5GQQC

Structure of alg-2/hebp2 complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
GSDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Study of Apoptosis-linked Gene-2Heme-binding Protein 2 Interactions in HIV-1 Production.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Heme-binding protein 2
total genus 64
structure length 170
sequence length 170
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13202 EF-hand_5 EF hand
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5gqqC00
2COLB 3SG4A 1SCMC 1AP4A 4ORAB 2BKHB 1SCVA 1SL8A 4MN0A 3PN7C 2LLUA 1ZUZA 3FS7A 1QIVA 1S5GY 3O4YA 3EKHA 1HQVA 1TN4A 3PFVA 3DD4A 1XFXO 2LVIA 2K7CA 1AJ4A 5HYDA 1IG5A 1UUSA 1TNQA 1ZACA 2LUCA 2Q4UA 3EVVA 1V1GA 3BUNB 5FYXA 1CB1A 2G9BA 2MLEC 1TIZA 3DVJA 5J3XA 4PHJA 2JNXA 2LMVA 1K95A 2H2KA 2KNEA 4JQ0D 1OMVA 2K61A 4PCWA 4BY4A 1WRZA 4FQOA 1BODA 3LK0A 1B8CA 1ZMZA 5ER4X 1J7QA 1H4BA 1CDNA 2ZFDA 3O6BA 1NWDA 1EG4A 1JF0A 1G8IA 3AAJA 3RLZA 1S6CA 1XFZO 2M29A 2KHNA 1QS7A 1WRLA 2M9GA 2B1UA 1YR5A 1S5GZ 5AEQA 1IJ5A 4YGBB 1KWOB 4YGEB 1S1EA 5F6TA 4USLA 2JPTA 1MXLC 3IF7A 1QLSA 1BG1A 3I5GB 3KO0A 3DVKA 1KQMB 3SG5A 1TOPA 2SCPA 2LVJA 2PVBA 1V1FA 2KAYA 3CTNA 4GGFC 4GPLB 2BKIB 3VRRA 2JQ6A 4MZKA 3BQ3A 4YI9A 1X02A 5CSNA 2KBIA 5GQQC 5AFPA 3VRQA 5IBWA 1IQ3A 1PSBA 2M1KB 3LLEA 2HETA 1CMFA 1Y0VH 2I7AA 2P6BB 4GAOA 5HKZA 1YURA 2PMYA 5I8NA 4MRXA 2OS8B 3KF9A 2Y5IA 1R6PA 1IKUA 2LLSA 1S6JA 2PASA 1YUUA 2LP3A 3AKBA 1DJWA 3I5FB 5AXIA 3WXAA 1AK8A 1H8BA 2WCEA 3MSEB 4YGAA 1S3PA 2L51A 3SJSA 1HT9A 5DKQA 1NPQA 2WOSA 1UHNA 4MVFA 1XA5A 3E3RA 2OPOA 2PRUA 1F71A 1CDMA 1M31A 1AJ5A 1U5IB 2OS8C 2WNDA 2CBLA 2JOJA 1NX1A 3A8RA 1LA3A 3HX4A 2OTGB 3I5HB 2CT9A 3EK4A 1SR6B 1CTRA 2D8NA 1CLMA 1K94A 1VRKA 4XJKB 4DUQA 1CFDA 4P2YB 1JSAA 4OR9B 3EKJA 2EHBA 1OOJA 1Y6WA 2KYCA 1A75A 1EH2A 2H61A 1WLZA 2LVVA 1MWNA 2M7LA 4NDBA 1KFUS 1XK4A 2HQWA 4HREE 1K90D 2L4IA 1RJVA 1XO5A 2RGIA 4NQGA 1UHKA 3JTDC 2WCBA 1SKTA 2JULA 3CR5X 2Q91A 3JVTB 1SL7A 3VRNA 4IL1A 4PALA 1TCOB 1RFJA 4I5JA 2KGBC 1NSHA 2MRDA 5HKWA 2JTZA 1PULA 3I5IC 2MLFC 4OKHA 2DOQA 3F45A 2M97A 5B8IB 2MJWB 1CKKA 3CGAA 1KFXL 4C0JA 1MR8A 2BECA 2KAVA 4QJ3B 2QACA 3WNXB 1M39A 2CXJA 1XFVO 4GFTA 2NLNA 2LV7A 2MAZA 2NZ0A 3TZ1A 2LHIA 4A4CA 1F8HA 2CNPA 1QX7A 4YI8A 2BBMA 1UHIA 2JT0A 4I5LB 3FIAA 2PSRA 4WQ2A 5CSFA 1M63B 2A4JA 5I2OA 1UWOA 3OHMB 1YTZC 2E30A 4E68A 4MLWA 1OMRA 1JUOA 3WHTB 2WORA 4N1FA 5KTYA 2GGZA 1AVSA 1OZOA 3A4UB 1KK8C 2F3YA 1AHRA 2KYFA 1BT6A 2V53A 4MZJA 2ISDA 1JC2A 1B9AA 1ODBA 1RECA 1SMGA 2PALA 3GK2A 3OB1B 1G4YR 4ETOA 1Y1XA 4XYNA 1GJYA 3VROA 3HCMA 2LUXA 5AANA 4C0KA 4PHMA 5DKNA 4MSPA 1XFWO 1NP8A 1YVLA 1BF5A 1SR6C 2K2AA 1F4QA 2ZN9A 2HPSA 1DMOA 3OB2B 5HLOA 1BJFA 1G33A 5ER5A 2F8PA 1K93D 1NCZA 4D1EA 2KI6D 1J7RA 1N65A 4MBEA 1SNLA 5TNCA 1Y1UA 4QJ5B 1KK8B 3PLFB 3D0YB 1QJTA 5D69A 1TCFA 4GGNA 2KAXA 1TNXA 1KFUL 4PE1A 4CPVA 3I5FC 3NXAA 5KU1A 3BUMB 1JF2A 1ALVA 1YUTA 2LMUA 4U8DA 2KQ6A 2I18A 1YVHA 1J7OA 1TRFA 2EC6C 4CFRA 2G2BA 1PSRA 1M45A 1XYDA 2JWWA 2KFFA 4YBHB 1BU3A 3TS5C 3BXKA 4I5KA 4I5NB 3SG3A 1FBVA 5K89A 4GBAA 1DJZA 1NCYA 4N1GA 1OZSA 3AAKA 3CS1A 2IS9A 2JC2A 4N5XA 2H61C 1EJ3A 1QIWA 3KEVA 3BOWB 4OV2A 2CTNA 1PRWA 1LKJA 1CDPA 1QATA 1W7IB 1SY9A 1LVCD 2ZKMX 2KSPA 1CLLA 2GV5A 1DJGA 1QV1A 1WRKA 1NCXA 2LAPA 2ZRTA 5G08A 1BR4B 4PHKA 3RM1A 4AOMA 2EGDA 1CM4A 3JVTC 2LP2A 1LINA 2M7NA 4L9MA 3JTDB 1F4OA 1SL9A 3NSKA 1KCYA 4M2PA 2I2RE 1RK9A 2WC8A 4ICBA 3O2PA 1BOCA 3CLNA 2NCOA 2LC5A 1NYAA 1SYMA 1LA0A 2HQ8A 1QV0A 1FI5A 1CDLA 1K9KA 1CFPA 1UURA 2F2PA 3LL8B 1KQVA 2BCBA 2L4HA 4DCKA 1IJ6A 2OTGC 1DT7B 1JFJA 4QJ4B 2M0RA 1Q80A 1J1EA 1CLBA 1IH0A 1YUSA 2K8MB 1K8UA 1ALWA 1ZOTB 3FWBA 1IQ5A 1BLQA 4YGCB 3KPXA 1F70A 4HRGA 1B8RA 3ZNIA 3TUYC 3TUYB 2R2IA 3NSOA 3TDZA 3SIBA 1QXPA 1MXEA 1WDCB 3AKAA 4YGDB 5JOLA 4MZLA 2LANA 3QRXA 4R1EA 1B8LA 1YRTB 1JBAA 1A4PA 4HSZA 1K2HA 1KFXS 2VRGA 3PN7B 5DKRA 1FF1A 2JTTA 1DJXA 1DVIA 2Y1NA 3CR4X 1QTXA 4OCIA 1SCMB 1EL4A 2KFGA 1J55A 4ZCVA 4AQJA 1BR1B 2FCEA 1R2UA 1SBJA 1M46A 1RROA 1XFUO 3D10A 1TTXA 2O5GA 2F3ZA 4ZCUA 3SIAA 1KSMA 1DGVA 2Y1MA 1A03A 2M1UA 3VRPA 3I5GC 4PHNA 1SK6D 1KQMC 5CSIA 3PSRA 3PATA 2BE6A 2BE4A 4M2QA 2K7DA 3H4SE 4PE7A 1PVBA 1XVJA 3CZTX 4UPGA 1DF0B 4DIRA 1SPYA 4AQIA 1WY9A 1S36A 3O78A 1B7TY 1L2OC 4DRWA 2HF5A 5HKYA 2FCDA 2MA2A 3DF0A 1QLKA 4MRYA 4P5OE 2BCAA 1D1OA 4JPZB 2GGMA 4M2OA 3SG6A 2L0PA 4GUKA 4ORBB 1YX8A 1JWDA 1MUXA 2E6WA 2I94A 4FTGA 1FW4A 4C0LA 1NX3A 4NDCA 4TNCA 1OE9B 1OQPA 4GNKB 1K9UA 4CIDA 1B47A 2L5XB 1C07A 1N0YA 2ZN8A 3CWGA 3TDIA 1ZFSA 2JU0A 3BUXB 1PALA 1L2OB 2LNKA 1PK0D 1QX2A 2KDHA 3NSIA 1KSOA 1IWQA 3EVRA 1UP5A 1S6IA 2NXQA 3DVEA 1U5IA 2SASA 4PE0A 1CM1A 4Q04A 4XJKA 2KI6C 3KHEA 2JXCA 4OVNF 2JXLA 3BYAA 5HLVA 4A4BA 2BL0C 3C1VA 1KK7Z 2LE9B 1MQ1A 1CFFA 1LXFC 2JNFA 3D0YA 2LCPA 1SRAA 1XK4C 5D7FA 1QX5B 2M3WA 2JT3A 3DF0B 3LK1A 2KI4C 5CPVA 1OMDA 1W7JB 2K7BA 2WCFA 3ICBA 1SW8A 2MHHA 1YRUB 1J1DA 1IRJA 1NX0A 1WDCC 2ZNDA 2AMIA 1GGZA 2MBXA 4BY5A 1RTP1 1BMOA 2LHLA 1CMGA 2KI4B 2LVKA 5CSJA 1NX2A 5AERA 2K2FA 3OX6A 1QASA 5I2LA 3ZWHA 2AUCA 1DJIA 1A29A 1XFYO 5I2QA 1CFCA 3GK4X 4NDDA 4PDZA 1WLMA 1NIWA 1AUIB 3K21A 3LCPC 5KSZA 2CCMA 1KK7Y 2O60A 1PVAA 4YRUA 4MEWA 1F55A 1GGWA 4PE4A 2M8UA 2JZIA 2BCXA 3I5IB 5BPJA 1DJYA 2L2EA 1E8AA 1YX7A 3BUWB 3OX5A 1A75B 4WQ3A 2LLTA 1C7WA 2ZNEA 1KWOC 2F2OA 1EXRA 1IGVA 1QVIZ 3FWCA 1L7ZA 2LMTA 3EK8A 1FPWA 1EG3A 3PALA 3BUOB 3BOWA 1J7PA 3EK7A 1N2DA 1FI6A 3TDUA 1CNPA 1GQMA 3DVMA 3IQQA 1UHJA 1DJHA 2KOTA 1Y1AA 3GOFA 2Y4QA 3SG7A 1C7VA 2M49B 3I5HC 1S26D 2LM5A 3WHUB 1DF0A 2TN4A 3SG2A 3TS5B 2L50A 3CR2A 2JT8A 4HRHA 1K96A 2KFHA 2K7OA 2EC6B 4CFQA 2K0JA 3EVUA 3M0WA 1MF8B 2AAOA 1DGUA 2NCPA 2ZRSA 1TNPA 3NSLA 4ORCB 1NUBA 2KQYA 1B1GA 2KBMA 3IQOA 1A2XA 1K9PA 2KGRA 1QVIY 1UHHA 1RWYA 1B7TZ 2FOTA 1TNWA 5PALA 3VGOA 5JJGA 4GGFA 4CLNA 3GK1A 3OP0A 1F54A 4WRIA 2BBNA 2BL0B 4F0ZB 2L98A 1B4CA 1DTLA 2QPTA 3PM8A 1JFKA 2JRFA 4DS7A 2FJUB 1OSAA 4JWQA 2F33A 1MHOA
