1EL4A

Structure of the calcium-regulated photoprotein obelin determined by sulfur sas
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
SSKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords OBELIN
publication title Structure of the Ca2+-regulated photoprotein obelin at 1.7 A resolution determined directly from its sulfur substructure.
pubmed rcsb
source organism Obelia longissima
total genus 74
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1el4A00
1QASA 2CNPA 2TN4A 2OPOA 5IBWA 4PHMA 3CZTX 4D1EA 1NWDA 1NX3A 2JRFA 1EG3A 1LA0A 1PVAA 1SCVA 1OMVA 4YGEB 1CFCA 2H2KA 1Y0VH 4AQIA 5HLVA 2K7OA 1B47A 2P6BB 2COLB 2MBXA 2M0RA 3PN7B 1SBJA 4GNKB 1J7PA 2JXLA 1IWQA 4USLA 3EK4A 1AK8A 4XJKA 4ZCVA 2M1KB 2L4IA 4MEWA 1EL4A 1FBVA 1KWOC 1UHKA 1BODA 2HF5A 3BOWB 5D69A 3TDUA 3VRPA 3WXAA 2F3ZA 1IJ6A 2KI4C 3PALA 1OE9B 1RFJA 5CSNA 1J7OA 1AHRA 1YURA 1LINA 3D10A 1J1DA 1MWNA 3LL8B 2G9BA 2O60A 3O2PA 1WRKA 2Y5IA 1K94A 3A4UB 4GBAA 1QLKA 2OS8C 2E6WA 3BUOB 1UHJA 1DTLA 1KCYA 1MUXA 1DT7B 1B8LA 4OCIA 1S26D 3GK2A 3KF9A 1MQ1A 1UURA 1CTRA 1SMGA 1C7VA 1WRLA 1XK4C 2BE4A 2JXCA 3SG2A 2KFGA 1XFUO 3AKBA 2G2BA 3NSKA 1C07A 5G08A 2KI4B 1TCFA 2GGMA 1K90D 2LP2A 2F3YA 3KPXA 2OS8B 1CKKA 3H4SE 2DOQA 4YGBB 1PVBA 2LLTA 5B8IB 2KGRA 1M46A 4PE7A 1SPYA 2ZRSA 5F6TA 1QXPA 1ZOTB 1Q80A 2LLSA 1XFYO 2PALA 2MLEC 2K2FA 2V53A 1C7WA 1XFVO 2JULA 1A75B 1OZOA 3AAJA 4GGFC 1LKJA 2WCFA 4WQ3A 4I5LB 1WLZA 3DVJA 1YX8A 1TIZA 1QX2A 1ALWA 2F2OA 1DVIA 1G33A 1UHNA 1EG4A 1S36A 2M1UA 4Q04A 4MVFA 1SKTA 1YUSA 1M63B 1PK0D 3CR5X 2ZKMX 2D8NA 5JJGA 2FCEA 3CTNA 3SIAA 1ZACA 2CTNA 1DJZA 4JPZB 1RWYA 3KO0A 1NP8A 2MHHA 3I5HC 2BKIB 2L4HA 2CXJA 1IH0A 2JT0A 1CM1A 3OB1B 2KBMA 1E8AA 1GQMA 1K8UA 1M31A 3BUWB 1B1GA 2NXQA 1SYMA 5HKWA 1V1GA 2JNXA 3SG3A 2WNDA 3ZNIA 2BL0C 1KK7Z 1KQMC 2M7NA 4YI9A 2K61A 1TOPA 1DJGA 5I8NA 3EVRA 1TNXA 2LC5A 4PHNA 2LMUA 4I5KA 2NZ0A 1JF0A 1TTXA 1L2OC 3SG7A 1ALVA 3I5HB 2KQ6A 3DF0A 3SG5A 4A4BA 1CLBA 4PCWA 1WDCC 1XFZO 4MRXA 1B7TZ 1F4QA 5FYXA 1S6CA 4HRHA 2GV5A 3OHMB 2GGZA 4OV2A 1DMOA 1K2HA 2BL0B 2JQ6A 1KQMB 4L9MA 1CLLA 1YUUA 2CCMA 1RECA 3AKAA 4MLWA 2JWWA 4I5JA 5AEQA 2LVJA 2A4JA 3I5IC 4BY4A 1XVJA 1A75A 1QS7A 1A29A 3D0YA 2Y4QA 3F45A 4FTGA 1L2OB 4DIRA 1YRTB 1NCYA 3AAKA 1R2UA 1QV0A 2AAOA 1WDCB 4DUQA 1S5GY 5TNCA 1H8BA 1NUBA 1TN4A 3SG4A 2K8MB 1XYDA 3EK7A 4M2PA 5KSZA 4NDCA 1KSMA 4DRWA 1PSBA 4ZCUA 2KOTA 4C0LA 3SJSA 2L5XB 3DVKA 3I5GC 1N65A 2PVBA 4F0ZB 3VGOA 2M9GA 2BCAA 2KGBC 3NSLA 2H61A 1M45A 2JPTA 3I5IB 3SIBA 3CWGA 4ORAB 4CLNA 5AANA 3BYAA 1DJWA 1LXFC 1QLSA 1K9UA 5I2OA 1N0YA 1KQVA 1EXRA 4YI8A 1SY9A 1IGVA 2M97A 1F54A 2LNKA 5HLOA 3FWBA 1NCZA 2WOSA 4YRUA 1S6IA 1J7QA 5D7FA 1BF5A 1MF8B 1J55A 3C1VA 3I5GB 5KTYA 1TRFA 3CLNA 1WLMA 1K95A 1MXLC 1CNPA 1DF0B 1KK8C 5CSFA 4ORCB 2JC2A 1U5IB 5CPVA 2KSPA 1XFXO 2MAZA 4NQGA 1BR1B 2LUCA 3QRXA 1BG1A 1BT6A 2JOJA 4UPGA 2I18A 2WCEA 2WCBA 1S3PA 1AUIB 1F55A 4HSZA 3RM1A 1UWOA 2AMIA 2BBMA 5K89A 4AOMA 4PDZA 1FPWA 1PALA 4CIDA 1IQ3A 2ZN8A 1YRUB 2LHIA 4ICBA 4NDBA 4PALA 1CLMA 2K0JA 1WRZA 2BBNA 1JFKA 1KK8B 3PLFB 1JUOA 4QJ4B 1BU3A 1BR4B 5DKRA 1CFPA 1FF1A 1AJ5A 2BE6A 1QIVA 2LV7A 2KFFA 1OMRA 3NSOA 2JTZA 1F70A 4GUKA 3OX5A 4MZKA 1F4OA 3VRRA 2L0PA 1F8HA 3BXKA 1EH2A 1FW4A 2I2RE 1YX7A 2KAVA 2L98A 2RGIA 3JVTC 2LMVA 3EK8A 1AJ4A 3BOWA 2B1UA 1MHOA 1UHHA 1OZSA 3IF7A 4ORBB 3FS7A 2KI6D 5DKNA 3DVEA 4XJKB 4CPVA 5I2LA 3O78A 2LCPA 1ODBA 2ZRTA 3PATA 2Y1MA 4YBHB 3GK1A 2KAYA 4P5OE 3MSEB 2BKHB 4MN0A 4C0KA 4C0JA 1NX1A 4YGAA 1CM4A 1SW8A 1BOCA 3CR4X 1A2XA 1L7ZA 1K9PA 1ZUZA 4OVNF 1PSRA 1IQ5A 4TNCA 3VRQA 3IQQA 1SL8A 2MJWB 3JVTB 3HCMA 2LVVA 2FJUB 2HQ8A 1GGWA 2WC8A 2ZNEA 4M2OA 1NPQA 3FWCA 2LANA 4HRGA 3WHUB 2KYFA 2LVIA 3BUXB 4FQOA 2M3WA 1YTZC 1ZMZA 2K7DA 1PULA 1NX0A 1J1EA 2ZFDA 4PE0A 1CB1A 3TUYC 1QX5B 5AXIA 1GJYA 2FOTA 1Y1XA 4PHKA 1QX7A 3HX4A 1BJFA 1KSOA 2CT9A 3KEVA 3PFVA 4I5NB 3TDZA 1MR8A 1KFXS 4M2QA 2K2AA 4OKHA 2JT8A 2LUXA 1KFUS 2ZN9A 3BUNB 3VROA 5I2QA 1S5GZ 1UHIA 2KHNA 1JF2A 1LA3A 1SK6D 1DJIA 1WY9A 1XK4A 3ICBA 1K9KA 3BQ3A 5J3XA 1JWDA 3A8RA 3EKJA 2NCPA 1CMFA 1TNPA 1DGVA 3NXAA 1A4PA 1OMDA 1HQVA 2KYCA 2LMTA 3JTDC 3TS5C 3BUMB 4YGCB 3I5FC 4WRIA 1DJYA 2HPSA 2I7AA 5ER4X 2KQYA 3TUYB 3O6BA 5HYDA 4ETOA 2QACA 3LCPC 1B9AA 4MBEA 1LVCD 1A03A 1W7IB 1JSAA 4E68A 1RK9A 1CDPA 4CFQA 1NSHA 5HKZA 2F2PA 3OP0A 2K7CA 2F8PA 2M49B 1ZFSA 1AVSA 4N1FA 1DJHA 1S6JA 1OSAA 3PSRA 4GGFA 4NDDA 1Y6WA 2HETA 2M8UA 1CDLA 1HT9A 1EJ3A 1B4CA 1CFDA 4CFRA 4N5XA 3JTDB 3TS5B 1G4YR 3I5FB 1OOJA 2LM5A 2KDHA 2IS9A 2KAXA 2LLUA 1SL7A 1UP5A 2JU0A 3NSIA 3TZ1A 2SCPA 4GAOA 1IG5A 2KI6C 2Q4UA 3CS1A 4DS7A 1X02A 2WORA 2Y1NA 1DGUA 3WHTB 4IL1A 3WNXB 1SRAA 2NLNA 2LVKA 2OTGC 2KBIA 4MZLA 1NCXA 1PRWA 2JNFA 2JTTA 2PRUA 2BECA 1YVHA 3EVVA 3CGAA 1CMGA 1TNWA 4QJ3B 4MZJA 1D1OA 5PALA 1N2DA 2LAPA 1BMOA 2LP3A 5ER5A 1MXEA 1QTXA 1F71A 1KWOB 2MRDA 5HKYA 4GFTA 1AP4A 3DF0B 4XYNA 2HQWA 1IJ5A 4DCKA 5DKQA 2PMYA 2Q91A 2CBLA 2LHLA 3CR2A 5KU1A 5GQQC 1SR6C 2OTGB 1UUSA 3LK0A 3OB2B 1RROA 1XA5A 4WQ2A 3RLZA 4JQ0D 3SG6A 1GGZA 1TCOB 1QVIZ 4U8DA 2FCDA 2MLFC 2L50A 2I94A 2NCOA 3K21A 2BCBA 2EHBA 1QATA 1NX2A 1DJXA 2H61C 4YGDB 3D0YB 2QPTA 1QVIY 2L2EA 4GGNA 1XO5A 3GOFA 3LK1A 2ISDA 2KFHA 4QJ5B 5AFPA 2R2IA 2M7LA 1VRKA 3E3RA 1IKUA 1YUTA 1QJTA 2F33A 4PHJA 1SCMC 3KHEA 1SR6B 2K7BA 4BY5A 2JT3A 3DD4A 4GPLB 1JC2A 1G8IA 1H4BA 4MSPA 3M0WA 4HREE 1IRJA 1RTP1 2SASA 3FIAA 3TDIA 4JWQA 2O5GA 1SL9A 1CFFA 1NYAA 1QIWA 1FI6A 5JOLA 2KNEA 4R1EA 1K93D 5CSIA 1Y1UA 1BLQA 2AUCA 1FI5A 3LLEA 2M29A 2ZNDA 2PASA 4N1GA 4P2YB 1M39A 2EC6C 3EKHA 2MA2A 1YR5A 4PE1A 1SCMB 1J7RA 3VRNA 1Y1AA 1DF0A 2L51A 1U5IA 1K96A 4OR9B 2E30A 3DVMA 3PM8A 1W7JB 3EVUA 1NIWA 1YVLA 3ZWHA 1QV1A 2VRGA 3GK4X 4A4CA 5BPJA 1KK7Y 1S1EA 1V1FA 1B8CA 1R6PA 2LE9B 4AQJA 1TNQA 4MRYA 2BCXA 3PN7C 2JZIA 1XFWO 3IQOA 3O4YA 1SNLA 2EGDA 1B8RA 1CDMA 3OX6A 1CDNA 1RJVA 5AERA 5CSJA 2EC6B 1KFXL 2PSRA 1JBAA 1OQPA 4PE4A 1KFUL 1JFJA 1B7TY
