZA 1K9PA 1OOHA 2NXQA 1NWDA 4INXA 1JFJA 3BUNB 3K21A 1S1EA 3VB1A 1N0YA 1K93D 5PALA 2AMIA 3C1VA 4ICBA 5CSNA 2FOTA 1MHOA 3QRXA 3SG6A 1QV0A 2V53A 2F3YA 1SBJA 4MVFA 1TN4A 3WHUB 3AAJA 4WQ2A 3CZ2A 5HKYA 1TOPA 1OSAA 1PSRA 2ZNEA 1NCYA 2L98A 4MLWA 2HPSA 2FJUB 2E6WA 1SCMB 1YRTB 3EVUA 1SCMC 2K2AA 4PHNA 5DKNA 1ZFSA 5IBWA 4OR9B 1RECA 1UHHA 1CFFA 2KPHA 4CLNA 1XK4C 2BE4A 1AK8A 1S3PA 2L51A 3DXLA 4INWA 1M39A 1OOFA 3EVRA 4I5LB 1ZUZA 1NX1A 3BJHA 1F70A 1KFUL 4OZDA 2LP2A 3RZSA 4E68A 2NCPA 1OZOA 4MN0A 4ETOA 1C7WA 1SL7A 2K7OA 2WOSA 1A29A 1TCOB 1SL8A 3TUYB 3DVKA 4YRUA 1FF1A 1ZMZA 1BR4B 4MBEA 5HYDA 2K60A 1OMDA 2KBMA 2Q91A 2JT8A 1CDPA 5FI7A 3BYAA 1TWOA 1MF8B 2VRGA 3JVTC 4M2QA 1BG1A 1MR8A 1AVSA 2LC5A 4YI8A 1TNXA 2D8NA 3OGNA 2KLEA 4IJ7A 3GK4X 2JT3A 1S6CA 5CSFA 3O78A 1EL4A 3FS7A 1TUJA 4A4BA 1X02A 2LMTA 1KFXL 2HF5A 1NX0A 2MAZA 2K0JA 1PK0D 1HQVA 1Y0VH 1WLMA 4U8DA 3VRRA 4BY5A 3D77A 1DVIA 2MBXA 3OX5A 4FTGA 2LM5A 4YGAA 1RROA 4HSZA 3WXAA 2BKIB 5D7FA 2CNPA 4ORAB 1QX7A 1DJYA 5AERA 2LMUA 4MZLA 1DJIA 1RK9A 5D3OA 1DJWA 3I5FB 3S0EA 2K8MB 1SSEB 3CTNA 2NLNA 3KPXA 1CKKA 2CXJA 1LA3A 1LA0A 2I2RE 2LLUA 2LUXA 1CFDA 1SW8A 5I2QA 4DRWA 4DUQA 1JWDA 1RJVA 1NUBA 1BLQA 2KGRA 2LUCA 1SL9A 2PQLA 3HX4A 2HETA 2NZ0A 2P70A 3IQOA 3OX6A 4M2PA 1MXLC 4YI9A 1NSHA 4BY4A 4XJKB 1JUOA 1OOGA 1YVHA 5FI6A 1SMGA 1Y6WA 3BXKA 1XFZO 2QEBA 4GAOA 2WCJA 4MZKA 1QVIY 2ZRSA 3NHIA 2B1UA 4JWQA 1TRFA 2M97A 2WCMA 4N5XA 1D1OA 2QACA 4GGNA 1S6IA 1TNWA 2QDIA 3CZ0A 1JC2A 2DOQA 2FCEA 3DD4A 5ER4X 3TS5B 3FE9A 1J7OA 3TS5C 3LLEA 1HT9A 1BJFA 2LHLA 1Z2CB 4NDDA 1XFXO 1SKTA 4TNCA 3FE6A 3PM8A 1K95A 1UHJA
chains in the Genus database with same CATH topology
2FCDA 1XVJA 1TIZA 1WY9A 1PALA 1J1DA 2ZRTA 1H4BA 1YR5A 5DKRA 1K8UA 1XFWO 2K7CA 4OKHA 3SG2A 4XYNA 3BUOB 2LNKA 2LP3A 5KSZA 2PRUA 5AEQA 1KWOB 4PCWA 1KWOC 2GGZA 2M49B 4NDCA 5J3XA 1SR6B 4CFRA 1XFYO 1SR6C 2G2BA 2ISDA 1QX2A 2MRDA 1KSMA 1SCVA 4GPLB 2KOTA 1RWYA 2PVBA 1S5GZ 1WRLA 2LANA 2KQYA 1PRWA 1IJ5A 2EC6B 3I5GC 3VGOA 2P6BB 3IF7A 1UHIA 1A4PA 1SY9A 1XK4A 4CFQA 1DF0B 2LMVA 3E3RA 1U5IA 2LVVA 5ER5A 1F54A 1MUXA 1TTXA 2BKHB 2WCFA 2COLB 1BMOA 2KFGA 4N1FA 1XFUO 2MA2A 4JPZB 4WQ3A 1WDCC 3TZ1A 1J55A 1BODA 4FQOA 1KK7Z 4QJ5B 1NX3A 3BUMB 1G33A 3VRNA 3SIAA 2BE6A 1U5IB 3PATA 2ZKMX 1K9KA 2M9GA 2OPOA 1QTXA 1KK8C 3NSLA 1KSOA 3AKBA 1B7TZ 1L7ZA 1YVLA 2IS9A 1ALVA 1LINA 1DJXA 1S36A 4DS7A 1UHKA 3I5IB 3I5IC 2KNEA 1UP5A 4HRGA 1QIWA 2CCMA 2HQ8A 2KI6D 3ICBA 2BECA 1FPWA 2LLSA 1XA5A 1L2OB 2M29A 3JVTB 1L2OC 1QV1A 2JNXA 1BR1B 1UUSA 2KAYA 3NSKA 4A4CA 3CS1A 1EH2A 1J7RA 2CTNA 2BCAA 1M31A 5BPJA 1XFVO 3LK0A 4MSPA 5DKQA 1M45A 1CMFA 1BF5A 5KU1A 1PSBA 3SG5A 3A4UB 3GK1A 3D10A 1AHRA 2LVJA 4Q04A 3SJSA 3CLNA 1EJ3A 2O60A 5CPVA 5I2OA 2OTGB 1CDLA 4HRHA 2K7DA 2OTGC 2WCBA 1K90D 1NPQA 1EG3A 2SASA 2WC8A 2ZN8A 1NYAA 2PALA 1TNQA 4P2YB 4XJKA 3WHTB 3EKHA 2KFHA 3KO0A 4PHMA 1XO5A 2HQWA 4GFTA 2KHNA 1OOJA 3SIBA 1NP8A 4OVNF 1A75A 4AQIA 1OZSA 3TDIA 4R1EA 1AJ4A 1DGVA 2KYCA 2K2FA 1DTLA 2F8PA 1IGVA 1OMVA 5JJGA 2JPTA 4C0JA 4L9MA 2KDHA 1DJZA 1OQPA 2LE9B 1YUUA 2JU0A 2M3WA 4P5OE 1ZOTB 4USLA 2OS8C 1V1GA 5TNCA 1QLKA 3KF9A 2JULA 2JTZA 3WNXB 2MHHA 1IRJA 1FW4A 4WRIA 1YUTA 1A75B 1QX5B 2O5GA 1CM4A 3BOWA 1K94A 2PSRA 3CGAA 3D0YA 4AQJA 1E8AA 2WORA 5B8IB 5G08A 5HKWA 2H2KA 1G8IA 2LAPA 1VRKA 2AAOA 2I7AA 1F55A 3EK8A 1AP4A 4I5NB 4YGDB 2JC2A 2JQ6A 1H8BA 3VROA 1CTRA 1B4CA 1CMGA 4GGFC 1BOCA 2F2PA 3SG4A 1IG5A 2BCXA 1S5GY 1IQ5A 4I5KA 3FIAA 3BOWB 2JWWA 3D0YB 1DGUA 4GBAA 3TDZA 1TCFA 3DF0B 2L4HA 3RM1A 2KFFA 4MRYA 1A03A 2EHBA 1DF0A 1KCYA 1UWOA 2LV7A 1XYDA 2JXCA 2F3ZA 2ZN9A 3EKJA 3JTDB 1S26D 3JTDC 1NCZA 2NCOA 3EK4A 4MRXA 3VRPA 1Y1XA 2LVIA 3SG3A 1B9AA 2TN4A 3I5GB 5D69A 3CR4X 2JXLA 1BT6A 1N2DA 5JOLA 1JSAA 2QPTA 3AKAA 1KK7Y 3CWGA 1F4OA 1WRKA 1NX2A 2JT0A 4OV2A 1JBAA 4M2OA 1W7IB 1EXRA 2A4JA 2M1UA 1PVBA 3M0WA 4YGEB 4DCKA 4CIDA 1EG4A 2MLEC 4DIRA 2I18A 1F8HA 1IJ6A 1WDCB 5HKZA 1B7TY 1G4YR 2PMYA 2M0RA 2Y5IA 4PE1A 1F71A 3LCPC 2LCPA 3LL8B 5I2LA 3PFVA 1YX8A 1QS7A 2KI4B 2KI4C 1CLBA 3NSOA 2BCBA 3F45A 3PN7B 3FWCA 3PN7C 3VRQA 1KK8B 1UURA 1NCXA 5AANA 1UHNA 2CT9A 2KBIA 4PE4A 