1EL4A

Structure of the calcium-regulated photoprotein obelin determined by sulfur sas
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
b'SSKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBELIN
publication title Structure of the Ca2+-regulated photoprotein obelin at 1.7 A resolution determined directly from its sulfur substructure.
pubmed rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 74
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1el4A00
1WLMA 2CNPA 3O78A 5IBWA 3EVRA 1K94A 2KI4C 1TOPA 2LVIA 1BU3A 1Y1UA 1SR6B 2MLFC 1DGUA 1EXRA 4ORBB 2ZNEA 1MF8B 5CSJA 5JOLA 1DT7B 1AVSA 1YUTA 1YVLA 1JC2A 1IWQA 1KK7Y 1IGVA 3IF7A 2PSRA 2LP3A 3BOWA 3CR5X 3IQOA 4DRWA 3BUNB 1XO5A 5HKZA 2NCOA 1J1DA 3FWCA 4ORAB 4PHNA 5I2QA 1ODBA 2Q91A 5I2LA 1S1EA 2BBMA 4CFRA 4C0KA 1JF0A 1TTXA 2LV7A 2WORA 2KAXA 5GQQC 3HCMA 1BT6A 1DF0B 2LAPA 2QACA 1QX5B 1MQ1A 2L0PA 4NDBA 1SK6D 1M45A 1IQ5A 2BBNA 4FQOA 1D1OA 2M1KB 2M49B 4GFTA 1S5GZ 2F2OA 4HSZA 1YRTB 1QVIZ 1WDCB 2ZN9A 3CGAA 1A29A 1PALA 2WOSA 4L9MA 1V1FA 3BUXB 2EC6B 1LXFC 4NDDA 1J1EA 4YGAA 2FCDA 1DJIA 4CIDA 3I5IB 1NCZA 1OZOA 3LK0A 1F55A 2HQWA 3WHUB 2LUXA 1AHRA 1JFKA 2D8NA 1NCYA 1KWOC 1SBJA 1BJFA 3PSRA 3BYAA 1WLZA 2M29A 3I5GC 1K90D 5DKQA 1F4OA 5ER5A 2KQ6A 1QV0A 3PALA 1A2XA 2KHNA 1B47A 2KGRA 2NXQA 2ZRSA 4NQGA 2Y1MA 5CSNA 4ETOA 4HRHA 2BKHB 3D0YA 1K8UA 1S5GY 4YGEB 3KHEA 1KK8C 1OQPA 2KYFA 4YGDB 4JWQA 1NCXA 3ICBA 1QVIY 1SRAA 3RM1A 1HT9A 2CXJA 2LM5A 1C7VA 3JVTC 2BCXA 2ZKMX 4P5OE 1KQMC 1J7PA 2F2PA 3LK1A 5I8NA 1RROA 1UP5A 2AAOA 4DCKA 1Y6WA 3TDIA 2MA2A 3SG5A 1N2DA 1SL9A 3CR4X 1TNPA 4DIRA 1G4YR 4QJ5B 1KCYA 1F70A 1UHHA 2I2RE 1S36A 1S3PA 3CLNA 2KFGA 1AP4A 1YRUB 1SL8A 1M39A 4AQJA 1OOJA 4P2YB 1J7OA 2PRUA 3BUWB 1KSOA 1QIVA 2K2FA 3DVJA 1PVAA 4Q04A 1H4BA 5KSZA 2L5XB 3GOFA 1DJXA 3O6BA 2JC2A 3TZ1A 3SIAA 1CLMA 2E6WA 2CT9A 1QTXA 4DS7A 1BLQA 3DF0B 2CBLA 4MEWA 2JU0A 3EK7A 1YX8A 2ZRTA 1Y1XA 4QJ4B 1YTZC 1XFXO 1AUIB 1M46A 4GNKB 4MSPA 1K9PA 5AERA 2F8PA 2F3YA 1TCFA 2SCPA 3SG4A 2M97A 1LVCD 1QASA 2KFFA 2WC8A 2JQ6A 3HX4A 2OS8B 2NZ0A 4USLA 5CSFA 1JWDA 1IQ3A 4OCIA 2KNEA 1XFYO 1W7IB 3FS7A 2LMUA 1CMGA 1ZUZA 3F45A 3OP0A 1CFDA 2PVBA 3KPXA 1CM4A 1CDMA 2M7LA 1GJYA 1B4CA 1B8CA 2ZFDA 4AQIA 2L51A 1AJ5A 1NX3A 1S6JA 1CLLA 1OMDA 3LCPC 4PHJA 2JTZA 2M8UA 1G33A 2HQ8A 1F4QA 2BL0C 1OZSA 2BCBA 3VRQA 1JBAA 1K95A 2LVJA 2PMYA 2BECA 1TNQA 1SW8A 2OTGC 3QRXA 1UHNA 1J55A 3TUYB 1L2OC 1L7ZA 1CTRA 2ZNDA 1SKTA 3M0WA 4XYNA 1A03A 4YRUA 2ZN8A 3TDZA 3NSLA 5J3XA 3OX6A 4R1EA 1J7RA 4MRYA 3DF0A 3EVVA 4I5JA 1QLSA 2WCFA 1K93D 3OB2B 2JULA 1FI6A 1BR4B 1QATA 1DJYA 1S6IA 1U5IB 2M0RA 3D10A 2JXCA 1QX2A 3PATA 1WRKA 2Y4QA 1KQVA 1MHOA 4I5LB 2WNDA 4MVFA 4C0JA 2F3ZA 2HETA 1RK9A 2V53A 1FPWA 4GGNA 1F54A 2K7CA 3PN7C 2Q4UA 3O4YA 5BPJA 3O2PA 2LMTA 1DJGA 4GUKA 3EK4A 4BY5A 1RTP1 2ISDA 5CSIA 1HQVA 1YX7A 1LA0A 2LLSA 1NP8A 1UUSA 2JNXA 2L98A 2QPTA 4I5NB 4JQ0D 2LVVA 3BUOB 3I5HC 4M2QA 4FTGA 1NWDA 2K61A 2MLEC 1M63B 2L4HA 3I5FB 3SG7A 1UWOA 1XK4A 5TNCA 3A4UB 3FWBA 3SJSA 2JTTA 1VRKA 1TRFA 1UHIA 2I7AA 1DMOA 5AEQA 1A75B 4YGCB 1N0YA 4QJ3B 1Q80A 3WHTB 1GGWA 1TCOB 1PVBA 3JTDC 3K21A 4C0LA 2K0JA 1BOCA 