chains in the Genus database with same CATH superfamily
1QASA 2CNPA 2TN4A 2OPOA 5IBWA 4PHMA 3CZTX 2WCJA 3NHIA 3FE9A 1NWDA 4D1EA 1NX3A 2JRFA 3R1OA 1EG3A 1LA0A 1PVAA 1SCVA 1OMVA 1TUJA 4INXA 4YGEB 2H2KA 3D74A 1Y0VH 4AQIA 1CFCA 4JKTA 5HLVA 2K7OA 3R72A 1B47A 2P6BB 2COLB 3NHTA 2MBXA 2M0RA 3PN7B 1SBJA 1QWVA 4GNKB 1J7PA 2JXLA 1IWQA 1DEKA 4USLA 3EK4A 1AK8A 4XJKA 4ZCVA 2M1KB 2L4IA 4MEWA 1EL4A 1FBVA 1KWOC 1UHKA 1BODA 2HF5A 3BOWB 5D69A 3TDUA 3VRPA 3WXAA 2F3ZA 1IJ6A 2KI4C 3PALA 1OE9B 1RFJA 5CSNA 1J7OA 1AHRA 1YURA 1LINA 3D10A 1J1DA 1MWNA 3LL8B 2G9BA 2O60A 3D78A 3O2PA 4FQTA 1WRKA 2Y5IA 1K94A 3A4UB 4GBAA 1QLKA 2OS8C 2E6WA 3BUOB 3RZSA 3CZ1A 1UHJA 1DTLA 1KCYA 2WCMA 1XFRA 1MUXA 1DT7B 1B8LA 4OCIA 1S26D 3GK2A 3KF9A 1MQ1A 1UURA 1CTRA 1SMGA 1C7VA 1WRLA 2P71A 1XK4C 2BE4A 2JXCA 3Q8IA 3SG2A 2KFGA 3B86A 1XFUO 3AKBA 2G2BA 3NSKA 1C07A 2WCHA 2KLEA 5G08A 1OOFA 2KI4B 1TCFA 2GGMA 1K90D 2LP2A 2F3YA 3KPXA 2OS8B 1CKKA 3H4SE 2DOQA 4YGBB 1PVBA 2LLTA 5B8IB 3N7HA 2KGRA 1M46A 3L47A 1SPYA 2ZRSA 4PE7A 5F6TA 3V2LA 1ZOTB 1QXPA 1Q80A 2LLSA 1XFYO 2PALA 2MLEC 2K2FA 2QEOA 1C7WA 1XFVO 2JULA 1A75B 1OZOA 3R1VA 3AAJA 4GGFC 3PJIA 1LKJA 2WCFA 3BFAA 4WQ3A 5FI7A 3R1PA 4I5LB 1WLZA 3DVJA 5FI2A 1YX8A 1TIZA 1QX2A 1ALWA 2F2OA 1DVIA 1G33A 1UHNA 1EG4A 1S36A 2M1UA 3EG5B 4Q04A 4MVFA 4IJ7A 1SKTA 1YUSA 1M63B 1PK0D 3CR5X 3L4LA 2ZKMX 2D8NA 5JJGA 2FCEA 3CTNA 3SIAA 1ZACA 2CTNA 3S0EA 1DJZA 4JPZB 5I94A 1RWYA 3KO0A 1SSEB 3NGVA 1NP8A 2MHHA 3I5HC 2BKIB 2L4HA 2CXJA 1IH0A 3PM2A 2JT0A 1CM1A 3DXLA 3OB1B 2KBMA 1E8AA 1GQMA 1K8UA 1M31A 1OW4A 3BUWB 1B1GA 2NXQA 1SYMA 5HKWA 1V1GA 4JD9A 2JNXA 3SG3A 2KPHA 2WNDA 3ZNIA 2BL0C 1KK7Z 1KQMC 2M7NA 4YI9A 2K61A 1TOPA 1DJGA 1T14A 3D76A 5I8NA 3EVRA 1TNXA 2LC5A 4PHNA 2LMUA 4I5KA 2NZ0A 1JF0A 1TTXA 1L2OC 3SG7A 1ALVA 3I5HB 2KQ6A 3DF0A 3SG5A 4A4BA 1CLBA 4PCWA 1WDCC 1XFZO 4MRXA 1B7TZ 1F4QA 3DY9A 5FYXA 1S6CA 4HRHA 3DYEA 2GV5A 3OHMB 2GGZA 4OV2A 1DMOA 1K2HA 2BL0B 2JQ6A 1KQMB 5HL1A 4L9MA 1CLLA 1YUUA 2CCMA 1RECA 3AKAA 4MLWA 2JWWA 4I5JA 3D75A 4F7FA 5AEQA 2LVJA 2A4JA 3I5IC 4BY4A 1XVJA 1A75A 1QS7A 1A29A 3D0YA 2Y4QA 3F45A 4FTGA 1L2OB 4DIRA 2PYQA 1YRTB 1NCYA 3AAKA 1R2UA 1QV0A 3D77A 2AAOA 1WDCB 4DUQA 1S5GY 5TNCA 1H8BA 1NUBA 1TN4A 3SG4A 2K8MB 1XYDA 3EK7A 4M2PA 5EL2A 5KSZA 4NDCA 1KSMA 3B87A 4DRWA 1PSBA 4ZCUA 2KOTA 4C0LA 3SJSA 2L5XB 3S0DA 3DVKA 3I5GC 1N65A 2PVBA 4F0ZB 3VGOA 2M9GA 3IVTA 3O4XA 2BCAA 2KGBC 3CDNA 3NSLA 2H61A 1M45A 2JPTA 3I5IB 3SIBA 3CWGA 4ORAB 4CLNA 5AANA 3BYAA 1DJWA 1LXFC 1QLSA 2K60A 1K9UA 5I2OA 1N0YA 1KQVA 1EXRA 3CYZA 4YI8A 1SY9A 1IGVA 2KLDA 2M97A 1F54A 2LNKA 5HLOA 3FWBA 1NCZA 2WOSA 3S0BA 3SS3A 1S6IA 4YRUA 1J7QA 5D7FA 1BF5A 1MF8B 1J55A 3C1VA 3I5GB 5KTYA 1TRFA 3CLNA 1WLMA 1K95A 1MXLC 1CNPA 1DF0B 1KK8C 1IIOA 5CSFA 4ORCB 5DICA 1W9ZA 1DELA 1U5IB 2JC2A 1XFXO 2KSPA 2MAZA 3QMEA 4NQGA 5CPVA 1BR1B 2LUCA 3QRXA 1BG1A 1BT6A 2JOJA 4UPGA 2I18A 2WCEA 2WCBA 1S3PA 1AUIB 1F55A 4HSZA 2QEBA 1P28A 3VB1A 3RM1A 1UWOA 2AMIA 2BBMA 5K89A 4AOMA 4PDZA 1FPWA 1PALA 4CIDA 1IQ3A 2ZN8A 2YGUA 1YRUB 2LHIA 4ICBA 4NDBA 4PALA 1CLMA 2K0JA 1WRZA 2BBNA 1JFKA 1KK8B 3PLFB 1JUOA 4QJ4B 1OOHA 1BU3A 1BR4B 5DKRA 1CFPA 1FF1A 1AJ5A 2BE6A 1QIVA 2LV7A 2KFFA 1OMRA 3NSOA 2JTZA 1F70A 4GUKA 3OX5A 4MZKA 1F4OA 3VRRA 2L0PA 1Z4HA 2ERBA 1F8HA 3BXKA 1EH2A 1FW4A 3OBVA 3CZ2A 2I2RE 1YX7A 2KAVA 2L98A 2RGIA 3JVTC 1DC1A 2LMVA 3EK8A 1AJ4A 3BOWA 2B1UA 1MHOA 1UHHA 1OZSA 3IF7A 4ORBB 3FS7A 2KI6D 5DKNA 3DVEA 4XJKB 4CPVA 5I2LA 3BFHA 3O78A 2LCPA 3FE6A 1ODBA 2ZRTA 3PATA 2Y1MA 4YBHB 3GK1A 1DQEA 2KAYA 3MSEB 2BKHB 4P5OE 4MN0A 4C0KA 4C0JA 1NX1A 4YGAA 1CM4A 1SW8A 1BOCA 3CR4X 1A2XA 3L4AA 1L7ZA 1K9PA 1ZUZA 4OVNF 1PSRA 1IQ5A 4TNCA 3VRQA 3IQQA 2QEVA 1SL8A 2JPOA 2MJWB 3JVTB 3HCMA 2LVVA 2FJUB 2QDIA 2HQ8A 1GGWA 2WC8A 2ZNEA 4M2OA 1NPQA 3FWCA 2LANA 4HRGA 3S0GA 2KYFA 2LVIA 3WHUB 3BUXB 4FQOA 2M3WA 1YTZC 1ZMZA 2K7DA 1PULA 1NX0A 1J1EA 2ZFDA 4PE0A 1CB1A 3TUYC 1QX5B 5AXIA 2QEHA 1GJYA 2FOTA 1Y1XA 4PHKA 1QX7A 2BAPA 1BJFA 1KSOA 2CT9A 3HX4A 3KEVA 3PFVA 4I5NB 3TDZA 1MR8A 1KFXS 4M2QA 2K2AA 4OKHA 2JT8A 2H8VA 2LUXA 1KFUS 2ZN9A 3BUNB 3VROA 5I2QA 1S5GZ 1UHIA 2KHNA 1JF2A 3B7AA 1LA3A 1SK6D 1DJIA 1C3YA 1WY9A 1XK4A 3ICBA 1K9KA 3BQ3A 5J3XA 1JWDA 2L2CA 3A8RA 3EKJA 2NCPA 1CMFA 1TNPA 4KYNA 1DGVA 3NXAA 1A4PA 1OMDA 1HQVA 2KYCA 2LMTA 3JTDC 2PQLA 3BUMB 4YGCB 3I5FC 3TS5C 4WRIA 1DJYA 2HPSA 2I7AA 5ER4X 2KQYA 3TUYB 3O6BA 5HYDA 4ETOA 2QACA 3LCPC 1B9AA 4MBEA 1LVCD 1A03A 1W7IB 1JSAA 4E68A 1RK9A 2WCKA 1CDPA 4CFQA 2P70A 1NSHA 5HKZA 1LS8A 2F2PA 3OP0A 2K7CA 2F8PA 2M49B 1ZFSA 1AVSA 4N1FA 5FI6A 1DJHA 1S6JA 1OSAA 3PSRA 4GGFA 4NDDA 1Y6WA 2HETA 2M8UA 1CDLA 1HT9A 1EJ3A 1B4CA 3OGNA 1CFDA 2V53A 4CFRA 3D73A 4N5XA 3JTDB 3TS5B 1G4YR 3I5FB 2FJYA 1OOJA 2LM5A 2KDHA 2IS9A 2KAXA 2LLUA 1SL7A 1UP5A 2JU0A 3NSIA 3TZ1A 2SCPA 4GAOA 1IG5A 2KI6C 2Q4UA 3CS1A 1OOIX 4DS7A 1X02A 2WORA 2Y1NA 1DGUA 3WHTB 4IL1A 3WNXB 1SRAA 2NLNA 2LVKA 2OTGC 3BJHA 2KBIA 4MZLA 1Z2CB 1NCXA 1PRWA 2JNFA 2JTTA 2PRUA 2BECA 1YVHA 3EVVA 3CGAA 1CMGA 