chains in the Genus database with same CATH superfamily
2COLB 3SG4A 1SCMC 1AP4A 4ORAB 2BKHB 3B87A 1SCVA 1SL8A 4MN0A 3PN7C 2LLUA 1ZUZA 3FS7A 1QIVA 1S5GY 3O4YA 3EKHA 1HQVA 1TN4A 3PFVA 3DD4A 1XFXO 3B6XA 2LVIA 2K7CA 1AJ4A 5HYDA 5EL2A 1IG5A 1UUSA 1TNQA 1ZACA 2LUCA 2Q4UA 3EVVA 1V1GA 3BUNB 5FYXA 1CB1A 2G9BA 2MLEC 2ERBA 3L4LA 1TIZA 3DVJA 5J3XA 4PHJA 2JNXA 2LMVA 1K95A 2H2KA 2KNEA 4JQ0D 1OMVA 2K61A 4PCWA 4BY4A 1WRZA 4FQOA 1BODA 3LK0A 1B8CA 1ZMZA 5ER4X 1J7QA 1H4BA 1CDNA 2ZFDA 3O6BA 1NWDA 1EG4A 1JF0A 1G8IA 3AAJA 3L47A 3RLZA 1S6CA 1DC1A 1XFZO 1XFRA 2M29A 2KHNA 1QS7A 5FI2A 1WRLA 2M9GA 3D77A 2B1UA 1YR5A 1S5GZ 5AEQA 1IJ5A 4YGBB 1KWOB 4YGEB 1S1EA 5F6TA 4USLA 2JPTA 1MXLC 2WCLA 1QLSA 3B86A 3IF7A 3I5GB 1BG1A 3KO0A 3DVKA 1KQMB 2WCMA 3SG5A 1TOPA 2SCPA 2LVJA 2PVBA 1V1FA 2KAYA 3CTNA 4GGFC 4GPLB 2BKIB 3VRRA 1Z2CB 2JQ6A 4MZKA 3BQ3A 4YI9A 1X02A 5CSNA 2KBIA 5GQQC 5AFPA 3VRQA 5IBWA 1IQ3A 1PSBA 3S0DA 2M1KB 3LLEA 2KLEA 2HETA 1CMFA 1Y0VH 2I7AA 2P6BB 4GAOA 5HKZA 1YURA 2QEBA 2PMYA 3DZTA 5I8NA 4MRXA 2OS8B 3KF9A 2Y5IA 1R6PA 1IKUA 2LLSA 3D74A 1S6JA 2PASA 3VB1A 1YUUA 2LP3A 3AKBA 1DJWA 3I5FB 5AXIA 3WXAA 1AK8A 1H8BA 2WCEA 3MSEB 4YGAA 1S3PA 2L51A 3SJSA 1HT9A 5DKQA 1NPQA 2WOSA 1UHNA 3D78A 1XA5A 4MVFA 3E3RA 2OPOA 2PRUA 1F71A 1CDMA 1M31A 1AJ5A 1U5IB 2OS8C 2WNDA 2CBLA 2JOJA 1NX1A 2GTEA 1LA3A 3A8RA 3HX4A 2OTGB 2H8VA 3I5HB 2CT9A 3EK4A 1SR6B 2D8NA 1CTRA 1TUJA 1CLMA 1K94A 1VRKA 4XJKB 4DUQA 1CFDA 2L5YA 3B88A 4P2YB 4OR9B 1JSAA 3EKJA 2EHBA 1OOJA 1W9ZA 1Y6WA 1A75A 2KYCA 3D75A 1EH2A 2H61A 1WLZA 2LVVA 1MWNA 5D3OA 2M7LA 4NDBA 1KFUS 1XK4A 2HQWA 4HREE 1K90D 2L4IA 1RJVA 1XO5A 2RGIA 4NQGA 1UHKA 3JTDC 2WCBA 1SKTA 2JULA 3CR5X 2Q91A 3JVTB 1SL7A 4IJ7A 4IL1A 3VRNA 4PALA 1TCOB 1RFJA 4I5JA 2KGBC 1NSHA 2JPOA 2MRDA 2JTZA 5HKWA 1PULA 4INXA 3I5IC 2MLFC 4OKHA 2DOQA 3F45A 2M97A 5B8IB 3UO9A 2QEHA 2MJWB 1CKKA 2PYQA 3CGAA 1KFXL 3R1PA 4C0JA 1MR8A 2BECA 3IVTA 2KAVA 4QJ3B 2QACA 3WNXB 1M39A 2CXJA 1XFVO 4GFTA 2NLNA 2LV7A 2MAZA 2NZ0A 3TZ1A 2LHIA 4A4CA 3S0FA 2CNPA 1QX7A 1F8HA 4YI8A 2BBMA 1UHIA 1C3ZA 2JT0A 4I5LB 3FIAA 2PSRA 3Q8IA 4PT1A 4WQ2A 5CSFA 1M63B 2A4JA 5I2OA 1UWOA 3OHMB 1YTZC 2E30A 4E68A 4MLWA 1OMRA 1TWOA 5DICA 1JUOA 3WHTB 2WORA 4N1FA 5KTYA 2GGZA 1AVSA 1OZOA 3A4UB 1KK8C 2F3YA 1AHRA 2KYFA 1BT6A 2V53A 3NGVA 4MZJA 2ISDA 1B9AA 1ODBA 1RECA 1SMGA 2PALA 3GK2A 3OB1B 1G4YR 4ETOA 1JC2A 3R1OA 3DYEA 1Y1XA 4XYNA 1GJYA 3NHTA 4INWA 3VROA 3HCMA 2LUXA 5AANA 4C0KA 3FE6A 4PHMA 5DKNA 4MSPA 1XFWO 4KYNA 1NP8A 1YVLA 1BF5A 1SR6C 2K2AA 1F4QA 2ZN9A 1DQEA 2HPSA 2WCKA 1DMOA 3OB2B 5HLOA 1BJFA 1G33A 5ER5A 2F8PA 1K93D 1NCZA 2WCJA 4D1EA 2KI6D 3EG5B 1J7RA 3S0GA 2WCHA 1N65A 4MBEA 1SNLA 5TNCA 1Y1UA 3S0EA 4QJ5B 1KK8B 3PLFB 3D0YB 1QJTA 5D69A 1TCFA 4GGNA 2KAXA 1TNXA 3S0BA 1KFUL 4PE1A 4CPVA 3I5FC 3NXAA 5KU1A 3BUMB 3D73A 3FE9A 1JF2A 1ALVA 1YUTA 2LMUA 4U8DA 2KQ6A 2I18A 1YVHA 1J7OA 1TRFA 2EC6C 4CFRA 2G2BA 3D76A 1PSRA 4FQTA 1M45A 1XYDA 2JWWA 2KFFA 4YBHB 1BU3A 3TS5C 3BXKA 4I5KA 4I5NB 3SG3A 1FBVA 5K89A 4GBAA 1DJZA 1NCYA 1OOHA 4N1GA 1OZSA 3AAKA 3CS1A 2IS9A 1OW4A 3UNWA 2JC2A 4N5XA 1EJ3A 2H61C 1QIWA 3KEVA 3BOWB 4OV2A 1TUZA 2CTNA 1PRWA 1LKJA 1CDPA 1QATA 1W7IB 3BFAA 1SY9A 1LVCD 2ZKMX 2KSPA 3QMEA 1CLLA 2GV5A 3PM2A 1IIOA 1DJGA 1QV1A 1WRKA 1NCXA 2LAPA 2ZRTA 5G08A 1BR4B 4PHKA 3RM1A 4AOMA 2EGDA 1CM4A 3JVTC 3CYZA 2LP2A 1LINA 4F7FA 2M7NA 4L9MA 3JTDB 1F4OA 1SL9A 3NSKA 1KCYA 1DEKA 3PJIA 4M2PA 2I2RE 1LS8A 1RK9A 2WC8A 3V2LA 3BFHA 3O2PA 4ICBA 1BOCA 3CDNA 3CLNA 2NCOA 3DXLA 2LC5A 1NYAA 1SYMA 1LA0A 2HQ8A 1QV0A 1FI5A 1CDLA 1K9KA 1CFPA 1UURA 2F2PA 3LL8B 1KQVA 2BNXA 2BCBA 2L4HA 4JD9A 4DCKA 1IJ6A 2OTGC 1DT7B 1JFJA 1GM0A 4QJ4B 2M0RA 1Q80A 1J1EA 1CLBA 1IH0A 1DELA 1YUSA 2K8MB 1K8UA 1ALWA 1ZOTB 3RZSA 3FWBA 1IQ5A 1BLQA 4YGCB 3KPXA 1F70A 4HRGA 1B8RA 3ZNIA 3TUYC 2WC6A 3TUYB 2R2IA 3N7HA 3NSOA 3TDZA 3SIBA 1QXPA 1MXEA 1WDCB 3AKAA 4YGDB 5JOLA 3R72A 4MZLA 2LANA 3QRXA 4R1EA 1B8LA 1YRTB 2FJYA 1A4PA 4HSZA 1JBAA 1K2HA 1KFXS 2VRGA 3PN7B 5DKRA 1FF1A 2JTTA 1DJXA 1DVIA 2Y1NA 3DY9A 3CR4X 1QTXA 4OCIA 1SCMB 1EL4A 1T14A 2KFGA 1J55A 4JKTA 4ZCVA 4AQJA 1BR1B 2FCEA 1R2UA 1SBJA 1M46A 1RROA 1XFUO 3D10A 1TTXA 2O5GA 2F3ZA 4ZCUA 3SIAA 1KSMA 1DGVA 2Y1MA 1A03A 2M1UA 3VRPA 3I5GC 4PHNA 1SK6D 1KQMC 5CSIA 3PSRA 3PATA 2BE6A 2BE4A 4M2QA 2K7DA 3H4SE 4PE7A 1PVBA 1XVJA 3CZTX 4UPGA 1DF0B 2YGUA 3CABA 4DIRA 1SPYA 4AQIA 1WY9A 1S36A 3O78A 1B7TY 1L2OC 4DRWA 2HF5A 5HKYA 2FCDA 2MA2A 3DF0A 5FI6A 1QLKA 1SSEB 2K60A 4MRYA 4P5OE 2BCAA 1P28A 1D1OA 4JPZB 2GGMA 4M2OA 3SG6A 2L0PA 4GUKA 4ORBB 1YX8A 1JWDA 1MUXA 2E6WA 2I94A 4FTGA 1FW4A 4C0LA 1NX3A 4NDCA 4TNCA 3OBVA 1OE9B 1OQPA 4GNKB 1K9UA 4CIDA 1B47A 2L5XB 1C07A 1N0YA 3S0AA 2PQLA 2ZN8A 3CWGA 3TDIA 1ZFSA 2JU0A 5HL1A 3BUXB 1PALA 1L2OB 2LNKA 1PK0D 1QX2A 2KDHA 3NSIA 1KSOA 1IWQA 3EVRA 1UP5A 1S6IA 2NXQA 3BFBA 3DVEA 1U5IA 2SASA 4PE0A 1CM1A 4Q04A 1OOFA 4XJKA 3B7AA 2KI6C 3KHEA 3R1VA 2JXCA 3O4XA 4OVNF 2JXLA 3BYAA 5HLVA 1C3YA 4A4BA 2BL0C 1QWVA 3C1VA 