3TS5B 1F8HA 1RWYA 1M31A 1DGVA 2G9BA 1SCMB 3GK2A 3KF9A 4PDZA 5D69A 4ICBA 2DOQA 1TIZA 2HF5A 5JJGA 2LHIA 1WRZA 2KI4B 4OV2A 3NXAA 2PALA 2BCAA 2EGDA 1U5IA 1LA3A 1DJWA 1DF0A 1SR6C 4CPVA 3SG2A 4OR9B 1RFJA 1TNWA 3CR2A 2KBIA 2HPSA 1DJZA 2A4JA 1MXEA 4PE4A 2GGMA 4IL1A 1UHKA 1AJ4A 4HRGA 1SPYA 2LANA 1H8BA 2M3WA 3SG3A 1MR8A 1RECA 3WXAA 2G2BA 3E3RA 2LNKA 4MBEA 4YI9A 1MUXA 1MWNA 2BE4A 4D1EA 1IJ5A 1NPQA 2LUCA 4ORCB 1XYDA 2KDHA 4GGFA 1NX0A 4GAOA 1CKKA 2Y5IA 2BE6A 4PE7A 1JFJA 1KFXL 1GQMA 5K89A 1YUSA 5G08A 3KEVA 3CS1A 1UURA 5KTYA 5AANA 1IH0A 1G8IA 1LKJA 1A75A 1GGZA 2M7NA 2M9GA 1JF2A 2IS9A 1NUBA 2LC5A 1YUUA 3BUMB 1EJ3A 1TNXA 5DKNA 4F0ZB 3NSIA 3CTNA 1WDCC 1IRJA 3IQQA 1IKUA 1B7TZ 2E30A 1UHJA 1NIWA 2EC6C 2JWWA 1CNPA 4MRXA 1QX7A 1A4PA 2O60A 1QJTA 1KWOB 4TNCA 3VRRA 1CB1A 2Y1NA 3EK8A 3I5IC 2CCMA 3VRNA 3I5GB 1FBVA 1NYAA 2CTNA 1C07A 4ZCVA 1ALVA 4PHKA 1B9AA 4OKHA 1B8LA 1KK8B 2AMIA 2H61A 2F33A 1K96A 3VROA 2K7BA 2KQYA 3GK4X 4PALA 2JT8A 3AAKA 3JVTB 4YI8A 4N1FA 1WY9A 1CFFA 1KQMB 3VRPA 2KFHA 1B7TY 1PSRA 2JZIA 1R2UA 1QIWA 2LVKA 2OPOA 2JXLA 5FYXA 1KFUL 2RGIA 4WQ2A 3VGOA 1C7WA 4ZCUA 1CMFA 1XVJA 1CM1A 3PLFB 1PULA 1Y1AA 4YBHB 1LINA 1W7JB 2LP2A 5HLVA 1IG5A 1E8AA 1PRWA 3NSOA 3OHMB 2MJWB 3EVUA 1JSAA 3D0YB 2H61C 2M1UA 1MXLC 4A4BA 5HYDA 2COLB 1OMVA 4I5KA 1BG1A 2KOTA 3BXKA 2LE9B 1Y0VH 2GV5A 4MZKA 2FOTA 1JUOA 1FF1A 2LCPA 2KAVA 2P6BB 5HKYA 5ER4X 2L2EA 3AAJA 2K2AA 1ALWA 1XFWO 1EG3A 1TN4A 2AUCA 1QV1A 1RJVA 1N65A 2KI6D 2MHHA 1QXPA 1SMGA 4AOMA 2K7DA 5B8IB 4WRIA 3ZWHA 1SL7A 4MN0A 2JRFA 3OB1B 2JOJA 2GGZA 2OS8C 3LLEA 3TDUA 4CLNA 1SCVA 1IJ6A 1EG4A 1X02A 1DJHA 1ZACA 2TN4A 4OVNF 4BY4A 4YGBB 1NX2A 1PSBA 4DUQA 3PFVA 1CFPA 1CLBA 1S6CA 4U8DA 5AFPA 1OMRA 3KO0A 3GK1A 1XFZO 2FCEA 4GPLB 1J7QA 3FIAA 1XK4C 1KFXS 1EL4A 4HREE 1K9UA 1OSAA 1EH2A 2BL0B 4GBAA 1SNLA 3EKHA 4CFQA 1FW4A 1DVIA 2EHBA 2I18A 2KGBC 2OTGB 2JPTA 1DTLA 1ZMZA 1L2OB 3OX5A 4N5XA 4MZJA 1SYMA 4PCWA 5HLOA 2LLUA 1BF5A 4PE1A 2O5GA 3TUYC 1S26D 1KSMA 3DVEA 4XJKB 4JPZB 4UPGA 4PHMA 2K8MB 1QLKA 2JT3A 1QS7A 2BKIB 2MAZA 1YR5A 3CZTX 5KU1A 5AXIA 4MLWA 5F6TA 1K9KA 4WQ3A 1B8RA 1WRLA 2L50A 2R2IA 2SASA 1V1GA 2H2KA 4M2PA 3C1VA 3PN7B 4E68A 3SG6A 5DKRA 3DD4A 2KAYA 1ZFSA 3BOWB 3CWGA 5PALA 2B1UA 2MRDA 1SY9A 2JNFA 2JT0A 5HKWA 2FJUB 3A8RA 3WNXB 2VRGA 2MBXA 1YURA 3I5HB 2LLTA 2WCBA 2LMVA 1CFCA 2WCEA 2PASA 4N1GA 2KBMA 2KYCA 1CDNA 4A4CA 1F71A 1KFUS 4M2OA 1XFUO 3EKJA 3NSKA 3RLZA 4PE0A 1B1GA 1BODA 1XFVO 1FI5A 3H4SE 2I94A 3I5FC 3MSEB 2LHLA 4GGFC 3AKAA 1NSHA 3PM8A 3AKBA 1K2HA 1ZOTB 3ZNIA 4NDCA 5CPVA 4MZLA 1PK0D 1XA5A 3LL8B 1OE9B 1KK7Z 1BMOA 2NLNA 2KI6C 1CDPA 1NX1A 3JTDB 3DVKA 5D7FA 2L4IA 1BR1B 1CDLA 3SIBA 2K7OA 3BQ3A 2KSPA 3DVMA 2NCPA 3TS5C 1AK8A 4XJKA 1YVHA 1R6PA 1SCMC 5I2OA
chains in the Genus database with same CATH superfamily
1WLMA 2CNPA 3O78A 5IBWA 3EVRA 1K94A 2KI4C 1TOPA 3D75A 2LVIA 1BU3A 2WC6A 1Y1UA 1SR6B 1W9ZA 2MLFC 1DGUA 1EXRA 3BFBA 2ZNEA 1MF8B 3BFHA 3O4XA 4ORBB 1AVSA 5CSJA 5JOLA 1YUTA 3RZSA 1DT7B 3S0DA 1YVLA 1JC2A 1IWQA 1KK7Y 1IGVA 3IF7A 2PSRA 2LP3A 5D3OA 1SSEB 3BOWA 3CR5X 3IQOA 4DRWA 3BUNB 1XO5A 5HKZA 2NCOA 1J1DA 3FWCA 3D76A 1GM0A 2K60A 4ORAB 4PHNA 5I2QA 1ODBA 2Q91A 5I2LA 3S0FA 1S1EA 2BBMA 4CFRA 4C0KA 1JF0A 1TTXA 2LV7A 2WORA 3NHIA 2KAXA 3DXLA 3HCMA 1BT6A 1DF0B 2LAPA 2QACA 5GQQC 1QX5B 2WCHA 3BFAA 1MQ1A 2L0PA 3L4LA 4NDBA 2FJYA 1SK6D 3DZTA 1M45A 1IQ5A 2BBNA 4FQOA 1D1OA 2M1KB 2M49B 4GFTA 1S5GZ 2F2OA 4HSZA 1YRTB 1QVIZ 1WDCB 2ZN9A 3CGAA 1A29A 1PALA 2WOSA 4L9MA 1V1FA 3BUXB 2EC6B 3N7HA 1LXFC 5EL2A 4NDDA 1J1EA 4YGAA 3S0BA 2FCDA 1OOHA 1DJIA 4CIDA 3I5IB 1NCZA 1OZOA 3LK0A 1F55A 2HQWA 3WHUB 3OBVA 2LUXA 1AHRA 1JFKA 2D8NA 1NCYA 1KWOC 1SBJA 1BJFA 3PSRA 2PQLA 3BYAA 1WLZA 2M29A 3I5GC 1K90D 5DKQA 1F4OA 2L2CA 2YGUA 5ER5A 2KQ6A 1QV0A 3PALA 1A2XA 2KHNA 1B47A 2KGRA 2NXQA 2ZRSA 4NQGA 2Y1MA 3R1PA 5CSNA 4ETOA 4HRHA 2P71A 2BKHB 3D0YA 1K8UA 1S5GY 4YGEB 3KHEA 1KK8C 1OQPA 2KYFA 4YGDB 4JWQA 1NCXA 3ICBA 1QVIY 1SRAA 3RM1A 1HT9A 2CXJA 2LM5A 1C7VA 3JVTC 2BCXA 2WC5A 2ZKMX 4P5OE 1KQMC 1TUZA 2F2PA 3LK1A 5I8NA 1RROA 1UP5A 2AAOA 4DCKA 1J7PA 1Y6WA 3TDIA 2MA2A 3D74A 3SG5A 1N2DA 1SL9A 3CR4X 1TNPA 4DIRA 1G4YR 4QJ5B 3B6XA 1KCYA 1F70A 3D77A 1UHHA 2I2RE 1S36A 1S3PA 3CLNA 2KFGA 1AP4A 2GTEA 1YRUB 3R1VA 1SL8A 1M39A 3FE9A 4AQJA 1OOJA 4P2YB 1J7OA 2PRUA 1TUJA 1KSOA 1QIVA 3BUWB 2K2FA 3DVJA 3SS5A 1PVAA 4Q04A 1H4BA 5KSZA 2L5XB 3GOFA 1DJXA 3O6BA 2JC2A 3BJHA 3S0EA 3SIAA 3TZ1A 1CLMA 2E6WA 2CT9A 3CDNA 1QTXA 4DS7A 1BLQA 3DF0B 2CBLA 4MEWA 2JU0A 3EK7A 1YX8A 2ZRTA 1Y1XA 4QJ4B 1YTZC 3DYEA 1XFXO 1AUIB 3QMEA 1M46A 4GNKB 4MSPA 1K9PA 5AERA 2F8PA 2F3YA 1TCFA 2SCPA 3SG4A 2M97A 1LVCD 1QASA 2KFFA 3UNWA 2WC8A 2PYQA 1C3YA 2JQ6A 2KLEA 3HX4A 2OS8B 3FE8A 2NZ0A 2WCJA 4USLA 5CSFA 1JWDA 1IQ3A 3B86A 4OCIA 2KNEA 1XFYO 1W7IB 3FS7A 2LMUA 1CMGA 1ZUZA 3F45A 3OP0A 1CFDA 2PVBA 3KPXA 1CM4A 1Z4HA 1CDMA 2M7LA 1GJYA 1B4CA 1B8CA 2ZFDA 4AQIA 3L47A 5FI6A 2L51A 4IJ7A 1AJ5A 1NX3A 1S6JA 1CLLA 1OMDA 3LCPC 4PHJA 2JTZA 2M8UA 1G33A 3FE6A 2HQ8A 1F4QA 2BL0C 1OZSA 2BCBA 3VRQA 1JBAA 1K95A 2LVJA 2PMYA 4KYNA 2BECA 1TNQA 1SW8A 2OTGC 3QRXA 1UHNA 1J55A 3TUYB 1L2OC 1L7ZA 1CTRA 2ZNDA 1SKTA 3M0WA 3R72A 4XYNA 4F7FA 1A03A 4YRUA 2ZN8A 3TDZA 3NSLA 5J3XA 3OX6A 4R1EA 1J7RA 4MRYA 3DF0A 3EVVA 4I5JA 1QLSA 3NHTA 2WCFA 1K93D 3OB2B 2JULA 1FI6A 1BR4B 1QATA 1DJYA 1S6IA 1U5IB 2M0RA 3D10A 2JXCA 3DY9A 1QX2A 5DICA 3PATA 1WRKA 2Y4QA 1KQVA 1MHOA 4I5LB 2WNDA 4MVFA 4C0JA 2F3ZA 3D73A 2HETA 1RK9A 2V53A 1FPWA 4GGNA 1F54A 2K7CA 3PN7C 2Q4UA 3O4YA 5BPJA 3O2PA 3VB1A 2QEVA 2LMTA 2H8VA 1DJGA 4GUKA 3EK4A 4BY5A 1TWOA 1RTP1 2ISDA 5CSIA 1HQVA 1YX7A 1LA0A 2LLSA 1NP8A 3EG5B 1UUSA 2JNXA 2L98A 2QPTA 4I5NB 4JQ0D 2LVVA 3BUOB 3I5HC 4M2QA 4FTGA 1NWDA 2K61A 2MLEC 1M63B 2L4HA 3I5FB 3SG7A 1UWOA 1XK4A 5TNCA 3A4UB 3FWBA 3SJSA 2JTTA 1VRKA 1TRFA 5HL1A 1UHIA 2I7AA 1DMOA 5AEQA 1A75B 2WCKA 4YGCB 1N0YA 4QJ3B 1Q80A 3WHTB 3SS4A 1GGWA 2WCMA 1TCOB 1PVBA 3JTDC 3K21A 4C0LA 2K0JA 1BOCA 3TS5B 1F8HA 1RWYA 1M31A 1DGVA 2G9BA 1SCMB 3GK2A 3KF9A 4PDZA 5D69A 4ICBA 2DOQA 3PJIA 1TIZA 2HF5A 5JJGA 2LHIA 1WRZA 2KI4B 4OV2A 3NXAA 2PALA 2BCAA 2EGDA 1U5IA 1LA3A 1DJWA 4PT1A 1DF0A 1SR6C 2L5YA 4CPVA 3SG2A 4OR9B 1RFJA 1TNWA 3CR2A 2KBIA 2HPSA 1DJZA 2WCLA 2A4JA 1MXEA 4PE4A 2GGMA 4IL1A 1UHKA 1AJ4A 4HRGA 1SPYA 2LANA 1H8BA 2M3WA 3Q8IA 1MR8A 1RECA 3SG3A 3WXAA 