5GQQC

Structure of alg-2/hebp2 complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
b'GSDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme-binding protein 2
publication title Structural and Functional Study of Apoptosis-linked Gene-2Heme-binding Protein 2 Interactions in HIV-1 Production.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 64
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13202 EF-hand_5 EF hand
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5gqqC00
3DVKA 2MLEC 1BMOA 2ZRTA 1EL4A 1IQ5A 3NSIA 2LP2A 3KHEA 2EC6B 3NSKA 1J1DA 1AVSA 3H4SE 3WNXB 3SIBA 1EH2A 3M0WA 1M63B 1LINA 4CLNA 1B7TZ 2O60A 4I5KA 1WLMA 1UHKA 3CR5X 1G8IA 2LCPA 1J7RA 1S3PA 2PASA 5ER4X 3D10A 2HQ8A 2JT0A 2M1KB 1NSHA 3BOWB 1OZSA 1YR5A 4R1EA 4YGCB 2HQWA 4MZLA 1QLKA 4DUQA 1C07A 1MXEA 3DVMA 3RM1A 2KQYA 1CLBA 1KQMC 4YGAA 1SYMA 1TTXA 3OHMB 5D7FA 1WDCC 1YRUB 2K7BA 1DGUA 5F6TA 3EVVA 2KNEA 2KSPA 1JSAA 1OSAA 2KBIA 1UP5A 3PLFB 1QTXA 3SG6A 1GGZA 1OZOA 1CDLA 3EK7A 2PVBA 4C0LA 1L2OC 1ZUZA 2CBLA 5AERA 3GK2A 4N1GA 3VGOA 1BR1B 2KHNA 5I2OA 2LMTA 1TCFA 1RK9A 5I2QA 2CT9A 1M39A 2JXLA 4GGFA 1Q80A 2OPOA 4DRWA 1J1EA 2PSRA 2KFHA 2JT8A 1GQMA 2I18A 4E68A 4HREE 2BBMA 2I7AA 2PRUA 1SCMC 2CNPA 1RFJA 1QATA 1M31A 1LA0A 2E6WA 2KAXA 1K93D 2Y5IA 3VRPA 5HKYA 2MJWB 2JWWA 1XFYO 3CS1A 3KO0A 1A75B 1F71A 5AEQA 1BG1A 1MQ1A 2CXJA 3E3RA 1SY9A 4PHKA 4FQOA 2M29A 1EJ3A 2CCMA 1CM1A 2JXCA 2BL0B 3BYAA 3SG5A 2BCBA 1M46A 1JWDA 1CFCA 3A8RA 3DF0A 1KWOC 1YURA 1ZOTB 2M1UA 2M7LA 2BKIB 2P6BB 1RECA 3CZTX 4PE1A 5D69A 4PE0A 2OTGC 2LAPA 1SL7A 2DOQA 1TIZA 2LC5A 1ZMZA 1UHJA 1QV1A 3OX6A 1Y1XA 4MRXA 3BUMB 4M2QA 4UPGA 2CTNA 2KI6C 1IWQA 1CLLA 1BLQA 2JT3A 1WRZA 2NCOA 4M2OA 2KGRA 3LK1A 1N2DA 1H4BA 2SCPA 1B7TY 2Q91A 1BT6A 3BQ3A 3IF7A 2LLUA 3LLEA 1S6CA 1DJXA 4N5XA 3DVEA 2BE6A 3EK4A 1SRAA 1RTP1 1V1GA 1QV0A 2F33A 4GNKB 1KK8C 5I2LA 3SG7A 1EG4A 4F0ZB 2MBXA 1FF1A 1K2HA 1HT9A 4GUKA 1E8AA 3PFVA 1K9UA 1C7WA 2WCFA 3WHTB 1JFKA 1DJWA 2F2PA 3PALA 5JOLA 1YX7A 1A4PA 4NDDA 3TDUA 2R2IA 1CFDA 2OS8C 3PM8A 3TDZA 3BUXB 2Q4UA 1YTZC 1QVIZ 1NCXA 2ZNEA 2LVKA 1SCVA 3SG4A 1NIWA 3TUYB 5CSFA 3JTDB 1RJVA 4MEWA 1F8HA 5KU1A 1R6PA 5HLOA 1DJZA 2E30A 2L50A 3OB2B 1A75A 1DT7B 2LANA 2RGIA 4QJ4B 1PVBA 1XFVO 2K61A 3OX5A 1W7JB 1L7ZA 1QJTA 2LUCA 3EKHA 3VROA 1CDNA 2Y1MA 1PULA 3HCMA 2KFFA 1IQ3A 1B4CA 1NX1A 2F3ZA 2BBNA 2KGBC 3I5GC 4HRHA 1DJGA 5AFPA 2WORA 4CPVA 1S1EA 3EK8A 2JQ6A 5HLVA 1SR6B 4HRGA 1BOCA 3WHUB 2K2FA 1V1FA 5JJGA 1XA5A 1CM4A 1OOJA 4P5OE 4AQIA 2H2KA 2JTZA 1WY9A 1RWYA 1UWOA 2KI6D 3DF0B 2L4HA 3FIAA 2EHBA 4OCIA 2WOSA 3F45A 4C0KA 4MVFA 4YI9A 3GK1A 2LE9B 2L51A 1N0YA 1JF2A 2KFGA 4USLA 2JPTA 2MA2A 4DIRA 3O2PA 2JRFA 5KTYA 1PVAA 1S5GZ 2KBMA 1AUIB 1MR8A 1GJYA 2LHLA 2LNKA 3PSRA 2F8PA 4GAOA 2ZN9A 1N65A 4GFTA 3VRRA 1IG5A 4TNCA 5CPVA 1YVHA 1F70A 4PHMA 4PALA 3I5HB 4OKHA 1XFZO 1NYAA 3A4UB 2KI4C 4XJKA 1QIVA 5IBWA 1M45A 1J55A 2L0PA 1KK7Z 1CTRA 1KQVA 4DCKA 1BU3A 3TS5B 2F3YA 1SL9A 2KQ6A 2JOJA 1HQVA 4D1EA 4GGFC 1FW4A 1KSOA 4MZJA 3I5FC 3RLZA 5TNCA 5HYDA 1F55A 2JU0A 3KEVA 2LUXA 1CDPA 2M9GA 5FYXA 1DVIA 1JC2A 4M2PA 2WCBA 1UHNA 1BJFA 1XK4C 5AANA 3GK4X 3AAJA 4GPLB 2EC6C 2K7OA 2K8MB 1GGWA 1DTLA 1SNLA 4MZKA 1LXFC 4PCWA 4ZCUA 3VRQA 2M49B 3PN7B 1TNWA 5B8IB 4NDCA 2JULA 1NP8A 1QVIY 3JVTC 2K7DA 4DS7A 2NCPA 1BODA 3LK0A 1F4QA 2GGZA 1MWNA 4AQJA 2KAVA 3ZNIA 1UHIA 2ZKMX 3LCPC 4WRIA 3SG2A 1CFPA 1KFXS 1KFXL 4Q04A 3FS7A 1X02A 4PE4A 2VRGA 3I5IB 4IL1A 4OR9B 1ZFSA 1JBAA 1ODBA 4N1FA 3BUNB 1TN4A 1OQPA 1XFXO 1K95A 1Y6WA 1F4OA 2LLTA 3GOFA 2SASA 4ZCVA 4ICBA 1B8RA 1SK6D 3LL8B 3O4YA 1WRKA 1D1OA 1Y1AA 4GGNA 2MHHA 4NDBA 4YGDB 2MAZA 2FJUB 3SG3A 2GGMA 1AJ4A 2GV5A 4YBHB 1PSBA 1QX5B 2K2AA 2QPTA 2H61C 5CSIA 1EXRA 2KDHA 1AP4A 4OVNF 1H8BA 1YRTB 2K0JA 5AXIA 4XJKB 1A29A 1NCZA 2AAOA 1U5IA 3TZ1A 2KYCA 4PHNA 1QASA 4CFRA 5DKNA 2AMIA 2BCXA 3PATA 1IKUA 1DJHA 1QS7A 1R2UA 4HSZA 2V53A 5J3XA 1KQMB 1PALA 2G2BA 1WDCB 5I8NA 1OMVA 1NPQA 1B8CA 2BL0C 3ICBA 1LVCD 1KK7Y 1YVLA 1OMRA 4U8DA 1DMOA 2FCDA 1G33A 1ALVA 4I5LB 1CMGA 3DD4A 3CLNA 1L2OB 1JUOA 1AJ5A 2PALA 2A4JA 3BUWB 3K21A 3AKBA 1CDMA 2ZNDA 1IH0A 4FTGA 3MSEB 1JFJA 2MLFC 3D0YA 4ETOA 1KFUS 1KFUL 2LHIA 1MUXA 2M0RA 1S26D 1Y0VH 1YUTA 1IGVA 4PDZA 5HKWA 2L5XB 1XYDA 1B9AA 2HPSA 1SCMB 1S36A 1CMFA 1FI5A 2BKHB 4OV2A 4PHJA 4C0JA 3KPXA 3VRNA 1NWDA 3EVRA 3CR4X 1YUSA 1MHOA 3AKAA 4CFQA 2WC8A 1PK0D 3EKJA 3FWBA 2LVIA 2BCAA 1G4YR 1K8UA 1CKKA 5BPJA 1DJIA 2LMVA 2ZN8A 1B47A 2ISDA 1MF8B 3JVTB 5HKZA 1J7QA 3NSOA 1NX0A 1KWOB 3O78A 4NQGA 3TUYC 1K9PA 3JTDC 1UURA 2LP3A 2OTGB 3CTNA 2LMUA 2LV7A 2WCEA 1DF0A 4BY5A 1U5IB 3BXKA 1SBJA 3NSLA 1ALWA 1XFUO 3DVJA 3HX4A 5ER5A 3SJSA 2KOTA 2MRDA 3WXAA 4P2YB 2LLSA 1C7VA 2BECA 3AAKA 4JPZB 1SW8A 2L98A 2ZFDA 1SR6C 1WLZA 4AOMA 1KCYA 2KYFA 2KAYA 1K90D 3IQOA 2BE4A 4XYNA 1KK8B 4GBAA 1TRFA 1BF5A 2TN4A 4CIDA 1A2XA 4YGEB 1W7IB 3QRXA 2L4IA 1AK8A 4MLWA 3O6BA 4MSPA 1BR4B 2OS8B 1OMDA 1NX3A 1J7PA 1TOPA 1XO5A 1KSMA 2D8NA 4QJ5B 4A4CA 2IS9A 2HF5A 2PMYA 3EVUA 1XK4A 1UHHA 3FWCA 3OB1B 2G9BA 3D0YB 1PSRA 4YGBB 1NUBA 2I2RE 3CR2A 1QXPA 1CLMA 1SKTA 1TNQA 2O5GA 3I5HC 3TDIA 1TCOB 2ZRSA 3ZWHA 4ORAB 4A4BA 1CB1A 1S6JA 1J7OA 2JZIA 5CSNA 5GQQC 3NXAA 4BY4A 2LVVA 4YRUA 2JC2A 2COLB 5G08A 3BOWA 5PALA 3I5GB 3SIAA 1DGVA 3TS5C 4JWQA 1K96A 1B1GA 2QACA 1Y1UA 1DJYA 1RROA 1WRLA 2L2EA 2WNDA 4L9MA 1UUSA 3OP0A 4I5NB 1S6IA 1XFWO 2EGDA 2M97A 4WQ2A 2I94A 1VRKA 1K9KA 4MN0A 5DKQA 4I5JA 4ORCB 5KSZA 1FI6A 4JQ0D 4PE7A 1IJ5A 2F2OA 3BUOB 1A03A 1QX7A 1QLSA 2LM5A 1OE9B 1AHRA 1JF0A 1S5GY 2FOTA 2K7CA 1SPYA 4MRYA 2B1UA 1DF0B 2M3WA 1CFFA 1SMGA 2NZ0A 1FPWA 2NLNA 5DKRA 3PN7C 2M8UA 1IJ6A 2AUCA 2M7NA 2H61A 1EG3A 1CNPA 4ORBB 3KF9A 1IRJA 4QJ3B 2KI4B 1NX2A 1YX8A 2Y4QA 2Y1NA 1PRWA 2NXQA 1TNXA 1NCYA 1TNPA 1LA3A 1F54A 4YI8A 1QX2A 4WQ3A 1QIWA 3IQQA 3I5IC 1YUUA 2HETA 1FBVA 1MXLC 2JNFA 5K89A 3C1VA 3CWGA 3I5FB 1K94A 2JTTA 1LKJA 5CSJA 1B8LA 1SL8A 2LVJA 2JNXA 3CGAA 1ZACA 1XVJA 4MBEA 2FCEA