1TNWA 4QJ3B 4MZJA 1D1OA 2GTEA 1TUZA 5PALA 1N2DA 2LAPA 1BMOA 2LP3A 5ER5A 1MXEA 1QTXA 1F71A 1KWOB 2MRDA 5HKYA 4GFTA 1AP4A 3DF0B 4XYNA 2HQWA 1IJ5A 4DCKA 5DKQA 2PMYA 2Q91A 2CBLA 2LHLA 3CR2A 5KU1A 5GQQC 1SR6C 2OTGB 3B6XA 1UUSA 3LK0A 3OB2B 1RROA 1XA5A 4WQ2A 3RLZA 2WC6A 4JQ0D 3SG6A 1GGZA 1TCOB 1QVIZ 4U8DA 2FCDA 2MLFC 2L50A 2I94A 2NCOA 3K21A 2BCBA 2EHBA 3K1EA 1QATA 1NX2A 1DJXA 2H61C 4YGDB 3D0YB 2QPTA 1QVIY 2L2EA 4GGNA 1XO5A 3GOFA 3LK1A 2ISDA 2KFHA 4QJ5B 5AFPA 2R2IA 1GM0A 1TWOA 2M7LA 1VRKA 3S0AA 3E3RA 1IKUA 1YUTA 1QJTA 2F33A 4PHJA 1SCMC 3KHEA 1SR6B 2K7BA 4BY5A 2JT3A 2BNXA 3DD4A 4GPLB 1G8IA 1JC2A 1H4BA 3CZ0A 4MSPA 3M0WA 4HREE 1IRJA 1RTP1 2SASA 3FIAA 4INWA 3UO9A 4PT1A 4OZDA 3TDIA 4JWQA 2O5GA 1SL9A 3DZTA 2WC5A 1CFFA 1NYAA 1QIWA 3SS4A 5JOLA 3UNWA 1FI6A 2KNEA 4R1EA 1ORGA 1K93D 5CSIA 1Y1UA 1BLQA 3BFBA 2AUCA 5D3OA 1FI5A 3LLEA 2M29A 2ZNDA 2PASA 4N1GA 4P2YB 1C3ZA 1M39A 2EC6C 2MA2A 3EKHA 1YR5A 4PE1A 3S0FA 1SCMB 1J7RA 3SS5A 3VRNA 1Y1AA 1DF0A 2L51A 1U5IA 1K96A 4OR9B 2E30A 3DVMA 3PM8A 1W7JB 3EVUA 1NIWA 1YVLA 3ZWHA 1QV1A 2VRGA 3GK4X 4A4CA 5BPJA 1KK7Y 1S1EA 1V1FA 1B8CA 1R6PA 2LE9B 4AQJA 1OOGA 1TNQA 4MRYA 3FE8A 2BCXA 3PN7C 2JZIA 1XFWO 3IQOA 2L5YA 1SNLA 2EGDA 3O4YA 1B8RA 1CDMA 3OX6A 1CDNA 1RJVA 5AERA 5CSJA 2EC6B 1KFXL 2PSRA 1JBAA 1OQPA 4PE4A 3CABA 2WCLA 3B88A 1KFUL 1JFJA 1B7TY
chains in the Genus database with same CATH topology
1QASA 2CNPA 2TN4A 2OPOA 5IBWA 4PHMA 3CZTX 4D1EA 1NWDA 1NX3A 2JRFA 1EG3A 1LA0A 1PVAA 1SCVA 1OMVA 4YGEB 1CFCA 2H2KA 1Y0VH 4AQIA 5HLVA 2K7OA 1B47A 2P6BB 2COLB 2MBXA 2M0RA 3PN7B 1SBJA 4GNKB 1J7PA 2JXLA 1IWQA 4USLA 3EK4A 1AK8A 4XJKA 4ZCVA 2M1KB 2L4IA 4MEWA 1EL4A 1FBVA 1KWOC 1UHKA 1BODA 2HF5A 3BOWB 5D69A 3TDUA 3VRPA 3WXAA 2F3ZA 1IJ6A 2KI4C 3PALA 1OE9B 1RFJA 5CSNA 1J7OA 1AHRA 1YURA 1LINA 3D10A 1J1DA 1MWNA 3LL8B 2G9BA 2O60A 3O2PA 1WRKA 2Y5IA 1K94A 3A4UB 4GBAA 1QLKA 2OS8C 2E6WA 3BUOB 1UHJA 1DTLA 1KCYA 1MUXA 1DT7B 1B8LA 4OCIA 1S26D 3GK2A 3KF9A 1MQ1A 1UURA 1CTRA 1SMGA 1C7VA 1WRLA 1XK4C 2BE4A 2JXCA 3SG2A 2KFGA 1XFUO 3AKBA 2G2BA 3NSKA 1C07A 5G08A 2KI4B 1TCFA 2GGMA 1K90D 2LP2A 2F3YA 3KPXA 2OS8B 1CKKA 3H4SE 2DOQA 4YGBB 1PVBA 2LLTA 5B8IB 2KGRA 1M46A 4PE7A 1SPYA 2ZRSA 5F6TA 1QXPA 1ZOTB 1Q80A 2LLSA 1XFYO 2PALA 2MLEC 2K2FA 2V53A 1C7WA 1XFVO 2JULA 1A75B 1OZOA 3AAJA 4GGFC 1LKJA 2WCFA 4WQ3A 4I5LB 1WLZA 3DVJA 1YX8A 1TIZA 1QX2A 1ALWA 2F2OA 1DVIA 1G33A 1UHNA 1EG4A 1S36A 2M1UA 4Q04A 4MVFA 1SKTA 1YUSA 1M63B 1PK0D 3CR5X 2ZKMX 2D8NA 5JJGA 2FCEA 3CTNA 3SIAA 1ZACA 2CTNA 1DJZA 4JPZB 1RWYA 3KO0A 1NP8A 2MHHA 3I5HC 2BKIB 2L4HA 2CXJA 1IH0A 2JT0A 1CM1A 3OB1B 2KBMA 1E8AA 1GQMA 1K8UA 1M31A 3BUWB 1B1GA 2NXQA 1SYMA 5HKWA 1V1GA 2JNXA 3SG3A 2WNDA 3ZNIA 2BL0C 1KK7Z 1KQMC 2M7NA 4YI9A 2K61A 1TOPA 1DJGA 5I8NA 3EVRA 1TNXA 2LC5A 4PHNA 2LMUA 4I5KA 2NZ0A 1JF0A 1TTXA 1L2OC 3SG7A 1ALVA 3I5HB 2KQ6A 3DF0A 3SG5A 4A4BA 1CLBA 4PCWA 1WDCC 1XFZO 4MRXA 1B7TZ 1F4QA 5FYXA 1S6CA 4HRHA 2GV5A 3OHMB 2GGZA 4OV2A 1DMOA 1K2HA 2BL0B 2JQ6A 1KQMB 4L9MA 1CLLA 1YUUA 2CCMA 1RECA 3AKAA 4MLWA 2JWWA 4I5JA 5AEQA 2LVJA 2A4JA 3I5IC 4BY4A 1XVJA 1A75A 1QS7A 1A29A 3D0YA 2Y4QA 3F45A 4FTGA 1L2OB 4DIRA 1YRTB 1NCYA 3AAKA 1R2UA 1QV0A 2AAOA 1WDCB 4DUQA 1S5GY 5TNCA 1H8BA 1NUBA 1TN4A 3SG4A 2K8MB 1XYDA 3EK7A 4M2PA 5KSZA 4NDCA 1KSMA 4DRWA 1PSBA 4ZCUA 2KOTA 4C0LA 3SJSA 2L5XB 3DVKA 3I5GC 1N65A 2PVBA 4F0ZB 3VGOA 2M9GA 2BCAA 2KGBC 3NSLA 2H61A 1M45A 2JPTA 3I5IB 3SIBA 3CWGA 4ORAB 4CLNA 5AANA 3BYAA 1DJWA 1LXFC 1QLSA 1K9UA 5I2OA 1N0YA 1KQVA 1EXRA 4YI8A 1SY9A 1IGVA 2M97A 1F54A 2LNKA 5HLOA 3FWBA 1NCZA 2WOSA 4YRUA 1S6IA 1J7QA 5D7FA 1BF5A 1MF8B 1J55A 3C1VA 3I5GB 5KTYA 1TRFA 3CLNA 1WLMA 1K95A 1MXLC 1CNPA 1DF0B 1KK8C 5CSFA 4ORCB 2JC2A 1U5IB 5CPVA 2KSPA 1XFXO 2MAZA 4NQGA 1BR1B 2LUCA 3QRXA 1BG1A 1BT6A 2JOJA 4UPGA 2I18A 2WCEA 2WCBA 1S3PA 1AUIB 1F55A 4HSZA 3RM1A 1UWOA 2AMIA 2BBMA 5K89A 4AOMA 4PDZA 1FPWA 1PALA 4CIDA 1IQ3A 2ZN8A 1YRUB 2LHIA 4ICBA 4NDBA 4PALA 1CLMA 2K0JA 1WRZA 2BBNA 1JFKA 1KK8B 3PLFB 1JUOA 4QJ4B 1BU3A 1BR4B 5DKRA 1CFPA 1FF1A 1AJ5A 2BE6A 1QIVA 2LV7A 2KFFA 1OMRA 3NSOA 2JTZA 1F70A 4GUKA 3OX5A 4MZKA 1F4OA 3VRRA 2L0PA 1F8HA 3BXKA 1EH2A 1FW4A 2I2RE 1YX7A 2KAVA 2L98A 2RGIA 3JVTC 2LMVA 3EK8A 1AJ4A 3BOWA 2B1UA 1MHOA 1UHHA 1OZSA 3IF7A 4ORBB 3FS7A 2KI6D 5DKNA 3DVEA 4XJKB 4CPVA 5I2LA 3O78A 2LCPA 1ODBA 2ZRTA 3PATA 2Y1MA 4YBHB 3GK1A 2KAYA 4P5OE 3MSEB 2BKHB 4MN0A 4C0KA 4C0JA 1NX1A 4YGAA 1CM4A 1SW8A 1BOCA 3CR4X 1A2XA 1L7ZA 1K9PA 1ZUZA 4OVNF 1PSRA 1IQ5A 4TNCA 3VRQA 3IQQA 1SL8A 2MJWB 3JVTB 3HCMA 2LVVA 2FJUB 2HQ8A 1GGWA 2WC8A 2ZNEA 4M2OA 1NPQA 3FWCA 2LANA 4HRGA 3WHUB 2KYFA 2LVIA 3BUXB 4FQOA 2M3WA 1YTZC 1ZMZA 2K7DA 1PULA 1NX0A 1J1EA 2ZFDA 4PE0A 1CB1A 3TUYC 1QX5B 5AXIA 1GJYA 2FOTA 1Y1XA 4PHKA 1QX7A 3HX4A 1BJFA 1KSOA 2CT9A 3KEVA 3PFVA 4I5NB 3TDZA 1MR8A 1KFXS 4M2QA 2K2AA 4OKHA 2JT8A 2LUXA 1KFUS 2ZN9A 3BUNB 3VROA 5I2QA 1S5GZ 1UHIA 2KHNA 1JF2A 1LA3A 1SK6D 1DJIA 1WY9A 1XK4A 3ICBA 1K9KA 3BQ3A 5J3XA 1JWDA 3A8RA 3EKJA 2NCPA 1CMFA 1TNPA 1DGVA 3NXAA 1A4PA 1OMDA 1HQVA 2KYCA 2LMTA 3JTDC 3TS5C 3BUMB 4YGCB 3I5FC 4WRIA 1DJYA 2HPSA 2I7AA 5ER4X 2KQYA 3TUYB 3O6BA 5HYDA 4ETOA 2QACA 3LCPC 1B9AA 4MBEA 1LVCD 1A03A 1W7IB 1JSAA 4E68A 1RK9A 1CDPA 4CFQA 1NSHA 5HKZA 2F2PA 3OP0A 2K7CA 2F8PA 2M49B 1ZFSA 1AVSA 4N1FA 1DJHA 1S6JA 1OSAA 3PSRA 4GGFA 4NDDA 1Y6WA 2HETA 2M8UA 1CDLA 1HT9A 1EJ3A 1B4CA 1CFDA 4CFRA 4N5XA 3JTDB 3TS5B 1G4YR 3I5FB 1OOJA 2LM5A 2KDHA 2IS9A 2KAXA 2LLUA 1SL7A 1UP5A 