2BAPA 2G2BA 3E3RA 2LNKA 4MBEA 4YI9A 1MUXA 1MWNA 2BE4A 4D1EA 1IJ5A 1NPQA 2LUCA 4JKTA 4ORCB 1C3ZA 1XYDA 2KDHA 4GGFA 1NX0A 4GAOA 1CKKA 2Y5IA 2BE6A 4PE7A 1JFJA 1KFXL 2QEOA 1GQMA 5K89A 1YUSA 5G08A 1DEKA 3KEVA 3CS1A 1UURA 5KTYA 5AANA 1IH0A 1G8IA 1LKJA 1A75A 1GGZA 2M7NA 2M9GA 1JF2A 2IS9A 1NUBA 2LC5A 1YUUA 3BUMB 1EJ3A 1TNXA 5DKNA 3R1OA 4F0ZB 3NSIA 3CTNA 3L4AA 1WDCC 1IRJA 3IQQA 3PM2A 1B7TZ 1IKUA 2E30A 1UHJA 1NIWA 2EC6C 2JWWA 1CNPA 4MRXA 1QX7A 1A4PA 2O60A 1QJTA 1KWOB 3IVTA 4TNCA 3VRRA 1CB1A 2Y1NA 3EK8A 3I5IC 2CCMA 3VRNA 3I5GB 1FBVA 1NYAA 2CTNA 1XFRA 1C07A 4ZCVA 1ALVA 4PHKA 1B9AA 5I94A 4OKHA 1OOIX 1B8LA 1KK8B 2AMIA 2H61A 2F33A 1K96A 3VROA 2K7BA 2KQYA 3GK4X 4PALA 2JT8A 3AAKA 3JVTB 4YI8A 4N1FA 4OZDA 1WY9A 1CFFA 1KQMB 3VRPA 2KFHA 1B7TY 1PSRA 2JZIA 1R2UA 1QIWA 2LVKA 2OPOA 3S0AA 2JXLA 5FYXA 1KFUL 2RGIA 4WQ2A 3VGOA 1T14A 1C7WA 4ZCUA 1CMFA 1XVJA 1CM1A 3PLFB 1PULA 1Y1AA 4YBHB 1LINA 1W7JB 2LP2A 3CZ2A 1IG5A 5HLVA 1E8AA 1PRWA 3NSOA 2QDIA 2MJWB 3OHMB 3EVUA 4INWA 1JSAA 1Z2CB 3D0YB 4JD9A 2H61C 2M1UA 1MXLC 4A4BA 5HYDA 2COLB 1OMVA 4I5KA 1BG1A 3D78A 2KOTA 3B88A 3BXKA 2LE9B 1Y0VH 2GV5A 4MZKA 2FOTA 1JUOA 1FF1A 2LCPA 2KAVA 2P6BB 5HKYA 5ER4X 2L2EA 3AAJA 1DELA 2K2AA 1ALWA 1XFWO 2JPOA 1EG3A 1TN4A 2AUCA 1QV1A 1RJVA 1N65A 2KI6D 2MHHA 1QXPA 1SMGA 3K1EA 4AOMA 2K7DA 5B8IB 4WRIA 3ZWHA 1SL7A 2BNXA 4MN0A 2JRFA 3OB1B 2JOJA 3B87A 2GGZA 2OS8C 3LLEA 3TDUA 4CLNA 1SCVA 1IJ6A 1EG4A 1X02A 1DJHA 1ZACA 2TN4A 4OVNF 5FI2A 4BY4A 4YGBB 1NX2A 1PSBA 4DUQA 3PFVA 1DQEA 1CFPA 1CLBA 1S6CA 4U8DA 5AFPA 1OMRA 3KO0A 3GK1A 1XFZO 2FCEA 4GPLB 1J7QA 3FIAA 1XK4C 3SS3A 1KFXS 1EL4A 3CABA 4HREE 1K9UA 1DC1A 1OSAA 1EH2A 2BL0B 4GBAA 3CYZA 1SNLA 3NGVA 3EKHA 4CFQA 1FW4A 1DVIA 2EHBA 2I18A 2KGBC 2OTGB 2JPTA 1DTLA 1ZMZA 1L2OB 3OX5A 4N5XA 4MZJA 1SYMA 4PCWA 5HLOA 2LLUA 1BF5A 4PE1A 2O5GA 3TUYC 1S26D 1KSMA 2KPHA 3DVEA 4JPZB 4XJKB 1OW4A 4PHMA 2K8MB 4UPGA 1QLKA 2JT3A 1QS7A 2BKIB 2MAZA 1YR5A 3CZTX 5FI7A 5KU1A 1OOFA 4FQTA 4MLWA 5AXIA 4INXA 5F6TA 1K9KA 4WQ3A 1B8RA 1WRLA 2QEBA 2L50A 2R2IA 2SASA 1V1GA 2H2KA 4M2PA 3B7AA 3C1VA 1QWVA 3PN7B 3CZ0A 5I2OA 4E68A 3SG6A 5DKRA 3DD4A 2KAYA 1ZFSA 3BOWB 3CWGA 5PALA 2B1UA 2MRDA 1SY9A 2JNFA 2JT0A 5HKWA 2FJUB 3A8RA 3WNXB 1IIOA 2VRGA 2MBXA 3S0GA 1YURA 3I5HB 1LS8A 2LLTA 2QEHA 2WCBA 2LMVA 2KLDA 1CFCA 2WCEA 2PASA 4N1GA 2KBMA 2KYCA 1CDNA 4A4CA 1F71A 1KFUS 4M2OA 1XFUO 3EKJA 3NSKA 3RLZA 4PE0A 1B1GA 3CZ1A 1XFVO 1BODA 2P70A 1FI5A 3H4SE 2I94A 3I5FC 3MSEB 2LHLA 4GGFC 3AKAA 3UO9A 1NSHA 3PM8A 3AKBA 1K2HA 1ZOTB 3ZNIA 4NDCA 5CPVA 4MZLA 1PK0D 1XA5A 3LL8B 1OE9B 1ORGA 1KK7Z 1BMOA 2NLNA 2KI6C 1CDPA 1NX1A 3JTDB 3DVKA 5D7FA 2L4IA 1BR1B 1CDLA 1OOGA 3SIBA 2K7OA 1P28A 3BQ3A 2KSPA 3DVMA 3V2LA 2NCPA 3OGNA 3TS5C 1AK8A 4XJKA 1YVHA 1R6PA 1SCMC 2ERBA
chains in the Genus database with same CATH topology
1WLMA 2CNPA 3O78A 5IBWA 3EVRA 1K94A 2KI4C 1TOPA 2LVIA 1BU3A 1Y1UA 1SR6B 2MLFC 1DGUA 1EXRA 4ORBB 2ZNEA 1MF8B 5CSJA 5JOLA 1DT7B 1AVSA 1YUTA 1YVLA 1JC2A 1IWQA 1KK7Y 1IGVA 3IF7A 2PSRA 2LP3A 3BOWA 3CR5X 3IQOA 4DRWA 3BUNB 1XO5A 5HKZA 2NCOA 1J1DA 3FWCA 4ORAB 4PHNA 5I2QA 1ODBA 2Q91A 5I2LA 1S1EA 2BBMA 4CFRA 4C0KA 1JF0A 1TTXA 2LV7A 2WORA 2KAXA 5GQQC 3HCMA 1BT6A 1DF0B 2LAPA 2QACA 1QX5B 1MQ1A 2L0PA 4NDBA 1SK6D 1M45A 1IQ5A 2BBNA 4FQOA 1D1OA 2M1KB 2M49B 4GFTA 1S5GZ 2F2OA 4HSZA 1YRTB 1QVIZ 1WDCB 2ZN9A 3CGAA 1A29A 1PALA 2WOSA 4L9MA 1V1FA 3BUXB 2EC6B 1LXFC 4NDDA 1J1EA 4YGAA 2FCDA 1DJIA 4CIDA 3I5IB 1NCZA 1OZOA 3LK0A 1F55A 2HQWA 3WHUB 2LUXA 1AHRA 1JFKA 2D8NA 1NCYA 1KWOC 1SBJA 1BJFA 3PSRA 3BYAA 1WLZA 2M29A 3I5GC 1K90D 5DKQA 1F4OA 5ER5A 2KQ6A 1QV0A 3PALA 1A2XA 2KHNA 1B47A 2KGRA 2NXQA 2ZRSA 4NQGA 2Y1MA 5CSNA 4ETOA 4HRHA 2BKHB 3D0YA 1K8UA 1S5GY 4YGEB 3KHEA 1KK8C 1OQPA 2KYFA 4YGDB 4JWQA 1NCXA 3ICBA 1QVIY 1SRAA 3RM1A 1HT9A 2CXJA 2LM5A 1C7VA 3JVTC 2BCXA 2ZKMX 4P5OE 1KQMC 1J7PA 2F2PA 3LK1A 5I8NA 1RROA 1UP5A 2AAOA 4DCKA 1Y6WA 3TDIA 2MA2A 3SG5A 1N2DA 1SL9A 3CR4X 1TNPA 4DIRA 1G4YR 4QJ5B 1KCYA 1F70A 1UHHA 2I2RE 1S36A 1S3PA 3CLNA 2KFGA 1AP4A 1YRUB 1SL8A 1M39A 4AQJA 1OOJA 4P2YB 1J7OA 2PRUA 3BUWB 1KSOA 1QIVA 2K2FA 3DVJA 1PVAA 4Q04A 1H4BA 5KSZA 2L5XB 3GOFA 1DJXA 3O6BA 2JC2A 3TZ1A 3SIAA 1CLMA 2E6WA 2CT9A 1QTXA 4DS7A 1BLQA 3DF0B 2CBLA 4MEWA 2JU0A 3EK7A 1YX8A 2ZRTA 1Y1XA 4QJ4B 1YTZC 1XFXO 1AUIB 1M46A 4GNKB 4MSPA 1K9PA 5AERA 2F8PA 2F3YA 1TCFA 2SCPA 3SG4A 2M97A 1LVCD 1QASA 2KFFA 2WC8A 2JQ6A 3HX4A 2OS8B 2NZ0A 4USLA 5CSFA 1JWDA 1IQ3A 4OCIA 2KNEA 1XFYO 1W7IB 3FS7A 2LMUA 1CMGA 1ZUZA 3F45A 3OP0A 1CFDA 2PVBA 3KPXA 1CM4A 1CDMA 2M7LA 1GJYA 1B4CA 1B8CA 2ZFDA 4AQIA 2L51A 1AJ5A 1NX3A 1S6JA 1CLLA 1OMDA 3LCPC 4PHJA 2JTZA 2M8UA 1G33A 2HQ8A 1F4QA 2BL0C 1OZSA 2BCBA 3VRQA 1JBAA 1K95A 2LVJA 2PMYA 2BECA 1TNQA 1SW8A 2OTGC 3QRXA 1UHNA 1J55A 3TUYB 1L2OC 1L7ZA 1CTRA 2ZNDA 1SKTA 3M0WA 4XYNA 1A03A 4YRUA 2ZN8A 3TDZA 3NSLA 5J3XA 3OX6A 4R1EA 1J7RA 4MRYA 3DF0A 3EVVA 4I5JA 1QLSA 2WCFA 1K93D 3OB2B 2JULA 1FI6A 1BR4B 1QATA 1DJYA 1S6IA 1U5IB 2M0RA 3D10A 2JXCA 1QX2A 3PATA 1WRKA 2Y4QA 1KQVA 1MHOA 4I5LB 2WNDA 4MVFA 4C0JA 2F3ZA 2HETA 1RK9A 2V53A 1FPWA 4GGNA 1F54A 2K7CA 3PN7C 2Q4UA 3O4YA 5BPJA 3O2PA 2LMTA 1DJGA 4GUKA 3EK4A 4BY5A 1RTP1 2ISDA 5CSIA 1HQVA 1YX7A 1LA0A 2LLSA 1NP8A 1UUSA 2JNXA 2L98A 2QPTA 4I5NB 4JQ0D 2LVVA 3BUOB 3I5HC 4M2QA 4FTGA 1NWDA 2K61A 2MLEC 1M63B 2L4HA 3I5FB 3SG7A 1UWOA 1XK4A 5TNCA 3A4UB 3FWBA 3SJSA 2JTTA 1VRKA 1TRFA 1UHIA 2I7AA 1DMOA 5AEQA 1A75B 4YGCB 1N0YA 4QJ3B 1Q80A 3WHTB 1GGWA 1TCOB 1PVBA 3JTDC 3K21A 4C0LA 2K0JA 1BOCA 3TS5B 1F8HA 1RWYA 1M31A 1DGVA 2G9BA 1SCMB 3GK2A 3KF9A 4PDZA 5D69A 4ICBA 2DOQA 1TIZA 2HF5A 5JJGA 2LHIA 1WRZA 2KI4B 4OV2A 3NXAA 2PALA 2BCAA 2EGDA 1U5IA 1LA3A 1DJWA 1DF0A 1SR6C 4CPVA 3SG2A 4OR9B 1RFJA 1TNWA 3CR2A 2KBIA 2HPSA 1DJZA 2A4JA 1MXEA 4PE4A 2GGMA 4IL1A 1UHKA 1AJ4A 4HRGA 1SPYA 2LANA 1H8BA 2M3WA 3SG3A 1MR8A 1RECA 3WXAA 2G2BA 3E3RA 2LNKA 4MBEA 4YI9A 1MUXA 1MWNA 2BE4A 4D1EA 1IJ5A 1NPQA 2LUCA 4ORCB 1XYDA 2KDHA 4GGFA 1NX0A 4GAOA 1CKKA 2Y5IA 2BE6A 4PE7A 1JFJA 1KFXL 1GQMA 5K89A 1YUSA 5G08A 3KEVA 3CS1A 1UURA 5KTYA 5AANA 1IH0A 1G8IA 1LKJA 1A75A 1GGZA 2M7NA 2M9GA 1JF2A 2IS9A 1NUBA 2LC5A 1YUUA 3BUMB 1EJ3A 1TNXA 5DKNA 4F0ZB 3NSIA 3CTNA 1WDCC 1IRJA 3IQQA 1IKUA 1B7TZ 2E30A 1UHJA 1NIWA 2EC6C 2JWWA 1CNPA 4MRXA 1QX7A 1A4PA 2O60A 1QJTA 1KWOB 4TNCA 3VRRA 1CB1A 2Y1NA 3EK8A 3I5IC 2CCMA 3VRNA 