1KK7Z 2LE9B 1MQ1A 1Z4HA 1CFFA 1LXFC 1OOIX 2JNFA 3CZ0A 2LCPA 3D0YA 1SRAA 1XK4C 3SS3A 5I94A 2QEOA 1QX5B 5D7FA 2M3WA 2JT3A 3DF0B 3LK1A 2KI4C 5CPVA 1OMDA 1W7JB 2K7BA 2WCFA 3ICBA 1SW8A 2MHHA 1YRUB 1J1DA 1IRJA 1NX0A 1WDCC 2ZNDA 2AMIA 1GGZA 2MBXA 4BY5A 1RTP1 1BMOA 2LHLA 1CMGA 2KI4B 2LVKA 5CSJA 1NX2A 5AERA 2K2FA 3OX6A 1QASA 3SS5A 5I2LA 3ZWHA 2AUCA 1DJIA 1A29A 1XFYO 3FE8A 5I2QA 1CFCA 3GK4X 3NHIA 4NDDA 4PDZA 1OOGA 1WLMA 1NIWA 1AUIB 3K21A 3LCPC 5KSZA 2CCMA 1KK7Y 2O60A 1PVAA 4YRUA 4MEWA 1F55A 1GGWA 4PE4A 3K1EA 2M8UA 2JZIA 2BCXA 3I5IB 5BPJA 1DJYA 2L2EA 1E8AA 1YX7A 3BUWB 3OX5A 2KLDA 1A75B 4WQ3A 2LLTA 1C7WA 2KPHA 2ZNEA 1KWOC 2F2OA 2QDIA 2BAPA 1EXRA 1IGVA 1QVIZ 2WC5A 1L7ZA 3FWCA 2LMTA 4OZDA 2P71A 3EK8A 1FPWA 1ORGA 1EG3A 3PALA 3BUOB 3BOWA 3CZ1A 1J7PA 3EK7A 1N2DA 1FI6A 3TDUA 1CNPA 1GQMA 3DVMA 3IQQA 1UHJA 1DJHA 2KOTA 1Y1AA 3GOFA 2Y4QA 3SG7A 1C7VA 2M49B 3I5HC 1S26D 2LM5A 3WHUB 1DF0A 2TN4A 3SG2A 3TS5B 3CZ2A 2L50A 2L2CA 3CR2A 2JT8A 4HRHA 1K96A 2KFHA 2K7OA 2EC6B 4CFQA 2K0JA 3EVUA 3M0WA 1MF8B 2AAOA 1DGUA 2NCPA 2ZRSA 1TNPA 3NSLA 4ORCB 1NUBA 2KQYA 1B1GA 2P70A 3SS4A 2KBMA 2QEVA 3IQOA 1A2XA 1K9PA 2KGRA 1QVIY 1UHHA 1RWYA 1B7TZ 2FOTA 1TNWA 5PALA 3VGOA 5JJGA 3OGNA 4GGFA 4CLNA 3GK1A 3OP0A 1F54A 3L4AA 4WRIA 2BBNA 3BJHA 2BL0B 4F0ZB 2L98A 5FI7A 1DTLA 1B4CA 2QPTA 3PM8A 1JFKA 2JRFA 4DS7A 2FJUB 1OSAA 4JWQA 2F33A 1MHOA
chains in the Genus database with same CATH topology
2COLB 3SG4A 1SCMC 1AP4A 4ORAB 2BKHB 1SCVA 1SL8A 4MN0A 3PN7C 2LLUA 1ZUZA 3FS7A 1QIVA 1S5GY 3O4YA 3EKHA 1HQVA 1TN4A 3PFVA 3DD4A 1XFXO 2LVIA 2K7CA 1AJ4A 5HYDA 1IG5A 1UUSA 1TNQA 1ZACA 2LUCA 2Q4UA 3EVVA 1V1GA 3BUNB 5FYXA 1CB1A 2G9BA 2MLEC 1TIZA 3DVJA 5J3XA 4PHJA 2JNXA 2LMVA 1K95A 2H2KA 2KNEA 4JQ0D 1OMVA 2K61A 4PCWA 4BY4A 1WRZA 4FQOA 1BODA 3LK0A 1B8CA 1ZMZA 5ER4X 1J7QA 1H4BA 1CDNA 2ZFDA 3O6BA 1NWDA 1EG4A 1JF0A 1G8IA 3AAJA 3RLZA 1S6CA 1XFZO 2M29A 2KHNA 1QS7A 1WRLA 2M9GA 2B1UA 1YR5A 1S5GZ 5AEQA 1IJ5A 4YGBB 1KWOB 4YGEB 1S1EA 5F6TA 4USLA 2JPTA 1MXLC 3IF7A 1QLSA 1BG1A 3I5GB 3KO0A 3DVKA 1KQMB 3SG5A 1TOPA 2SCPA 2LVJA 2PVBA 1V1FA 2KAYA 3CTNA 4GGFC 4GPLB 2BKIB 3VRRA 2JQ6A 4MZKA 3BQ3A 4YI9A 1X02A 5CSNA 2KBIA 5GQQC 5AFPA 3VRQA 5IBWA 1IQ3A 1PSBA 2M1KB 3LLEA 2HETA 1CMFA 1Y0VH 2I7AA 2P6BB 4GAOA 5HKZA 1YURA 2PMYA 5I8NA 4MRXA 2OS8B 3KF9A 2Y5IA 1R6PA 1IKUA 2LLSA 1S6JA 2PASA 1YUUA 2LP3A 3AKBA 1DJWA 3I5FB 5AXIA 3WXAA 1AK8A 1H8BA 2WCEA 3MSEB 4YGAA 1S3PA 2L51A 3SJSA 1HT9A 5DKQA 1NPQA 2WOSA 1UHNA 4MVFA 1XA5A 3E3RA 2OPOA 2PRUA 1F71A 1CDMA 1M31A 1AJ5A 1U5IB 2OS8C 2WNDA 2CBLA 2JOJA 1NX1A 3A8RA 1LA3A 3HX4A 2OTGB 3I5HB 2CT9A 3EK4A 1SR6B 1CTRA 2D8NA 1CLMA 1K94A 1VRKA 4XJKB 4DUQA 1CFDA 4P2YB 1JSAA 4OR9B 3EKJA 2EHBA 1OOJA 1Y6WA 2KYCA 1A75A 1EH2A 2H61A 1WLZA 2LVVA 1MWNA 2M7LA 4NDBA 1KFUS 1XK4A 2HQWA 4HREE 1K90D 2L4IA 1RJVA 1XO5A 2RGIA 4NQGA 1UHKA 3JTDC 2WCBA 1SKTA 2JULA 3CR5X 2Q91A 3JVTB 1SL7A 3VRNA 4IL1A 4PALA 1TCOB 1RFJA 4I5JA 2KGBC 1NSHA 2MRDA 5HKWA 2JTZA 1PULA 3I5IC 2MLFC 4OKHA 2DOQA 3F45A 2M97A 5B8IB 2MJWB 1CKKA 3CGAA 1KFXL 4C0JA 1MR8A 2BECA 2KAVA 4QJ3B 2QACA 3WNXB 1M39A 2CXJA 1XFVO 4GFTA 2NLNA 2LV7A 2MAZA 2NZ0A 3TZ1A 2LHIA 4A4CA 1F8HA 2CNPA 1QX7A 4YI8A 2BBMA 1UHIA 2JT0A 4I5LB 3FIAA 2PSRA 4WQ2A 5CSFA 1M63B 2A4JA 5I2OA 1UWOA 3OHMB 1YTZC 2E30A 4E68A 4MLWA 1OMRA 1JUOA 3WHTB 2WORA 4N1FA 5KTYA 2GGZA 1AVSA 1OZOA 3A4UB 1KK8C 2F3YA 1AHRA 2KYFA 1BT6A 2V53A 4MZJA 2ISDA 1JC2A 1B9AA 1ODBA 1RECA 1SMGA 2PALA 3GK2A 3OB1B 1G4YR 4ETOA 1Y1XA 4XYNA 1GJYA 3VROA 3HCMA 2LUXA 5AANA 4C0KA 4PHMA 5DKNA 4MSPA 1XFWO 1NP8A 1YVLA 1BF5A 1SR6C 2K2AA 1F4QA 2ZN9A 2HPSA 1DMOA 3OB2B 5HLOA 1BJFA 1G33A 5ER5A 2F8PA 1K93D 1NCZA 4D1EA 2KI6D 1J7RA 1N65A 4MBEA 1SNLA 5TNCA 1Y1UA 4QJ5B 1KK8B 3PLFB 3D0YB 1QJTA 5D69A 1TCFA 4GGNA 2KAXA 1TNXA 1KFUL 4PE1A 4CPVA 3I5FC 3NXAA 5KU1A 3BUMB 1JF2A 1ALVA 1YUTA 2LMUA 4U8DA 2KQ6A 2I18A 1YVHA 1J7OA 1TRFA 2EC6C 4CFRA 2G2BA 1PSRA 1M45A 1XYDA 2JWWA 2KFFA 4YBHB 1BU3A 3TS5C 3BXKA 4I5KA 4I5NB 3SG3A 1FBVA 5K89A 4GBAA 1DJZA 1NCYA 4N1GA 1OZSA 3AAKA 3CS1A 2IS9A 2JC2A 4N5XA 2H61C 1EJ3A 1QIWA 3KEVA 3BOWB 4OV2A 2CTNA 1PRWA 1LKJA 1CDPA 1QATA 1W7IB 1SY9A 1LVCD 2ZKMX 2KSPA 1CLLA 2GV5A 1DJGA 1QV1A 1WRKA 1NCXA 2LAPA 2ZRTA 5G08A 1BR4B 4PHKA 3RM1A 4AOMA 2EGDA 1CM4A 3JVTC 2LP2A 1LINA 2M7NA 4L9MA 3JTDB 1F4OA 1SL9A 3NSKA 1KCYA 4M2PA 2I2RE 1RK9A 2WC8A 4ICBA 3O2PA 1BOCA 3CLNA 2NCOA 2LC5A 1NYAA 1SYMA 1LA0A 2HQ8A 1QV0A 1FI5A 1CDLA 1K9KA 1CFPA 1UURA 2F2PA 3LL8B 1KQVA 2BCBA 2L4HA 4DCKA 1IJ6A 2OTGC 1DT7B 1JFJA 4QJ4B 2M0RA 1Q80A 1J1EA 1CLBA 1IH0A 1YUSA 2K8MB 1K8UA 1ALWA 1ZOTB 3FWBA 1IQ5A 1BLQA 4YGCB 3KPXA 1F70A 4HRGA 1B8RA 3ZNIA 3TUYC 3TUYB 2R2IA 3NSOA 3TDZA 3SIBA 1QXPA 1MXEA 1WDCB 3AKAA 4YGDB 5JOLA 4MZLA 2LANA 3QRXA 4R1EA 1B8LA 1YRTB 1JBAA 1A4PA 4HSZA 1K2HA 1KFXS 2VRGA 3PN7B 5DKRA 1FF1A 2JTTA 1DJXA 1DVIA 2Y1NA 3CR4X 1QTXA 4OCIA 1SCMB 1EL4A 2KFGA 1J55A 4ZCVA 4AQJA 1BR1B 2FCEA 1R2UA 1SBJA 1M46A 1RROA 1XFUO 3D10A 1TTXA 2O5GA 2F3ZA 4ZCUA 3SIAA 1KSMA 1DGVA 2Y1MA 1A03A 2M1UA 3VRPA 3I5GC 4PHNA 1SK6D 1KQMC 5CSIA 3PSRA 3PATA 2BE6A 2BE4A 4M2QA 2K7DA 3H4SE 4PE7A 1PVBA 1XVJA 3CZTX 4UPGA 1DF0B 4DIRA 1SPYA 4AQIA 1WY9A 1S36A 3O78A 1B7TY 1L2OC 4DRWA 2HF5A 5HKYA 2FCDA 2MA2A 3DF0A 1QLKA 4MRYA 4P5OE 2BCAA 1D1OA 4JPZB 2GGMA 4M2OA 3SG6A 2L0PA 4GUKA 4ORBB 1YX8A 1JWDA 1MUXA 2E6WA 2I94A 4FTGA 1FW4A 4C0LA 1NX3A 4NDCA 4TNCA 1OE9B 1OQPA 4GNKB 1K9UA 4CIDA 1B47A 2L5XB 1C07A 1N0YA 2ZN8A 3CWGA 3TDIA 1ZFSA 2JU0A 