2JU0A 3NSIA 3TZ1A 2SCPA 4GAOA 1IG5A 2KI6C 2Q4UA 3CS1A 4DS7A 1X02A 2WORA 2Y1NA 1DGUA 3WHTB 4IL1A 3WNXB 1SRAA 2NLNA 2LVKA 2OTGC 2KBIA 4MZLA 1NCXA 1PRWA 2JNFA 2JTTA 2PRUA 2BECA 1YVHA 3EVVA 3CGAA 1CMGA 1TNWA 4QJ3B 4MZJA 1D1OA 5PALA 1N2DA 2LAPA 1BMOA 2LP3A 5ER5A 1MXEA 1QTXA 1F71A 1KWOB 2MRDA 5HKYA 4GFTA 1AP4A 3DF0B 4XYNA 2HQWA 1IJ5A 4DCKA 5DKQA 2PMYA 2Q91A 2CBLA 2LHLA 3CR2A 5KU1A 5GQQC 1SR6C 2OTGB 1UUSA 3LK0A 3OB2B 1RROA 1XA5A 4WQ2A 3RLZA 4JQ0D 3SG6A 1GGZA 1TCOB 1QVIZ 4U8DA 2FCDA 2MLFC 2L50A 2I94A 2NCOA 3K21A 2BCBA 2EHBA 1QATA 1NX2A 1DJXA 2H61C 4YGDB 3D0YB 2QPTA 1QVIY 2L2EA 4GGNA 1XO5A 3GOFA 3LK1A 2ISDA 2KFHA 4QJ5B 5AFPA 2R2IA 2M7LA 1VRKA 3E3RA 1IKUA 1YUTA 1QJTA 2F33A 4PHJA 1SCMC 3KHEA 1SR6B 2K7BA 4BY5A 2JT3A 3DD4A 4GPLB 1JC2A 1G8IA 1H4BA 4MSPA 3M0WA 4HREE 1IRJA 1RTP1 2SASA 3FIAA 3TDIA 4JWQA 2O5GA 1SL9A 1CFFA 1NYAA 1QIWA 1FI6A 5JOLA 2KNEA 4R1EA 1K93D 5CSIA 1Y1UA 1BLQA 2AUCA 1FI5A 3LLEA 2M29A 2ZNDA 2PASA 4N1GA 4P2YB 1M39A 2EC6C 3EKHA 2MA2A 1YR5A 4PE1A 1SCMB 1J7RA 3VRNA 1Y1AA 1DF0A 2L51A 1U5IA 1K96A 4OR9B 2E30A 3DVMA 3PM8A 1W7JB 3EVUA 1NIWA 1YVLA 3ZWHA 1QV1A 2VRGA 3GK4X 4A4CA 5BPJA 1KK7Y 1S1EA 1V1FA 1B8CA 1R6PA 2LE9B 4AQJA 1TNQA 4MRYA 2BCXA 3PN7C 2JZIA 1XFWO 3IQOA 3O4YA 1SNLA 2EGDA 1B8RA 1CDMA 3OX6A 1CDNA 1RJVA 5AERA 5CSJA 2EC6B 1KFXL 2PSRA 1JBAA 1OQPA 4PE4A 1KFUL 1JFJA 1B7TY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAS A;  2CNP A;  2TN4 A;  2OPO A;  5IBW A;  4PHM A;  3CZT X;  4D1E A;  1NWD A;  1NX3 A;  2JRF A;  1EG3 A;  1LA0 A;  1PVA A;  1SCV A;  1OMV A;  4YGE B;  1CFC A;  2H2K A;  1Y0V H;  4AQI A;  5HLV A;  2K7O A;  1B47 A;  2P6B B;  2COL B;  2MBX A;  2M0R A;  3PN7 B;  1SBJ A;  4GNK B;  1J7P A;  2JXL A;  1IWQ A;  4USL A;  3EK4 A;  1AK8 A;  4XJK A;  4ZCV A;  2M1K B;  2L4I A;  4MEW A;  1EL4 A;  1FBV A;  1KWO C;  1UHK A;  1BOD A;  2HF5 A;  3BOW B;  5D69 A;  3TDU A;  3VRP A;  3WXA A;  2F3Z A;  1IJ6 A;  2KI4 C;  3PAL A;  1OE9 B;  1RFJ A;  5CSN A;  1J7O A;  1AHR A;  1YUR A;  1LIN A;  3D10 A;  1J1D A;  1MWN A;  3LL8 B;  2G9B A;  2O60 A;  3O2P A;  1WRK A;  2Y5I A;  1K94 A;  3A4U B;  4GBA A;  1QLK A;  2OS8 C;  2E6W A;  3BUO B;  1UHJ A;  1DTL A;  1KCY A;  1MUX A;  1DT7 B;  1B8L A;  4OCI A;  1S26 D;  3GK2 A;  3KF9 A;  1MQ1 A;  1UUR A;  1CTR A;  1SMG A;  1C7V A;  1WRL A;  1XK4 C;  2BE4 A;  2JXC A;  3SG2 A;  2KFG A;  1XFU O;  3AKB A;  2G2B A;  3NSK A;  1C07 A;  5G08 A;  2KI4 B;  1TCF A;  2GGM A;  1K90 D;  2LP2 A;  2F3Y A;  3KPX A;  2OS8 B;  1CKK A;  3H4S E;  2DOQ A;  4YGB B;  1PVB A;  2LLT A;  5B8I B;  2KGR A;  1M46 A;  4PE7 A;  1SPY A;  2ZRS A;  5F6T A;  1QXP A;  1ZOT B;  1Q80 A;  2LLS A;  1XFY O;  2PAL A;  2MLE C;  2K2F A;  2V53 A;  1C7W A;  1XFV O;  2JUL A;  1A75 B;  1OZO A;  3AAJ A;  4GGF C;  1LKJ A;  2WCF A;  4WQ3 A;  4I5L B;  1WLZ A;  3DVJ A;  1YX8 A;  1TIZ A;  1QX2 A;  1ALW A;  2F2O A;  1DVI A;  1G33 A;  1UHN A;  1EG4 A;  1S36 A;  2M1U A;  4Q04 A;  4MVF A;  1SKT A;  1YUS A;  1M63 B;  1PK0 D;  3CR5 X;  2ZKM X;  2D8N A;  5JJG A;  2FCE A;  3CTN A;  3SIA A;  1ZAC A;  2CTN A;  1DJZ A;  4JPZ B;  1RWY A;  3KO0 A;  1NP8 A;  2MHH A;  3I5H C;  2BKI B;  2L4H A;  2CXJ A;  1IH0 A;  2JT0 A;  1CM1 A;  3OB1 B;  2KBM A;  1E8A A;  1GQM A;  1K8U A;  1M31 A;  3BUW B;  1B1G A;  2NXQ A;  1SYM A;  5HKW A;  1V1G A;  2JNX A;  3SG3 A;  2WND A;  3ZNI A;  2BL0 C;  1KK7 Z;  1KQM C;  2M7N A;  4YI9 A;  2K61 A;  1TOP A;  1DJG A;  5I8N A;  3EVR A;  1TNX A;  2LC5 A;  4PHN A;  2LMU A;  4I5K A;  2NZ0 A;  1JF0 A;  1TTX A;  1L2O C;  3SG7 A;  1ALV A;  3I5H B;  2KQ6 A;  3DF0 A;  3SG5 A;  4A4B A;  1CLB A;  4PCW A;  1WDC C;  1XFZ O;  4MRX A;  1B7T Z;  1F4Q A;  5FYX A;  1S6C A;  4HRH A;  2GV5 A;  3OHM B;  2GGZ A;  4OV2 A;  1DMO A;  1K2H A;  2BL0 B;  2JQ6 A;  1KQM B;  4L9M A;  1CLL A;  1YUU A;  2CCM A;  1REC A;  3AKA A;  4MLW A;  2JWW A;  4I5J A;  5AEQ A;  2LVJ A;  2A4J A;  3I5I C;  4BY4 A;  1XVJ A;  1A75 A;  1QS7 A;  1A29 A;  3D0Y A;  2Y4Q A;  3F45 A;  4FTG A;  1L2O B;  4DIR A;  1YRT B;  1NCY A;  3AAK A;  1R2U A;  1QV0 A;  2AAO A;  1WDC B;  4DUQ A;  1S5G Y;  5TNC A;  1H8B A;  1NUB A;  1TN4 A;  3SG4 A;  2K8M B;  1XYD A;  3EK7 A;  4M2P A;  5KSZ A;  4NDC A;  1KSM A;  4DRW A;  1PSB A;  4ZCU A;  2KOT A;  4C0L A;  3SJS A;  2L5X B;  3DVK A;  3I5G C;  1N65 A;  2PVB A;  4F0Z B;  3VGO A;  2M9G A;  2BCA A;  2KGB C;  3NSL A;  2H61 A;  1M45 A;  2JPT A;  3I5I B;  3SIB A;  3CWG A;  4ORA B;  4CLN A;  5AAN A;  3BYA A;  1DJW A;  1LXF C;  1QLS A;  1K9U A;  5I2O A;  1N0Y A;  1KQV A;  1EXR A;  4YI8 A;  1SY9 A;  1IGV A;  2M97 A;  1F54 A;  2LNK A;  5HLO A;  3FWB A;  1NCZ A;  2WOS A;  4YRU A;  1S6I A;  1J7Q A;  5D7F A;  1BF5 A;  1MF8 B;  1J55 A;  3C1V A;  3I5G B;  5KTY A;  1TRF A;  3CLN A;  1WLM A;  1K95 A;  1MXL C;  1CNP A;  1DF0 B;  1KK8 C;  5CSF A;  4ORC B;  2JC2 A;  1U5I B;  5CPV A;  2KSP A;  1XFX O;  2MAZ A;  4NQG A;  1BR1 B;  2LUC A;  3QRX A;  1BG1 A;  1BT6 A;  2JOJ A;  4UPG A;  2I18 A;  2WCE A;  2WCB A;  1S3P A;  1AUI B;  1F55 A;  4HSZ A;  3RM1 A;  1UWO A;  2AMI A;  2BBM A;  5K89 A;  4AOM A;  4PDZ A;  1FPW A;  1PAL A;  4CID A;  1IQ3 A;  2ZN8 A;  1YRU B;  2LHI A;  4ICB A;  4NDB A;  4PAL A;  1CLM A;  2K0J A;  1WRZ A;  2BBN A;  1JFK A;  1KK8 B;  3PLF B;  1JUO A;  4QJ4 B;  1BU3 A;  1BR4 B;  5DKR A;  1CFP A;  1FF1 A;  1AJ5 A;  2BE6 A;  1QIV A;  2LV7 A;  2KFF A;  1OMR A;  3NSO A;  2JTZ A;  1F70 A;  