3I5GB 1FBVA 1NYAA 2CTNA 1C07A 4ZCVA 1ALVA 4PHKA 1B9AA 4OKHA 1B8LA 1KK8B 2AMIA 2H61A 2F33A 1K96A 3VROA 2K7BA 2KQYA 3GK4X 4PALA 2JT8A 3AAKA 3JVTB 4YI8A 4N1FA 1WY9A 1CFFA 1KQMB 3VRPA 2KFHA 1B7TY 1PSRA 2JZIA 1R2UA 1QIWA 2LVKA 2OPOA 2JXLA 5FYXA 1KFUL 2RGIA 4WQ2A 3VGOA 1C7WA 4ZCUA 1CMFA 1XVJA 1CM1A 3PLFB 1PULA 1Y1AA 4YBHB 1LINA 1W7JB 2LP2A 5HLVA 1IG5A 1E8AA 1PRWA 3NSOA 3OHMB 2MJWB 3EVUA 1JSAA 3D0YB 2H61C 2M1UA 1MXLC 4A4BA 5HYDA 2COLB 1OMVA 4I5KA 1BG1A 2KOTA 3BXKA 2LE9B 1Y0VH 2GV5A 4MZKA 2FOTA 1JUOA 1FF1A 2LCPA 2KAVA 2P6BB 5HKYA 5ER4X 2L2EA 3AAJA 2K2AA 1ALWA 1XFWO 1EG3A 1TN4A 2AUCA 1QV1A 1RJVA 1N65A 2KI6D 2MHHA 1QXPA 1SMGA 4AOMA 2K7DA 5B8IB 4WRIA 3ZWHA 1SL7A 4MN0A 2JRFA 3OB1B 2JOJA 2GGZA 2OS8C 3LLEA 3TDUA 4CLNA 1SCVA 1IJ6A 1EG4A 1X02A 1DJHA 1ZACA 2TN4A 4OVNF 4BY4A 4YGBB 1NX2A 1PSBA 4DUQA 3PFVA 1CFPA 1CLBA 1S6CA 4U8DA 5AFPA 1OMRA 3KO0A 3GK1A 1XFZO 2FCEA 4GPLB 1J7QA 3FIAA 1XK4C 1KFXS 1EL4A 4HREE 1K9UA 1OSAA 1EH2A 2BL0B 4GBAA 1SNLA 3EKHA 4CFQA 1FW4A 1DVIA 2EHBA 2I18A 2KGBC 2OTGB 2JPTA 1DTLA 1ZMZA 1L2OB 3OX5A 4N5XA 4MZJA 1SYMA 4PCWA 5HLOA 2LLUA 1BF5A 4PE1A 2O5GA 3TUYC 1S26D 1KSMA 3DVEA 4XJKB 4JPZB 4UPGA 4PHMA 2K8MB 1QLKA 2JT3A 1QS7A 2BKIB 2MAZA 1YR5A 3CZTX 5KU1A 5AXIA 4MLWA 5F6TA 1K9KA 4WQ3A 1B8RA 1WRLA 2L50A 2R2IA 2SASA 1V1GA 2H2KA 4M2PA 3C1VA 3PN7B 4E68A 3SG6A 5DKRA 3DD4A 2KAYA 1ZFSA 3BOWB 3CWGA 5PALA 2B1UA 2MRDA 1SY9A 2JNFA 2JT0A 5HKWA 2FJUB 3A8RA 3WNXB 2VRGA 2MBXA 1YURA 3I5HB 2LLTA 2WCBA 2LMVA 1CFCA 2WCEA 2PASA 4N1GA 2KBMA 2KYCA 1CDNA 4A4CA 1F71A 1KFUS 4M2OA 1XFUO 3EKJA 3NSKA 3RLZA 4PE0A 1B1GA 1BODA 1XFVO 1FI5A 3H4SE 2I94A 3I5FC 3MSEB 2LHLA 4GGFC 3AKAA 1NSHA 3PM8A 3AKBA 1K2HA 1ZOTB 3ZNIA 4NDCA 5CPVA 4MZLA 1PK0D 1XA5A 3LL8B 1OE9B 1KK7Z 1BMOA 2NLNA 2KI6C 1CDPA 1NX1A 3JTDB 3DVKA 5D7FA 2L4IA 1BR1B 1CDLA 3SIBA 2K7OA 3BQ3A 2KSPA 3DVMA 2NCPA 3TS5C 1AK8A 4XJKA 1YVHA 1R6PA 1SCMC 5I2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLM A;  2CNP A;  3O78 A;  5IBW A;  3EVR A;  1K94 A;  2KI4 C;  1TOP A;  2LVI A;  1BU3 A;  1Y1U A;  1SR6 B;  2MLF C;  1DGU A;  1EXR A;  4ORB B;  2ZNE A;  1MF8 B;  5CSJ A;  5JOL A;  1DT7 B;  1AVS A;  1YUT A;  1YVL A;  1JC2 A;  1IWQ A;  1KK7 Y;  1IGV A;  3IF7 A;  2PSR A;  2LP3 A;  3BOW A;  3CR5 X;  3IQO A;  4DRW A;  3BUN B;  1XO5 A;  5HKZ A;  2NCO A;  1J1D A;  3FWC A;  4ORA B;  4PHN A;  5I2Q A;  1ODB A;  2Q91 A;  5I2L A;  1S1E A;  2BBM A;  4CFR A;  4C0K A;  1JF0 A;  1TTX A;  2LV7 A;  2WOR A;  2KAX A;  5GQQ C;  3HCM A;  1BT6 A;  1DF0 B;  2LAP A;  2QAC A;  1QX5 B;  1MQ1 A;  2L0P A;  4NDB A;  1SK6 D;  1M45 A;  1IQ5 A;  2BBN A;  4FQO A;  1D1O A;  2M1K B;  2M49 B;  4GFT A;  1S5G Z;  2F2O A;  4HSZ A;  1YRT B;  1QVI Z;  1WDC B;  2ZN9 A;  3CGA A;  1A29 A;  1PAL A;  2WOS A;  4L9M A;  1V1F A;  3BUX B;  2EC6 B;  1LXF C;  4NDD A;  1J1E A;  4YGA A;  2FCD A;  1DJI A;  4CID A;  3I5I B;  1NCZ A;  1OZO A;  3LK0 A;  1F55 A;  2HQW A;  3WHU B;  2LUX A;  1AHR A;  1JFK A;  2D8N A;  1NCY A;  1KWO C;  1SBJ A;  1BJF A;  3PSR A;  3BYA A;  1WLZ A;  2M29 A;  3I5G C;  1K90 D;  5DKQ A;  1F4O A;  5ER5 A;  2KQ6 A;  1QV0 A;  3PAL A;  1A2X A;  