2MJWB 1CFPA 3BQ3A 1QATA 3OP0A 1R2UA 2KAVA 1PULA 2M1KB 4ZCUA 1LVCD 1QIVA 2KGBC 2EGDA 2RGIA 1B47A 1QASA 3O2PA 4NQGA 2K7BA 1JF0A 2E30A 4GUKA 1OE9B 2KSPA 4YBHB 1J7QA 1GQMA 2H61A 1JF2A 2JNFA 4JQ0D 2Y1NA 1DJGA 3DVJA 1IWQA 4PE7A 1QJTA 3EVVA 4HREE 4CPVA 4F0ZB 3OHMB 1CLMA 1RFJA 1AUIB 2Y4QA 4OCIA 1IH0A 5CSJA 1B8RA 1OMRA 3TUYC 3NXAA 1YURA 4ZCVA 3RLZA 1NIWA 3A8RA 1ALWA 2JTTA 1WLZA 3GK2A 5KTYA 1DMOA 2H61C 4PE0A 1V1FA 2K61A 4PDZA 1C7VA 1DJHA 1F4QA 2KI6C 3OB1B 2KQ6A 1DT7B 1K96A 1KQVA 1CM1A 1YX7A 2ZFDA 1MXEA 5I8NA 1SYMA 2F33A 1W7JB 1J1EA 4ORCB 3O4YA 1ODBA 4MZJA 1YTZC 1YUSA 1S6JA 4NDBA 3DVMA 2MLFC 2BBMA 1CFCA 1R6PA 3ZNIA 1CDNA 1CDMA 2JOJA 1FI6A 3BUWB 1GJYA 3PALA 2M7NA 2BL0B 5AXIA 2BL0C 2KAXA 3I5HB 3I5HC 2OS8B 4PHJA 4YGBB 3I5FC 2M8UA 1A2XA 4AOMA 1B8LA 1GGZA 1MQ1A 2F2OA 2M7LA 1K2HA 2G9BA 4GGFA 1ZACA 1SK6D 2LHIA 5HLOA 4QJ4B 1YRUB 1FBVA 4PHKA 2JRFA 2L4IA 4MEWA 1B1GA 3DF0A 1KFUS 1WRZA 3PSRA 1Y1UA 5K89A 4D1EA 3TDUA 1J7PA 3SG7A 4ORBB 1Q80A 2L50A 4QJ3B 1IKUA 1CB1A 2WNDA 2R2IA 3H4SE 1BU3A 1JFKA 3CR2A 2LLTA 3AAKA 4N1GA 1FI5A 3EK7A 3MSEB 3NSIA 3KEVA 2Y1MA 2L0PA 1AJ5A 3CZTX 4C0LA 1LXFC 4IL1A 1IQ3A 1CNPA 2L5XB 1LKJA 2Q4UA 2GV5A 1SNLA 4PALA 3FWBA 1KFXS 1Y1AA 3CR5X 1SPYA 5CSIA 1GGWA 1CLLA 3ZWHA 1QVIZ 2I94A 3GOFA 2PASA 2SCPA 1B8CA 1MWNA 1M46A 3PLFB 1PVAA 1K9UA 3HCMA 1QXPA 2GGMA 1KQMB 1M63B 1KQMC 1C07A 2CBLA 2ZNDA 2BBNA 2LVKA 3BUXB 3IQQA 5F6TA 1RTP1 3LK1A 3KHEA 1SRAA 2WCEA 2L2EA 4GNKB 5HLVA 2KYFA 1N65A 3DVEA 5FYXA 4UPGA 3OB2B 4YGCB 5AFPA 1QLSA 2AUCA 4C0KA 1TNPA 2JZIA 5GQQC 2EC6C 3O6BA 4I5JA 1K9PA 2NXQA 1NWDA 1JFJA 3BUNB 3K21A 1S1EA 1N0YA 1K93D 5PALA 2AMIA 3C1VA 4ICBA 5CSNA 2FOTA 1MHOA 3QRXA 3SG6A 1QV0A 2V53A 2F3YA 1SBJA 4MVFA 1TN4A 3WHUB 3AAJA 4WQ2A 5HKYA 1TOPA 1OSAA 1PSRA 2ZNEA 1NCYA 2L98A 4MLWA 2HPSA 2FJUB 2E6WA 1SCMB 1YRTB 3EVUA 1SCMC 2K2AA 4PHNA 5DKNA 1ZFSA 5IBWA 4OR9B 1RECA 1UHHA 1CFFA 4CLNA 1XK4C 2BE4A 1AK8A 1S3PA 2L51A 1M39A 3EVRA 4I5LB 1ZUZA 1NX1A 1F70A 1KFUL 2LP2A 4E68A 2NCPA 1OZOA 4MN0A 4ETOA 1C7WA 1SL7A 2K7OA 2WOSA 1A29A 1TCOB 1SL8A 3TUYB 3DVKA 4YRUA 1FF1A 1ZMZA 1BR4B 4MBEA 5HYDA 1OMDA 2KBMA 2Q91A 2JT8A 1CDPA 3BYAA 3JVTC 1MF8B 2VRGA 4M2QA 1BG1A 1MR8A 1AVSA 2LC5A 4YI8A 1TNXA 2D8NA 3GK4X 2JT3A 1S6CA 5CSFA 3O78A 1EL4A 3FS7A 4A4BA 1X02A 2LMTA 1KFXL 2HF5A 1NX0A 2MAZA 2K0JA 1PK0D 1HQVA 1Y0VH 1WLMA 4U8DA 3VRRA 4BY5A 2MBXA 1DVIA 3OX5A 4FTGA 2LM5A 4YGAA 1RROA 4HSZA 3WXAA 2BKIB 5D7FA 2CNPA 4ORAB 1QX7A 1DJYA 5AERA 2LMUA 4MZLA 1DJIA 1RK9A 1DJWA 3I5FB 2K8MB 3CTNA 2NLNA 3KPXA 1CKKA 2CXJA 1LA3A 1LA0A 2I2RE 2LLUA 2LUXA 1CFDA 1SW8A 5I2QA 4DRWA 4DUQA 1JWDA 1RJVA 1NUBA 1BLQA 2KGRA 2LUCA 1SL9A 3HX4A 2HETA 2NZ0A 3IQOA 3OX6A 4M2PA 4YI9A 1MXLC 1NSHA 4BY4A 4XJKB 1JUOA 1YVHA 1SMGA 1Y6WA 3BXKA 1XFZO 4MZKA 4GAOA 1QVIY 2ZRSA 2B1UA 4JWQA 1TRFA 2M97A 4N5XA 1D1OA 2QACA 4GGNA 1S6IA 1TNWA 1JC2A 2DOQA 2FCEA 3DD4A 5ER4X 3TS5B 1J7OA 3TS5C 3LLEA 1HT9A 1BJFA 2LHLA 4NDDA 1XFXO 1SKTA 4TNCA 3PM8A 1K95A 1UHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCD A;  1XVJ A;  1TIZ A;  1WY9 A;  1PAL A;  1J1D A;  2ZRT A;  1H4B A;  1YR5 A;  5DKR A;  1K8U A;  1XFW O;  2K7C A;  4OKH A;  3SG2 A;  4XYN A;  3BUO B;  2LNK A;  2LP3 A;  5KSZ A;  2PRU A;  5AEQ A;  1KWO B;  4PCW A;  1KWO C;  2GGZ A;  2M49 B;  4NDC A;  5J3X A;  1SR6 B;  4CFR A;  1XFY O;  1SR6 C;  2G2B A;  2ISD A;  1QX2 A;  2MRD A;  1KSM A;  1SCV A;  4GPL B;  2KOT A;  1RWY A;  2PVB A;  1S5G Z;  1WRL A;  2LAN A;  2KQY A;  1PRW A;  1IJ5 A;  2EC6 B;  3I5G C;  3VGO A;  2P6B B;  3IF7 A;  1UHI A;  1A4P A;  1SY9 A;  1XK4 A;  4CFQ A;  1DF0 B;  2LMV A;  3E3R A;  1U5I A;  2LVV A;  5ER5 A;  1F54 A;  1MUX A;  1TTX A;  2BKH B;  2WCF A;  2COL B;  1BMO A;  2KFG A;  4N1F A;  1XFU O;  2MA2 A;  4JPZ B;  4WQ3 A;  1WDC C;  3TZ1 A;  1J55 A;  1BOD A;  4FQO A;  1KK7 Z;  4QJ5 B;  1NX3 A;  3BUM B;  1G33 A;  3VRN A;  3SIA A;  2BE6 A;  1U5I B;  3PAT A;  2ZKM X;  1K9K A;  2M9G A;  2OPO A;  1QTX A;  1KK8 C;  3NSL A;  1KSO A;  3AKB A;  1B7T Z;  1L7Z A;  1YVL A;  2IS9 A;  1ALV A;  1LIN A;  1DJX A;  1S36 A;  4DS7 A;  1UHK A;  3I5I B;  3I5I C;  2KNE A;  