4GUK A;  3OX5 A;  4MZK A;  1F4O A;  3VRR A;  2L0P A;  1F8H A;  3BXK A;  1EH2 A;  1FW4 A;  2I2R E;  1YX7 A;  2KAV A;  2L98 A;  2RGI A;  3JVT C;  2LMV A;  3EK8 A;  1AJ4 A;  3BOW A;  2B1U A;  1MHO A;  1UHH A;  1OZS A;  3IF7 A;  4ORB B;  3FS7 A;  2KI6 D;  5DKN A;  3DVE A;  4XJK B;  4CPV A;  5I2L A;  3O78 A;  2LCP A;  1ODB A;  2ZRT A;  3PAT A;  2Y1M A;  4YBH B;  3GK1 A;  2KAY A;  4P5O E;  3MSE B;  2BKH B;  4MN0 A;  4C0K A;  4C0J A;  1NX1 A;  4YGA A;  1CM4 A;  1SW8 A;  1BOC A;  3CR4 X;  1A2X A;  1L7Z A;  1K9P A;  1ZUZ A;  4OVN F;  1PSR A;  1IQ5 A;  4TNC A;  3VRQ A;  3IQQ A;  1SL8 A;  2MJW B;  3JVT B;  3HCM A;  2LVV A;  2FJU B;  2HQ8 A;  1GGW A;  2WC8 A;  2ZNE A;  4M2O A;  1NPQ A;  3FWC A;  2LAN A;  4HRG A;  3WHU B;  2KYF A;  2LVI A;  3BUX B;  4FQO A;  2M3W A;  1YTZ C;  1ZMZ A;  2K7D A;  1PUL A;  1NX0 A;  1J1E A;  2ZFD A;  4PE0 A;  1CB1 A;  3TUY C;  1QX5 B;  5AXI A;  1GJY A;  2FOT A;  1Y1X A;  4PHK A;  1QX7 A;  3HX4 A;  1BJF A;  1KSO A;  2CT9 A;  3KEV A;  3PFV A;  4I5N B;  3TDZ A;  1MR8 A;  1KFX S;  4M2Q A;  2K2A A;  4OKH A;  2JT8 A;  2LUX A;  1KFU S;  2ZN9 A;  3BUN B;  3VRO A;  5I2Q A;  1S5G Z;  1UHI A;  2KHN A;  1JF2 A;  1LA3 A;  1SK6 D;  1DJI A;  1WY9 A;  1XK4 A;  3ICB A;  1K9K A;  3BQ3 A;  5J3X A;  1JWD A;  3A8R A;  3EKJ A;  2NCP A;  1CMF A;  1TNP A;  1DGV A;  3NXA A;  1A4P A;  1OMD A;  1HQV A;  2KYC A;  2LMT A;  3JTD C;  3TS5 C;  3BUM B;  4YGC B;  3I5F C;  4WRI A;  1DJY A;  2HPS A;  2I7A A;  5ER4 X;  2KQY A;  3TUY B;  3O6B A;  5HYD A;  4ETO A;  2QAC A;  3LCP C;  1B9A A;  4MBE A;  1LVC D;  1A03 A;  1W7I B;  1JSA A;  4E68 A;  1RK9 A;  1CDP A;  4CFQ A;  1NSH A;  5HKZ A;  2F2P A;  3OP0 A;  2K7C A;  2F8P A;  2M49 B;  1ZFS A;  1AVS A;  4N1F A;  1DJH A;  1S6J A;  1OSA A;  3PSR A;  4GGF A;  4NDD A;  1Y6W A;  2HET A;  2M8U A;  1CDL A;  1HT9 A;  1EJ3 A;  1B4C A;  1CFD A;  4CFR A;  4N5X A;  3JTD B;  3TS5 B;  1G4Y R;  3I5F B;  1OOJ A;  2LM5 A;  2KDH A;  2IS9 A;  2KAX A;  2LLU A;  1SL7 A;  1UP5 A;  2JU0 A;  3NSI A;  3TZ1 A;  2SCP A;  4GAO A;  1IG5 A;  2KI6 C;  2Q4U A;  3CS1 A;  4DS7 A;  1X02 A;  2WOR A;  2Y1N A;  1DGU A;  3WHT B;  4IL1 A;  3WNX B;  1SRA A;  2NLN A;  2LVK A;  2OTG C;  2KBI A;  4MZL A;  1NCX A;  1PRW A;  2JNF A;  2JTT A;  2PRU A;  2BEC A;  1YVH A;  3EVV A;  3CGA A;  1CMG A;  1TNW A;  4QJ3 B;  4MZJ A;  1D1O A;  5PAL A;  1N2D A;  2LAP A;  1BMO A;  2LP3 A;  5ER5 A;  1MXE A;  1QTX A;  1F71 A;  1KWO B;  2MRD A;  5HKY A;  4GFT A;  1AP4 A;  3DF0 B;  4XYN A;  2HQW A;  1IJ5 A;  4DCK A;  5DKQ A;  2PMY A;  2Q91 A;  2CBL A;  2LHL A;  3CR2 A;  5KU1 A;  5GQQ C;  1SR6 C;  2OTG B;  1UUS A;  3LK0 A;  3OB2 B;  1RRO A;  1XA5 A;  4WQ2 A;  3RLZ A;  4JQ0 D;  3SG6 A;  1GGZ A;  1TCO B;  1QVI Z;  4U8D A;  2FCD A;  2MLF C;  2L50 A;  2I94 A;  2NCO A;  3K21 A;  2BCB A;  2EHB A;  1QAT A;  1NX2 A;  1DJX A;  2H61 C;  4YGD B;  3D0Y B;  2QPT A;  1QVI Y;  2L2E A;  4GGN A;  1XO5 A;  3GOF A;  3LK1 A;  2ISD A;  2KFH A;  4QJ5 B;  5AFP A;  2R2I A;  2M7L A;  1VRK A;  3E3R A;  1IKU A;  1YUT A;  1QJT A;  2F33 A;  4PHJ A;  1SCM C;  3KHE A;  1SR6 B;  2K7B A;  4BY5 A;  2JT3 A;  3DD4 A;  4GPL B;  1JC2 A;  1G8I A;  1H4B A;  4MSP A;  3M0W A;  4HRE E;  1IRJ A;  1RTP 1;  2SAS A;  3FIA A;  3TDI A;  4JWQ A;  2O5G A;  1SL9 A;  1CFF A;  1NYA A;  1QIW A;  1FI6 A;  5JOL A;  2KNE A;  4R1E A;  1K93 D;  5CSI A;  1Y1U A;  1BLQ A;  2AUC A;  1FI5 A;  3LLE A;  2M29 A;  2ZND A;  2PAS A;  4N1G A;  4P2Y B;  1M39 A;  2EC6 C;  3EKH A;  2MA2 A;  1YR5 A;  4PE1 A;  1SCM B;  1J7R A;  3VRN A;  1Y1A A;  1DF0 A;  2L51 A;  1U5I A;  1K96 A;  4OR9 B;  2E30 A;  3DVM A;  3PM8 A;  1W7J B;  3EVU A;  1NIW A;  1YVL A;  3ZWH A;  1QV1 A;  2VRG A;  3GK4 X;  4A4C A;  5BPJ A;  1KK7 Y;  1S1E A;  1V1F A;  1B8C A;  1R6P A;  2LE9 B;  4AQJ A;  1TNQ A;  4MRY A;  2BCX A;  3PN7 C;  2JZI A;  1XFW O;  3IQO A;  3O4Y A;  1SNL A;  2EGD A;  1B8R A;  1CDM A;  3OX6 A;  1CDN A;  1RJV A;  5AER A;  5CSJ A;  2EC6 B;  1KFX L;  2PSR A;  1JBA A;  1OQP A;  4PE4 A;  1KFU L;  1JFJ A;  1B7T Y; 
#chains in the Genus database with same CATH topology
 1QAS A;  2CNP A;  2TN4 A;  2OPO A;  5IBW A;  4PHM A;  3CZT X;  2WCJ A;  3NHI A;  3FE9 A;  1NWD A;  4D1E A;  1NX3 A;  2JRF A;  3R1O A;  1EG3 A;  1LA0 A;  1PVA A;  1SCV A;  1OMV A;  1TUJ A;  4INX A;  4YGE B;  2H2K A;  3D74 A;  1Y0V H;  4AQI A;  1CFC A;  4JKT A;  5HLV A;  2K7O A;  3R72 A;  1B47 A;  2P6B B;  2COL B;  3NHT A;  2MBX A;  2M0R A;  3PN7 B;  1SBJ A;  1QWV A;  4GNK B;  1J7P A;  2JXL A;  1IWQ A;  1DEK A;  4USL A;  3EK4 A;  1AK8 A;  4XJK A;  4ZCV A;  2M1K B;  2L4I A;  4MEW A;  1EL4 A;  1FBV A;  1KWO C;  1UHK A;  1BOD A;  2HF5 A;  3BOW B;  5D69 A;  3TDU A;  3VRP A;  3WXA A;  2F3Z A;  1IJ6 A;  2KI4 C;  3PAL A;  1OE9 B;  1RFJ A;  5CSN A;  1J7O A;  1AHR A;  1YUR A;  1LIN A;  3D10 A;  1J1D A;  1MWN A;  3LL8 B;  2G9B A;  2O60 A;  3D78 A;  3O2P A;  4FQT A;  1WRK A;  2Y5I A;  1K94 A;  3A4U B;  4GBA A;  1QLK A;  2OS8 C;  2E6W A;  3BUO B;  3RZS A;  3CZ1 A;  1UHJ A;  1DTL A;  1KCY A;  2WCM A;  1XFR A;  1MUX A;  1DT7 B;  1B8L A;  4OCI A;  1S26 D;  3GK2 A;  3KF9 A;  1MQ1 A;  1UUR A;  1CTR A;  1SMG A;  1C7V A;  1WRL A;  2P71 A;  1XK4 C;  2BE4 A;  2JXC A;  3Q8I A;  3SG2 A;  2KFG A;  3B86 A;  1XFU O;  3AKB A;  2G2B A;  3NSK A;  1C07 A;  2WCH A;  2KLE A;  5G08 A;  1OOF A;  2KI4 B;  1TCF A;  2GGM A;  1K90 D;  2LP2 A;  2F3Y