chains in the Genus database with same CATH superfamily
3DVKA 2MLEC 1BMOA 2ZRTA 1EL4A 1IQ5A 3NSIA 2LP2A 3KHEA 2EC6B 3NSKA 1J1DA 1AVSA 3H4SE 1QWVA 3SIBA 3WNXB 1EH2A 3M0WA 2WCHA 1M63B 1LINA 4CLNA 1B7TZ 2O60A 4I5KA 3BFBA 1WLMA 1UHKA 3CR5X 1G8IA 2LCPA 1J7RA 1OOHA 1S3PA 2PASA 2PYQA 5ER4X 3D10A 2HQ8A 3CABA 2JT0A 3UO9A 2M1KB 1NSHA 3BOWB 1OZSA 1YR5A 4R1EA 4INXA 4YGCB 2HQWA 3PJIA 4MZLA 1QLKA 4DUQA 1C07A 1MXEA 3DVMA 3RM1A 2KQYA 1CLBA 1KQMC 4YGAA 1SYMA 1TTXA 3OHMB 5D7FA 1WDCC 1YRUB 2K7BA 1DGUA 5F6TA 3EVVA 2KNEA 2KSPA 1JSAA 1OSAA 2KBIA 1UP5A 2WCKA 3PLFB 1QTXA 3SG6A 1GGZA 1OZOA 1CDLA 3EK7A 2PVBA 4C0LA 1L2OC 1ZUZA 2CBLA 1Z2CB 5AERA 1ORGA 3GK2A 4JD9A 4N1GA 3VGOA 1BR1B 2KHNA 5I2OA 2LMTA 1TCFA 1RK9A 3R1VA 1GM0A 5I2QA 2CT9A 1M39A 2JXLA 4GGFA 1Q80A 2OPOA 4DRWA 1J1EA 2PSRA 2KFHA 2JT8A 1GQMA 2I18A 4E68A 3R1PA 4HREE 1OOGA 2BBMA 2I7AA 2PRUA 1SCMC 2CNPA 1RFJA 1QATA 3QMEA 1M31A 1LA0A 2E6WA 2KAXA 1K93D 2PQLA 2Y5IA 3VRPA 5HKYA 2MJWB 2JWWA 1XFYO 3CS1A 3KO0A 1A75B 1F71A 5AEQA 1BG1A 1MQ1A 2CXJA 3E3RA 1SY9A 3R1OA 4PHKA 4FQOA 2M29A 1EJ3A 2CCMA 1CM1A 2JXCA 2BL0B 3BYAA 3SG5A 2BCBA 3NHTA 1M46A 1JWDA 2P70A 1CFCA 3A8RA 3DF0A 1KWOC 1YURA 4PT1A 1ZOTB 2M1UA 2M7LA 2BKIB 2P6BB 1RECA 3CYZA 3CZTX 4PE1A 5D69A 4PE0A 2OTGC 2LAPA 1SL7A 2DOQA 3D74A 1TIZA 2LC5A 1ZMZA 1UHJA 1QV1A 3OX6A 1Y1XA 4MRXA 3BUMB 4M2QA 4UPGA 2CTNA 2KI6C 1IWQA 1CLLA 1BLQA 2JT3A 3B87A 1WRZA 2NCOA 4M2OA 2KGRA 3LK1A 1N2DA 1H4BA 2SCPA 1B7TY 2Q91A 1BT6A 2QDIA 3BQ3A 3IF7A 2LLUA 3LLEA 1S6CA 1DJXA 4N5XA 3DVEA 2BE6A 3EK4A 1SRAA 1RTP1 1V1GA 1QV0A 2F33A 4GNKB 1KK8C 5I2LA 3SG7A 1EG4A 4F0ZB 2MBXA 1FF1A 1K2HA 1HT9A 4GUKA 1E8AA 3PFVA 1K9UA 1C7WA 2WCFA 3WHTB 1JFKA 1DJWA 2F2PA 3PALA 5JOLA 1YX7A 1A4PA 4NDDA 3BJHA 2R2IA 1CFDA 2KLEA 2K60A 2OS8C 3D77A 3BUXB 2Q4UA 1YTZC 3D73A 1DELA 3TDZA 1QVIZ 1NCXA 1Z4HA 2ZNEA 2LVKA 1SCVA 3SG4A 1NIWA 3TUYB 3FE8A 5CSFA 4F7FA 3JTDB 1RJVA 4MEWA 1F8HA 5KU1A 1R6PA 5HLOA 1DJZA 2E30A 2L50A 3OB2B 3S0DA 2L2CA 1A75A 1DT7B 2LANA 2RGIA 4QJ4B 1PVBA 1XFVO 3NHIA 2K61A 3OX5A 1W7JB 1L7ZA 1QJTA 2LUCA 3EKHA 3VROA 1CDNA 2Y1MA 1PULA 3HCMA 2KFFA 3DZTA 1IQ3A 1B4CA 1NX1A 2H8VA 3PM8A 2F3ZA 2BBNA 2KGBC 3I5GC 3OGNA 4HRHA 1DJGA 5AFPA 1OOIX 2WORA 4CPVA 1S1EA 3BFAA 3O4XA 3EK8A 2JQ6A 5HLVA 1SR6B 4HRGA 1BOCA 3WHUB 2K2FA 1V1FA 5JJGA 1XA5A 2WCLA 1CM4A 1OOJA 4P5OE 4AQIA 2H2KA 2JTZA 3D75A 5EL2A 1WY9A 1DEKA 1RWYA 1UWOA 2KI6D 3DF0B 2L4HA 2ERBA 3FIAA 2EHBA 1P28A 4OCIA 2WOSA 4OZDA 3CZ2A 5DICA 3F45A 4C0KA 4MVFA 4YI9A 3GK1A 2LE9B 2QEOA 2L51A 1N0YA 1JF2A 2KFGA 4USLA 2JPTA 2MA2A 4DIRA 3O2PA 2JRFA 5KTYA 1PVAA 1S5GZ 2KBMA 2KPHA 1AUIB 1MR8A 1GJYA 2LHLA 2LNKA 3PSRA 2F8PA 4GAOA 2ZN9A 1N65A 4GFTA 3DYEA 1IG5A 4TNCA 5CPVA 3VRRA 1YVHA 1F70A 4PHMA 4PALA 3I5HB 4OKHA 1XFZO 1NYAA 3A4UB 2KI4C 4XJKA 1TUZA 1DQEA 1QIVA 5FI6A 1M45A 5IBWA 1J55A 2L0PA 1KK7Z 2WC6A 1CTRA 1KQVA 4DCKA 3Q8IA 1BU3A 3TS5B 2F3YA 1SL9A 2KQ6A 5HL1A 2JOJA 1HQVA 4D1EA 4GGFC 1FW4A 1KSOA 4MZJA 3I5FC 3RLZA 5TNCA 5HYDA 1F55A 2JU0A 3SS4A 3D78A 3KEVA 2LUXA 1CDPA 2M9GA 5FYXA 1DVIA 5I94A 1JC2A 4M2PA 2WCBA 1UHNA 1BJFA 1XK4C 5AANA 3GK4X 4KYNA 3AAJA 3L4LA 4GPLB 2EC6C 1TUJA 2K7OA 2K8MB 1GGWA 1DTLA 1SNLA 4MZKA 1LXFC 4PCWA 4ZCUA 3VRQA 2M49B 3PN7B 1TNWA 3D76A 5B8IB 4NDCA 2JULA 4FQTA 1NP8A 1QVIY 3JVTC 2K7DA 3SS3A 4DS7A 2NCPA 1BODA 3LK0A 1F4QA 2GGZA 1MWNA 4AQJA 2KAVA 3ZNIA 3TDUA 1UHIA 2ZKMX 3LCPC 4WRIA 3SG2A 1CFPA 1TWOA 1KFXS 1KFXL 4Q04A 3FS7A 1X02A 4PE4A 2VRGA 3I5IB 4IL1A 4OR9B 1ZFSA 1JBAA 1ODBA 4N1FA 3BUNB 1TN4A 1OQPA 1XFXO 1K95A 1Y6WA 1F4OA 2LLTA 3GOFA 3DXLA 2SASA 4ZCVA 4ICBA 1B8RA 1SK6D 3LL8B 3O4YA 1WRKA 1D1OA 1Y1AA 4GGNA 2MHHA 4NDBA 3K1EA 4YGDB 2MAZA 2FJUB 3SG3A 2GGMA 1AJ4A 2GV5A 1LS8A 4YBHB 1PSBA 2FJYA 2KLDA 1QX5B 2K2AA 2QPTA 2H61C 3PM2A 5CSIA 1EXRA 3S0GA 2KDHA 1AP4A 4OVNF 1H8BA 1YRTB 2K0JA 5AXIA 4XJKB 1A29A 2QEBA 1NCZA 2AAOA 1U5IA 3TZ1A 2KYCA 4PHNA 1QASA 4CFRA 5DKNA 2AMIA 3SS5A 2BCXA 3PATA 1IKUA 1DJHA 1QS7A 1R2UA 4HSZA 2V53A 3B86A 5D3OA 5J3XA 1KQMB 1PALA 2G2BA 1WDCB 5I8NA 1OMVA 1NPQA 3V2LA 1B8CA 1C3ZA 2BL0C 3ICBA 1LVCD 1KK7Y 1YVLA 1OMRA 4U8DA 1DMOA 2FCDA 1G33A 1ALVA 4I5LB 1CMGA 3DD4A 3CLNA 1L2OB 2WCMA 3CDNA 3VB1A 1JUOA 1AJ5A 3S0AA 2PALA 2A4JA 3BUWB 3K21A 3AKBA 1CDMA 3L4AA 2ZNDA 1IH0A 4FTGA 3MSEB 1JFJA 2MLFC 3D0YA 4ETOA 1KFUS 1KFUL 2JPOA 2LHIA 1MUXA 2M0RA 1S26D 1Y0VH 1YUTA 1IGVA 1T14A 4PDZA 2L5XB 5HKWA 1XYDA 1B9AA 2HPSA 1SCMB 1S36A 1CMFA 1FI5A 2BKHB 4OV2A 4PHJA 4C0JA 3KPXA 4JKTA 3VRNA 1NWDA 3EVRA 3CR4X 1YUSA 1W9ZA 1MHOA 1OW4A 3AKAA 3EG5B 4CFQA 2WC8A 1PK0D 3EKJA 3FWBA 2LVIA 2BCAA 1G4YR 2WC5A 1K8UA 1CKKA 5BPJA 1DJIA 2LMVA 3B7AA 2ZN8A 2P71A 1B47A 2ISDA 1MF8B 3JVTB 5HKZA 1J7QA 3NSOA 3L47A 1NX0A 1KWOB 3O78A 1IIOA 1OOFA 4NQGA 3TUYC 2L5YA 1K9PA 3JTDC 1UURA 2LP3A 2OTGB 3CTNA 2LMUA 2LV7A 2WCEA 1DF0A 4BY5A 1U5IB 3BXKA 1SBJA 3CZ1A 3NSLA 1ALWA 1XFUO 3DVJA 3HX4A 5ER5A 3SJSA 2KOTA 2MRDA 3WXAA 4P2YB 2LLSA 3B88A 1C7VA 2BECA 3AAKA 3IVTA 4JPZB 1XFRA 3BFHA 1SW8A 2L98A 2ZFDA 