1UP5 A;  4HRG A;  1QIW A;  2CCM A;  2HQ8 A;  2KI6 D;  3ICB A;  2BEC A;  1FPW A;  2LLS A;  1XA5 A;  1L2O B;  2M29 A;  3JVT B;  1L2O C;  1QV1 A;  2JNX A;  1BR1 B;  1UUS A;  2KAY A;  3NSK A;  4A4C A;  3CS1 A;  1EH2 A;  1J7R A;  2CTN A;  2BCA A;  1M31 A;  5BPJ A;  1XFV O;  3LK0 A;  4MSP A;  5DKQ A;  1M45 A;  1CMF A;  1BF5 A;  5KU1 A;  1PSB A;  3SG5 A;  3A4U B;  3GK1 A;  3D10 A;  1AHR A;  2LVJ A;  4Q04 A;  3SJS A;  3CLN A;  1EJ3 A;  2O60 A;  5CPV A;  5I2O A;  2OTG B;  1CDL A;  4HRH A;  2K7D A;  2OTG C;  2WCB A;  1K90 D;  1NPQ A;  1EG3 A;  2SAS A;  2WC8 A;  2ZN8 A;  1NYA A;  2PAL A;  1TNQ A;  4P2Y B;  4XJK A;  3WHT B;  3EKH A;  2KFH A;  3KO0 A;  4PHM A;  1XO5 A;  2HQW A;  4GFT A;  2KHN A;  1OOJ A;  3SIB A;  1NP8 A;  4OVN F;  1A75 A;  4AQI A;  1OZS A;  3TDI A;  4R1E A;  1AJ4 A;  1DGV A;  2KYC A;  2K2F A;  1DTL A;  2F8P A;  1IGV A;  1OMV A;  5JJG A;  2JPT A;  4C0J A;  4L9M A;  2KDH A;  1DJZ A;  1OQP A;  2LE9 B;  1YUU A;  2JU0 A;  2M3W A;  4P5O E;  1ZOT B;  4USL A;  2OS8 C;  1V1G A;  5TNC A;  1QLK A;  3KF9 A;  2JUL A;  2JTZ A;  3WNX B;  2MHH A;  1IRJ A;  1FW4 A;  4WRI A;  1YUT A;  1A75 B;  1QX5 B;  2O5G A;  1CM4 A;  3BOW A;  1K94 A;  2PSR A;  3CGA A;  3D0Y A;  4AQJ A;  1E8A A;  2WOR A;  5B8I B;  5G08 A;  5HKW A;  2H2K A;  1G8I A;  2LAP A;  1VRK A;  2AAO A;  2I7A A;  1F55 A;  3EK8 A;  1AP4 A;  4I5N B;  4YGD B;  2JC2 A;  2JQ6 A;  1H8B A;  3VRO A;  1CTR A;  1B4C A;  1CMG A;  4GGF C;  1BOC A;  2F2P A;  3SG4 A;  1IG5 A;  2BCX A;  1S5G Y;  1IQ5 A;  4I5K A;  3FIA A;  3BOW B;  2JWW A;  3D0Y B;  1DGU A;  4GBA A;  3TDZ A;  1TCF A;  3DF0 B;  2L4H A;  3RM1 A;  2KFF A;  4MRY A;  1A03 A;  2EHB A;  1DF0 A;  1KCY A;  1UWO A;  2LV7 A;  1XYD A;  2JXC A;  2F3Z A;  2ZN9 A;  3EKJ A;  3JTD B;  1S26 D;  3JTD C;  1NCZ A;  2NCO A;  3EK4 A;  4MRX A;  3VRP A;  1Y1X A;  2LVI A;  3SG3 A;  1B9A A;  2TN4 A;  3I5G B;  5D69 A;  3CR4 X;  2JXL A;  1BT6 A;  1N2D A;  5JOL A;  1JSA A;  2QPT A;  3AKA A;  1KK7 Y;  3CWG A;  1F4O A;  1WRK A;  1NX2 A;  2JT0 A;  4OV2 A;  1JBA A;  4M2O A;  1W7I B;  1EXR A;  2A4J A;  2M1U A;  1PVB A;  3M0W A;  4YGE B;  4DCK A;  4CID A;  1EG4 A;  2MLE C;  4DIR A;  2I18 A;  1F8H A;  1IJ6 A;  1WDC B;  5HKZ A;  1B7T Y;  1G4Y R;  2PMY A;  2M0R A;  2Y5I A;  4PE1 A;  1F71 A;  3LCP C;  2LCP A;  3LL8 B;  5I2L A;  3PFV A;  1YX8 A;  1QS7 A;  2KI4 B;  2KI4 C;  1CLB A;  3NSO A;  2BCB A;  3F45 A;  3PN7 B;  3FWC A;  3PN7 C;  3VRQ A;  1KK8 B;  1UUR A;  1NCX A;  5AAN A;  1UHN A;  2CT9 A;  2KBI A;  4PE4 A;  2MJW B;  1CFP A;  3BQ3 A;  1QAT A;  3OP0 A;  1R2U A;  2KAV A;  1PUL A;  2M1K B;  4ZCU A;  1LVC D;  1QIV A;  2KGB C;  2EGD A;  2RGI A;  1B47 A;  1QAS A;  3O2P A;  4NQG A;  2K7B A;  1JF0 A;  2E30 A;  4GUK A;  1OE9 B;  2KSP A;  4YBH B;  1J7Q A;  1GQM A;  2H61 A;  1JF2 A;  2JNF A;  4JQ0 D;  2Y1N A;  1DJG A;  3DVJ A;  1IWQ A;  4PE7 A;  1QJT A;  3EVV A;  4HRE E;  4CPV A;  4F0Z B;  3OHM B;  1CLM A;  1RFJ A;  1AUI B;  2Y4Q A;  4OCI A;  1IH0 A;  5CSJ A;  1B8R A;  1OMR A;  3TUY C;  3NXA A;  1YUR A;  4ZCV A;  3RLZ A;  1NIW A;  3A8R A;  1ALW A;  2JTT A;  1WLZ A;  3GK2 A;  5KTY A;  1DMO A;  2H61 C;  4PE0 A;  1V1F A;  2K61 A;  4PDZ A;  1C7V A;  1DJH A;  1F4Q A;  2KI6 C;  3OB1 B;  2KQ6 A;  1DT7 B;  1K96 A;  1KQV A;  1CM1 A;  1YX7 A;  2ZFD A;  1MXE A;  5I8N A;  1SYM A;  2F33 A;  1W7J B;  1J1E A;  4ORC B;  3O4Y A;  1ODB A;  4MZJ A;  1YTZ C;  1YUS A;  1S6J A;  4NDB A;  3DVM A;  2MLF C;  2BBM A;  1CFC A;  1R6P A;  3ZNI A;  1CDN A;  1CDM A;  2JOJ A;  1FI6 A;  3BUW B;  1GJY A;  3PAL A;  2M7N A;  2BL0 B;  5AXI A;  2BL0 C;  2KAX A;  3I5H B;  3I5H C;  2OS8 B;  4PHJ A;  4YGB B;  3I5F C;  2M8U A;  1A2X A;  4AOM A;  1B8L A;  1GGZ A;  1MQ1 A;  2F2O A;  2M7L A;  1K2H A;  2G9B A;  4GGF A;  1ZAC A;  1SK6 D;  2LHI A;  5HLO A;  4QJ4 B;  1YRU B;  1FBV A;  4PHK A;  2JRF A;  2L4I A;  4MEW A;  1B1G A;  3DF0 A;  1KFU S;  1WRZ A;  3PSR A;  1Y1U A;  5K89 A;  4D1E A;  3TDU A;  1J7P A;  3SG7 A;  4ORB B;  1Q80 A;  2L50 A;  4QJ3 B;  1IKU A;  1CB1 A;  2WND A;  2R2I A;  3H4S E;  1BU3 A;  1JFK