3BUXB 1PALA 1L2OB 2LNKA 1PK0D 1QX2A 2KDHA 3NSIA 1KSOA 1IWQA 3EVRA 1UP5A 1S6IA 2NXQA 3DVEA 1U5IA 2SASA 4PE0A 1CM1A 4Q04A 4XJKA 2KI6C 3KHEA 2JXCA 4OVNF 2JXLA 3BYAA 5HLVA 4A4BA 2BL0C 3C1VA 1KK7Z 2LE9B 1MQ1A 1CFFA 1LXFC 2JNFA 3D0YA 2LCPA 1SRAA 1XK4C 5D7FA 1QX5B 2M3WA 2JT3A 3DF0B 3LK1A 2KI4C 5CPVA 1OMDA 1W7JB 2K7BA 2WCFA 3ICBA 1SW8A 2MHHA 1YRUB 1J1DA 1IRJA 1NX0A 1WDCC 2ZNDA 2AMIA 1GGZA 2MBXA 4BY5A 1RTP1 1BMOA 2LHLA 1CMGA 2KI4B 2LVKA 5CSJA 1NX2A 5AERA 2K2FA 3OX6A 1QASA 5I2LA 3ZWHA 2AUCA 1DJIA 1A29A 1XFYO 5I2QA 1CFCA 3GK4X 4NDDA 4PDZA 1WLMA 1NIWA 1AUIB 3K21A 3LCPC 5KSZA 2CCMA 1KK7Y 2O60A 1PVAA 4YRUA 4MEWA 1F55A 1GGWA 4PE4A 2M8UA 2JZIA 2BCXA 3I5IB 5BPJA 1DJYA 2L2EA 1E8AA 1YX7A 3BUWB 3OX5A 1A75B 4WQ3A 2LLTA 1C7WA 2ZNEA 1KWOC 2F2OA 1EXRA 1IGVA 1QVIZ 3FWCA 1L7ZA 2LMTA 3EK8A 1FPWA 1EG3A 3PALA 3BUOB 3BOWA 1J7PA 3EK7A 1N2DA 1FI6A 3TDUA 1CNPA 1GQMA 3DVMA 3IQQA 1UHJA 1DJHA 2KOTA 1Y1AA 3GOFA 2Y4QA 3SG7A 1C7VA 2M49B 3I5HC 1S26D 2LM5A 3WHUB 1DF0A 2TN4A 3SG2A 3TS5B 2L50A 3CR2A 2JT8A 4HRHA 1K96A 2KFHA 2K7OA 2EC6B 4CFQA 2K0JA 3EVUA 3M0WA 1MF8B 2AAOA 1DGUA 2NCPA 2ZRSA 1TNPA 3NSLA 4ORCB 1NUBA 2KQYA 1B1GA 2KBMA 3IQOA 1A2XA 1K9PA 2KGRA 1QVIY 1UHHA 1RWYA 1B7TZ 2FOTA 1TNWA 5PALA 3VGOA 5JJGA 4GGFA 4CLNA 3GK1A 3OP0A 1F54A 4WRIA 2BBNA 2BL0B 4F0ZB 2L98A 1B4CA 1DTLA 2QPTA 3PM8A 1JFKA 2JRFA 4DS7A 2FJUB 1OSAA 4JWQA 2F33A 1MHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COL B;  3SG4 A;  1SCM C;  1AP4 A;  4ORA B;  2BKH B;  1SCV A;  1SL8 A;  4MN0 A;  3PN7 C;  2LLU A;  1ZUZ A;  3FS7 A;  1QIV A;  1S5G Y;  3O4Y A;  3EKH A;  1HQV A;  1TN4 A;  3PFV A;  3DD4 A;  1XFX O;  2LVI A;  2K7C A;  1AJ4 A;  5HYD A;  1IG5 A;  1UUS A;  1TNQ A;  1ZAC A;  2LUC A;  2Q4U A;  3EVV A;  1V1G A;  3BUN B;  5FYX A;  1CB1 A;  2G9B A;  2MLE C;  1TIZ A;  3DVJ A;  5J3X A;  4PHJ A;  2JNX A;  2LMV A;  1K95 A;  2H2K A;  2KNE A;  4JQ0 D;  1OMV A;  2K61 A;  4PCW A;  4BY4 A;  1WRZ A;  4FQO A;  1BOD A;  3LK0 A;  1B8C A;  1ZMZ A;  5ER4 X;  1J7Q A;  1H4B A;  1CDN A;  2ZFD A;  3O6B A;  1NWD A;  1EG4 A;  1JF0 A;  1G8I A;  3AAJ A;  3RLZ A;  1S6C A;  1XFZ O;  2M29 A;  2KHN A;  1QS7 A;  1WRL A;  2M9G A;  2B1U A;  1YR5 A;  1S5G Z;  5AEQ A;  1IJ5 A;  4YGB B;  1KWO B;  4YGE B;  1S1E A;  5F6T A;  4USL A;  2JPT A;  1MXL C;  3IF7 A;  1QLS A;  1BG1 A;  3I5G B;  3KO0 A;  3DVK A;  1KQM B;  3SG5 A;  1TOP A;  2SCP A;  2LVJ A;  2PVB A;  1V1F A;  2KAY A;  3CTN A;  4GGF C;  4GPL B;  2BKI B;  3VRR A;  2JQ6 A;  4MZK A;  3BQ3 A;  4YI9 A;  1X02 A;  5CSN A;  2KBI A;  5GQQ C;  5AFP A;  3VRQ A;  5IBW A;  1IQ3 A;  1PSB A;  2M1K B;  3LLE A;  2HET A;  1CMF A;  1Y0V H;  2I7A A;  2P6B B;  4GAO A;  5HKZ A;  1YUR A;  2PMY A;  5I8N A;  4MRX A;  2OS8 B;  3KF9 A;  2Y5I A;  1R6P A;  1IKU A;  2LLS A;  1S6J A;  2PAS A;  1YUU A;  2LP3 A;  3AKB A;  1DJW A;  3I5F B;  5AXI A;  3WXA A;  1AK8 A;  1H8B A;  2WCE A;  3MSE B;  4YGA A;  1S3P A;  2L51 A;  3SJS A;  1HT9 A;  5DKQ A;  1NPQ A;  2WOS A;  1UHN A;  4MVF A;  1XA5 A;  3E3R A;  2OPO A;  2PRU A;  1F71 A;  1CDM A;  1M31 A;  1AJ5 A;  1U5I B;  2OS8 C;  2WND A;  2CBL A;  2JOJ A;  1NX1 A;  3A8R A;  1LA3 A;  3HX4 A;  2OTG B;  3I5H B;  2CT9 A;  3EK4 A;  1SR6 B;  1CTR A;  2D8N A;  1CLM A;  1K94 A;  1VRK A;  4XJK B;  4DUQ A;  1CFD A;  4P2Y B;  1JSA A;  4OR9 B;  3EKJ A;  2EHB A;  1OOJ A;  1Y6W A;  2KYC A;  1A75 A;  1EH2 A;  2H61 A;  1WLZ A;  2LVV A;  1MWN A;  2M7L A;  4NDB A;  1KFU S;  1XK4 A;  2HQW A;  4HRE E;  1K90 D;  2L4I A;  1RJV A;  1XO5 A;  2RGI A;  4NQG A;  1UHK A;  3JTD C;  2WCB A;  1SKT A;  2JUL A;  3CR5 X;  2Q91 A;  3JVT B;  1SL7 A;  3VRN A;  4IL1 A;  4PAL A;  1TCO B;  1RFJ A;  4I5J A;  2KGB C;  1NSH A;  2MRD A;  5HKW A;  2JTZ A;  1PUL A;  3I5I C;  2MLF C;  4OKH A;  2DOQ A;  3F45 A;  2M97 A;  5B8I B;  2MJW B;  1CKK A;  3CGA A;  1KFX L;  4C0J A;  1MR8 A;  2BEC A;  2KAV A;  4QJ3 B;  2QAC A;  3WNX B;  1M39 A;  2CXJ A;  1XFV O;  4GFT A;  2NLN A;  2LV7 A;  2MAZ A;  2NZ0 A;  3TZ1 A;  2LHI A;  4A4C A;  1F8H A;  2CNP A;  1QX7 A;  4YI8 A;  2BBM A;  1UHI A;  2JT0 A;  4I5L B;  3FIA A;  2PSR A;  4WQ2 A;  5CSF A;  1M63 B;  2A4J A;  5I2O A;  1UWO A;  3OHM B;  1YTZ C;  2E30 A;  4E68 A;  4MLW A;  1OMR A;  1JUO A;  3WHT B;  2WOR A;  4N1F A;  5KTY A;  2GGZ A;  1AVS A;  1OZO A;  3A4U B;  1KK8 C;  2F3Y A;  1AHR A;  2KYF A;  1BT6 A;  2V53 A;  4MZJ A;  2ISD A;  1JC2 A;  1B9A A;  1ODB A;  1REC A;  1SMG A;  2PAL A;  3GK2 A;  3OB1 B;  1G4Y R;  4ETO A;  1Y1X A;  4XYN A;  1GJY A;  3VRO A;  3HCM A;  2LUX A;  5AAN A;  4C0K A;  4PHM A;  5DKN A;  4MSP A;  1XFW O;  1NP8 A;  1YVL A;  1BF5 A;  1SR6 C;  2K2A A;  1F4Q A;  2ZN9 A;  2HPS A;  1DMO A;  3OB2 B;  5HLO A;  1BJF A;  1G33 A;  5ER5 A;  2F8P A;  1K93 D;  1NCZ A;  4D1E A;  2KI6 D;  1J7R A;  1N65 A;  4MBE A;  1SNL A;  5TNC A;  1Y1U A;  4QJ5 B;  1KK8 B;  3PLF B;  3D0Y B;  1QJT A;  5D69 A;  1TCF A;  4GGN A;  2KAX A;  1TNX A;  1KFU L;  4PE1 A;  4CPV A;  3I5F C;  3NXA A;  5KU1 A;  3BUM B;  1JF2 A;  1ALV A;  1YUT A;  2LMU A;  4U8D A;  2KQ6 A;  2I18 A;  1YVH A;  1J7O A;  1TRF A;  2EC6 C;  4CFR A;  2G2B A;  1PSR A;  1M45 A;  1XYD A;  2JWW A;  2KFF A;  4YBH B;  1BU3 A;  3TS5 C;  3BXK A;  4I5K A;  4I5N B;  3SG3 A;  1FBV A;  5K89 A;  4GBA A;  1DJZ A;  1NCY A;  4N1G A;  1OZS A;  3AAK A;  3CS1 A;  2IS9 A;  2JC2 A;  4N5X A;  2H61 C;  1EJ3 A;  1QIW A;  3KEV A;  3BOW B;  4OV2 A;  2CTN A;  1PRW A;  1LKJ A;  1CDP A;  1QAT A;  1W7I B;  1SY9 A;  1LVC D;  2ZKM X;  2KSP A;  1CLL A;  2GV5 A;  1DJG A;  1QV1 A;  1WRK A;  1NCX A;  2LAP A;  2ZRT A;  5G08 A;  1BR4 B;  4PHK A;  3RM1 A;  4AOM A;  2EGD A;  1CM4 A;  3JVT C;  2LP2 A;  1LIN A;  2M7N A;  4L9M A;  3JTD B;  1F4O A;  1SL9 A;  3NSK A;  1KCY A;  4M2P A;  2I2R E;  1RK9 A;  2WC8 A;  4ICB A;  3O2P A;  1BOC A;  3CLN A;  2NCO A;  2LC5 A;  1NYA A;  1SYM A;  1LA0 A;  2HQ8 A;  1QV0 A;  1FI5 A;  1CDL A;  1K9K A;  1CFP A;  1UUR A;  2F2P A;  3LL8 B;  1KQV A;  2BCB A;  2L4H A;  4DCK A;  1IJ6 A;  2OTG C;  1DT7 B;  1JFJ A;  4QJ4 B;  2M0R A;  1Q80 A;  1J1E A;  1CLB A;  1IH0 A;  1YUS A;  2K8M B;  1K8U A;  1ALW A;  1ZOT B;  3FWB A;  1IQ5 A;  1BLQ A;  4YGC B;  3KPX A;  1F70 A;  4HRG A;  1B8R A;  3ZNI A;  3TUY C;  3TUY B;  2R2I A;  3NSO A;  3TDZ A;  3SIB A;  1QXP A;  1MXE A;  1WDC B;  3AKA A;  4YGD B;  5JOL A;  4MZL A;  2LAN A;  3QRX A;  4R1E A;  1B8L A;  1YRT B;  1JBA A;  1A4P A;  4HSZ A;  1K2H A;  1KFX S;  2VRG A;  3PN7 B;  5DKR A;  1FF1 A;  2JTT A;  1DJX A;  1DVI A;  2Y1N A;  3CR4 X;  1QTX A;  4OCI A;  1SCM B;  1EL4 A;  2KFG A;  1J55 A;  4ZCV A;  4AQJ A;  1BR1 B;  2FCE A;  1R2U A;  1SBJ A;  1M46 A;  1RRO A;  1XFU O;  3D10 A;  1TTX A;  2O5G A;  2F3Z A;  4ZCU A;  3SIA A;  1KSM A;  1DGV A;  2Y1M A;  1A03 A;  2M1U A;  3VRP A;  3I5G C;  4PHN A;  1SK6 D;  1KQM C;  5CSI A;  3PSR A;  3PAT A;  2BE6 A;  2BE4 A;  4M2Q A;  2K7D A;  3H4S E;  4PE7 A;  1PVB A;  1XVJ A;  3CZT X;  4UPG A;  1DF0 B;  4DIR A;  1SPY A;  4AQI A;  1WY9 A;  1S36 A;  3O78 A;  1B7T Y;  1L2O C;  4DRW A;  2HF5 A;  5HKY A;  2FCD A;  2MA2 A;  3DF0 A;  1QLK A;  4MRY A;  4P5O E;  2BCA A;  1D1O A;  4JPZ B;  2GGM A;  4M2O A;  3SG6 A;  2L0P A;  4GUK A;  4ORB B;  1YX8 A;  1JWD A;  1MUX A;  2E6W A;  2I94 A;  4FTG A;  1FW4 A;  4C0L A;  1NX3 A;  4NDC A;  4TNC A;  1OE9 B;  1OQP A;  4GNK B;  1K9U A;  4CID A;  1B47 A;  2L5X B;  1C07 A;  1N0Y A;  2ZN8 A;  3CWG A;  3TDI A;  1ZFS A;  2JU0 A;  3BUX B;  1PAL A;  1L2O B;  2LNK A;  1PK0 D;  1QX2 A;  2KDH A;  3NSI A;  1KSO A;  1IWQ A;  3EVR A;  1UP5 A;  1S6I A;  2NXQ A;  3DVE A;  1U5I A;  2SAS A;  4PE0 A;  1CM1 A;  4Q04 A;  4XJK A;  2KI6 C;  3KHE A;  2JXC A;  4OVN F;  2JXL A;  3BYA A;  5HLV A;  4A4B A;  2BL0 C;  3C1V A;  1KK7 Z;  2LE9 B;  1MQ1 A;  1CFF A;  1LXF C;  2JNF A;  3D0Y A;  2LCP A;  1SRA A;  1XK4 C;  5D7F A;  1QX5 B;  2M3W A;  2JT3 A;  3DF0 B;  3LK1 A;  2KI4 C;  5CPV A;  1OMD A;  1W7J B;  2K7B A;  2WCF A;  3ICB A;  1SW8 A;  2MHH A;  1YRU B;  1J1D A;  1IRJ A;  1NX0 A;  1WDC C;  2ZND A;  2AMI A;  1GGZ A;  2MBX A;  4BY5 A;  1RTP 1;  1BMO A;  2LHL A;  1CMG A;  2KI4 B;  2LVK A;  5CSJ A;  1NX2 A;  5AER A;  2K2F A;  3OX6 A;  1QAS A;  5I2L A;  3ZWH A;  2AUC A;  1DJI A;  1A29 A;  1XFY O;  5I2Q A;  1CFC A;  3GK4 X;  4NDD A;  4PDZ A;  1WLM A;  1NIW A;  1AUI B;  3K21 A;  3LCP C;  5KSZ A;  2CCM A;  1KK7 Y;  2O60 A;  1PVA A;  4YRU A;  4MEW A;  1F55 A;  1GGW A;  4PE4 A;  2M8U A;  2JZI A;  2BCX A;  3I5I B;  5BPJ A;  1DJY A;  2L2E A;  1E8A A;  1YX7 A;  3BUW B;  3OX5 A;  1A75 B;  4WQ3 A;  2LLT A;  1C7W A;  2ZNE A;  1KWO C;  2F2O A;  1EXR A;  1IGV A;  1QVI Z;  3FWC A;  1L7Z A;  2LMT A;  3EK8 A;  1FPW A;  1EG3 A;  3PAL A;  3BUO B;  3BOW A;  1J7P A;  3EK7 A;  1N2D A;  1FI6 A;  3TDU A;  1CNP A;  1GQM A;  3DVM A;  3IQQ A;  1UHJ A;  1DJH A;  2KOT A;  1Y1A A;  3GOF A;  2Y4Q A;  3SG7 A;  1C7V A;  2M49 B;  3I5H C;  1S26 D;  2LM5 A;  3WHU B;  1DF0 A;  2TN4 A;  3SG2 A;  3TS5 B;  2L50 A;  3CR2 A;  2JT8 A;  4HRH A;  1K96 A;  2KFH A;  2K7O A;  2EC6 B;  4CFQ A;  2K0J A;  3EVU A;  3M0W A;  1MF8 B;  2AAO A;  1DGU A;  2NCP A;  2ZRS A;  1TNP A;  3NSL A;  4ORC B;  1NUB A;  2KQY A;  1B1G A;  2KBM A;  3IQO A;  1A2X A;  1K9P A;  2KGR A;  1QVI Y;  1UHH A;  1RWY A;  1B7T Z;  2FOT A;  1TNW A;  5PAL A;  3VGO A;  5JJG A;  4GGF A;  4CLN A;  3GK1 A;  3OP0 A;  1F54 A;  4WRI A;  2BBN A;  2BL0 B;  4F0Z B;  2L98 A;  1B4C A;  1DTL A;  2QPT A;  3PM8 A;  1JFK A;  2JRF A;  4DS7 A;  2FJU B;  1OSA A;  4JWQ A;  2F33 A;  1MHO A; 
#chains in the Genus database with same CATH topology
 2COL B;  3SG4 A;  1SCM C;  1AP4 A;  4ORA B;  2BKH B;  3B87 A;  1SCV A;  1SL8 A;  4MN0 A;  3PN7 C;  2LLU A;  1ZUZ A;  3FS7 A;  1QIV A;  1S5G Y;  3O4Y A;  3EKH A;  1HQV A;  1TN4 A;  3PFV A;  3DD4 A;  1XFX O;  3B6X A;  2LVI A;  2K7C A;  1AJ4 A;  5HYD A;  5EL2 A;  1IG5 A;  1UUS A;  1TNQ A;  1ZAC A;  2LUC A;  2Q4U A;  3EVV A;  1V1G A;  3BUN B;  5FYX A;  1CB1 A;  2G9B A;  2MLE C;  2ERB A;  3L4L A;  1TIZ A;  3DVJ A;  5J3X A;  4PHJ A;  2JNX A;  2LMV A;  1K95 A;  2H2K A;  2KNE A;  4JQ0 D;  1OMV A;  2K61 A;  4PCW A;  4BY4 A;  1WRZ A;  4FQO A;  1BOD A;  3LK0 A;  1B8C A;  1ZMZ A;  5ER4 X;  1J7Q A;  1H4B A;  1CDN A;  2ZFD A;  3O6B A;  1NWD A;  1EG4 A;  1JF0 A;  1G8I A;  3AAJ A;  3L47 A;  3RLZ A;  1S6C A;  1DC1 A;  1XFZ O;  1XFR A;  2M29 A;  2KHN A;  1QS7 A;  5FI2 A;  1WRL A;  2M9G A;  3D77 A;  2B1U A;  1YR5 A;  1S5G Z;  5AEQ A;  1IJ5 A;  4YGB B;  1KWO B;  4YGE B;  1S1E A;  5F6T A;  4USL A;  2JPT A;  1MXL C;  2WCL A;  1QLS A;  3B86 A;  3IF7 A;  3I5G B;  1BG1 A;  3KO0 A;  3DVK A;  1KQM B;  2WCM A;  3SG5 A;  1TOP A;  2SCP A;  2LVJ A;  2PVB A;  1V1F A;  2KAY A;  3CTN A;  4GGF C;  4GPL B;  2BKI B;  3VRR A;  1Z2C B;  2JQ6 A;  4MZK A;  3BQ3 A;  4YI9 A;  1X02 A;  5CSN A;  2KBI A;  5GQQ C;  5AFP A;  3VRQ A;  5IBW A;  