A;  3KPX A;  2OS8 B;  1CKK A;  3H4S E;  2DOQ A;  4YGB B;  1PVB A;  2LLT A;  5B8I B;  3N7H A;  2KGR A;  1M46 A;  3L47 A;  1SPY A;  2ZRS A;  4PE7 A;  5F6T A;  3V2L A;  1ZOT B;  1QXP A;  1Q80 A;  2LLS A;  1XFY O;  2PAL A;  2MLE C;  2K2F A;  2QEO A;  1C7W A;  1XFV O;  2JUL A;  1A75 B;  1OZO A;  3R1V A;  3AAJ A;  4GGF C;  3PJI A;  1LKJ A;  2WCF A;  3BFA A;  4WQ3 A;  5FI7 A;  3R1P A;  4I5L B;  1WLZ A;  3DVJ A;  5FI2 A;  1YX8 A;  1TIZ A;  1QX2 A;  1ALW A;  2F2O A;  1DVI A;  1G33 A;  1UHN A;  1EG4 A;  1S36 A;  2M1U A;  3EG5 B;  4Q04 A;  4MVF A;  4IJ7 A;  1SKT A;  1YUS A;  1M63 B;  1PK0 D;  3CR5 X;  3L4L A;  2ZKM X;  2D8N A;  5JJG A;  2FCE A;  3CTN A;  3SIA A;  1ZAC A;  2CTN A;  3S0E A;  1DJZ A;  4JPZ B;  5I94 A;  1RWY A;  3KO0 A;  1SSE B;  3NGV A;  1NP8 A;  2MHH A;  3I5H C;  2BKI B;  2L4H A;  2CXJ A;  1IH0 A;  3PM2 A;  2JT0 A;  1CM1 A;  3DXL A;  3OB1 B;  2KBM A;  1E8A A;  1GQM A;  1K8U A;  1M31 A;  1OW4 A;  3BUW B;  1B1G A;  2NXQ A;  1SYM A;  5HKW A;  1V1G A;  4JD9 A;  2JNX A;  3SG3 A;  2KPH A;  2WND A;  3ZNI A;  2BL0 C;  1KK7 Z;  1KQM C;  2M7N A;  4YI9 A;  2K61 A;  1TOP A;  1DJG A;  1T14 A;  3D76 A;  5I8N A;  3EVR A;  1TNX A;  2LC5 A;  4PHN A;  2LMU A;  4I5K A;  2NZ0 A;  1JF0 A;  1TTX A;  1L2O C;  3SG7 A;  1ALV A;  3I5H B;  2KQ6 A;  3DF0 A;  3SG5 A;  4A4B A;  1CLB A;  4PCW A;  1WDC C;  1XFZ O;  4MRX A;  1B7T Z;  1F4Q A;  3DY9 A;  5FYX A;  1S6C A;  4HRH A;  3DYE A;  2GV5 A;  3OHM B;  2GGZ A;  4OV2 A;  1DMO A;  1K2H A;  2BL0 B;  2JQ6 A;  1KQM B;  5HL1 A;  4L9M A;  1CLL A;  1YUU A;  2CCM A;  1REC A;  3AKA A;  4MLW A;  2JWW A;  4I5J A;  3D75 A;  4F7F A;  5AEQ A;  2LVJ A;  2A4J A;  3I5I C;  4BY4 A;  1XVJ A;  1A75 A;  1QS7 A;  1A29 A;  3D0Y A;  2Y4Q A;  3F45 A;  4FTG A;  1L2O B;  4DIR A;  2PYQ A;  1YRT B;  1NCY A;  3AAK A;  1R2U A;  1QV0 A;  3D77 A;  2AAO A;  1WDC B;  4DUQ A;  1S5G Y;  5TNC A;  1H8B A;  1NUB A;  1TN4 A;  3SG4 A;  2K8M B;  1XYD A;  3EK7 A;  4M2P A;  5EL2 A;  5KSZ A;  4NDC A;  1KSM A;  3B87 A;  4DRW A;  1PSB A;  4ZCU A;  2KOT A;  4C0L A;  3SJS A;  2L5X B;  3S0D A;  3DVK A;  3I5G C;  1N65 A;  2PVB A;  4F0Z B;  3VGO A;  2M9G A;  3IVT A;  3O4X A;  2BCA A;  2KGB C;  3CDN A;  3NSL A;  2H61 A;  1M45 A;  2JPT A;  3I5I B;  3SIB A;  3CWG A;  4ORA B;  4CLN A;  5AAN A;  3BYA A;  1DJW A;  1LXF C;  1QLS A;  2K60 A;  1K9U A;  5I2O A;  1N0Y A;  1KQV A;  1EXR A;  3CYZ A;  4YI8 A;  1SY9 A;  1IGV A;  2KLD A;  2M97 A;  1F54 A;  2LNK A;  5HLO A;  3FWB A;  1NCZ A;  2WOS A;  3S0B A;  3SS3 A;  1S6I A;  4YRU A;  1J7Q A;  5D7F A;  1BF5 A;  1MF8 B;  1J55 A;  3C1V A;  3I5G B;  5KTY A;  1TRF A;  3CLN A;  1WLM A;  1K95 A;  1MXL C;  1CNP A;  1DF0 B;  1KK8 C;  1IIO A;  5CSF A;  4ORC B;  5DIC A;  1W9Z A;  1DEL A;  1U5I B;  2JC2 A;  1XFX O;  2KSP A;  2MAZ A;  3QME A;  4NQG A;  5CPV A;  1BR1 B;  2LUC A;  3QRX A;  1BG1 A;  1BT6 A;  2JOJ A;  4UPG A;  2I18 A;  2WCE A;  2WCB A;  1S3P A;  1AUI B;  1F55 A;  4HSZ A;  2QEB A;  1P28 A;  3VB1 A;  3RM1 A;  1UWO A;  2AMI A;  2BBM A;  5K89 A;  4AOM A;  4PDZ A;  1FPW A;  1PAL A;  4CID A;  1IQ3 A;  2ZN8 A;  2YGU A;  1YRU B;  2LHI A;  4ICB A;  4NDB A;  4PAL A;  1CLM A;  2K0J A;  1WRZ A;  2BBN A;  1JFK A;  1KK8 B;  3PLF B;  1JUO A;  4QJ4 B;  1OOH A;  1BU3 A;  1BR4 B;  5DKR A;  1CFP A;  1FF1 A;  1AJ5 A;  2BE6 A;  1QIV A;  2LV7 A;  2KFF A;  1OMR A;  3NSO A;  2JTZ A;  1F70 A;  4GUK A;  3OX5 A;  4MZK A;  1F4O A;  3VRR A;  2L0P A;  1Z4H A;  2ERB A;  1F8H A;  3BXK A;  1EH2 A;  1FW4 A;  3OBV A;  3CZ2 A;  2I2R E;  1YX7 A;  2KAV A;  2L98 A;  2RGI A;  3JVT C;  1DC1 A;  2LMV A;  3EK8 A;  1AJ4 A;  3BOW A;  2B1U A;  1MHO A;  1UHH A;  1OZS A;  3IF7 A;  4ORB B;  3FS7 A;  2KI6 D;  5DKN A;  3DVE A;  4XJK B;  4CPV A;  5I2L A;  3BFH A;  3O78 A;  2LCP A;  3FE6 A;  1ODB A;  2ZRT A;  3PAT A;  2Y1M A;  4YBH B;  3GK1 A;  1DQE A;  2KAY A;  3MSE B;  2BKH B;  4P5O E;  4MN0 A;  4C0K A;  4C0J A;  1NX1 A;  4YGA A;  1CM4 A;  1SW8 A;  1BOC A;  3CR4 X;  1A2X A;  3L4A A;  1L7Z A;  1K9P A;  1ZUZ A;  4OVN F;  1PSR A;  1IQ5 A;  4TNC A;  3VRQ A;  3IQQ A;  2QEV A;  1SL8 A;  2JPO A;  2MJW B;  3JVT B;  3HCM A;  2LVV A;  2FJU B;  2QDI A;  2HQ8 A;  1GGW A;  2WC8 A;  2ZNE A;  4M2O A;  1NPQ A;  3FWC A;  2LAN A;  4HRG A;  3S0G A;  2KYF A;  2LVI A;  3WHU B;  3BUX B;  4FQO A;  2M3W A;  1YTZ C;  1ZMZ A;  2K7D A;  1PUL A;  1NX0 A;  1J1E A;  2ZFD A;  4PE0 A;  1CB1 A;  3TUY C;  1QX5 B;  5AXI A;  2QEH A;  1GJY A;  2FOT A;  1Y1X A;  4PHK A;  1QX7 A;  2BAP A;  1BJF A;  1KSO A;  2CT9 A;  3HX4 A;  3KEV A;  3PFV A;  4I5N B;  3TDZ A;  1MR8 A;  1KFX S;  4M2Q A;  2K2A A;  4OKH A;  2JT8 A;  2H8V A;  2LUX A;  1KFU S;  2ZN9 A;  3BUN B;  3VRO A;  5I2Q A;  1S5G Z;  1UHI A;  2KHN A;  1JF2 A;  3B7A A;  1LA3 A;  1SK6 D;  1DJI A;  1C3Y A;  1WY9 A;  1XK4 A;  3ICB A;  1K9K A;  3BQ3 A;  5J3X A;  1JWD A;  2L2C A;  3A8R A;  3EKJ A;  2NCP A;  1CMF A;  1TNP A;  4KYN A;  1DGV A;  3NXA A;  1A4P A;  1OMD A;  1HQV A;  2KYC A;  2LMT A;  3JTD C;  2PQL A;  3BUM B;  4YGC B;  3I5F C;  3TS5 C;  4WRI A;  1DJY A;  2HPS A;  2I7A A;  5ER4 X;  2KQY A;  3TUY B;  3O6B A;  5HYD A;  4ETO A;  2QAC A;  3LCP C;  1B9A A;  4MBE A;  1LVC D;  1A03 A;  1W7I B;  1JSA A;  4E68 A;  1RK9 A;  2WCK A;  1CDP A;  4CFQ A;  2P70 A;  1NSH A;  5HKZ A;  1LS8 A;  2F2P A;  3OP0 A;  2K7C A;  2F8P A;  2M49 B;  1ZFS A;  1AVS A;  4N1F A;  5FI6 A;  1DJH