A;  3CR2 A;  2LLT A;  3AAK A;  4N1G A;  1FI5 A;  3EK7 A;  3MSE B;  3NSI A;  3KEV A;  2Y1M A;  2L0P A;  1AJ5 A;  3CZT X;  4C0L A;  1LXF C;  4IL1 A;  1IQ3 A;  1CNP A;  2L5X B;  1LKJ A;  2Q4U A;  2GV5 A;  1SNL A;  4PAL A;  3FWB A;  1KFX S;  1Y1A A;  3CR5 X;  1SPY A;  5CSI A;  1GGW A;  1CLL A;  3ZWH A;  1QVI Z;  2I94 A;  3GOF A;  2PAS A;  2SCP A;  1B8C A;  1MWN A;  1M46 A;  3PLF B;  1PVA A;  1K9U A;  3HCM A;  1QXP A;  2GGM A;  1KQM B;  1M63 B;  1KQM C;  1C07 A;  2CBL A;  2ZND A;  2BBN A;  2LVK A;  3BUX B;  3IQQ A;  5F6T A;  1RTP 1;  3LK1 A;  3KHE A;  1SRA A;  2WCE A;  2L2E A;  4GNK B;  5HLV A;  2KYF A;  1N65 A;  3DVE A;  5FYX A;  4UPG A;  3OB2 B;  4YGC B;  5AFP A;  1QLS A;  2AUC A;  4C0K A;  1TNP A;  2JZI A;  5GQQ C;  2EC6 C;  3O6B A;  4I5J A;  1K9P A;  2NXQ A;  1NWD A;  1JFJ A;  3BUN B;  3K21 A;  1S1E A;  1N0Y A;  1K93 D;  5PAL A;  2AMI A;  3C1V A;  4ICB A;  5CSN A;  2FOT A;  1MHO A;  3QRX A;  3SG6 A;  1QV0 A;  2V53 A;  2F3Y A;  1SBJ A;  4MVF A;  1TN4 A;  3WHU B;  3AAJ A;  4WQ2 A;  5HKY A;  1TOP A;  1OSA A;  1PSR A;  2ZNE A;  1NCY A;  2L98 A;  4MLW A;  2HPS A;  2FJU B;  2E6W A;  1SCM B;  1YRT B;  3EVU A;  1SCM C;  2K2A A;  4PHN A;  5DKN A;  1ZFS A;  5IBW A;  4OR9 B;  1REC A;  1UHH A;  1CFF A;  4CLN A;  1XK4 C;  2BE4 A;  1AK8 A;  1S3P A;  2L51 A;  1M39 A;  3EVR A;  4I5L B;  1ZUZ A;  1NX1 A;  1F70 A;  1KFU L;  2LP2 A;  4E68 A;  2NCP A;  1OZO A;  4MN0 A;  4ETO A;  1C7W A;  1SL7 A;  2K7O A;  2WOS A;  1A29 A;  1TCO B;  1SL8 A;  3TUY B;  3DVK A;  4YRU A;  1FF1 A;  1ZMZ A;  1BR4 B;  4MBE A;  5HYD A;  1OMD A;  2KBM A;  2Q91 A;  2JT8 A;  1CDP A;  3BYA A;  3JVT C;  1MF8 B;  2VRG A;  4M2Q A;  1BG1 A;  1MR8 A;  1AVS A;  2LC5 A;  4YI8 A;  1TNX A;  2D8N A;  3GK4 X;  2JT3 A;  1S6C A;  5CSF A;  3O78 A;  1EL4 A;  3FS7 A;  4A4B A;  1X02 A;  2LMT A;  1KFX L;  2HF5 A;  1NX0 A;  2MAZ A;  2K0J A;  1PK0 D;  1HQV A;  1Y0V H;  1WLM A;  4U8D A;  3VRR A;  4BY5 A;  2MBX A;  1DVI A;  3OX5 A;  4FTG A;  2LM5 A;  4YGA A;  1RRO A;  4HSZ A;  3WXA A;  2BKI B;  5D7F A;  2CNP A;  4ORA B;  1QX7 A;  1DJY A;  5AER A;  2LMU A;  4MZL A;  1DJI A;  1RK9 A;  1DJW A;  3I5F B;  2K8M B;  3CTN A;  2NLN A;  3KPX A;  1CKK A;  2CXJ A;  1LA3 A;  1LA0 A;  2I2R E;  2LLU A;  2LUX A;  1CFD A;  1SW8 A;  5I2Q A;  4DRW A;  4DUQ A;  1JWD A;  1RJV A;  1NUB A;  1BLQ A;  2KGR A;  2LUC A;  1SL9 A;  3HX4 A;  2HET A;  2NZ0 A;  3IQO A;  3OX6 A;  4M2P A;  4YI9 A;  1MXL C;  1NSH A;  4BY4 A;  4XJK B;  1JUO A;  1YVH A;  1SMG A;  1Y6W A;  3BXK A;  1XFZ O;  4MZK A;  4GAO A;  1QVI Y;  2ZRS A;  2B1U A;  4JWQ A;  1TRF A;  2M97 A;  4N5X A;  1D1O A;  2QAC A;  4GGN A;  1S6I A;  1TNW A;  1JC2 A;  2DOQ A;  2FCE A;  3DD4 A;  5ER4 X;  3TS5 B;  1J7O A;  3TS5 C;  3LLE A;  1HT9 A;  1BJF A;  2LHL A;  4NDD A;  1XFX O;  1SKT A;  4TNC A;  3PM8 A;  1K95 A;  1UHJ A; 
#chains in the Genus database with same CATH topology
 2FCD A;  1XVJ A;  1TUZ A;  1TIZ A;  1WY9 A;  1PAL A;  1J1D A;  2KLD A;  2ZRT A;  1YR5 A;  1H4B A;  5DKR A;  1K8U A;  1XFW O;  2K7C A;  4OKH A;  3SG2 A;  4XYN A;  3BUO B;  3UNW A;  2LNK A;  2LP3 A;  5KSZ A;  2PRU A;  5AEQ A;  1T14 A;  2JPO A;  1KWO B;  4PCW A;  1KWO C;  2GGZ A;  2M49 B;  4NDC A;  5J3X A;  1SR6 B;  4CFR A;  1XFY O;  1SR6 C;  2G2B A;  2ISD A;  1QX2 A;  3DY9 A;  2MRD A;  3IVT A;  1KSM A;  1SCV A;  4GPL B;  2KOT A;  3NGV A;  1RWY A;  2PVB A;  1S5G Z;  1WRL A;  2LAN A;  2BAP A;  2QEV A;  2KQY A;  1PRW A;  4PT1 A;  1IJ5 A;  5DIC A;  3B87 A;  2EC6 B;  3I5G C;  3VGO A;  1C3Y A;  2P6B B;  3R1P A;  3IF7 A;  5HL1 A;  3FE8 A;  1UHI A;  1A4P A;  1SY9 A;  1XK4 A;  4CFQ A;  1DF0 B;  2LMV A;  3E3R A;  1U5I A;  2LVV A;  5ER5 A;  1F54 A;  3PJI A;  1MUX A;  1TTX A;  2BKH B;  2WCF A;  2COL B;  1BMO A;  2KFG A;  3L4A A;  4N1F A;  2WC6 A;  1XFU O;  2MA2 A;  4JPZ B;  4WQ3 A;  3SS4 A;  1WDC C;  3TZ1 A;  1DC1 A;  1J55 A;  1BOD A;  4FQO A;  1XFR A;  1KK7 Z;  4QJ5 B;  1NX3 A;  1W9Z A;  3BUM B;  1G33 A;  3VRN A;  3SIA A;  2BE6 A;  1Z4H A;  1U5I B;  3PAT A;  2ZKM X;  1K9K A;  2M9G A;  2OPO A;  1QTX