1IQ3 A;  1PSB A;  3S0D A;  2M1K B;  3LLE A;  2KLE A;  2HET A;  1CMF A;  1Y0V H;  2I7A A;  2P6B B;  4GAO A;  5HKZ A;  1YUR A;  2QEB A;  2PMY A;  3DZT A;  5I8N A;  4MRX A;  2OS8 B;  3KF9 A;  2Y5I A;  1R6P A;  1IKU A;  2LLS A;  3D74 A;  1S6J A;  2PAS A;  3VB1 A;  1YUU A;  2LP3 A;  3AKB A;  1DJW A;  3I5F B;  5AXI A;  3WXA A;  1AK8 A;  1H8B A;  2WCE A;  3MSE B;  4YGA A;  1S3P A;  2L51 A;  3SJS A;  1HT9 A;  5DKQ A;  1NPQ A;  2WOS A;  1UHN A;  3D78 A;  1XA5 A;  4MVF A;  3E3R A;  2OPO A;  2PRU A;  1F71 A;  1CDM A;  1M31 A;  1AJ5 A;  1U5I B;  2OS8 C;  2WND A;  2CBL A;  2JOJ A;  1NX1 A;  2GTE A;  1LA3 A;  3A8R A;  3HX4 A;  2OTG B;  2H8V A;  3I5H B;  2CT9 A;  3EK4 A;  1SR6 B;  2D8N A;  1CTR A;  1TUJ A;  1CLM A;  1K94 A;  1VRK A;  4XJK B;  4DUQ A;  1CFD A;  2L5Y A;  3B88 A;  4P2Y B;  4OR9 B;  1JSA A;  3EKJ A;  2EHB A;  1OOJ A;  1W9Z A;  1Y6W A;  1A75 A;  2KYC A;  3D75 A;  1EH2 A;  2H61 A;  1WLZ A;  2LVV A;  1MWN A;  5D3O A;  2M7L A;  4NDB A;  1KFU S;  1XK4 A;  2HQW A;  4HRE E;  1K90 D;  2L4I A;  1RJV A;  1XO5 A;  2RGI A;  4NQG A;  1UHK A;  3JTD C;  2WCB A;  1SKT A;  2JUL A;  3CR5 X;  2Q91 A;  3JVT B;  1SL7 A;  4IJ7 A;  4IL1 A;  3VRN A;  4PAL A;  1TCO B;  1RFJ A;  4I5J A;  2KGB C;  1NSH A;  2JPO A;  2MRD A;  2JTZ A;  5HKW A;  1PUL A;  4INX A;  3I5I C;  2MLF C;  4OKH A;  2DOQ A;  3F45 A;  2M97 A;  5B8I B;  3UO9 A;  2QEH A;  2MJW B;  1CKK A;  2PYQ A;  3CGA A;  1KFX L;  3R1P A;  4C0J A;  1MR8 A;  2BEC A;  3IVT A;  2KAV A;  4QJ3 B;  2QAC A;  3WNX B;  1M39 A;  2CXJ A;  1XFV O;  4GFT A;  2NLN A;  2LV7 A;  2MAZ A;  2NZ0 A;  3TZ1 A;  2LHI A;  4A4C A;  3S0F A;  2CNP A;  1QX7 A;  1F8H A;  4YI8 A;  2BBM A;  1UHI A;  1C3Z A;  2JT0 A;  4I5L B;  3FIA A;  2PSR A;  3Q8I A;  4PT1 A;  4WQ2 A;  5CSF A;  1M63 B;  2A4J A;  5I2O A;  1UWO A;  3OHM B;  1YTZ C;  2E30 A;  4E68 A;  4MLW A;  1OMR A;  1TWO A;  5DIC A;  1JUO A;  3WHT B;  2WOR A;  4N1F A;  5KTY A;  2GGZ A;  1AVS A;  1OZO A;  3A4U B;  1KK8 C;  2F3Y A;  1AHR A;  2KYF A;  1BT6 A;  2V53 A;  3NGV A;  4MZJ A;  2ISD A;  1B9A A;  1ODB A;  1REC A;  1SMG A;  2PAL A;  3GK2 A;  3OB1 B;  1G4Y R;  4ETO A;  1JC2 A;  3R1O A;  3DYE A;  1Y1X A;  4XYN A;  1GJY A;  3NHT A;  4INW A;  3VRO A;  3HCM A;  2LUX A;  5AAN A;  4C0K A;  3FE6 A;  4PHM A;  5DKN A;  4MSP A;  1XFW O;  4KYN A;  1NP8 A;  1YVL A;  1BF5 A;  1SR6 C;  2K2A A;  1F4Q A;  2ZN9 A;  1DQE A;  2HPS A;  2WCK A;  1DMO A;  3OB2 B;  5HLO A;  1BJF A;  1G33 A;  5ER5 A;  2F8P A;  1K93 D;  1NCZ A;  2WCJ A;  4D1E A;  2KI6 D;  3EG5 B;  1J7R A;  3S0G A;  2WCH A;  1N65 A;  4MBE A;  1SNL A;  5TNC A;  1Y1U A;  3S0E A;  4QJ5 B;  1KK8 B;  3PLF B;  3D0Y B;  1QJT A;  5D69 A;  1TCF A;  4GGN A;  2KAX A;  1TNX A;  3S0B A;  1KFU L;  4PE1 A;  4CPV A;  3I5F C;  3NXA A;  5KU1 A;  3BUM B;  3D73 A;  3FE9 A;  1JF2 A;  1ALV A;  1YUT A;  2LMU A;  4U8D A;  2KQ6 A;  2I18 A;  1YVH A;  1J7O A;  1TRF A;  2EC6 C;  4CFR A;  2G2B A;  3D76 A;  1PSR A;  4FQT A;  1M45 A;  1XYD A;  2JWW A;  2KFF A;  4YBH B;  1BU3 A;  3TS5 C;  3BXK A;  4I5K A;  4I5N B;  3SG3 A;  1FBV A;  5K89 A;  4GBA A;  1DJZ A;  1NCY A;  1OOH A;  4N1G A;  1OZS A;  3AAK A;  3CS1 A;  2IS9 A;  1OW4 A;  3UNW A;  2JC2 A;  4N5X A;  1EJ3 A;  2H61 C;  1QIW A;  3KEV A;  3BOW B;  4OV2 A;  1TUZ A;  2CTN A;  1PRW A;  1LKJ A;  1CDP A;  1QAT A;  1W7I B;  3BFA A;  1SY9 A;  1LVC D;  2ZKM X;  2KSP A;  3QME A;  1CLL A;  2GV5 A;  3PM2 A;  1IIO A;  1DJG A;  1QV1 A;  1WRK A;  1NCX A;  2LAP A;  2ZRT A;  5G08 A;  1BR4 B;  4PHK A;  3RM1 A;  4AOM A;  2EGD A;  1CM4 A;  3JVT C;  3CYZ A;  2LP2 A;  1LIN A;  4F7F A;  2M7N A;  4L9M A;  3JTD B;  1F4O A;  1SL9 A;  3NSK A;  1KCY A;  1DEK A;  3PJI A;  4M2P A;  2I2R E;  1LS8 A;  1RK9 A;  2WC8 A;  3V2L A;  3BFH A;  3O2P A;  4ICB A;  1BOC A;  3CDN A;  3CLN A;  2NCO A;  3DXL A;  2LC5 A;  1NYA A;  1SYM A;  1LA0 A;  2HQ8 A;  1QV0 A;  1FI5 A;  1CDL A;  1K9K A;  1CFP A;  1UUR A;  2F2P A;  3LL8 B;  1KQV A;  2BNX A;  2BCB A;  2L4H A;  4JD9 A;  4DCK A;  1IJ6 A;  2OTG C;  1DT7 B;  1JFJ A;  1GM0 A;  4QJ4 B;  2M0R A;  1Q80 A;  1J1E A;  1CLB A;  1IH0 A;  1DEL A;  1YUS A;  2K8M B;  1K8U A;  1ALW A;  1ZOT B;  3RZS A;  3FWB A;  1IQ5 A;  1BLQ A;  4YGC B;  3KPX A;  1F70 A;  4HRG A;  1B8R A;  3ZNI A;  3TUY C;  2WC6 A;  3TUY B;  2R2I A;  3N7H A;  3NSO A;  3TDZ A;  3SIB A;  1QXP A;  1MXE A;  1WDC B;  3AKA A;  4YGD B;  5JOL A;  3R72 A;  4MZL A;  2LAN A;  3QRX A;  4R1E A;  1B8L A;  1YRT B;  2FJY A;  1A4P A;  4HSZ A;  1JBA A;  1K2H A;  1KFX S;  2VRG A;  3PN7 B;  5DKR A;  1FF1 A;  2JTT A;  1DJX A;  1DVI A;  2Y1N A;  3DY9 A;  3CR4 X;  1QTX A;  4OCI A;  1SCM B;  1EL4 A;  1T14 A;  2KFG A;  1J55 A;  4JKT A;  4ZCV A;  4AQJ A;  1BR1 B;  2FCE A;  1R2U A;  1SBJ A;  1M46 A;  1RRO A;  1XFU O;  3D10 A;  1TTX A;  2O5G A;  2F3Z A;  4ZCU A;  3SIA A;  1KSM A;  1DGV A;  2Y1M A;  1A03 A;  2M1U A;  3VRP A;  3I5G C;  4PHN A;  1SK6 D;  1KQM C;  5CSI A;  3PSR A;  3PAT A;  2BE6 A;  2BE4 A;  4M2Q A;  2K7D A;  3H4S E;  4PE7 A;  1PVB A;  1XVJ A;  3CZT X;  4UPG A;  1DF0 B;  2YGU A;  3CAB A;  4DIR A;  1SPY A;  4AQI A;  1WY9 A;  1S36 A;  3O78 A;  1B7T Y;  1L2O C;  4DRW A;  2HF5 A;  5HKY A;  2FCD A;  2MA2 A;  3DF0 A;  5FI6 A;  1QLK A;  1SSE B;  2K60 A;  4MRY A;  4P5O E;  2BCA A;  1P28 A;  1D1O A;  4JPZ B;  2GGM A;  4M2O A;  3SG6 A;  2L0P A;  4GUK A;  4ORB B;  1YX8 A;  1JWD A;  1MUX A;  2E6W