1SR6C 1WLZA 4AOMA 1KCYA 2KYFA 2KAYA 3RZSA 1K90D 3IQOA 2BE4A 2QEVA 4XYNA 1KK8B 4GBAA 1TRFA 1BF5A 2TN4A 4CIDA 1A2XA 3N7HA 4YGEB 1W7IB 3QRXA 2L4IA 1AK8A 4MLWA 3O6BA 4MSPA 1BR4B 2OS8B 3S0FA 1OMDA 1NX3A 4INWA 1TOPA 1XO5A 1J7PA 1KSMA 2D8NA 4QJ5B 4A4CA 2IS9A 2HF5A 2PMYA 3EVUA 1XK4A 1UHHA 3FWCA 5FI7A 3OB1B 3CZ0A 2G9BA 3D0YB 1PSRA 4YGBB 2GTEA 1NUBA 2I2RE 3CR2A 1QXPA 1CLMA 1SKTA 1TNQA 2O5GA 3I5HC 3B6XA 3TDIA 1TCOB 2ZRSA 3ZWHA 4ORAB 4A4BA 1CB1A 1S6JA 1J7OA 2JZIA 5CSNA 5GQQC 3NXAA 4BY4A 2LVVA 4YRUA 1C3YA 2JC2A 2COLB 5G08A 3BOWA 5PALA 3S0EA 3I5GB 3S0BA 3SIAA 2BNXA 1DGVA 3TS5C 4JWQA 1K96A 1B1GA 2QACA 1Y1UA 1DJYA 1RROA 1WRLA 2L2EA 2WNDA 3FE6A 4L9MA 1UUSA 3OBVA 3OP0A 4I5NB 1S6IA 1SSEB 1XFWO 2EGDA 2M97A 4WQ2A 2I94A 1VRKA 1K9KA 4MN0A 5DKQA 4I5JA 2YGUA 4ORCB 5KSZA 1FI6A 4JQ0D 2WCJA 4PE7A 1IJ5A 2F2OA 3BUOB 1A03A 1QX7A 1QLSA 2LM5A 1OE9B 1AHRA 1JF0A 1S5GY 2FOTA 2K7CA 1SPYA 4MRYA 2B1UA 1DF0B 2M3WA 1CFFA 3UNWA 1SMGA 2NZ0A 1FPWA 2NLNA 5DKRA 3PN7C 2M8UA 3R72A 1IJ6A 3FE9A 2AUCA 2QEHA 2M7NA 2H61A 1EG3A 1CNPA 4ORBB 3KF9A 1IRJA 4QJ3B 2KI4B 1NX2A 1YX8A 2Y4QA 2Y1NA 1PRWA 3DY9A 2NXQA 1TNXA 1NCYA 1TNPA 1LA3A 1F54A 4YI8A 1QX2A 4WQ3A 1QIWA 3NGVA 3IQQA 3I5IC 1YUUA 2HETA 1FBVA 1MXLC 2JNFA 5K89A 3C1VA 1DC1A 3CWGA 3I5FB 1K94A 4IJ7A 2JTTA 2BAPA 1LKJA 5CSJA 5FI2A 1B8LA 1SL8A 2LVJA 2JNXA 3CGAA 1ZACA 1XVJA 4MBEA 2FCEA
chains in the Genus database with same CATH topology
3DVKA 2MLEC 1BMOA 2ZRTA 1EL4A 1IQ5A 3NSIA 2LP2A 3KHEA 2EC6B 3NSKA 1J1DA 1AVSA 3H4SE 3WNXB 3SIBA 1EH2A 3M0WA 1M63B 1LINA 4CLNA 1B7TZ 2O60A 4I5KA 1WLMA 1UHKA 3CR5X 1G8IA 2LCPA 1J7RA 1S3PA 2PASA 5ER4X 3D10A 2HQ8A 2JT0A 2M1KB 1NSHA 3BOWB 1OZSA 1YR5A 4R1EA 4YGCB 2HQWA 4MZLA 1QLKA 4DUQA 1C07A 1MXEA 3DVMA 3RM1A 2KQYA 1CLBA 1KQMC 4YGAA 1SYMA 1TTXA 3OHMB 5D7FA 1WDCC 1YRUB 2K7BA 1DGUA 5F6TA 3EVVA 2KNEA 2KSPA 1JSAA 1OSAA 2KBIA 1UP5A 3PLFB 1QTXA 3SG6A 1GGZA 1OZOA 1CDLA 3EK7A 2PVBA 4C0LA 1L2OC 1ZUZA 2CBLA 5AERA 3GK2A 4N1GA 3VGOA 1BR1B 2KHNA 5I2OA 2LMTA 1TCFA 1RK9A 5I2QA 2CT9A 1M39A 2JXLA 4GGFA 1Q80A 2OPOA 4DRWA 1J1EA 2PSRA 2KFHA 2JT8A 1GQMA 2I18A 4E68A 4HREE 2BBMA 2I7AA 2PRUA 1SCMC 2CNPA 1RFJA 1QATA 1M31A 1LA0A 2E6WA 2KAXA 1K93D 2Y5IA 3VRPA 5HKYA 2MJWB 2JWWA 1XFYO 3CS1A 3KO0A 1A75B 1F71A 5AEQA 1BG1A 1MQ1A 2CXJA 3E3RA 1SY9A 4PHKA 4FQOA 2M29A 1EJ3A 2CCMA 1CM1A 2JXCA 2BL0B 3BYAA 3SG5A 2BCBA 1M46A 1JWDA 1CFCA 3A8RA 3DF0A 1KWOC 1YURA 1ZOTB 2M1UA 2M7LA 2BKIB 2P6BB 1RECA 3CZTX 4PE1A 5D69A 4PE0A 2OTGC 2LAPA 1SL7A 2DOQA 1TIZA 2LC5A 1ZMZA 1UHJA 1QV1A 3OX6A 1Y1XA 4MRXA 3BUMB 4M2QA 4UPGA 2CTNA 2KI6C 1IWQA 1CLLA 1BLQA 2JT3A 1WRZA 2NCOA 4M2OA 2KGRA 3LK1A 1N2DA 1H4BA 2SCPA 1B7TY 2Q91A 1BT6A 3BQ3A 3IF7A 2LLUA 3LLEA 1S6CA 1DJXA 4N5XA 3DVEA 2BE6A 3EK4A 1SRAA 1RTP1 1V1GA 1QV0A 2F33A 4GNKB 1KK8C 5I2LA 3SG7A 1EG4A 4F0ZB 2MBXA 1FF1A 1K2HA 1HT9A 4GUKA 1E8AA 3PFVA 1K9UA 1C7WA 2WCFA 3WHTB 1JFKA 1DJWA 2F2PA 3PALA 5JOLA 1YX7A 1A4PA 4NDDA 3TDUA 2R2IA 1CFDA 2OS8C 3PM8A 3TDZA 3BUXB 2Q4UA 1YTZC 1QVIZ 1NCXA 2ZNEA 2LVKA 1SCVA 3SG4A 1NIWA 3TUYB 5CSFA 3JTDB 1RJVA 4MEWA 1F8HA 5KU1A 1R6PA 5HLOA 1DJZA 2E30A 2L50A 3OB2B 1A75A 1DT7B 2LANA 2RGIA 4QJ4B 1PVBA 1XFVO 2K61A 3OX5A 1W7JB 1L7ZA 1QJTA 2LUCA 3EKHA 3VROA 1CDNA 2Y1MA 1PULA 3HCMA 2KFFA 1IQ3A 1B4CA 1NX1A 2F3ZA 2BBNA 2KGBC 3I5GC 4HRHA 1DJGA 5AFPA 2WORA 4CPVA 1S1EA 3EK8A 2JQ6A 5HLVA 1SR6B 4HRGA 1BOCA 3WHUB 2K2FA 1V1FA 5JJGA 1XA5A 1CM4A 1OOJA 4P5OE 4AQIA 2H2KA 2JTZA 1WY9A 1RWYA 1UWOA 2KI6D 3DF0B 2L4HA 3FIAA 2EHBA 4OCIA 2WOSA 3F45A 4C0KA 4MVFA 4YI9A 3GK1A 2LE9B 2L51A 1N0YA 1JF2A 2KFGA 4USLA 2JPTA 2MA2A 4DIRA 3O2PA 2JRFA 5KTYA 1PVAA 1S5GZ 2KBMA 1AUIB 1MR8A 1GJYA 2LHLA 2LNKA 3PSRA 2F8PA 4GAOA 2ZN9A 1N65A 4GFTA 3VRRA 1IG5A 4TNCA 5CPVA 1YVHA 1F70A 4PHMA 4PALA 3I5HB 4OKHA 1XFZO 1NYAA 3A4UB 2KI4C 4XJKA 1QIVA 5IBWA 1M45A 1J55A 2L0PA 1KK7Z 1CTRA 1KQVA 4DCKA 1BU3A 3TS5B 2F3YA 1SL9A 2KQ6A 2JOJA 1HQVA 4D1EA 4GGFC 1FW4A 1KSOA 4MZJA 3I5FC 3RLZA 5TNCA 5HYDA 1F55A 2JU0A 3KEVA 2LUXA 1CDPA 2M9GA 5FYXA 1DVIA 1JC2A 4M2PA 2WCBA 1UHNA 1BJFA 1XK4C 5AANA 3GK4X 3AAJA 4GPLB 2EC6C 2K7OA 2K8MB 1GGWA 1DTLA 1SNLA 4MZKA 1LXFC 4PCWA 4ZCUA 3VRQA 2M49B 3PN7B 1TNWA 5B8IB 4NDCA 2JULA 1NP8A 1QVIY 3JVTC 2K7DA 4DS7A 2NCPA 1BODA 3LK0A 1F4QA 2GGZA 1MWNA 4AQJA 2KAVA 3ZNIA 1UHIA 2ZKMX 3LCPC 4WRIA 3SG2A 1CFPA 1KFXS 1KFXL 4Q04A 3FS7A 1X02A 4PE4A 2VRGA 3I5IB 4IL1A 4OR9B 1ZFSA 1JBAA 1ODBA 4N1FA 3BUNB 1TN4A 1OQPA 1XFXO 1K95A 1Y6WA 1F4OA 2LLTA 3GOFA 2SASA 4ZCVA 4ICBA 1B8RA 1SK6D 3LL8B 3O4YA 1WRKA 1D1OA 1Y1AA 4GGNA 2MHHA 4NDBA 4YGDB 2MAZA 2FJUB 3SG3A 2GGMA 1AJ4A 2GV5A 4YBHB 1PSBA 1QX5B 2K2AA 2QPTA 2H61C 5CSIA 1EXRA 2KDHA 1AP4A 4OVNF 1H8BA 1YRTB 2K0JA 5AXIA 4XJKB 1A29A 1NCZA 2AAOA 1U5IA 3TZ1A 2KYCA 4PHNA 1QASA 4CFRA 5DKNA 2AMIA 2BCXA 3PATA 1IKUA 1DJHA 1QS7A 1R2UA 4HSZA 2V53A 5J3XA 1KQMB 1PALA 2G2BA 1WDCB 5I8NA 1OMVA 1NPQA 1B8CA 2BL0C 3ICBA 1LVCD 1KK7Y 1YVLA 1OMRA 4U8DA 1DMOA 2FCDA 1G33A 1ALVA 4I5LB 1CMGA 3DD4A 3CLNA 1L2OB 1JUOA 1AJ5A 2PALA 2A4JA 3BUWB 3K21A 3AKBA 1CDMA 2ZNDA 1IH0A 4FTGA 3MSEB 1JFJA 2MLFC 3D0YA 4ETOA 1KFUS 1KFUL 2LHIA 1MUXA 2M0RA 1S26D 1Y0VH 1YUTA 1IGVA 4PDZA 5HKWA 2L5XB 1XYDA 1B9AA 2HPSA 1SCMB 1S36A 1CMFA 1FI5A 2BKHB 4OV2A 4PHJA 4C0JA 3KPXA 3VRNA 1NWDA 3EVRA 3CR4X 1YUSA 1MHOA 3AKAA 4CFQA 2WC8A 1PK0D 3EKJA 3FWBA 2LVIA 2BCAA 1G4YR 1K8UA 1CKKA 5BPJA 1DJIA 2LMVA 2ZN8A 1B47A 2ISDA 1MF8B 3JVTB 5HKZA 1J7QA 3NSOA 1NX0A 1KWOB 3O78A 4NQGA 3TUYC 1K9PA 3JTDC 1UURA 