A;  1KK8 C;  3NSL A;  1KSO A;  3SS3 A;  3AKB A;  1B7T Z;  1L7Z A;  1YVL A;  2IS9 A;  1ALV A;  1LIN A;  1DJX A;  1S36 A;  4DS7 A;  1UHK A;  3I5I B;  3I5I C;  2KNE A;  1UP5 A;  4HRG A;  1QIW A;  2CCM A;  2HQ8 A;  2KI6 D;  3ICB A;  2BEC A;  1FPW A;  2LLS A;  1XA5 A;  1L2O B;  2M29 A;  3JVT B;  1L2O C;  3UO9 A;  1QV1 A;  2JNX A;  1BR1 B;  1UUS A;  2KAY A;  3NSK A;  3OBV A;  4A4C A;  3L47 A;  3CS1 A;  1EH2 A;  1J7R A;  2FJY A;  3PM2 A;  2CTN A;  2BCA A;  1M31 A;  5BPJ A;  1XFV O;  3LK0 A;  4MSP A;  5DKQ A;  1M45 A;  1CMF A;  1BF5 A;  5KU1 A;  1PSB A;  3SG5 A;  3A4U B;  1OOI X;  3D10 A;  3GK1 A;  1AHR A;  2L2C A;  2LVJ A;  4Q04 A;  3SJS A;  3CLN A;  3R72 A;  1EJ3 A;  2O60 A;  5CPV A;  5I2O A;  2OTG B;  1CDL A;  4HRH A;  2K7D A;  2OTG C;  2WCB A;  1K90 D;  1NPQ A;  1EG3 A;  2SAS A;  2WC8 A;  2ZN8 A;  1NYA A;  2PAL A;  1TNQ A;  4P2Y B;  4XJK A;  3WHT B;  3EKH A;  2KFH A;  3KO0 A;  4PHM A;  1XO5 A;  2HQW A;  4GFT A;  2KHN A;  1OOJ A;  3SIB A;  1NP8 A;  4OVN F;  1A75 A;  4AQI A;  1OZS A;  4KYN A;  3TDI A;  3SS5 A;  4R1E A;  1AJ4 A;  1DGV A;  2KYC A;  2K2F A;  1DTL A;  2F8P A;  2GTE A;  1IGV A;  1OMV A;  5FI2 A;  5JJG A;  2L5Y A;  2JPT A;  3DZT A;  4C0J A;  4L9M A;  2KDH A;  1DJZ A;  1OQP A;  2LE9 B;  3D73 A;  1YUU A;  2JU0 A;  2M3W A;  4P5O E;  1ZOT B;  4USL A;  2OS8 C;  1V1G A;  5TNC A;  1QLK A;  3KF9 A;  2JUL A;  2JTZ A;  3WNX B;  5I94 A;  2MHH A;  1IRJ A;  1FW4 A;  3BFH A;  1YUT A;  1A75 B;  1QX5 B;  2O5G A;  4WRI A;  1CM4 A;  3BOW A;  3R1O A;  1K94 A;  2PSR A;  3CGA A;  3D0Y A;  4AQJ A;  1E8A A;  2WOR A;  5B8I B;  5G08 A;  5HKW A;  2H2K A;  1G8I A;  2LAP A;  1VRK A;  2AAO A;  2I7A A;  3S0F A;  3EK8 A;  1AP4 A;  1F55 A;  4I5N B;  3BFB A;  4YGD B;  2JC2 A;  2JQ6 A;  4FQT A;  2WCK A;  3VRO A;  1CTR A;  1H8B A;  1B4C A;  1CMG A;  4GGF C;  1BOC A;  2F2P A;  3SG4 A;  1IG5 A;  2BCX A;  1S5G Y;  1IQ5 A;  4I5K A;  3FIA A;  3BOW B;  2JWW A;  3D0Y B;  1DGU A;  4GBA A;  3TDZ A;  1TCF A;  3DF0 B;  2L4H A;  3RM1 A;  2KFF A;  4MRY A;  1A03 A;  2EHB A;  1DF0 A;  2ERB A;  1IIO A;  1KCY A;  1UWO A;  2LV7 A;  1XYD A;  2JXC A;  2F3Z A;  2ZN9 A;  3EKJ A;  3JTD B;  1S26 D;  3JTD C;  1GM0 A;  2P71 A;  1NCZ A;  2NCO A;  3EK4 A;  4MRX A;  3VRP A;  1Y1X A;  2LVI A;  3SG3 A;  1B9A A;  2TN4 A;  3CAB A;  3I5G B;  3L4L A;  5D69 A;  3CR4 X;  2JXL A;  1BT6 A;  1N2D A;  5JOL A;  1JSA A;  3CZ1 A;  2QPT A;  2QEH A;  1KK7 Y;  3AKA A;  3CWG A;  1F4O A;  1WRK A;  1NX2 A;  2JT0 A;  4OV2 A;  1JBA A;  4M2O A;  1W7I B;  1EXR A;  2A4J A;  3S0B A;  2M1U A;  1PVB A;  3M0W A;  4YGE B;  3S0D A;  4DCK A;  4CID A;  1EG4 A;  2MLE C;  4DIR A;  2I18 A;  1F8H A;  1IJ6 A;  1WDC B;  5HKZ A;  1B7T Y;  1G4Y R;  2PMY A;  2M0R A;  2Y5I A;  4JD9 A;  3DYE A;  4PE1 A;  1F71 A;  3LCP C;  2LCP A;  3LL8 B;  5I2L A;  3PFV A;  1YX8 A;  2WCL A;  4JKT A;  1QS7 A;  2KI4 B;  2KI4 C;  1CLB A;  3NSO A;  2BCB A;  3F45 A;  3PN7 B;  3BFA A;  3FWC A;  3PN7 C;  3VRQ A;  1KK8 B;  1UUR A;  1NCX A;  5AAN A;  1UHN A;  2CT9 A;  2KBI A;  4PE4 A;  3N7H A;  2MJW B;  1QWV A;  1CFP A;  3BQ3 A;  1QAT A;  3OP0 A;  1R2U A;  2KAV A;  1PUL A;  2M1K B;  4ZCU A;  1LVC D;  3D74 A;  1QIV A;  2KGB C;  2EGD A;  2RGI A;  1B47 A;  1QAS A;  3O2P A;  4NQG A;  2K7B A;  1JF0 A;  2E30 A;  4GUK A;  1OE9 B;  2KSP A;  4YBH B;  1J7Q A;  1GQM A;  2H61 A;  2H8V A;  1JF2 A;  2JNF A;  4JQ0 D;  2Y1N A;  1DJG A;  3DVJ A;  1IWQ A;  2WC5 A;  4PE7 A;  1QJT A;  3EVV A;  4HRE E;  3B86 A;  2QEO A;  4CPV A;  3B6X A;  4F0Z B;  3OHM B;  1CLM A;  1RFJ A;  1AUI B;  2Y4Q A;  4OCI A;  1IH0 A;  1DEK A;  1B8R A;  1OMR A;  3B7A A;  5CSJ A;  3NXA A;  3TUY C;  1YUR A;  4ZCV A;  3RLZ A;  1NIW A;  3A8R A;  3R1V A;  1ALW A;  2JTT A;  1WLZ A;  3GK2 A;  5KTY A;  1DMO A;  2H61 C;  4PE0 A;  1V1F A;  2K61 A;  3NHT A;  4PDZ A;  1C7V A;  1DJH A;  1F4Q A;  2KI6 C;  3OB1 B;  2KQ6 A;  1DT7 B;  1K96 A;  1KQV A;  1CM1 A;  1YX7 A;  2ZFD A;  1MXE A;  5I8N A;  4F7F A;  1SYM A;  2F33 A;  1W7J B;  3S0G A;  1J1E A;  4ORC B;  2YGU A;  1C3Z A;  1ODB A;  3O4Y A;  4MZJ A;  1YTZ C;  1YUS A;  1S6J A;  4NDB A;  3DVM A;  2MLF C;  2BBM A;  1CFC A;  1R6P A;  3ZNI A;  1CDN A;  1CDM A;  3D75 A;  2JOJ A;  1FI6 A;  3BUW B;  1GJY A;  3B88 A;  3PAL A;  2M7N A;  2BL0 B;  5AXI A;  2BL0 C;  2KAX A;  3D76 A;  3I5H B;  2OS8 B;  3I5H C;  4PHJ A;  4YGB B;  1DEL A;  3I5F C;  2M8U A;  1A2X A;  3QME A;  1B8L A;  1GGZ A;  1MQ1 A;  2F2O A;  2M7L A;  4AOM A;  2G9B A;  4GGF A;  1K2H A;  1ZAC A;  1SK6 D;  2LHI A;  5HLO A;  4QJ4 B;  1YRU B;  1FBV A;  5EL2 A;  4PHK A;  2JRF A;  2L4I A;  4MEW A;  1B1G A;  3DF0 A;  1KFU S;  1WRZ A;  3PSR A;  1Y1U A;  5K89 A;  4D1E A;  3TDU A;  3V2L A;  1J7P A;  3SG7 A;  4ORB B;  1Q80 A;  2L50 A;  4QJ3 B;  1IKU A;  1CB1 A;  2WND A;  2R2I A;  3H4S E;  1BU3 A;  1JFK A;  3CR2 A;  2LLT A;  3AAK A;  4N1G A;  1FI5 A;  3S0A A;  3EK7 A;  2PYQ A;  3MSE B;  3NSI A;  3KEV A;  2Y1M A;  2L0P A;  2WCH A;  1AJ5 A;  3CZT X;  4C0L A;  1LXF C;  4IL1 A;  1IQ3 A;  1CNP A;  2L5X B;  1LKJ A;  2Q4U A;  3Q8I A;  2GV5 A;  1SNL A;  4PAL A;  3FWB A;  1KFX S;  1Y1A A;  3CR5 X;  1SPY A;  5CSI A;  1GGW A;  1CLL A;  3ZWH A;  1QVI Z;  2I94 A;  3GOF A;  3O4X A;  1LS8 A;  2PAS A;  2SCP A;  1B8C A;  3D78 A;  3EG5 B;  1MWN A;  1M46 A;  1OW4 A;  3PLF B;  1PVA A;  1K9U A;  3HCM A;  1QXP A;  3CDN A;  2GGM A;  1KQM B;  1M63 B;  1KQM C;  1C07 A;  2CBL A;  2ZND A;  2BBN A;  2LVK A;  3BUX B;  3IQQ A;  5F6T A;  1RTP 1;  3LK1 A;  1P28 A;  3KHE A;  2BNX A;  1SRA A;  2WCE A;  2L2E A;  3K1E A;  4GNK B;  5HLV A;  2KYF A;  1N65 A;  3DVE A;  5FYX A;  4UPG A;  3OB2 B;  4YGC B;  5AFP A;  1QLS A;  2AUC A;  4C0K A;  1ORG A;  1TNP A;  1DQE A;  2JZI A;  5GQQ C;  2EC6 C;  3O6B A;  4I5J A;  3CYZ A;  1K9P A;  1OOH A;  2NXQ A;  1NWD A;  4INX A;  1JFJ A;  3BUN B;  3K21 A;  1S1E A;  3VB1 A;  1N0Y A;  1K93 D;  5PAL A;  2AMI A;  3C1V A;  4ICB A;  5CSN A;  2FOT A;  1MHO A;  3QRX A;  3SG6 A;  1QV0 A;  2V53 A;  2F3Y A;  1SBJ A;  4MVF A;  1TN4 A;  3WHU B;  3AAJ A;  4WQ2 A;  3CZ2 A;  5HKY A;  1TOP A;  1OSA A;  1PSR A;  2ZNE A;  1NCY A;  2L98 A;  4MLW A;  2HPS A;  2FJU B;  2E6W A;  1SCM B;  1YRT B;  3EVU A;  1SCM C;  2K2A A;  4PHN A;  5DKN A;  1ZFS A;  5IBW A;  4OR9 B;  1REC A;  1UHH A;  1CFF A;  2KPH A;  4CLN A;  1XK4 C;  2BE4 A;  1AK8 A;  1S3P A;  2L51 A;  3DXL A;  4INW A;  1M39 A;  1OOF A;  3EVR A;  4I5L B;  1ZUZ A;  1NX1 A;  3BJH A;  1F70 A;  1KFU L;  4OZD A;  2LP2 A;  3RZS A;  4E68 A;  2NCP A;  1OZO A;  4MN0 A;  4ETO A;  1C7W A;  1SL7 A;  2K7O A;  2WOS A;  1A29 A;  1TCO B;  1SL8 A;  3TUY B;  3DVK A;  4YRU A;  1FF1 A;  1ZMZ A;  1BR4 B;  4MBE A;  5HYD A;  2K60 A;  1OMD A;  2KBM A;  2Q91 A;  2JT8 A;  1CDP A;  5FI7 A;  3BYA A;  1TWO A;  1MF8 B;  2VRG A;  3JVT C;  4M2Q A;  1BG1 A;  1MR8 A;  1AVS A;  2LC5 A;  4YI8 A;  1TNX A;  2D8N A;  3OGN A;  2KLE A;  4IJ7 A;  3GK4 X;  2JT3 A;  1S6C A;  5CSF A;  3O78 A;  1EL4 A;  3FS7 A;  1TUJ A;  4A4B A;  1X02 A;  2LMT A;  1KFX L;  2HF5 A;  1NX0 A;  2MAZ A;  2K0J A;  1PK0 D;  1HQV A;  1Y0V H;  1WLM A;  4U8D A;  3VRR A;  4BY5 A;  3D77 A;  1DVI A;  2MBX A;  3OX5 A;  4FTG A;  2LM5 A;  4YGA A;  1RRO A;  4HSZ A;  3WXA A;  2BKI B;  5D7F A;  2CNP A;  4ORA B;  1QX7 A;  1DJY A;  5AER A;  2LMU A;  4MZL A;  1DJI A;  1RK9 A;  5D3O A;  1DJW A;  3I5F B;  3S0E A;  2K8M B;  1SSE B;  3CTN A;  2NLN A;  3KPX A;  1CKK A;  2CXJ A;  1LA3 A;  1LA0 A;  2I2R E;  2LLU A;  2LUX A;  1CFD A;  1SW8 A;  5I2Q A;  4DRW A;  4DUQ A;  1JWD A;  1RJV A;  1NUB A;  1BLQ A;  2KGR A;  2LUC A;  1SL9 A;  2PQL A;  3HX4 A;  2HET A;  2NZ0 A;  2P70 A;  3IQO A;  3OX6 A;  4M2P A;  1MXL C;  4YI9 A;  1NSH A;  4BY4 A;  4XJK B;  1JUO A;  1OOG A;  1YVH A;  5FI6 A;  1SMG A;  1Y6W A;  3BXK A;  1XFZ O;  2QEB A;  4GAO A;  2WCJ A;  4MZK A;  1QVI Y;  2ZRS A;  3NHI A;  2B1U A;  4JWQ A;  1TRF A;  2M97 A;  2WCM A;  4N5X A;  1D1O A;  2QAC A;  4GGN A;  1S6I A;  1TNW A;  2QDI A;  3CZ0 A;  1JC2 A;  2DOQ A;  2FCE A;  3DD4 A;  5ER4 X;  3TS5 B;  3FE9 A;  1J7O A;  3TS5 C;  3LLE A;  1HT9 A;  1BJF A;  2LHL A;  1Z2C B;  4NDD A;  1XFX O;  1SKT A;  4TNC A;  3FE6 A;  3PM8 A;  1K95 A;  1UHJ A; 