A;  2I94 A;  4FTG A;  1FW4 A;  4C0L A;  1NX3 A;  4NDC A;  4TNC A;  3OBV A;  1OE9 B;  1OQP A;  4GNK B;  1K9U A;  4CID A;  1B47 A;  2L5X B;  1C07 A;  1N0Y A;  3S0A A;  2PQL A;  2ZN8 A;  3CWG A;  3TDI A;  1ZFS A;  2JU0 A;  5HL1 A;  3BUX B;  1PAL A;  1L2O B;  2LNK A;  1PK0 D;  1QX2 A;  2KDH A;  3NSI A;  1KSO A;  1IWQ A;  3EVR A;  1UP5 A;  1S6I A;  2NXQ A;  3BFB A;  3DVE A;  1U5I A;  2SAS A;  4PE0 A;  1CM1 A;  4Q04 A;  1OOF A;  4XJK A;  3B7A A;  2KI6 C;  3KHE A;  3R1V A;  2JXC A;  3O4X A;  4OVN F;  2JXL A;  3BYA A;  5HLV A;  1C3Y A;  4A4B A;  2BL0 C;  1QWV A;  3C1V A;  1KK7 Z;  2LE9 B;  1MQ1 A;  1Z4H A;  1CFF A;  1LXF C;  1OOI X;  2JNF A;  3CZ0 A;  2LCP A;  3D0Y A;  1SRA A;  1XK4 C;  3SS3 A;  5I94 A;  2QEO A;  1QX5 B;  5D7F A;  2M3W A;  2JT3 A;  3DF0 B;  3LK1 A;  2KI4 C;  5CPV A;  1OMD A;  1W7J B;  2K7B A;  2WCF A;  3ICB A;  1SW8 A;  2MHH A;  1YRU B;  1J1D A;  1IRJ A;  1NX0 A;  1WDC C;  2ZND A;  2AMI A;  1GGZ A;  2MBX A;  4BY5 A;  1RTP 1;  1BMO A;  2LHL A;  1CMG A;  2KI4 B;  2LVK A;  5CSJ A;  1NX2 A;  5AER A;  2K2F A;  3OX6 A;  1QAS A;  3SS5 A;  5I2L A;  3ZWH A;  2AUC A;  1DJI A;  1A29 A;  1XFY O;  3FE8 A;  5I2Q A;  1CFC A;  3GK4 X;  3NHI A;  4NDD A;  4PDZ A;  1OOG A;  1WLM A;  1NIW A;  1AUI B;  3K21 A;  3LCP C;  5KSZ A;  2CCM A;  1KK7 Y;  2O60 A;  1PVA A;  4YRU A;  4MEW A;  1F55 A;  1GGW A;  4PE4 A;  3K1E A;  2M8U A;  2JZI A;  2BCX A;  3I5I B;  5BPJ A;  1DJY A;  2L2E A;  1E8A A;  1YX7 A;  3BUW B;  3OX5 A;  2KLD A;  1A75 B;  4WQ3 A;  2LLT A;  1C7W A;  2KPH A;  2ZNE A;  1KWO C;  2F2O A;  2QDI A;  2BAP A;  1EXR A;  1IGV A;  1QVI Z;  2WC5 A;  1L7Z A;  3FWC A;  2LMT A;  4OZD A;  2P71 A;  3EK8 A;  1FPW A;  1ORG A;  1EG3 A;  3PAL A;  3BUO B;  3BOW A;  3CZ1 A;  1J7P A;  3EK7 A;  1N2D A;  1FI6 A;  3TDU A;  1CNP A;  1GQM A;  3DVM A;  3IQQ A;  1UHJ A;  1DJH A;  2KOT A;  1Y1A A;  3GOF A;  2Y4Q A;  3SG7 A;  1C7V A;  2M49 B;  3I5H C;  1S26 D;  2LM5 A;  3WHU B;  1DF0 A;  2TN4 A;  3SG2 A;  3TS5 B;  3CZ2 A;  2L50 A;  2L2C A;  3CR2 A;  2JT8 A;  4HRH A;  1K96 A;  2KFH A;  2K7O A;  2EC6 B;  4CFQ A;  2K0J A;  3EVU A;  3M0W A;  1MF8 B;  2AAO A;  1DGU A;  2NCP A;  2ZRS A;  1TNP A;  3NSL A;  4ORC B;  1NUB A;  2KQY A;  1B1G A;  2P70 A;  3SS4 A;  2KBM A;  2QEV A;  3IQO A;  1A2X A;  1K9P A;  2KGR A;  1QVI Y;  1UHH A;  1RWY A;  1B7T Z;  2FOT A;  1TNW A;  5PAL A;  3VGO A;  5JJG A;  3OGN A;  4GGF A;  4CLN A;  3GK1 A;  3OP0 A;  1F54 A;  3L4A A;  4WRI A;  2BBN A;  3BJH A;  2BL0 B;  4F0Z B;  2L98 A;  5FI7 A;  1DTL A;  1B4C A;  2QPT A;  3PM8 A;  1JFK A;  2JRF A;  4DS7 A;  2FJU B;  1OSA A;  4JWQ A;  2F33 A;  1MHO A; 
#chains in the Genus database with same CATH homology
 2COL B;  3SG4 A;  1SCM C;  1AP4 A;  4ORA B;  2BKH B;  1SCV A;  1SL8 A;  4MN0 A;  3PN7 C;  2LLU A;  1ZUZ A;  3FS7 A;  1QIV A;  1S5G Y;  3O4Y A;  3EKH A;  1HQV A;  1TN4 A;  3PFV A;  3DD4 A;  1XFX O;  2LVI A;  2K7C A;  1AJ4 A;  5HYD A;  1IG5 A;  1UUS A;  1TNQ A;  1ZAC A;  2LUC A;  2Q4U A;  3EVV A;  1V1G A;  3BUN B;  5FYX A;  1CB1 A;  2G9B A;  2MLE C;  1TIZ A;  3DVJ A;  5J3X A;  4PHJ A;  2JNX A;  2LMV A;  1K95 A;  2H2K A;  2KNE A;  4JQ0 D;  1OMV A;  2K61 A;  4PCW A;  4BY4 A;  1WRZ A;  4FQO A;  1BOD A;  3LK0 A;  1B8C A;  1ZMZ A;  5ER4 X;  1J7Q A;  1H4B A;  1CDN A;  2ZFD A;  3O6B A;  1NWD A;  1EG4 A;  1JF0 A;  1G8I A;  3AAJ A;  3RLZ A;  1S6C A;  1XFZ O;  2M29 A;  2KHN A;  1QS7 A;  1WRL A;  2M9G A;  2B1U A;  1YR5 A;  1S5G Z;  5AEQ A;  1IJ5 A;  4YGB B;  1KWO B;  4YGE B;  1S1E A;  5F6T A;  4USL A;  2JPT A;  1MXL C;  3IF7 A;  1QLS A;  1BG1 A;  3I5G B;  3KO0 A;  3DVK A;  1KQM B;  3SG5 A;  1TOP A;  2SCP A;  2LVJ A;  2PVB A;  1V1F A;  2KAY A;  3CTN A;  4GGF C;  4GPL B;  2BKI B;  3VRR A;  2JQ6 A;  4MZK A;  3BQ3 A;  4YI9 A;  1X02 A;  5CSN A;  2KBI A;  5GQQ C;  5AFP A;  3VRQ A;  5IBW A;  1IQ3 A;  1PSB A;  2M1K B;  3LLE A;  2HET A;  1CMF A;  1Y0V H;  2I7A A;  2P6B B;  4GAO A;  5HKZ A;  1YUR A;  2PMY A;  5I8N A;  4MRX A;  2OS8 B;  3KF9 A;  2Y5I A;  1R6P A;  1IKU A;  2LLS A;  1S6J A;  2PAS A;  1YUU A;  2LP3 A;  3AKB A;  1DJW A;  3I5F B;  5AXI A;  3WXA A;  1AK8 A;  1H8B A;  2WCE A;  3MSE B;  4YGA A;  1S3P A;  2L51 A;  3SJS A;  1HT9 A;  5DKQ A;  1NPQ A;  2WOS A;  1UHN A;  4MVF A;  1XA5 A;  3E3R A;  2OPO A;  2PRU A;  1F71 A;  1CDM A;  1M31 A;  1AJ5 A;  1U5I B;  2OS8 C;  2WND A;  2CBL A;  2JOJ A;  1NX1 A;  3A8R A;  1LA3 A;  3HX4 A;  2OTG B;  3I5H B;  2CT9 A;  3EK4 A;  1SR6 B;  1CTR A;  2D8N A;  1CLM A;  1K94 A;  1VRK A;  4XJK B;  4DUQ A;  1CFD A;  4P2Y B;  1JSA A;  4OR9 B;  3EKJ A;  2EHB A;  1OOJ A;  1Y6W A;  2KYC A;  1A75 A;  1EH2 A;  2H61 A;  1WLZ A;  2LVV A;  1MWN A;  2M7L A;  4NDB A;  1KFU S;  1XK4 A;  2HQW A;  4HRE E;  1K90 D;  2L4I A;  1RJV A;  1XO5 A;  2RGI A;  4NQG A;  1UHK A;  3JTD C;  2WCB A;  1SKT A;  2JUL A;  3CR5 X;  2Q91 A;  3JVT B;  1SL7 A;  3VRN A;  4IL1 A;  4PAL A;  1TCO B;  1RFJ A;  4I5J A;  2KGB C;  1NSH A;  2MRD A;  5HKW A;  2JTZ A;  1PUL A;  3I5I C;  2MLF C;  4OKH A;  2DOQ A;  3F45 A;  2M97 A;  5B8I B;  2MJW B;  1CKK A;  3CGA A;  1KFX L;  4C0J A;  1MR8 A;  2BEC A;  2KAV A;  4QJ3 B;  2QAC A;  3WNX B;  1M39 A;  2CXJ A;  1XFV O;  4GFT A;  2NLN A;  2LV7 A;  2MAZ A;  2NZ0 A;  3TZ1 A;  2LHI A;  4A4C A;  1F8H A;  2CNP A;  1QX7 A;  4YI8 A;  2BBM A;  1UHI A;  2JT0 A;  4I5L B;  3FIA A;  2PSR A;  4WQ2 A;  5CSF A;  1M63 B;  