2LP3A 2OTGB 3CTNA 2LMUA 2LV7A 2WCEA 1DF0A 4BY5A 1U5IB 3BXKA 1SBJA 3NSLA 1ALWA 1XFUO 3DVJA 3HX4A 5ER5A 3SJSA 2KOTA 2MRDA 3WXAA 4P2YB 2LLSA 1C7VA 2BECA 3AAKA 4JPZB 1SW8A 2L98A 2ZFDA 1SR6C 1WLZA 4AOMA 1KCYA 2KYFA 2KAYA 1K90D 3IQOA 2BE4A 4XYNA 1KK8B 4GBAA 1TRFA 1BF5A 2TN4A 4CIDA 1A2XA 4YGEB 1W7IB 3QRXA 2L4IA 1AK8A 4MLWA 3O6BA 4MSPA 1BR4B 2OS8B 1OMDA 1NX3A 1J7PA 1TOPA 1XO5A 1KSMA 2D8NA 4QJ5B 4A4CA 2IS9A 2HF5A 2PMYA 3EVUA 1XK4A 1UHHA 3FWCA 3OB1B 2G9BA 3D0YB 1PSRA 4YGBB 1NUBA 2I2RE 3CR2A 1QXPA 1CLMA 1SKTA 1TNQA 2O5GA 3I5HC 3TDIA 1TCOB 2ZRSA 3ZWHA 4ORAB 4A4BA 1CB1A 1S6JA 1J7OA 2JZIA 5CSNA 5GQQC 3NXAA 4BY4A 2LVVA 4YRUA 2JC2A 2COLB 5G08A 3BOWA 5PALA 3I5GB 3SIAA 1DGVA 3TS5C 4JWQA 1K96A 1B1GA 2QACA 1Y1UA 1DJYA 1RROA 1WRLA 2L2EA 2WNDA 4L9MA 1UUSA 3OP0A 4I5NB 1S6IA 1XFWO 2EGDA 2M97A 4WQ2A 2I94A 1VRKA 1K9KA 4MN0A 5DKQA 4I5JA 4ORCB 5KSZA 1FI6A 4JQ0D 4PE7A 1IJ5A 2F2OA 3BUOB 1A03A 1QX7A 1QLSA 2LM5A 1OE9B 1AHRA 1JF0A 1S5GY 2FOTA 2K7CA 1SPYA 4MRYA 2B1UA 1DF0B 2M3WA 1CFFA 1SMGA 2NZ0A 1FPWA 2NLNA 5DKRA 3PN7C 2M8UA 1IJ6A 2AUCA 2M7NA 2H61A 1EG3A 1CNPA 4ORBB 3KF9A 1IRJA 4QJ3B 2KI4B 1NX2A 1YX8A 2Y4QA 2Y1NA 1PRWA 2NXQA 1TNXA 1NCYA 1TNPA 1LA3A 1F54A 4YI8A 1QX2A 4WQ3A 1QIWA 3IQQA 3I5IC 1YUUA 2HETA 1FBVA 1MXLC 2JNFA 5K89A 3C1VA 3CWGA 3I5FB 1K94A 2JTTA 1LKJA 5CSJA 1B8LA 1SL8A 2LVJA 2JNXA 3CGAA 1ZACA 1XVJA 4MBEA 2FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVK A;  2MLE C;  1BMO A;  2ZRT A;  1EL4 A;  1IQ5 A;  3NSI A;  2LP2 A;  3KHE A;  2EC6 B;  3NSK A;  1J1D A;  1AVS A;  3H4S E;  3WNX B;  3SIB A;  1EH2 A;  3M0W A;  1M63 B;  1LIN A;  4CLN A;  1B7T Z;  2O60 A;  4I5K A;  1WLM A;  1UHK A;  3CR5 X;  1G8I A;  2LCP A;  1J7R A;  1S3P A;  2PAS A;  5ER4 X;  3D10 A;  2HQ8 A;  2JT0 A;  2M1K B;  1NSH A;  3BOW B;  1OZS A;  1YR5 A;  4R1E A;  4YGC B;  2HQW A;  4MZL A;  1QLK A;  4DUQ A;  1C07 A;  1MXE A;  3DVM A;  3RM1 A;  2KQY A;  1CLB A;  1KQM C;  4YGA A;  1SYM A;  1TTX A;  3OHM B;  5D7F A;  1WDC C;  1YRU B;  2K7B A;  1DGU A;  5F6T A;  3EVV A;  2KNE A;  2KSP A;  1JSA A;  1OSA A;  2KBI A;  1UP5 A;  3PLF B;  1QTX A;  3SG6 A;  1GGZ A;  1OZO A;  1CDL A;  3EK7 A;  2PVB A;  4C0L A;  1L2O C;  1ZUZ A;  2CBL A;  5AER A;  3GK2 A;  4N1G A;  3VGO A;  1BR1 B;  2KHN A;  5I2O A;  2LMT A;  1TCF A;  1RK9 A;  5I2Q A;  2CT9 A;  1M39 A;  2JXL A;  4GGF A;  1Q80 A;  2OPO A;  4DRW A;  1J1E A;  2PSR A;  2KFH A;  2JT8 A;  1GQM A;  2I18 A;  4E68 A;  4HRE E;  2BBM A;  2I7A A;  2PRU A;  1SCM C;  2CNP A;  1RFJ A;  1QAT A;  1M31 A;  1LA0 A;  2E6W A;  2KAX A;  1K93 D;  2Y5I A;  3VRP A;  5HKY A;  2MJW B;  2JWW A;  1XFY O;  3CS1 A;  3KO0 A;  1A75 B;  1F71 A;  5AEQ A;  1BG1 A;  1MQ1 A;  2CXJ A;  3E3R A;  1SY9 A;  4PHK A;  4FQO A;  2M29 A;  1EJ3 A;  2CCM A;  1CM1 A;  2JXC A;  2BL0 B;  3BYA A;  3SG5 A;  2BCB A;  1M46 A;  1JWD A;  1CFC A;  3A8R A;  3DF0 A;  1KWO C;  1YUR A;  1ZOT B;  2M1U A;  2M7L A;  2BKI B;  2P6B B;  1REC A;  3CZT X;  4PE1 A;  5D69 A;  4PE0 A;  2OTG C;  2LAP A;  1SL7 A;  2DOQ A;  1TIZ A;  2LC5 A;  1ZMZ A;  1UHJ A;  1QV1 A;  3OX6 A;  1Y1X A;  4MRX A;  3BUM B;  4M2Q A;  4UPG A;  2CTN A;  2KI6 C;  1IWQ A;  1CLL A;  1BLQ A;  2JT3 A;  1WRZ A;  2NCO A;  4M2O A;  2KGR A;  3LK1 A;  1N2D A;  1H4B A;  2SCP A;  1B7T Y;  2Q91 A;  1BT6 A;  3BQ3 A;  3IF7 A;  2LLU A;  3LLE A;  1S6C A;  1DJX A;  4N5X A;  3DVE A;  2BE6 A;  3EK4 A;  1SRA A;  1RTP 1;  1V1G A;  1QV0 A;  2F33 A;  4GNK B;  1KK8 C;  5I2L A;  3SG7 A;  1EG4 A;  4F0Z B;  2MBX A;  1FF1 A;  1K2H A;  1HT9 A;  4GUK A;  1E8A A;  3PFV A;  1K9U A;  1C7W A;  2WCF A;  3WHT B;  1JFK A;  1DJW A;  2F2P A;  3PAL A;  5JOL A;  1YX7 A;  1A4P A;  4NDD A;  3TDU A;  2R2I A;  1CFD A;  2OS8 C;  3PM8 A;  3TDZ A;  3BUX B;  2Q4U A;  1YTZ C;  1QVI Z;  1NCX A;  2ZNE A;  2LVK A;  1SCV A;  3SG4 A;  1NIW A;  3TUY B;  5CSF A;  3JTD B;  1RJV A;  4MEW A;  1F8H A;  5KU1 A;  1R6P A;  5HLO A;  1DJZ A;  2E30 A;  2L50 A;  3OB2 B;  1A75 A;  1DT7 B;  2LAN A;  2RGI A;  4QJ4 B;  1PVB A;  1XFV O;  2K61 A;  3OX5 A;  1W7J B;  1L7Z A;  1QJT A;  2LUC A;  3EKH A;  3VRO A;  1CDN A;  2Y1M A;  1PUL A;  3HCM A;  2KFF A;  1IQ3 A;  1B4C A;  1NX1 A;  2F3Z A;  2BBN A;  2KGB C;  3I5G C;  4HRH A;  1DJG A;  5AFP A;  2WOR A;  4CPV A;  1S1E A;  3EK8 A;  2JQ6 A;  5HLV A;  1SR6 B;  4HRG A;  1BOC A;  3WHU B;  2K2F A;  1V1F A;  5JJG A;  1XA5 A;  1CM4 A;  1OOJ A;  4P5O E;  4AQI A;  2H2K A;  2JTZ A;  1WY9 A;  1RWY A;  1UWO A;  2KI6 D;  3DF0 B;  2L4H A;  3FIA A;  2EHB A;  4OCI A;  2WOS A;  3F45 A;  4C0K A;  4MVF A;  4YI9 A;  3GK1 A;  2LE9 B;  2L51 A;  1N0Y A;  1JF2 A;  2KFG A;  4USL A;  2JPT A;  2MA2 A;  4DIR A;  3O2P A;  2JRF A;  5KTY A;  1PVA A;  1S5G Z;  2KBM A;  1AUI B;  1MR8 A;  1GJY A;  2LHL A;  2LNK A;  3PSR A;  2F8P A;  4GAO A;  2ZN9 A;  1N65 A;  4GFT A;  3VRR A;  1IG5 A;  4TNC A;  5CPV A;  1YVH A;  1F70 A;  4PHM A;  4PAL A;  3I5H B;  4OKH A;  1XFZ O;  1NYA A;  3A4U B;  2KI4 C;  4XJK A;  1QIV A;  5IBW A;  1M45 A;  1J55 A;  2L0P A;  1KK7 Z;  1CTR A;  1KQV A;  4DCK A;  1BU3 A;  3TS5 B;  2F3Y A;  1SL9 A;  2KQ6 A;  2JOJ A;  1HQV A;  4D1E A;  4GGF C;  1FW4 A;  1KSO A;  4MZJ A;  3I5F C;  3RLZ A;  5TNC A;  5HYD A;  1F55 A;  2JU0 A;  3KEV A;  2LUX A;  1CDP A;  2M9G A;  5FYX A;  1DVI A;  1JC2 A;  4M2P A;  2WCB A;  1UHN A;  1BJF A;  1XK4 C;  5AAN A;  3GK4 X;  3AAJ A;  4GPL B;  2EC6 C;  2K7O A;  2K8M B;  1GGW A;  1DTL A;  