A;  1S6J A;  1OSA A;  3PSR A;  4GGF A;  4NDD A;  1Y6W A;  2HET A;  2M8U A;  1CDL A;  1HT9 A;  1EJ3 A;  1B4C A;  3OGN A;  1CFD A;  2V53 A;  4CFR A;  3D73 A;  4N5X A;  3JTD B;  3TS5 B;  1G4Y R;  3I5F B;  2FJY A;  1OOJ A;  2LM5 A;  2KDH A;  2IS9 A;  2KAX A;  2LLU A;  1SL7 A;  1UP5 A;  2JU0 A;  3NSI A;  3TZ1 A;  2SCP A;  4GAO A;  1IG5 A;  2KI6 C;  2Q4U A;  3CS1 A;  1OOI X;  4DS7 A;  1X02 A;  2WOR A;  2Y1N A;  1DGU A;  3WHT B;  4IL1 A;  3WNX B;  1SRA A;  2NLN A;  2LVK A;  2OTG C;  3BJH A;  2KBI A;  4MZL A;  1Z2C B;  1NCX A;  1PRW A;  2JNF A;  2JTT A;  2PRU A;  2BEC A;  1YVH A;  3EVV A;  3CGA A;  1CMG A;  1TNW A;  4QJ3 B;  4MZJ A;  1D1O A;  2GTE A;  1TUZ A;  5PAL A;  1N2D A;  2LAP A;  1BMO A;  2LP3 A;  5ER5 A;  1MXE A;  1QTX A;  1F71 A;  1KWO B;  2MRD A;  5HKY A;  4GFT A;  1AP4 A;  3DF0 B;  4XYN A;  2HQW A;  1IJ5 A;  4DCK A;  5DKQ A;  2PMY A;  2Q91 A;  2CBL A;  2LHL A;  3CR2 A;  5KU1 A;  5GQQ C;  1SR6 C;  2OTG B;  3B6X A;  1UUS A;  3LK0 A;  3OB2 B;  1RRO A;  1XA5 A;  4WQ2 A;  3RLZ A;  2WC6 A;  4JQ0 D;  3SG6 A;  1GGZ A;  1TCO B;  1QVI Z;  4U8D A;  2FCD A;  2MLF C;  2L50 A;  2I94 A;  2NCO A;  3K21 A;  2BCB A;  2EHB A;  3K1E A;  1QAT A;  1NX2 A;  1DJX A;  2H61 C;  4YGD B;  3D0Y B;  2QPT A;  1QVI Y;  2L2E A;  4GGN A;  1XO5 A;  3GOF A;  3LK1 A;  2ISD A;  2KFH A;  4QJ5 B;  5AFP A;  2R2I A;  1GM0 A;  1TWO A;  2M7L A;  1VRK A;  3S0A A;  3E3R A;  1IKU A;  1YUT A;  1QJT A;  2F33 A;  4PHJ A;  1SCM C;  3KHE A;  1SR6 B;  2K7B A;  4BY5 A;  2JT3 A;  2BNX A;  3DD4 A;  4GPL B;  1G8I A;  1JC2 A;  1H4B A;  3CZ0 A;  4MSP A;  3M0W A;  4HRE E;  1IRJ A;  1RTP 1;  2SAS A;  3FIA A;  4INW A;  3UO9 A;  4PT1 A;  4OZD A;  3TDI A;  4JWQ A;  2O5G A;  1SL9 A;  3DZT A;  2WC5 A;  1CFF A;  1NYA A;  1QIW A;  3SS4 A;  5JOL A;  3UNW A;  1FI6 A;  2KNE A;  4R1E A;  1ORG A;  1K93 D;  5CSI A;  1Y1U A;  1BLQ A;  3BFB A;  2AUC A;  5D3O A;  1FI5 A;  3LLE A;  2M29 A;  2ZND A;  2PAS A;  4N1G A;  4P2Y B;  1C3Z A;  1M39 A;  2EC6 C;  2MA2 A;  3EKH A;  1YR5 A;  4PE1 A;  3S0F A;  1SCM B;  1J7R A;  3SS5 A;  3VRN A;  1Y1A A;  1DF0 A;  2L51 A;  1U5I A;  1K96 A;  4OR9 B;  2E30 A;  3DVM A;  3PM8 A;  1W7J B;  3EVU A;  1NIW A;  1YVL A;  3ZWH A;  1QV1 A;  2VRG A;  3GK4 X;  4A4C A;  5BPJ A;  1KK7 Y;  1S1E A;  1V1F A;  1B8C A;  1R6P A;  2LE9 B;  4AQJ A;  1OOG A;  1TNQ A;  4MRY A;  3FE8 A;  2BCX A;  3PN7 C;  2JZI A;  1XFW O;  3IQO A;  2L5Y A;  1SNL A;  2EGD A;  3O4Y A;  1B8R A;  1CDM A;  3OX6 A;  1CDN A;  1RJV A;  5AER A;  5CSJ A;  2EC6 B;  1KFX L;  2PSR A;  1JBA A;  1OQP A;  4PE4 A;  3CAB A;  2WCL A;  3B88 A;  1KFU L;  1JFJ A;  1B7T Y; 
#chains in the Genus database with same CATH homology
 1QAS A;  2CNP A;  2TN4 A;  2OPO A;  5IBW A;  4PHM A;  3CZT X;  4D1E A;  1NWD A;  1NX3 A;  2JRF A;  1EG3 A;  1LA0 A;  1PVA A;  1SCV A;  1OMV A;  4YGE B;  1CFC A;  2H2K A;  1Y0V H;  4AQI A;  5HLV A;  2K7O A;  1B47 A;  2P6B B;  2COL B;  2MBX A;  2M0R A;  3PN7 B;  1SBJ A;  4GNK B;  1J7P A;  2JXL A;  1IWQ A;  4USL A;  3EK4 A;  1AK8 A;  4XJK A;  4ZCV A;  2M1K B;  2L4I A;  4MEW A;  1EL4 A;  1FBV A;  1KWO C;  1UHK A;  1BOD A;  2HF5 A;  3BOW B;  5D69 A;  3TDU A;  3VRP A;  3WXA A;  2F3Z A;  1IJ6 A;  2KI4 C;  3PAL A;  1OE9 B;  1RFJ A;  5CSN A;  1J7O A;  1AHR A;  1YUR A;  1LIN A;  3D10 A;  1J1D A;  1MWN A;  3LL8 B;  2G9B A;  2O60 A;  3O2P A;  1WRK A;  2Y5I A;  1K94 A;  3A4U B;  4GBA A;  1QLK A;  2OS8 C;  2E6W A;  3BUO B;  1UHJ A;  1DTL A;  1KCY A;  1MUX A;  1DT7 B;  1B8L A;  4OCI A;  1S26 D;  3GK2 A;  3KF9 A;  1MQ1 A;  1UUR A;  1CTR A;  1SMG A;  1C7V A;  1WRL A;  1XK4 C;  2BE4 A;  2JXC A;  3SG2 A;  2KFG A;  1XFU O;  3AKB A;  2G2B A;  3NSK A;  1C07 A;  5G08 A;  2KI4 B;  1TCF A;  2GGM A;  1K90 D;  2LP2 A;  2F3Y A;  3KPX A;  2OS8 B;  1CKK A;  3H4S E;  2DOQ A;  4YGB B;  1PVB A;  2LLT A;  5B8I B;  2KGR A;  1M46 A;  4PE7 A;  1SPY A;  2ZRS A;  5F6T A;  1QXP A;  1ZOT B;  1Q80 A;  2LLS A;  1XFY O;  2PAL A;  2MLE C;  2K2F A;  2V53 A;  1C7W A;  1XFV O;  2JUL A;  1A75 B;  1OZO A;  3AAJ A;  4GGF C;  1LKJ A;  2WCF A;  4WQ3 A;  4I5L B;  1WLZ A;  3DVJ A;  1YX8 A;  1TIZ A;  1QX2 A;  1ALW A;  2F2O A;  1DVI A;  1G33 A;  1UHN A;  1EG4 A;  1S36 A;  2M1U A;  4Q04 A;  4MVF A;  1SKT A;  1YUS A;  1M63 B;  1PK0 D;  3CR5 X;  2ZKM X;  2D8N A;  5JJG A;  2FCE A;  3CTN A;  3SIA A;  1ZAC A;  2CTN A;  1DJZ A;  4JPZ B;  1RWY A;  3KO0 A;  1NP8 A;  2MHH A;  3I5H C;  2BKI B;  2L4H A;  2CXJ A;  1IH0 A;  2JT0 A;  1CM1 A;  3OB1 B;  2KBM A;  1E8A A;  1GQM A;  1K8U A;  1M31 A;  3BUW B;  1B1G A;  2NXQ A;  1SYM A;  5HKW A;  1V1G A;  2JNX A;  3SG3 A;  2WND A;  3ZNI A;  2BL0 C;  1KK7 Z;  1KQM C;  2M7N A;  4YI9 A;  2K61 A;  1TOP A;  1DJG A;  5I8N A;  3EVR A;  1TNX A;  2LC5 A;  4PHN A;  2LMU A;  4I5K A;  2NZ0 A;  1JF0 A;  1TTX A;  1L2O C;  3SG7 A;  1ALV A;  3I5H B;  2KQ6 A;  3DF0 A;  3SG5 A;  4A4B A;  1CLB A;  4PCW A;  1WDC C;  1XFZ O;  4MRX A;  1B7T Z;  1F4Q A;  5FYX A;  1S6C A;  4HRH A;  2GV5 A;  3OHM B;  2GGZ A;  4OV2 A;  1DMO A;  1K2H A;  2BL0 B;  2JQ6 A;  1KQM B;  4L9M A;  1CLL A;  1YUU A;  2CCM A;  1REC A;  3AKA A;  4MLW A;  2JWW A;  4I5J A;  5AEQ A;  2LVJ A;  2A4J A;  3I5I C;  4BY4 A;  1XVJ A;  1A75 A;  1QS7 A;  1A29 A;  3D0Y A;  2Y4Q A;  3F45 A;  4FTG A;  1L2O B;  4DIR A;  1YRT B;  1NCY A;  3AAK A;  1R2U A;  1QV0 A;  2AAO A;  1WDC B;  4DUQ A;  1S5G Y;  5TNC A;  1H8B