2KHN A;  1B47 A;  2KGR A;  2NXQ A;  2ZRS A;  4NQG A;  2Y1M A;  5CSN A;  4ETO A;  4HRH A;  2BKH B;  3D0Y A;  1K8U A;  1S5G Y;  4YGE B;  3KHE A;  1KK8 C;  1OQP A;  2KYF A;  4YGD B;  4JWQ A;  1NCX A;  3ICB A;  1QVI Y;  1SRA A;  3RM1 A;  1HT9 A;  2CXJ A;  2LM5 A;  1C7V A;  3JVT C;  2BCX A;  2ZKM X;  4P5O E;  1KQM C;  1J7P A;  2F2P A;  3LK1 A;  5I8N A;  1RRO A;  1UP5 A;  2AAO A;  4DCK A;  1Y6W A;  3TDI A;  2MA2 A;  3SG5 A;  1N2D A;  1SL9 A;  3CR4 X;  1TNP A;  4DIR A;  1G4Y R;  4QJ5 B;  1KCY A;  1F70 A;  1UHH A;  2I2R E;  1S36 A;  1S3P A;  3CLN A;  2KFG A;  1AP4 A;  1YRU B;  1SL8 A;  1M39 A;  4AQJ A;  1OOJ A;  4P2Y B;  1J7O A;  2PRU A;  3BUW B;  1KSO A;  1QIV A;  2K2F A;  3DVJ A;  1PVA A;  4Q04 A;  1H4B A;  5KSZ A;  2L5X B;  3GOF A;  1DJX A;  3O6B A;  2JC2 A;  3TZ1 A;  3SIA A;  1CLM A;  2E6W A;  2CT9 A;  1QTX A;  4DS7 A;  1BLQ A;  3DF0 B;  2CBL A;  4MEW A;  2JU0 A;  3EK7 A;  1YX8 A;  2ZRT A;  1Y1X A;  4QJ4 B;  1YTZ C;  1XFX O;  1AUI B;  1M46 A;  4GNK B;  4MSP A;  1K9P A;  5AER A;  2F8P A;  2F3Y A;  1TCF A;  2SCP A;  3SG4 A;  2M97 A;  1LVC D;  1QAS A;  2KFF A;  2WC8 A;  2JQ6 A;  3HX4 A;  2OS8 B;  2NZ0 A;  4USL A;  5CSF A;  1JWD A;  1IQ3 A;  4OCI A;  2KNE A;  1XFY O;  1W7I B;  3FS7 A;  2LMU A;  1CMG A;  1ZUZ A;  3F45 A;  3OP0 A;  1CFD A;  2PVB A;  3KPX A;  1CM4 A;  1CDM A;  2M7L A;  1GJY A;  1B4C A;  1B8C A;  2ZFD A;  4AQI A;  2L51 A;  1AJ5 A;  1NX3 A;  1S6J A;  1CLL A;  1OMD A;  3LCP C;  4PHJ A;  2JTZ A;  2M8U A;  1G33 A;  2HQ8 A;  1F4Q A;  2BL0 C;  1OZS A;  2BCB A;  3VRQ A;  1JBA A;  1K95 A;  2LVJ A;  2PMY A;  2BEC A;  1TNQ A;  1SW8 A;  2OTG C;  3QRX A;  1UHN A;  1J55 A;  3TUY B;  1L2O C;  1L7Z A;  1CTR A;  2ZND A;  1SKT A;  3M0W A;  4XYN A;  1A03 A;  4YRU A;  2ZN8 A;  3TDZ A;  3NSL A;  5J3X A;  3OX6 A;  4R1E A;  1J7R A;  4MRY A;  3DF0 A;  3EVV A;  4I5J A;  1QLS A;  2WCF A;  1K93 D;  3OB2 B;  2JUL A;  1FI6 A;  1BR4 B;  1QAT A;  1DJY A;  1S6I A;  1U5I B;  2M0R A;  3D10 A;  2JXC A;  1QX2 A;  3PAT A;  1WRK A;  2Y4Q A;  1KQV A;  1MHO A;  4I5L B;  2WND A;  4MVF A;  4C0J A;  2F3Z A;  2HET A;  1RK9 A;  2V53 A;  1FPW A;  4GGN A;  1F54 A;  2K7C A;  3PN7 C;  2Q4U A;  3O4Y A;  5BPJ A;  3O2P A;  2LMT A;  1DJG A;  4GUK A;  3EK4 A;  4BY5 A;  1RTP 1;  2ISD A;  5CSI A;  1HQV A;  1YX7 A;  1LA0 A;  2LLS A;  1NP8 A;  1UUS A;  2JNX A;  2L98 A;  2QPT A;  4I5N B;  4JQ0 D;  2LVV A;  3BUO B;  3I5H C;  4M2Q A;  4FTG A;  1NWD A;  2K61 A;  2MLE C;  1M63 B;  2L4H A;  3I5F B;  3SG7 A;  1UWO A;  1XK4 A;  5TNC A;  3A4U B;  3FWB A;  3SJS A;  2JTT A;  1VRK A;  1TRF A;  1UHI A;  2I7A A;  1DMO A;  5AEQ A;  1A75 B;  4YGC B;  1N0Y A;  4QJ3 B;  1Q80 A;  3WHT B;  1GGW A;  1TCO B;  1PVB A;  3JTD C;  3K21 A;  4C0L A;  2K0J A;  1BOC A;  3TS5 B;  1F8H A;  1RWY A;  1M31 A;  1DGV A;  2G9B A;  1SCM B;  3GK2 A;  3KF9 A;  4PDZ A;  5D69 A;  4ICB A;  2DOQ A;  1TIZ A;  2HF5 A;  5JJG A;  2LHI A;  1WRZ A;  2KI4 B;  4OV2 A;  3NXA A;  2PAL A;  2BCA A;  2EGD A;  1U5I A;  1LA3 A;  1DJW A;  1DF0 A;  1SR6 C;  4CPV A;  3SG2 A;  4OR9 B;  1RFJ A;  1TNW A;  3CR2 A;  2KBI A;  2HPS A;  1DJZ A;  