1SNL A;  4MZK A;  1LXF C;  4PCW A;  4ZCU A;  3VRQ A;  2M49 B;  3PN7 B;  1TNW A;  5B8I B;  4NDC A;  2JUL A;  1NP8 A;  1QVI Y;  3JVT C;  2K7D A;  4DS7 A;  2NCP A;  1BOD A;  3LK0 A;  1F4Q A;  2GGZ A;  1MWN A;  4AQJ A;  2KAV A;  3ZNI A;  1UHI A;  2ZKM X;  3LCP C;  4WRI A;  3SG2 A;  1CFP A;  1KFX S;  1KFX L;  4Q04 A;  3FS7 A;  1X02 A;  4PE4 A;  2VRG A;  3I5I B;  4IL1 A;  4OR9 B;  1ZFS A;  1JBA A;  1ODB A;  4N1F A;  3BUN B;  1TN4 A;  1OQP A;  1XFX O;  1K95 A;  1Y6W A;  1F4O A;  2LLT A;  3GOF A;  2SAS A;  4ZCV A;  4ICB A;  1B8R A;  1SK6 D;  3LL8 B;  3O4Y A;  1WRK A;  1D1O A;  1Y1A A;  4GGN A;  2MHH A;  4NDB A;  4YGD B;  2MAZ A;  2FJU B;  3SG3 A;  2GGM A;  1AJ4 A;  2GV5 A;  4YBH B;  1PSB A;  1QX5 B;  2K2A A;  2QPT A;  2H61 C;  5CSI A;  1EXR A;  2KDH A;  1AP4 A;  4OVN F;  1H8B A;  1YRT B;  2K0J A;  5AXI A;  4XJK B;  1A29 A;  1NCZ A;  2AAO A;  1U5I A;  3TZ1 A;  2KYC A;  4PHN A;  1QAS A;  4CFR A;  5DKN A;  2AMI A;  2BCX A;  3PAT A;  1IKU A;  1DJH A;  1QS7 A;  1R2U A;  4HSZ A;  2V53 A;  5J3X A;  1KQM B;  1PAL A;  2G2B A;  1WDC B;  5I8N A;  1OMV A;  1NPQ A;  1B8C A;  2BL0 C;  3ICB A;  1LVC D;  1KK7 Y;  1YVL A;  1OMR A;  4U8D A;  1DMO A;  2FCD A;  1G33 A;  1ALV A;  4I5L B;  1CMG A;  3DD4 A;  3CLN A;  1L2O B;  1JUO A;  1AJ5 A;  2PAL A;  2A4J A;  3BUW B;  3K21 A;  3AKB A;  1CDM A;  2ZND A;  1IH0 A;  4FTG A;  3MSE B;  1JFJ A;  2MLF C;  3D0Y A;  4ETO A;  1KFU S;  1KFU L;  2LHI A;  1MUX A;  2M0R A;  1S26 D;  1Y0V H;  1YUT A;  1IGV A;  4PDZ A;  5HKW A;  2L5X B;  1XYD A;  1B9A A;  2HPS A;  1SCM B;  1S36 A;  1CMF A;  1FI5 A;  2BKH B;  4OV2 A;  4PHJ A;  4C0J A;  3KPX A;  3VRN A;  1NWD A;  3EVR A;  3CR4 X;  1YUS A;  1MHO A;  3AKA A;  4CFQ A;  2WC8 A;  1PK0 D;  3EKJ A;  3FWB A;  2LVI A;  2BCA A;  1G4Y R;  1K8U A;  1CKK A;  5BPJ A;  1DJI A;  2LMV A;  2ZN8 A;  1B47 A;  2ISD A;  1MF8 B;  3JVT B;  5HKZ A;  1J7Q A;  3NSO A;  1NX0 A;  1KWO B;  3O78 A;  4NQG A;  3TUY C;  1K9P A;  3JTD C;  1UUR A;  2LP3 A;  2OTG B;  3CTN A;  2LMU A;  2LV7 A;  2WCE A;  1DF0 A;  4BY5 A;  1U5I B;  3BXK A;  1SBJ A;  3NSL A;  1ALW A;  1XFU O;  3DVJ A;  3HX4 A;  5ER5 A;  3SJS A;  2KOT A;  2MRD A;  3WXA A;  4P2Y B;  2LLS A;  1C7V A;  2BEC A;  3AAK A;  4JPZ B;  1SW8 A;  2L98 A;  2ZFD A;  1SR6 C;  1WLZ A;  4AOM A;  1KCY A;  2KYF A;  2KAY A;  1K90 D;  3IQO A;  2BE4 A;  4XYN A;  1KK8 B;  4GBA A;  1TRF A;  1BF5 A;  2TN4 A;  4CID A;  1A2X A;  4YGE B;  1W7I B;  3QRX A;  2L4I A;  1AK8 A;  4MLW A;  3O6B A;  4MSP A;  1BR4 B;  2OS8 B;  1OMD A;  1NX3 A;  1J7P A;  1TOP A;  1XO5 A;  1KSM A;  2D8N A;  4QJ5 B;  4A4C A;  2IS9 A;  2HF5 A;  2PMY A;  3EVU A;  1XK4 A;  1UHH A;  3FWC A;  3OB1 B;  2G9B A;  3D0Y B;  1PSR A;  4YGB B;  1NUB A;  2I2R E;  3CR2 A;  1QXP A;  1CLM A;  1SKT A;  1TNQ A;  2O5G A;  3I5H C;  3TDI A;  1TCO B;  2ZRS A;  3ZWH A;  4ORA B;  4A4B A;  1CB1 A;  1S6J A;  1J7O A;  2JZI A;  5CSN A;  5GQQ C;  3NXA A;  4BY4 A;  2LVV A;  4YRU A;  2JC2 A;  2COL B;  5G08 A;  3BOW A;  5PAL A;  3I5G B;  3SIA A;  1DGV A;  3TS5 C;  4JWQ A;  1K96 A;  1B1G A;  2QAC A;  1Y1U A;  1DJY A;  1RRO A;  1WRL A;  2L2E A;  2WND A;  4L9M A;  1UUS A;  3OP0 A;  4I5N B;  1S6I A;  1XFW O;  2EGD A;  2M97 A;  4WQ2 A;  2I94 A;  1VRK A;  1K9K A;  4MN0 A;  5DKQ A;  4I5J A;  4ORC B;  5KSZ A;  1FI6 A;  4JQ0 D;  4PE7 A;  1IJ5 A;  2F2O A;  3BUO B;  1A03 A;  1QX7 A;  1QLS A;  2LM5 A;  1OE9 B;  1AHR A;  1JF0 A;  1S5G Y;  2FOT A;  2K7C A;  1SPY A;  4MRY A;  2B1U A;  1DF0 B;  2M3W A;  1CFF A;  1SMG A;  2NZ0 A;  1FPW A;  2NLN A;  5DKR A;  3PN7 C;  2M8U A;  1IJ6 A;  2AUC A;  2M7N A;  2H61 A;  1EG3 A;  1CNP A;  4ORB B;  3KF9 A;  1IRJ A;  4QJ3 B;  2KI4 B;  1NX2 A;  1YX8 A;  2Y4Q A;  2Y1N A;  1PRW A;  2NXQ A;  1TNX A;  1NCY A;  1TNP A;  1LA3 A;  1F54 A;  4YI8 A;  1QX2 A;  4WQ3 A;  1QIW A;  3IQQ A;  3I5I C;  1YUU A;  2HET A;  1FBV A;  1MXL C;  2JNF A;  5K89 A;  3C1V A;  3CWG A;  3I5F B;  1K94 A;  2JTT A;  1LKJ A;  5CSJ A;  1B8L A;  1SL8 A;  2LVJ A;  2JNX A;  3CGA A;  1ZAC A;  1XVJ A;  4MBE A;  2FCE A; 
#chains in the Genus database with same CATH topology
 3DVK A;  2MLE C;  1BMO A;  2ZRT A;  1EL4 A;  1IQ5 A;  3NSI A;  2LP2 A;  3KHE A;  2EC6 B;  3NSK A;  1J1D A;  1AVS A;  3H4S E;  1QWV A;  3SIB A;  3WNX B;  1EH2 A;  3M0W A;  2WCH A;  1M63 B;  1LIN A;  4CLN A;  1B7T Z;  2O60 A;  4I5K A;  3BFB A;  1WLM A;  1UHK A;  3CR5 X;  1G8I A;  2LCP A;  1J7R A;  1OOH A;  1S3P A;  2PAS A;  2PYQ A;  5ER4 X;  3D10 A;  2HQ8 A;  3CAB A;  2JT0 A;  3UO9 A;  2M1K B;  1NSH A;  3BOW B;  1OZS A;  1YR5 A;  4R1E A;  4INX A;  4YGC B;  2HQW A;  3PJI A;  4MZL A;  1QLK A;  4DUQ A;  1C07 A;  1MXE A;  3DVM A;  3RM1 A;  2KQY A;  1CLB A;  1KQM C;  4YGA A;  1SYM A;  1TTX A;  3OHM B;  5D7F A;  1WDC C;  1YRU B;  2K7B A;  1DGU A;  5F6T A;  3EVV A;  2KNE A;  2KSP A;  1JSA A;  1OSA A;  2KBI A;  1UP5 A;  2WCK A;  3PLF B;  1QTX A;  3SG6 A;  1GGZ A;  1OZO A;  1CDL A;  3EK7 A;  2PVB A;  4C0L A;  1L2O C;  1ZUZ A;  2CBL A;  1Z2C B;  5AER A;  1ORG A;  3GK2 A;  4JD9 A;  4N1G A;  3VGO A;  1BR1 B;  2KHN A;  5I2O A;  2LMT A;  1TCF A;  1RK9 A;  3R1V A;  1GM0 A;  5I2Q A;  2CT9 A;  1M39 A;  2JXL A;  4GGF A;  1Q80 A;  2OPO A;  4DRW A;  1J1E A;  2PSR A;  2KFH A;  2JT8 A;  1GQM A;  2I18 A;  4E68 A;  3R1P A;  4HRE E;  1OOG A;  2BBM A;  2I7A A;  2PRU A;  1SCM C;  2CNP A;  1RFJ A;  1QAT A;  3QME A;  1M31 A;  