A;  1NUB A;  1TN4 A;  3SG4 A;  2K8M B;  1XYD A;  3EK7 A;  4M2P A;  5KSZ A;  4NDC A;  1KSM A;  4DRW A;  1PSB A;  4ZCU A;  2KOT A;  4C0L A;  3SJS A;  2L5X B;  3DVK A;  3I5G C;  1N65 A;  2PVB A;  4F0Z B;  3VGO A;  2M9G A;  2BCA A;  2KGB C;  3NSL A;  2H61 A;  1M45 A;  2JPT A;  3I5I B;  3SIB A;  3CWG A;  4ORA B;  4CLN A;  5AAN A;  3BYA A;  1DJW A;  1LXF C;  1QLS A;  1K9U A;  5I2O A;  1N0Y A;  1KQV A;  1EXR A;  4YI8 A;  1SY9 A;  1IGV A;  2M97 A;  1F54 A;  2LNK A;  5HLO A;  3FWB A;  1NCZ A;  2WOS A;  4YRU A;  1S6I A;  1J7Q A;  5D7F A;  1BF5 A;  1MF8 B;  1J55 A;  3C1V A;  3I5G B;  5KTY A;  1TRF A;  3CLN A;  1WLM A;  1K95 A;  1MXL C;  1CNP A;  1DF0 B;  1KK8 C;  5CSF A;  4ORC B;  2JC2 A;  1U5I B;  5CPV A;  2KSP A;  1XFX O;  2MAZ A;  4NQG A;  1BR1 B;  2LUC A;  3QRX A;  1BG1 A;  1BT6 A;  2JOJ A;  4UPG A;  2I18 A;  2WCE A;  2WCB A;  1S3P A;  1AUI B;  1F55 A;  4HSZ A;  3RM1 A;  1UWO A;  2AMI A;  2BBM A;  5K89 A;  4AOM A;  4PDZ A;  1FPW A;  1PAL A;  4CID A;  1IQ3 A;  2ZN8 A;  1YRU B;  2LHI A;  4ICB A;  4NDB A;  4PAL A;  1CLM A;  2K0J A;  1WRZ A;  2BBN A;  1JFK A;  1KK8 B;  3PLF B;  1JUO A;  4QJ4 B;  1BU3 A;  1BR4 B;  5DKR A;  1CFP A;  1FF1 A;  1AJ5 A;  2BE6 A;  1QIV A;  2LV7 A;  2KFF A;  1OMR A;  3NSO A;  2JTZ A;  1F70 A;  4GUK A;  3OX5 A;  4MZK A;  1F4O A;  3VRR A;  2L0P A;  1F8H A;  3BXK A;  1EH2 A;  1FW4 A;  2I2R E;  1YX7 A;  2KAV A;  2L98 A;  2RGI A;  3JVT C;  2LMV A;  3EK8 A;  1AJ4 A;  3BOW A;  2B1U A;  1MHO A;  1UHH A;  1OZS A;  3IF7 A;  4ORB B;  3FS7 A;  2KI6 D;  5DKN A;  3DVE A;  4XJK B;  4CPV A;  5I2L A;  3O78 A;  2LCP A;  1ODB A;  2ZRT A;  3PAT A;  2Y1M A;  4YBH B;  3GK1 A;  2KAY A;  4P5O E;  3MSE B;  2BKH B;  4MN0 A;  4C0K A;  4C0J A;  1NX1 A;  4YGA A;  1CM4 A;  1SW8 A;  1BOC A;  3CR4 X;  1A2X A;  1L7Z A;  1K9P A;  1ZUZ A;  4OVN F;  1PSR A;  1IQ5 A;  4TNC A;  3VRQ A;  3IQQ A;  1SL8 A;  2MJW B;  3JVT B;  3HCM A;  2LVV A;  2FJU B;  2HQ8 A;  1GGW A;  2WC8 A;  2ZNE A;  4M2O A;  1NPQ A;  3FWC A;  2LAN A;  4HRG A;  3WHU B;  2KYF A;  2LVI A;  3BUX B;  4FQO A;  2M3W A;  1YTZ C;  1ZMZ A;  2K7D A;  1PUL A;  1NX0 A;  1J1E A;  2ZFD A;  4PE0 A;  1CB1 A;  3TUY C;  1QX5 B;  5AXI A;  1GJY A;  2FOT A;  1Y1X A;  4PHK A;  1QX7 A;  3HX4 A;  1BJF A;  1KSO A;  2CT9 A;  3KEV A;  3PFV A;  4I5N B;  3TDZ A;  1MR8 A;  1KFX S;  4M2Q A;  2K2A A;  4OKH A;  2JT8 A;  2LUX A;  1KFU S;  2ZN9 A;  3BUN B;  3VRO A;  5I2Q A;  1S5G Z;  1UHI A;  2KHN A;  1JF2 A;  1LA3 A;  1SK6 D;  1DJI A;  1WY9 A;  1XK4 A;  3ICB A;  1K9K A;  3BQ3 A;  5J3X A;  1JWD A;  3A8R A;  3EKJ A;  2NCP A;  1CMF A;  1TNP A;  1DGV A;  3NXA A;  1A4P A;  1OMD A;  1HQV A;  2KYC A;  2LMT A;  3JTD C;  3TS5 C;  3BUM B;  4YGC B;  3I5F C;  4WRI A;  1DJY A;  2HPS A;  2I7A A;  5ER4 X;  2KQY A;  3TUY B;  3O6B A;  5HYD A;  4ETO A;  2QAC A;  3LCP C;  1B9A A;  4MBE A;  1LVC D;  1A03 A;  1W7I B;  1JSA A;  4E68 A;  1RK9 A;  1CDP A;  4CFQ A;  1NSH A;  5HKZ A;  2F2P A;  3OP0 A;  2K7C A;  2F8P A;  2M49 B;  1ZFS A;  1AVS A;  4N1F A;  1DJH A;  1S6J A;  1OSA A;  3PSR A;  4GGF A;  4NDD A;  1Y6W A;  2HET A;  2M8U A;  1CDL A;  1HT9 A;  1EJ3 A;  1B4C A;  1CFD A;  4CFR A;  4N5X A;  3JTD B;  3TS5 B;  1G4Y R;  3I5F B;  1OOJ A;  2LM5 A;  2KDH A;  2IS9 A;  2KAX A;  2LLU A;  1SL7 A;  1UP5 A;  2JU0 A;  3NSI A;  3TZ1 A;  2SCP A;  4GAO A;  1IG5 A;  2KI6 C;  2Q4U A;  3CS1 A;  4DS7 A;  1X02 A;  2WOR A;  2Y1N A;  1DGU A;  3WHT B;  4IL1 A;  3WNX B;  1SRA A;  2NLN A;  2LVK A;  2OTG C;  2KBI A;  4MZL A;  1NCX A;  1PRW A;  2JNF A;  2JTT A;  2PRU A;  2BEC A;  1YVH A;  3EVV A;  3CGA A;  1CMG A;  1TNW A;  4QJ3 B;  4MZJ A;  1D1O A;  5PAL A;  1N2D A;  2LAP A;  1BMO A;  2LP3 A;  5ER5 A;  1MXE A;  1QTX A;  1F71 A;  1KWO B;  2MRD A;  5HKY A;  4GFT A;  1AP4 A;  3DF0 B;  4XYN A;  2HQW A;  1IJ5 A;  4DCK A;  5DKQ A;  2PMY A;  2Q91 A;  2CBL A;  2LHL A;  3CR2 A;  5KU1 A;  5GQQ C;  1SR6 C;  2OTG B;  1UUS A;  3LK0 A;  3OB2 B;  1RRO A;  1XA5 A;  4WQ2 A;  3RLZ A;  4JQ0 D;  3SG6 A;  1GGZ A;  1TCO B;  1QVI Z;  4U8D A;  2FCD A;  2MLF C;  2L50 A;  2I94 A;  2NCO A;  3K21 A;  2BCB A;  2EHB A;  1QAT A;  1NX2 A;  1DJX A;  2H61 C;  4YGD B;  3D0Y B;  2QPT A;  1QVI Y;  2L2E A;  4GGN A;  1XO5 A;  3GOF A;  3LK1 A;  2ISD A;  2KFH A;  4QJ5 B;  5AFP A;  2R2I A;  2M7L A;  1VRK A;  3E3R A;  1IKU A;  1YUT A;  1QJT A;  2F33 A;  4PHJ A;  1SCM C;  3KHE A;  1SR6 B;  2K7B A;  4BY5 A;  2JT3 A;  3DD4 A;  4GPL B;  1JC2 A;  1G8I A;  1H4B A;  4MSP A;  3M0W A;  4HRE E;  1IRJ A;  1RTP 1;  2SAS A;  3FIA A;  3TDI A;  4JWQ A;  2O5G A;  1SL9 A;  1CFF A;  1NYA A;  1QIW A;  1FI6 A;  5JOL A;  2KNE A;  4R1E A;  1K93 D;  5CSI A;  1Y1U A;  1BLQ A;  2AUC A;  1FI5 A;  3LLE A;  2M29 A;  2ZND A;  2PAS A;  4N1G A;  4P2Y B;  1M39 A;  2EC6 C;  3EKH A;  2MA2 A;  1YR5 A;  4PE1 A;  1SCM B;  1J7R A;  3VRN A;  1Y1A A;  1DF0 A;  2L51 A;  1U5I A;  1K96 A;  4OR9 B;  2E30 A;  3DVM A;  3PM8 A;  1W7J B;  3EVU A;  1NIW A;  1YVL A;  3ZWH A;  1QV1 A;  2VRG A;  3GK4 X;  4A4C A;  5BPJ A;  1KK7 Y;  1S1E A;  1V1F A;  1B8C A;  1R6P A;  2LE9 B;  4AQJ A;  1TNQ A;  4MRY A;  2BCX A;  3PN7 C;  2JZI A;  1XFW O;  3IQO A;  3O4Y A;  1SNL A;  2EGD A;  1B8R A;  1CDM A;  3OX6 A;  1CDN A;  1RJV A;  5AER A;  5CSJ A;  2EC6 B;  1KFX L;  2PSR A;  1JBA A;  1OQP A;  4PE4 A;  1KFU L;  1JFJ A;  1B7T Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...