#chains in the Genus database with same CATH homology
 2FCD A;  1XVJ A;  1TIZ A;  1WY9 A;  1PAL A;  1J1D A;  2ZRT A;  1H4B A;  1YR5 A;  5DKR A;  1K8U A;  1XFW O;  2K7C A;  4OKH A;  3SG2 A;  4XYN A;  3BUO B;  2LNK A;  2LP3 A;  5KSZ A;  2PRU A;  5AEQ A;  1KWO B;  4PCW A;  1KWO C;  2GGZ A;  2M49 B;  4NDC A;  5J3X A;  1SR6 B;  4CFR A;  1XFY O;  1SR6 C;  2G2B A;  2ISD A;  1QX2 A;  2MRD A;  1KSM A;  1SCV A;  4GPL B;  2KOT A;  1RWY A;  2PVB A;  1S5G Z;  1WRL A;  2LAN A;  2KQY A;  1PRW A;  1IJ5 A;  2EC6 B;  3I5G C;  3VGO A;  2P6B B;  3IF7 A;  1UHI A;  1A4P A;  1SY9 A;  1XK4 A;  4CFQ A;  1DF0 B;  2LMV A;  3E3R A;  1U5I A;  2LVV A;  5ER5 A;  1F54 A;  1MUX A;  1TTX A;  2BKH B;  2WCF A;  2COL B;  1BMO A;  2KFG A;  4N1F A;  1XFU O;  2MA2 A;  4JPZ B;  4WQ3 A;  1WDC C;  3TZ1 A;  1J55 A;  1BOD A;  4FQO A;  1KK7 Z;  4QJ5 B;  1NX3 A;  3BUM B;  1G33 A;  3VRN A;  3SIA A;  2BE6 A;  1U5I B;  3PAT A;  2ZKM X;  1K9K A;  2M9G A;  2OPO A;  1QTX A;  1KK8 C;  3NSL A;  1KSO A;  3AKB A;  1B7T Z;  1L7Z A;  1YVL A;  2IS9 A;  1ALV A;  1LIN A;  1DJX A;  1S36 A;  4DS7 A;  1UHK A;  3I5I B;  3I5I C;  2KNE A;  1UP5 A;  4HRG A;  1QIW A;  2CCM A;  2HQ8 A;  2KI6 D;  3ICB A;  2BEC A;  1FPW A;  2LLS A;  1XA5 A;  1L2O B;  2M29 A;  3JVT B;  1L2O C;  1QV1 A;  2JNX A;  1BR1 B;  1UUS A;  2KAY A;  3NSK A;  4A4C A;  3CS1 A;  1EH2 A;  1J7R A;  2CTN A;  2BCA A;  1M31 A;  5BPJ A;  1XFV O;  3LK0 A;  4MSP A;  5DKQ A;  1M45 A;  1CMF A;  1BF5 A;  5KU1 A;  1PSB A;  3SG5 A;  3A4U B;  3GK1 A;  3D10 A;  1AHR A;  2LVJ A;  4Q04 A;  3SJS A;  3CLN A;  1EJ3 A;  2O60 A;  5CPV A;  5I2O A;  2OTG B;  1CDL A;  4HRH A;  2K7D A;  2OTG C;  2WCB A;  1K90 D;  1NPQ A;  1EG3 A;  2SAS A;  2WC8 A;  2ZN8 A;  1NYA A;  2PAL A;  1TNQ A;  4P2Y B;  4XJK A;  3WHT B;  3EKH A;  2KFH A;  3KO0 A;  4PHM A;  1XO5 A;  2HQW A;  4GFT A;  2KHN A;  1OOJ A;  3SIB A;  1NP8 A;  4OVN F;  1A75 A;  4AQI A;  1OZS A;  3TDI A;  4R1E A;  1AJ4 A;  1DGV A;  2KYC A;  2K2F A;  1DTL A;  2F8P A;  1IGV A;  1OMV A;  5JJG A;  2JPT A;  4C0J A;  4L9M A;  2KDH A;  1DJZ A;  1OQP A;  2LE9 B;  1YUU A;  2JU0 A;  2M3W A;  4P5O E;  1ZOT B;  4USL A;  2OS8 C;  1V1G A;  5TNC A;  1QLK A;  3KF9 A;  2JUL A;  2JTZ A;  3WNX B;  2MHH A;  1IRJ A;  1FW4 A;  4WRI A;  1YUT A;  1A75 B;  1QX5 B;  2O5G A;  1CM4 A;  3BOW A;  1K94 A;  2PSR A;  3CGA A;  3D0Y A;  4AQJ A;  1E8A A;  2WOR A;  5B8I B;  5G08 A;  5HKW A;  2H2K A;  1G8I A;  2LAP A;  1VRK A;  2AAO A;  2I7A A;  1F55 A;  3EK8 A;  1AP4 A;  4I5N B;  4YGD B;  2JC2 A;  2JQ6 A;  1H8B A;  3VRO A;  1CTR A;  1B4C A;  1CMG A;  4GGF C;  1BOC A;  2F2P A;  3SG4 A;  1IG5 A;  2BCX A;  1S5G Y;  1IQ5 A;  4I5K A;  3FIA A;  3BOW B;  2JWW A;  3D0Y B;  1DGU A;  4GBA A;  3TDZ A;  1TCF A;  3DF0 B;  2L4H A;  3RM1 A;  2KFF A;  4MRY A;  1A03 A;  2EHB A;  1DF0 A;  1KCY A;  1UWO A;  2LV7 A;  1XYD A;  2JXC A;  2F3Z A;  2ZN9 A;  3EKJ A;  3JTD B;  1S26 D;  3JTD C;  1NCZ A;  2NCO A;  3EK4 A;  4MRX A;  3VRP A;  1Y1X A;  2LVI A;  3SG3 A;  1B9A A;  2TN4 A;  3I5G B;  5D69 A;  3CR4 X;  2JXL A;  1BT6 A;  1N2D A;  5JOL A;  1JSA A;  2QPT A;  3AKA A;  1KK7 Y;  3CWG A;  1F4O A;  1WRK A;  1NX2 A;  2JT0 A;  4OV2 A;  1JBA A;  4M2O A;  1W7I B;  1EXR A;  2A4J A;  2M1U A;  1PVB A;  3M0W A;  4YGE B;  4DCK A;  4CID A;  1EG4 A;  2MLE C;  4DIR A;  2I18 A;  1F8H A;  1IJ6 A;  1WDC B;  5HKZ A;  1B7T Y;  1G4Y R;  2PMY A;  2M0R A;  2Y5I A;  4PE1 A;  1F71 A;  3LCP C;  2LCP A;  3LL8 B;  5I2L A;  3PFV A;  1YX8 A;  1QS7 A;  2KI4 B;  2KI4 C;  1CLB A;  3NSO A;  2BCB A;  3F45 A;  3PN7 B;  3FWC A;  3PN7 C;  3VRQ A;  1KK8 B;  1UUR A;  1NCX A;  5AAN A;  1UHN A;  2CT9 A;  2KBI A;  4PE4 A;  2MJW B;  1CFP A;  3BQ3 A;  1QAT A;  3OP0 A;  1R2U A;  2KAV A;  1PUL A;  2M1K B;  4ZCU A;  1LVC D;  1QIV A;  2KGB C;  2EGD A;  2RGI A;  1B47 A;  1QAS A;  3O2P A;  4NQG A;  2K7B A;  1JF0 A;  2E30 A;  4GUK A;  1OE9 B;  2KSP A;  4YBH B;  1J7Q A;  1GQM A;  2H61 A;  1JF2 A;  2JNF A;  4JQ0 D;  2Y1N A;  1DJG A;  3DVJ A;  1IWQ A;  4PE7 A;  1QJT A;  3EVV A;  4HRE E;  4CPV