1LA0 A;  2E6W A;  2KAX A;  1K93 D;  2PQL A;  2Y5I A;  3VRP A;  5HKY A;  2MJW B;  2JWW A;  1XFY O;  3CS1 A;  3KO0 A;  1A75 B;  1F71 A;  5AEQ A;  1BG1 A;  1MQ1 A;  2CXJ A;  3E3R A;  1SY9 A;  3R1O A;  4PHK A;  4FQO A;  2M29 A;  1EJ3 A;  2CCM A;  1CM1 A;  2JXC A;  2BL0 B;  3BYA A;  3SG5 A;  2BCB A;  3NHT A;  1M46 A;  1JWD A;  2P70 A;  1CFC A;  3A8R A;  3DF0 A;  1KWO C;  1YUR A;  4PT1 A;  1ZOT B;  2M1U A;  2M7L A;  2BKI B;  2P6B B;  1REC A;  3CYZ A;  3CZT X;  4PE1 A;  5D69 A;  4PE0 A;  2OTG C;  2LAP A;  1SL7 A;  2DOQ A;  3D74 A;  1TIZ A;  2LC5 A;  1ZMZ A;  1UHJ A;  1QV1 A;  3OX6 A;  1Y1X A;  4MRX A;  3BUM B;  4M2Q A;  4UPG A;  2CTN A;  2KI6 C;  1IWQ A;  1CLL A;  1BLQ A;  2JT3 A;  3B87 A;  1WRZ A;  2NCO A;  4M2O A;  2KGR A;  3LK1 A;  1N2D A;  1H4B A;  2SCP A;  1B7T Y;  2Q91 A;  1BT6 A;  2QDI A;  3BQ3 A;  3IF7 A;  2LLU A;  3LLE A;  1S6C A;  1DJX A;  4N5X A;  3DVE A;  2BE6 A;  3EK4 A;  1SRA A;  1RTP 1;  1V1G A;  1QV0 A;  2F33 A;  4GNK B;  1KK8 C;  5I2L A;  3SG7 A;  1EG4 A;  4F0Z B;  2MBX A;  1FF1 A;  1K2H A;  1HT9 A;  4GUK A;  1E8A A;  3PFV A;  1K9U A;  1C7W A;  2WCF A;  3WHT B;  1JFK A;  1DJW A;  2F2P A;  3PAL A;  5JOL A;  1YX7 A;  1A4P A;  4NDD A;  3BJH A;  2R2I A;  1CFD A;  2KLE A;  2K60 A;  2OS8 C;  3D77 A;  3BUX B;  2Q4U A;  1YTZ C;  3D73 A;  1DEL A;  3TDZ A;  1QVI Z;  1NCX A;  1Z4H A;  2ZNE A;  2LVK A;  1SCV A;  3SG4 A;  1NIW A;  3TUY B;  3FE8 A;  5CSF A;  4F7F A;  3JTD B;  1RJV A;  4MEW A;  1F8H A;  5KU1 A;  1R6P A;  5HLO A;  1DJZ A;  2E30 A;  2L50 A;  3OB2 B;  3S0D A;  2L2C A;  1A75 A;  1DT7 B;  2LAN A;  2RGI A;  4QJ4 B;  1PVB A;  1XFV O;  3NHI A;  2K61 A;  3OX5 A;  1W7J B;  1L7Z A;  1QJT A;  2LUC A;  3EKH A;  3VRO A;  1CDN A;  2Y1M A;  1PUL A;  3HCM A;  2KFF A;  3DZT A;  1IQ3 A;  1B4C A;  1NX1 A;  2H8V A;  3PM8 A;  2F3Z A;  2BBN A;  2KGB C;  3I5G C;  3OGN A;  4HRH A;  1DJG A;  5AFP A;  1OOI X;  2WOR A;  4CPV A;  1S1E A;  3BFA A;  3O4X A;  3EK8 A;  2JQ6 A;  5HLV A;  1SR6 B;  4HRG A;  1BOC A;  3WHU B;  2K2F A;  1V1F A;  5JJG A;  1XA5 A;  2WCL A;  1CM4 A;  1OOJ A;  4P5O E;  4AQI A;  2H2K A;  2JTZ A;  3D75 A;  5EL2 A;  1WY9 A;  1DEK A;  1RWY A;  1UWO A;  2KI6 D;  3DF0 B;  2L4H A;  2ERB A;  3FIA A;  2EHB A;  1P28 A;  4OCI A;  2WOS A;  4OZD A;  3CZ2 A;  5DIC A;  3F45 A;  4C0K A;  4MVF A;  4YI9 A;  3GK1 A;  2LE9 B;  2QEO A;  2L51 A;  1N0Y A;  1JF2 A;  2KFG A;  4USL A;  2JPT A;  2MA2 A;  4DIR A;  3O2P A;  2JRF A;  5KTY A;  1PVA A;  1S5G Z;  2KBM A;  2KPH A;  1AUI B;  1MR8 A;  1GJY A;  2LHL A;  2LNK A;  3PSR A;  2F8P A;  4GAO A;  2ZN9 A;  1N65 A;  4GFT A;  3DYE A;  1IG5 A;  4TNC A;  5CPV A;  3VRR A;  1YVH A;  1F70 A;  4PHM A;  4PAL A;  3I5H B;  4OKH A;  1XFZ O;  1NYA A;  3A4U B;  2KI4 C;  4XJK A;  1TUZ A;  1DQE A;  1QIV A;  5FI6 A;  1M45 A;  5IBW A;  1J55 A;  2L0P A;  1KK7 Z;  2WC6 A;  1CTR A;  1KQV A;  4DCK A;  3Q8I A;  1BU3 A;  3TS5 B;  2F3Y A;  1SL9 A;  2KQ6 A;  5HL1 A;  2JOJ A;  1HQV A;  4D1E A;  4GGF C;  1FW4 A;  1KSO A;  4MZJ A;  3I5F C;  3RLZ A;  5TNC A;  5HYD A;  1F55 A;  2JU0 A;  3SS4 A;  3D78 A;  3KEV A;  2LUX A;  1CDP A;  2M9G A;  5FYX A;  1DVI A;  5I94 A;  1JC2 A;  4M2P A;  2WCB A;  1UHN A;  1BJF A;  1XK4 C;  5AAN A;  3GK4 X;  4KYN A;  3AAJ A;  3L4L A;  4GPL B;  2EC6 C;  1TUJ A;  2K7O A;  2K8M B;  1GGW A;  1DTL A;  1SNL A;  4MZK A;  1LXF C;  4PCW A;  4ZCU A;  3VRQ A;  2M49 B;  3PN7 B;  1TNW A;  3D76 A;  5B8I B;  4NDC A;  2JUL A;  4FQT A;  1NP8 A;  1QVI Y;  3JVT C;  2K7D A;  3SS3 A;  4DS7 A;  2NCP A;  1BOD A;  3LK0 A;  1F4Q A;  2GGZ A;  1MWN A;  4AQJ A;  2KAV A;  3ZNI A;  3TDU A;  1UHI A;  2ZKM X;  3LCP C;  4WRI A;  3SG2 A;  1CFP A;  1TWO A;  1KFX S;  1KFX L;  4Q04 A;  3FS7 A;  1X02 A;  4PE4 A;  2VRG A;  3I5I B;  4IL1 A;  4OR9 B;  1ZFS A;  1JBA A;  1ODB A;  4N1F A;  3BUN B;  1TN4 A;  1OQP A;  1XFX O;  1K95 A;  1Y6W A;  1F4O A;  2LLT A;  3GOF A;  3DXL A;  2SAS A;  4ZCV A;  4ICB A;  1B8R A;  1SK6 D;  3LL8 B;  3O4Y A;  1WRK A;  1D1O A;  1Y1A A;  4GGN A;  2MHH A;  4NDB A;  3K1E A;  4YGD B;  2MAZ A;  2FJU B;  3SG3 A;  2GGM A;  1AJ4 A;  2GV5 A;  1LS8 A;  4YBH B;  1PSB A;  2FJY A;  2KLD A;  1QX5 B;  2K2A A;  2QPT A;  2H61 C;  3PM2 A;  5CSI A;  1EXR A;  3S0G A;  2KDH A;  1AP4 A;  4OVN F;  1H8B A;  1YRT B;  2K0J A;  5AXI A;  4XJK B;  1A29 A;  2QEB A;  1NCZ A;  2AAO A;  1U5I A;  3TZ1 A;  2KYC A;  4PHN A;  1QAS A;  4CFR A;  5DKN A;  2AMI A;  3SS5 A;  2BCX A;  3PAT A;  1IKU A;  1DJH A;  1QS7 A;  1R2U A;  4HSZ A;  2V53 A;  3B86 A;  5D3O A;  5J3X A;  1KQM B;  1PAL A;  2G2B A;  1WDC B;  5I8N A;  1OMV A;  1NPQ A;  3V2L A;  1B8C A;  1C3Z A;  2BL0 C;  3ICB A;  1LVC D;  1KK7 Y;  1YVL A;  1OMR A;  4U8D A;  1DMO A;  2FCD A;  1G33 A;  1ALV A;  4I5L B;  1CMG A;  3DD4 A;  3CLN A;  1L2O B;  2WCM A;  3CDN A;  3VB1 A;  1JUO A;  1AJ5 A;  3S0A A;  2PAL A;  2A4J A;  3BUW B;  3K21 A;  3AKB A;  1CDM A;  3L4A A;  2ZND A;  1IH0 A;  4FTG A;  3MSE B;  1JFJ A;  2MLF C;  3D0Y A;  4ETO A;  1KFU S;  1KFU L;  2JPO A;  2LHI A;  1MUX A;  2M0R A;  1S26 D;  1Y0V H;  1YUT A;  1IGV A;  1T14 A;  4PDZ A;  2L5X B;  5HKW A;  1XYD A;  1B9A A;  2HPS A;  1SCM B;  1S36 A;  1CMF A;  1FI5 A;  2BKH B;  4OV2 A;  4PHJ A;  4C0J A;  3KPX A;  4JKT A;  3VRN A;  1NWD A;  3EVR A;  3CR4 X;  1YUS A;  1W9Z A;  1MHO A;  1OW4 A;  3AKA A;  3EG5 B;  4CFQ A;  2WC8 A;  1PK0 D;  3EKJ A;  3FWB A;  2LVI A;  2BCA