2A4J A;  5I2O A;  1UWO A;  3OHM B;  1YTZ C;  2E30 A;  4E68 A;  4MLW A;  1OMR A;  1JUO A;  3WHT B;  2WOR A;  4N1F A;  5KTY A;  2GGZ A;  1AVS A;  1OZO A;  3A4U B;  1KK8 C;  2F3Y A;  1AHR A;  2KYF A;  1BT6 A;  2V53 A;  4MZJ A;  2ISD A;  1JC2 A;  1B9A A;  1ODB A;  1REC A;  1SMG A;  2PAL A;  3GK2 A;  3OB1 B;  1G4Y R;  4ETO A;  1Y1X A;  4XYN A;  1GJY A;  3VRO A;  3HCM A;  2LUX A;  5AAN A;  4C0K A;  4PHM A;  5DKN A;  4MSP A;  1XFW O;  1NP8 A;  1YVL A;  1BF5 A;  1SR6 C;  2K2A A;  1F4Q A;  2ZN9 A;  2HPS A;  1DMO A;  3OB2 B;  5HLO A;  1BJF A;  1G33 A;  5ER5 A;  2F8P A;  1K93 D;  1NCZ A;  4D1E A;  2KI6 D;  1J7R A;  1N65 A;  4MBE A;  1SNL A;  5TNC A;  1Y1U A;  4QJ5 B;  1KK8 B;  3PLF B;  3D0Y B;  1QJT A;  5D69 A;  1TCF A;  4GGN A;  2KAX A;  1TNX A;  1KFU L;  4PE1 A;  4CPV A;  3I5F C;  3NXA A;  5KU1 A;  3BUM B;  1JF2 A;  1ALV A;  1YUT A;  2LMU A;  4U8D A;  2KQ6 A;  2I18 A;  1YVH A;  1J7O A;  1TRF A;  2EC6 C;  4CFR A;  2G2B A;  1PSR A;  1M45 A;  1XYD A;  2JWW A;  2KFF A;  4YBH B;  1BU3 A;  3TS5 C;  3BXK A;  4I5K A;  4I5N B;  3SG3 A;  1FBV A;  5K89 A;  4GBA A;  1DJZ A;  1NCY A;  4N1G A;  1OZS A;  3AAK A;  3CS1 A;  2IS9 A;  2JC2 A;  4N5X A;  2H61 C;  1EJ3 A;  1QIW A;  3KEV A;  3BOW B;  4OV2 A;  2CTN A;  1PRW A;  1LKJ A;  1CDP A;  1QAT A;  1W7I B;  1SY9 A;  1LVC D;  2ZKM X;  2KSP A;  1CLL A;  2GV5 A;  1DJG A;  1QV1 A;  1WRK A;  1NCX A;  2LAP A;  2ZRT A;  5G08 A;  1BR4 B;  4PHK A;  3RM1 A;  4AOM A;  2EGD A;  1CM4 A;  3JVT C;  2LP2 A;  1LIN A;  2M7N A;  4L9M A;  3JTD B;  1F4O A;  1SL9 A;  3NSK A;  1KCY A;  4M2P A;  2I2R E;  1RK9 A;  2WC8 A;  4ICB A;  3O2P A;  1BOC A;  3CLN A;  2NCO A;  2LC5 A;  1NYA A;  1SYM A;  1LA0 A;  2HQ8 A;  1QV0 A;  1FI5 A;  1CDL A;  1K9K A;  1CFP A;  1UUR A;  2F2P A;  3LL8 B;  1KQV A;  2BCB A;  2L4H A;  4DCK A;  1IJ6 A;  2OTG C;  1DT7 B;  1JFJ A;  4QJ4 B;  2M0R A;  1Q80 A;  1J1E A;  1CLB A;  1IH0 A;  1YUS A;  2K8M B;  1K8U A;  1ALW A;  1ZOT B;  3FWB A;  1IQ5 A;  1BLQ A;  4YGC B;  3KPX A;  1F70 A;  4HRG A;  1B8R A;  3ZNI A;  3TUY C;  3TUY B;  2R2I A;  3NSO A;  3TDZ A;  3SIB A;  1QXP A;  1MXE A;  1WDC B;  3AKA A;  4YGD B;  5JOL A;  4MZL A;  2LAN A;  3QRX A;  4R1E A;  1B8L A;  1YRT B;  1JBA A;  1A4P A;  4HSZ A;  1K2H A;  1KFX S;  2VRG A;  3PN7 B;  5DKR A;  1FF1 A;  2JTT A;  1DJX A;  1DVI A;  2Y1N A;  3CR4 X;  1QTX A;  4OCI A;  1SCM B;  1EL4 A;  2KFG A;  1J55 A;  4ZCV A;  4AQJ A;  1BR1 B;  2FCE A;  1R2U A;  1SBJ A;  1M46 A;  1RRO A;  1XFU O;  3D10 A;  1TTX A;  2O5G A;  2F3Z A;  4ZCU A;  3SIA A;  1KSM A;  1DGV A;  2Y1M A;  1A03 A;  2M1U A;  3VRP A;  3I5G C;  4PHN A;  1SK6 D;  1KQM C;  5CSI A;  3PSR A;  3PAT A;  2BE6 A;  2BE4 A;  4M2Q A;  2K7D A;  3H4S E;  4PE7 A;  1PVB A;  1XVJ A;  3CZT X;  4UPG A;  1DF0 B;  4DIR A;  1SPY A;  4AQI A;  1WY9 A;  1S36 A;  3O78 A;  1B7T Y;  1L2O C;  4DRW A;  2HF5 A;  5HKY A;  2FCD A;  2MA2 A;  3DF0 A;  1QLK A;  4MRY A;  4P5O E;  2BCA A;  1D1O A;  4JPZ B;  2GGM A;  4M2O A;  3SG6 A;  2L0P A;  4GUK A;  4ORB B;  1YX8 A;  1JWD A;  1MUX A;  2E6W A;  2I94 A;  4FTG A;  1FW4 A;  4C0L A;  1NX3 A;  4NDC A;  4TNC A;  1OE9 B;  1OQP A;  4GNK B;  1K9U A;  4CID A;  1B47 A;  2L5X B;  1C07 A;  1N0Y A;  2ZN8 A;  3CWG A;  3TDI A;  1ZFS A;  2JU0 A;  3BUX B;  1PAL A;  1L2O B;  2LNK A;  1PK0 D;  1QX2 A;  2KDH A;  3NSI A;  1KSO A;  1IWQ A;  3EVR A;  1UP5 A;  1S6I A;  2NXQ A;  3DVE A;  1U5I A;  2SAS A;  4PE0 A;  1CM1 A;  4Q04 A;  4XJK A;  2KI6 C;  3KHE A;  2JXC A;  4OVN F;  2JXL A;  3BYA A;  5HLV A;  4A4B A;  2BL0 C;  3C1V A;  1KK7 Z;  2LE9 B;  1MQ1 A;  1CFF A;  1LXF C;  2JNF A;  3D0Y A;  2LCP A;  1SRA A;  1XK4 C;  5D7F A;  1QX5 B;  2M3W A;  2JT3 A;  3DF0 B;  3LK1 A;  2KI4 C;  5CPV A;  1OMD A;  1W7J B;  2K7B A;  2WCF A;  3ICB A;  1SW8 A;  2MHH A;  1YRU B;  1J1D A;  1IRJ A;  1NX0 A;  1WDC C;  2ZND A;  2AMI A;  1GGZ A;  2MBX A;  4BY5 A;  1RTP 1;  1BMO A;  2LHL A;  1CMG A;  2KI4 B;  2LVK A;  5CSJ A;  1NX2 A;  5AER A;  2K2F A;  3OX6 A;  1QAS A;  5I2L A;  3ZWH A;  2AUC A;  1DJI A;  1A29 A;  1XFY O;  5I2Q A;  1CFC A;  3GK4 X;  4NDD A;  4PDZ A;  1WLM A;  1NIW A;  1AUI B;  3K21 A;  3LCP C;  5KSZ A;  2CCM A;  1KK7 Y;  2O60 A;  1PVA A;  4YRU A;  4MEW A;  1F55 A;  1GGW A;  4PE4 A;  2M8U A;  2JZI A;  2BCX A;  3I5I B;  5BPJ A;  1DJY A;  2L2E A;  1E8A A;  1YX7 A;  3BUW B;  3OX5 A;  1A75 B;  4WQ3 A;  2LLT A;  1C7W A;  2ZNE A;  1KWO C;  2F2O A;  1EXR A;  1IGV A;  1QVI Z;  3FWC A;  1L7Z A;  2LMT A;  3EK8 A;  1FPW A;  1EG3 A;  3PAL A;  3BUO B;  3BOW A;  1J7P A;  3EK7 A;  1N2D A;  1FI6 A;  3TDU A;  1CNP A;  1GQM A;  3DVM A;  3IQQ A;  1UHJ A;  1DJH A;  2KOT A;  1Y1A A;  3GOF A;  2Y4Q A;  3SG7 A;  1C7V A;  2M49 B;  3I5H C;  1S26 D;  2LM5 A;  3WHU B;  1DF0 A;  2TN4 A;  3SG2 A;  3TS5 B;  2L50 A;  3CR2 A;  2JT8 A;  4HRH A;  1K96 A;  2KFH A;  2K7O A;  2EC6 B;  4CFQ A;  2K0J A;  3EVU A;  3M0W A;  1MF8 B;  2AAO A;  1DGU A;  2NCP A;  2ZRS A;  1TNP A;  3NSL A;  4ORC B;  1NUB A;  2KQY A;  1B1G A;  2KBM A;  3IQO A;  1A2X A;  1K9P A;  2KGR A;  1QVI Y;  1UHH A;  1RWY A;  1B7T Z;  2FOT A;  1TNW A;  5PAL A;  3VGO A;  5JJG A;  4GGF A;  4CLN A;  3GK1 A;  3OP0 A;  1F54 A;  4WRI A;  2BBN A;  2BL0 B;  4F0Z B;  2L98 A;  1B4C A;  1DTL A;  2QPT A;  3PM8 A;  1JFK A;  2JRF A;  4DS7 A;  2FJU B;  1OSA A;  4JWQ A;  2F33 A;  1MHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...