A;  4F0Z B;  3OHM B;  1CLM A;  1RFJ A;  1AUI B;  2Y4Q A;  4OCI A;  1IH0 A;  5CSJ A;  1B8R A;  1OMR A;  3TUY C;  3NXA A;  1YUR A;  4ZCV A;  3RLZ A;  1NIW A;  3A8R A;  1ALW A;  2JTT A;  1WLZ A;  3GK2 A;  5KTY A;  1DMO A;  2H61 C;  4PE0 A;  1V1F A;  2K61 A;  4PDZ A;  1C7V A;  1DJH A;  1F4Q A;  2KI6 C;  3OB1 B;  2KQ6 A;  1DT7 B;  1K96 A;  1KQV A;  1CM1 A;  1YX7 A;  2ZFD A;  1MXE A;  5I8N A;  1SYM A;  2F33 A;  1W7J B;  1J1E A;  4ORC B;  3O4Y A;  1ODB A;  4MZJ A;  1YTZ C;  1YUS A;  1S6J A;  4NDB A;  3DVM A;  2MLF C;  2BBM A;  1CFC A;  1R6P A;  3ZNI A;  1CDN A;  1CDM A;  2JOJ A;  1FI6 A;  3BUW B;  1GJY A;  3PAL A;  2M7N A;  2BL0 B;  5AXI A;  2BL0 C;  2KAX A;  3I5H B;  3I5H C;  2OS8 B;  4PHJ A;  4YGB B;  3I5F C;  2M8U A;  1A2X A;  4AOM A;  1B8L A;  1GGZ A;  1MQ1 A;  2F2O A;  2M7L A;  1K2H A;  2G9B A;  4GGF A;  1ZAC A;  1SK6 D;  2LHI A;  5HLO A;  4QJ4 B;  1YRU B;  1FBV A;  4PHK A;  2JRF A;  2L4I A;  4MEW A;  1B1G A;  3DF0 A;  1KFU S;  1WRZ A;  3PSR A;  1Y1U A;  5K89 A;  4D1E A;  3TDU A;  1J7P A;  3SG7 A;  4ORB B;  1Q80 A;  2L50 A;  4QJ3 B;  1IKU A;  1CB1 A;  2WND A;  2R2I A;  3H4S E;  1BU3 A;  1JFK A;  3CR2 A;  2LLT A;  3AAK A;  4N1G A;  1FI5 A;  3EK7 A;  3MSE B;  3NSI A;  3KEV A;  2Y1M A;  2L0P A;  1AJ5 A;  3CZT X;  4C0L A;  1LXF C;  4IL1 A;  1IQ3 A;  1CNP A;  2L5X B;  1LKJ A;  2Q4U A;  2GV5 A;  1SNL A;  4PAL A;  3FWB A;  1KFX S;  1Y1A A;  3CR5 X;  1SPY A;  5CSI A;  1GGW A;  1CLL A;  3ZWH A;  1QVI Z;  2I94 A;  3GOF A;  2PAS A;  2SCP A;  1B8C A;  1MWN A;  1M46 A;  3PLF B;  1PVA A;  1K9U A;  3HCM A;  1QXP A;  2GGM A;  1KQM B;  1M63 B;  1KQM C;  1C07 A;  2CBL A;  2ZND A;  2BBN A;  2LVK A;  3BUX B;  3IQQ A;  5F6T A;  1RTP 1;  3LK1 A;  3KHE A;  1SRA A;  2WCE A;  2L2E A;  4GNK B;  5HLV A;  2KYF A;  1N65 A;  3DVE A;  5FYX A;  4UPG A;  3OB2 B;  4YGC B;  5AFP A;  1QLS A;  2AUC A;  4C0K A;  1TNP A;  2JZI A;  5GQQ C;  2EC6 C;  3O6B A;  4I5J A;  1K9P A;  2NXQ A;  1NWD A;  1JFJ A;  3BUN B;  3K21 A;  1S1E A;  1N0Y A;  1K93 D;  5PAL A;  2AMI A;  3C1V A;  4ICB A;  5CSN A;  2FOT A;  1MHO A;  3QRX A;  3SG6 A;  1QV0 A;  2V53 A;  2F3Y A;  1SBJ A;  4MVF A;  1TN4 A;  3WHU B;  3AAJ A;  4WQ2 A;  5HKY A;  1TOP A;  1OSA A;  1PSR A;  2ZNE A;  1NCY A;  2L98 A;  4MLW A;  2HPS A;  2FJU B;  2E6W A;  1SCM B;  1YRT B;  3EVU A;  1SCM C;  2K2A A;  4PHN A;  5DKN A;  1ZFS A;  5IBW A;  4OR9 B;  1REC A;  1UHH A;  1CFF A;  4CLN A;  1XK4 C;  2BE4 A;  1AK8 A;  1S3P A;  2L51 A;  1M39 A;  3EVR A;  4I5L B;  1ZUZ A;  1NX1 A;  1F70 A;  1KFU L;  2LP2 A;  4E68 A;  2NCP A;  1OZO A;  4MN0 A;  4ETO A;  1C7W A;  1SL7 A;  2K7O A;  2WOS A;  1A29 A;  1TCO B;  1SL8 A;  3TUY B;  3DVK A;  4YRU A;  1FF1 A;  1ZMZ A;  1BR4 B;  4MBE A;  5HYD A;  1OMD A;  2KBM A;  2Q91 A;  2JT8 A;  1CDP A;  3BYA A;  3JVT C;  1MF8 B;  2VRG A;  4M2Q A;  1BG1 A;  1MR8 A;  1AVS A;  2LC5 A;  4YI8 A;  1TNX A;  2D8N A;  3GK4 X;  2JT3 A;  1S6C A;  5CSF A;  3O78 A;  1EL4 A;  3FS7 A;  4A4B A;  1X02 A;  2LMT A;  1KFX L;  2HF5 A;  1NX0 A;  2MAZ A;  2K0J A;  1PK0 D;  1HQV A;  1Y0V H;  1WLM A;  4U8D A;  3VRR A;  4BY5 A;  2MBX A;  1DVI A;  3OX5 A;  4FTG A;  2LM5 A;  4YGA A;  1RRO A;  4HSZ A;  3WXA A;  2BKI B;  5D7F A;  2CNP A;  4ORA B;  1QX7 A;  1DJY A;  5AER A;  2LMU A;  4MZL A;  1DJI A;  1RK9 A;  1DJW A;  3I5F B;  2K8M B;  3CTN A;  2NLN A;  3KPX A;  1CKK A;  2CXJ A;  1LA3 A;  1LA0 A;  2I2R E;  2LLU A;  2LUX A;  1CFD A;  1SW8 A;  5I2Q A;  4DRW A;  4DUQ A;  1JWD A;  1RJV A;  1NUB A;  1BLQ A;  2KGR A;  2LUC A;  1SL9 A;  3HX4 A;  2HET A;  2NZ0 A;  3IQO A;  3OX6 A;  4M2P A;  4YI9 A;  1MXL C;  1NSH A;  4BY4 A;  4XJK B;  1JUO A;  1YVH A;  1SMG A;  1Y6W A;  3BXK A;  1XFZ O;  4MZK A;  4GAO A;  1QVI Y;  2ZRS A;  2B1U A;  4JWQ A;  1TRF A;  2M97 A;  4N5X A;  1D1O A;  2QAC A;  4GGN A;  1S6I A;  1TNW A;  1JC2 A;  2DOQ A;  2FCE A;  3DD4 A;  5ER4 X;  3TS5 B;  1J7O A;  3TS5 C;  3LLE A;  1HT9 A;  1BJF A;  2LHL A;  4NDD A;  1XFX O;  1SKT A;  4TNC A;  3PM8 A;  1K95 A;  1UHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...