A;  1G4Y R;  2WC5 A;  1K8U A;  1CKK A;  5BPJ A;  1DJI A;  2LMV A;  3B7A A;  2ZN8 A;  2P71 A;  1B47 A;  2ISD A;  1MF8 B;  3JVT B;  5HKZ A;  1J7Q A;  3NSO A;  3L47 A;  1NX0 A;  1KWO B;  3O78 A;  1IIO A;  1OOF A;  4NQG A;  3TUY C;  2L5Y A;  1K9P A;  3JTD C;  1UUR A;  2LP3 A;  2OTG B;  3CTN A;  2LMU A;  2LV7 A;  2WCE A;  1DF0 A;  4BY5 A;  1U5I B;  3BXK A;  1SBJ A;  3CZ1 A;  3NSL A;  1ALW A;  1XFU O;  3DVJ A;  3HX4 A;  5ER5 A;  3SJS A;  2KOT A;  2MRD A;  3WXA A;  4P2Y B;  2LLS A;  3B88 A;  1C7V A;  2BEC A;  3AAK A;  3IVT A;  4JPZ B;  1XFR A;  3BFH A;  1SW8 A;  2L98 A;  2ZFD A;  1SR6 C;  1WLZ A;  4AOM A;  1KCY A;  2KYF A;  2KAY A;  3RZS A;  1K90 D;  3IQO A;  2BE4 A;  2QEV A;  4XYN A;  1KK8 B;  4GBA A;  1TRF A;  1BF5 A;  2TN4 A;  4CID A;  1A2X A;  3N7H A;  4YGE B;  1W7I B;  3QRX A;  2L4I A;  1AK8 A;  4MLW A;  3O6B A;  4MSP A;  1BR4 B;  2OS8 B;  3S0F A;  1OMD A;  1NX3 A;  4INW A;  1TOP A;  1XO5 A;  1J7P A;  1KSM A;  2D8N A;  4QJ5 B;  4A4C A;  2IS9 A;  2HF5 A;  2PMY A;  3EVU A;  1XK4 A;  1UHH A;  3FWC A;  5FI7 A;  3OB1 B;  3CZ0 A;  2G9B A;  3D0Y B;  1PSR A;  4YGB B;  2GTE A;  1NUB A;  2I2R E;  3CR2 A;  1QXP A;  1CLM A;  1SKT A;  1TNQ A;  2O5G A;  3I5H C;  3B6X A;  3TDI A;  1TCO B;  2ZRS A;  3ZWH A;  4ORA B;  4A4B A;  1CB1 A;  1S6J A;  1J7O A;  2JZI A;  5CSN A;  5GQQ C;  3NXA A;  4BY4 A;  2LVV A;  4YRU A;  1C3Y A;  2JC2 A;  2COL B;  5G08 A;  3BOW A;  5PAL A;  3S0E A;  3I5G B;  3S0B A;  3SIA A;  2BNX A;  1DGV A;  3TS5 C;  4JWQ A;  1K96 A;  1B1G A;  2QAC A;  1Y1U A;  1DJY A;  1RRO A;  1WRL A;  2L2E A;  2WND A;  3FE6 A;  4L9M A;  1UUS A;  3OBV A;  3OP0 A;  4I5N B;  1S6I A;  1SSE B;  1XFW O;  2EGD A;  2M97 A;  4WQ2 A;  2I94 A;  1VRK A;  1K9K A;  4MN0 A;  5DKQ A;  4I5J A;  2YGU A;  4ORC B;  5KSZ A;  1FI6 A;  4JQ0 D;  2WCJ A;  4PE7 A;  1IJ5 A;  2F2O A;  3BUO B;  1A03 A;  1QX7 A;  1QLS A;  2LM5 A;  1OE9 B;  1AHR A;  1JF0 A;  1S5G Y;  2FOT A;  2K7C A;  1SPY A;  4MRY A;  2B1U A;  1DF0 B;  2M3W A;  1CFF A;  3UNW A;  1SMG A;  2NZ0 A;  1FPW A;  2NLN A;  5DKR A;  3PN7 C;  2M8U A;  3R72 A;  1IJ6 A;  3FE9 A;  2AUC A;  2QEH A;  2M7N A;  2H61 A;  1EG3 A;  1CNP A;  4ORB B;  3KF9 A;  1IRJ A;  4QJ3 B;  2KI4 B;  1NX2 A;  1YX8 A;  2Y4Q A;  2Y1N A;  1PRW A;  3DY9 A;  2NXQ A;  1TNX A;  1NCY A;  1TNP A;  1LA3 A;  1F54 A;  4YI8 A;  1QX2 A;  4WQ3 A;  1QIW A;  3NGV A;  3IQQ A;  3I5I C;  1YUU A;  2HET A;  1FBV A;  1MXL C;  2JNF A;  5K89 A;  3C1V A;  1DC1 A;  3CWG A;  3I5F B;  1K94 A;  4IJ7 A;  2JTT A;  2BAP A;  1LKJ A;  5CSJ A;  5FI2 A;  1B8L A;  1SL8 A;  2LVJ A;  2JNX A;  3CGA A;  1ZAC A;  1XVJ A;  4MBE A;  2FCE A; 
#chains in the Genus database with same CATH homology
 3DVK A;  2MLE C;  1BMO A;  2ZRT A;  1EL4 A;  1IQ5 A;  3NSI A;  2LP2 A;  3KHE A;  2EC6 B;  3NSK A;  1J1D A;  1AVS A;  3H4S E;  3WNX B;  3SIB A;  1EH2 A;  3M0W A;  1M63 B;  1LIN A;  4CLN A;  1B7T Z;  2O60 A;  4I5K A;  1WLM A;  1UHK A;  3CR5 X;  1G8I A;  2LCP A;  1J7R A;  1S3P A;  2PAS A;  5ER4 X;  3D10 A;  2HQ8 A;  2JT0 A;  2M1K B;  1NSH A;  3BOW B;  1OZS A;  1YR5 A;  4R1E A;  4YGC B;  2HQW A;  4MZL A;  1QLK A;  4DUQ A;  1C07 A;  1MXE A;  3DVM A;  3RM1 A;  2KQY A;  1CLB A;  1KQM C;  4YGA A;  1SYM A;  1TTX A;  3OHM B;  5D7F A;  1WDC C;  1YRU B;  2K7B A;  1DGU A;  5F6T A;  3EVV A;  2KNE A;  2KSP A;  1JSA A;  1OSA A;  2KBI A;  1UP5 A;  3PLF B;  1QTX A;  3SG6 A;  1GGZ A;  1OZO A;  1CDL A;  3EK7 A;  2PVB A;  4C0L A;  1L2O C;  1ZUZ A;  2CBL A;  5AER A;  3GK2 A;  4N1G A;  3VGO A;  1BR1 B;  2KHN A;  5I2O A;  2LMT A;  1TCF A;  1RK9 A;  5I2Q A;  2CT9 A;  1M39 A;  2JXL A;  4GGF A;  1Q80 A;  2OPO A;  4DRW A;  1J1E A;  2PSR A;  2KFH A;  2JT8 A;  1GQM A;  2I18 A;  4E68 A;  4HRE E;  2BBM A;  2I7A A;  2PRU A;  1SCM C;  2CNP A;  1RFJ A;  1QAT A;  1M31 A;  1LA0 A;  2E6W A;  2KAX A;  1K93 D;  2Y5I A;  3VRP A;  5HKY A;  2MJW B;  2JWW A;  1XFY O;  3CS1 A;  3KO0 A;  1A75 B;  1F71 A;  5AEQ A;  1BG1 A;  1MQ1 A;  2CXJ A;  3E3R A;  1SY9 A;  4PHK A;  4FQO A;  2M29 A;  1EJ3 A;  2CCM A;  1CM1 A;  2JXC A;  2BL0 B;  3BYA A;  3SG5 A;  2BCB A;  1M46 A;  1JWD A;  1CFC A;  3A8R A;  3DF0 A;  1KWO C;  1YUR A;  1ZOT B;  2M1U A;  2M7L A;  2BKI B;  2P6B B;  1REC A;  3CZT X;  4PE1 A;  5D69 A;  4PE0 A;  2OTG C;  2LAP A;  1SL7 A;  2DOQ A;  1TIZ A;  2LC5 A;  1ZMZ A;  1UHJ A;  1QV1 A;  3OX6 A;  1Y1X A;  4MRX A;  3BUM B;  4M2Q A;  4UPG A;  2CTN A;  2KI6 C;  1IWQ A;  1CLL A;  1BLQ A;  2JT3 A;  1WRZ A;  2NCO A;  4M2O A;  2KGR A;  3LK1 A;  1N2D A;  1H4B A;  2SCP A;  1B7T Y;  2Q91 A;  1BT6 A;  3BQ3 A;  3IF7 A;  2LLU A;  3LLE A;  1S6C A;  1DJX A;  4N5X A;  3DVE A;  2BE6 A;  3EK4 A;  1SRA A;  1RTP 1;  1V1G A;  1QV0 A;  2F33 A;  4GNK B;  1KK8 C;  5I2L A;  3SG7 A;  1EG4 A;  4F0Z B;  2MBX A;  1FF1 A;  1K2H A;  1HT9 A;  4GUK A;  1E8A A;  3PFV A;  1K9U A;  1C7W A;  2WCF A;  3WHT B;  1JFK A;  1DJW A;  2F2P A;  3PAL A;  5JOL A;  1YX7 A;  1A4P A;  4NDD A;  3TDU A;  2R2I A;  1CFD A;  2OS8 C;  3PM8 A;  3TDZ A;  3BUX B;  2Q4U A;  1YTZ C;  1QVI Z;  1NCX A;  2ZNE A;  2LVK A;  1SCV A;  3SG4 A;  1NIW A;  3TUY B;  5CSF A;  3JTD B;  1RJV A;  4MEW A;  1F8H A;  5KU1 A;  1R6P A;  5HLO A;  1DJZ A;  2E30 A;  2L50 A;  3OB2 B;  1A75 A;  1DT7 B;  2LAN A;  2RGI A;  4QJ4 B;  1PVB A;  1XFV O;  2K61 A;  3OX5 A;  1W7J B;  1L7Z A;  1QJT A;  2LUC A;  3EKH A;  3VRO A;  1CDN A;  2Y1M A;  1PUL A;  3HCM A;  2KFF A;  1IQ3 A;  1B4C A;  1NX1 A;  2F3Z A;  2BBN A;  2KGB C;  3I5G C;  4HRH A;  1DJG A;  5AFP A;  2WOR A;  4CPV A;  1S1E A;  3EK8 A;  2JQ6 A;  5HLV A;  1SR6 B;  4HRG A;  1BOC A;  3WHU B;  2K2F A;  1V1F A;  5JJG A;  1XA5 A;  1CM4 A;  1OOJ A;  4P5O E;  4AQI A;  2H2K A;  2JTZ A;  1WY9 A;  1RWY A;  1UWO A;  2KI6 D;  3DF0 B;  2L4H A;  3FIA A;  2EHB A;  4OCI A;  2WOS A;  3F45 A;  4C0K A;  4MVF A;  4YI9 A;  3GK1 A;  2LE9 B;  2L51 A;  1N0Y A;  1JF2 A;  2KFG A;  4USL A;  2JPT A;  2MA2 A;  4DIR A;  3O2P A;  2JRF A;  5KTY A;  1PVA A;  1S5G Z;  2KBM A;  1AUI B;  1MR8 A;  1GJY A;  2LHL A;  2LNK A;  3PSR A;  2F8P A;  4GAO A;  2ZN9 A;  1N65 A;  4GFT A;  3VRR A;  1IG5 A;  4TNC A;  5CPV A;  1YVH A;  1F70 A;  4PHM A;  4PAL A;  3I5H B;  4OKH A;  1XFZ O;  1NYA A;  3A4U B;  2KI4 C;  4XJK A;  1QIV A;  5IBW A;  1M45 A;  1J55 A;  2L0P A;  1KK7 Z;  1CTR A;  1KQV A;  4DCK A;  1BU3 A;  3TS5 B;  2F3Y A;  1SL9 A;  2KQ6 A;  2JOJ A;  1HQV A;  4D1E A;  4GGF C;  1FW4 A;  1KSO A;  4MZJ A;  3I5F C;  3RLZ A;  5TNC A;  5HYD A;  1F55 A;  2JU0 A;  3KEV A;  2LUX A;  1CDP A;  2M9G A;  5FYX A;  1DVI A;  1JC2 A;  4M2P A;  2WCB A;  1UHN A;  1BJF A;  1XK4 C;  5AAN A;  3GK4 X;  3AAJ A;  4GPL B;  2EC6 C;  2K7O A;  2K8M B;  1GGW A;  1DTL A;  1SNL A;  4MZK A;  1LXF C;  4PCW A;  4ZCU A;  3VRQ A;  2M49 B;  3PN7 B;  1TNW A;  5B8I B;  4NDC A;  2JUL A;  1NP8 A;  1QVI Y;  3JVT C;  2K7D A;  4DS7 A;  2NCP A;  1BOD A;  3LK0 A;  1F4Q A;  2GGZ A;  1MWN A;  4AQJ A;  2KAV A;  3ZNI A;  1UHI A;  2ZKM X;  3LCP C;  4WRI A;  3SG2 A;  1CFP A;  1KFX S;  1KFX L;  4Q04 A;  3FS7 A;  1X02 A;  4PE4 A;  2VRG A;  3I5I B;  4IL1 A;  4OR9 B;  1ZFS A;  1JBA A;  1ODB A;  4N1F A;  3BUN B;  1TN4 A;  1OQP A;  1XFX O;  1K95 A;  1Y6W A;  1F4O A;  2LLT A;  3GOF A;  2SAS A;  4ZCV A;  4ICB A;  1B8R A;  1SK6 D;  3LL8 B;  3O4Y A;  1WRK A;  1D1O A;  1Y1A A;  4GGN A;  2MHH A;  4NDB A;  4YGD B;  2MAZ A;  2FJU B;  3SG3 A;  2GGM A;  1AJ4 A;  2GV5 A;  4YBH B;  1PSB A;  1QX5 B;  2K2A A;  2QPT A;  2H61 C;  5CSI A;  1EXR A;  2KDH A;  1AP4 A;  4OVN F;  1H8B A;  1YRT B;  2K0J A;  5AXI A;  4XJK B;  1A29 A;  1NCZ A;  2AAO A;  1U5I A;  3TZ1 A;  2KYC A;  4PHN A;  1QAS A;  4CFR A;  5DKN A;  2AMI A;  2BCX A;  3PAT A;  1IKU A;  1DJH A;  1QS7 A;  1R2U A;  4HSZ A;  2V53 A;  5J3X A;  1KQM B;  1PAL A;  2G2B A;  1WDC B;  5I8N A;  1OMV A;  1NPQ A;  1B8C A;  2BL0 C;  3ICB A;  1LVC D;  1KK7 Y;  1YVL A;  1OMR A;  4U8D A;  1DMO A;  2FCD A;  1G33 A;  1ALV A;  4I5L B;  1CMG A;  3DD4 A;  3CLN A;  1L2O B;  1JUO A;  1AJ5 A;  2PAL A;  2A4J A;  3BUW B;  3K21 A;  3AKB A;  1CDM A;  2ZND A;  1IH0 A;  4FTG A;  3MSE B;  1JFJ A;  2MLF C;  3D0Y A;  4ETO A;  1KFU S;  1KFU L;  2LHI A;  1MUX A;  2M0R A;  1S26 D;  1Y0V H;  1YUT A;  1IGV A;  4PDZ A;  5HKW A;  2L5X B;  1XYD A;  1B9A A;  2HPS A;  1SCM B;  1S36 A;  1CMF A;  1FI5 A;  2BKH B;  4OV2 A;  4PHJ A;  4C0J A;  3KPX A;  3VRN A;  1NWD A;  3EVR A;  3CR4 X;  1YUS A;  1MHO A;  3AKA A;  4CFQ A;  2WC8 A;  1PK0 D;  3EKJ A;  3FWB A;  2LVI A;  2BCA A;  1G4Y R;  1K8U A;  1CKK A;  5BPJ A;  1DJI A;  2LMV A;  2ZN8 A;  1B47 A;  2ISD A;  1MF8 B;  3JVT B;  5HKZ A;  1J7Q A;  3NSO A;  1NX0 A;  1KWO B;  3O78 A;  4NQG A;  3TUY C;  1K9P A;  3JTD C;  1UUR A;  2LP3 A;  2OTG B;  3CTN A;  2LMU A;  2LV7 A;  2WCE A;  1DF0 A;  4BY5 A;  1U5I B;  3BXK A;  1SBJ A;  3NSL A;  1ALW A;  1XFU O;  3DVJ A;  3HX4 A;  5ER5 A;  3SJS A;  2KOT A;  2MRD A;  3WXA A;  4P2Y B;  2LLS A;  1C7V A;  2BEC A;  3AAK A;  4JPZ B;  1SW8 A;  2L98 A;  2ZFD A;  1SR6 C;  1WLZ A;  4AOM A;  1KCY A;  2KYF A;  2KAY A;  1K90 D;  3IQO A;  2BE4 A;  4XYN A;  1KK8 B;  4GBA A;  1TRF A;  1BF5 A;  2TN4 A;  4CID A;  1A2X A;  4YGE B;  1W7I B;  3QRX A;  2L4I A;  1AK8 A;  4MLW A;  3O6B A;  4MSP A;  1BR4 B;  2OS8 B;  1OMD A;  1NX3 A;  1J7P A;  1TOP A;  1XO5 A;  1KSM A;  2D8N A;  4QJ5 B;  4A4C A;  2IS9 A;  2HF5 A;  2PMY A;  3EVU A;  1XK4 A;  1UHH A;  3FWC A;  3OB1 B;  2G9B A;  3D0Y B;  1PSR A;  4YGB B;  1NUB A;  2I2R E;  3CR2 A;  1QXP A;  1CLM A;  1SKT A;  1TNQ A;  2O5G A;  3I5H C;  3TDI A;  1TCO B;  2ZRS A;  3ZWH A;  4ORA B;  4A4B A;  1CB1 A;  1S6J A;  1J7O A;  2JZI A;  5CSN A;  5GQQ C;  3NXA A;  4BY4 A;  2LVV A;  4YRU A;  2JC2 A;  2COL B;  5G08 A;  3BOW A;  5PAL A;  3I5G B;  3SIA A;  1DGV A;  3TS5 C;  4JWQ A;  1K96 A;  1B1G A;  2QAC A;  1Y1U A;  1DJY A;  1RRO A;  1WRL A;  2L2E A;  2WND A;  4L9M A;  1UUS A;  3OP0 A;  4I5N B;  1S6I A;  1XFW O;  2EGD A;  2M97 A;  4WQ2 A;  2I94 A;  1VRK A;  1K9K A;  4MN0 A;  5DKQ A;  4I5J A;  4ORC B;  5KSZ A;  1FI6 A;  4JQ0 D;  4PE7 A;  1IJ5 A;  2F2O A;  3BUO B;  1A03 A;  1QX7 A;  1QLS A;  2LM5 A;  1OE9 B;  1AHR A;  1JF0 A;  1S5G Y;  2FOT A;  2K7C A;  1SPY A;  4MRY A;  2B1U A;  1DF0 B;  2M3W A;  1CFF A;  1SMG A;  2NZ0 A;  1FPW A;  2NLN A;  5DKR A;  3PN7 C;  2M8U A;  1IJ6 A;  2AUC A;  2M7N A;  2H61 A;  1EG3 A;  1CNP A;  4ORB B;  3KF9 A;  1IRJ A;  4QJ3 B;  2KI4 B;  1NX2 A;  1YX8 A;  2Y4Q A;  2Y1N A;  1PRW A;  2NXQ A;  1TNX A;  1NCY A;  1TNP A;  1LA3 A;  1F54 A;  4YI8 A;  1QX2 A;  4WQ3 A;  1QIW A;  3IQQ A;  3I5I C;  1YUU A;  2HET A;  1FBV A;  1MXL C;  2JNF A;  5K89 A;  3C1V A;  3CWG A;  3I5F B;  1K94 A;  2JTT A;  1LKJ A;  5CSJ A;  1B8L A;  1SL8 A;  2LVJ A;  2JNX A;  3CGA A;  1ZAC A;  1XVJ A;  4MBE A;  2FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...