2A4J A;  1MXE A;  4PE4 A;  2GGM A;  4IL1 A;  1UHK A;  1AJ4 A;  4HRG A;  1SPY A;  2LAN A;  1H8B A;  2M3W A;  3SG3 A;  1MR8 A;  1REC A;  3WXA A;  2G2B A;  3E3R A;  2LNK A;  4MBE A;  4YI9 A;  1MUX A;  1MWN A;  2BE4 A;  4D1E A;  1IJ5 A;  1NPQ A;  2LUC A;  4ORC B;  1XYD A;  2KDH A;  4GGF A;  1NX0 A;  4GAO A;  1CKK A;  2Y5I A;  2BE6 A;  4PE7 A;  1JFJ A;  1KFX L;  1GQM A;  5K89 A;  1YUS A;  5G08 A;  3KEV A;  3CS1 A;  1UUR A;  5KTY A;  5AAN A;  1IH0 A;  1G8I A;  1LKJ A;  1A75 A;  1GGZ A;  2M7N A;  2M9G A;  1JF2 A;  2IS9 A;  1NUB A;  2LC5 A;  1YUU A;  3BUM B;  1EJ3 A;  1TNX A;  5DKN A;  4F0Z B;  3NSI A;  3CTN A;  1WDC C;  1IRJ A;  3IQQ A;  1IKU A;  1B7T Z;  2E30 A;  1UHJ A;  1NIW A;  2EC6 C;  2JWW A;  1CNP A;  4MRX A;  1QX7 A;  1A4P A;  2O60 A;  1QJT A;  1KWO B;  4TNC A;  3VRR A;  1CB1 A;  2Y1N A;  3EK8 A;  3I5I C;  2CCM A;  3VRN A;  3I5G B;  1FBV A;  1NYA A;  2CTN A;  1C07 A;  4ZCV A;  1ALV A;  4PHK A;  1B9A A;  4OKH A;  1B8L A;  1KK8 B;  2AMI A;  2H61 A;  2F33 A;  1K96 A;  3VRO A;  2K7B A;  2KQY A;  3GK4 X;  4PAL A;  2JT8 A;  3AAK A;  3JVT B;  4YI8 A;  4N1F A;  1WY9 A;  1CFF A;  1KQM B;  3VRP A;  2KFH A;  1B7T Y;  1PSR A;  2JZI A;  1R2U A;  1QIW A;  2LVK A;  2OPO A;  2JXL A;  5FYX A;  1KFU L;  2RGI A;  4WQ2 A;  3VGO A;  1C7W A;  4ZCU A;  1CMF A;  1XVJ A;  1CM1 A;  3PLF B;  1PUL A;  1Y1A A;  4YBH B;  1LIN A;  1W7J B;  2LP2 A;  5HLV A;  1IG5 A;  1E8A A;  1PRW A;  3NSO A;  3OHM B;  2MJW B;  3EVU A;  1JSA A;  3D0Y B;  2H61 C;  2M1U A;  1MXL C;  4A4B A;  5HYD A;  2COL B;  1OMV A;  4I5K A;  1BG1 A;  2KOT A;  3BXK A;  2LE9 B;  1Y0V H;  2GV5 A;  4MZK A;  2FOT A;  1JUO A;  1FF1 A;  2LCP A;  2KAV A;  2P6B B;  5HKY A;  5ER4 X;  2L2E A;  3AAJ A;  2K2A A;  1ALW A;  1XFW O;  1EG3 A;  1TN4 A;  2AUC A;  1QV1 A;  1RJV A;  1N65 A;  2KI6 D;  2MHH A;  1QXP A;  1SMG A;  4AOM A;  2K7D A;  5B8I B;  4WRI A;  3ZWH A;  1SL7 A;  4MN0 A;  2JRF A;  3OB1 B;  2JOJ A;  2GGZ A;  2OS8 C;  3LLE A;  3TDU A;  4CLN A;  1SCV A;  1IJ6 A;  1EG4 A;  1X02 A;  1DJH A;  1ZAC A;  2TN4 A;  4OVN F;  4BY4 A;  4YGB B;  1NX2 A;  1PSB A;  4DUQ A;  3PFV A;  1CFP A;  1CLB A;  1S6C A;  4U8D A;  5AFP A;  1OMR A;  3KO0 A;  3GK1 A;  1XFZ O;  2FCE A;  4GPL B;  1J7Q A;  3FIA A;  1XK4 C;  1KFX S;  1EL4 A;  4HRE E;  1K9U A;  1OSA A;  1EH2 A;  2BL0 B;  4GBA A;  1SNL A;  3EKH A;  4CFQ A;  1FW4 A;  1DVI A;  2EHB A;  2I18 A;  2KGB C;  2OTG B;  2JPT A;  1DTL A;  1ZMZ A;  1L2O B;  3OX5 A;  4N5X A;  4MZJ A;  1SYM A;  4PCW A;  5HLO A;  2LLU A;  1BF5 A;  4PE1 A;  2O5G A;  3TUY C;  1S26 D;  1KSM A;  3DVE A;  4XJK B;  4JPZ B;  4UPG A;  4PHM A;  2K8M B;  1QLK A;  2JT3 A;  1QS7 A;  2BKI B;  2MAZ A;  1YR5 A;  3CZT X;  5KU1 A;  5AXI A;  4MLW A;  5F6T A;  1K9K A;  4WQ3 A;  1B8R A;  1WRL A;  2L50 A;  2R2I A;  2SAS A;  1V1G A;  2H2K A;  4M2P A;  3C1V A;  3PN7 B;  4E68 A;  3SG6 A;  5DKR A;  3DD4 A;  2KAY A;  1ZFS A;  3BOW B;  3CWG A;  5PAL A;  2B1U A;  2MRD A;  1SY9 A;  2JNF A;  2JT0 A;  5HKW A;  2FJU B;  3A8R A;  3WNX B;  2VRG A;  2MBX A;  1YUR A;  3I5H B;  2LLT A;  2WCB A;  2LMV A;  1CFC A;  2WCE A;  2PAS A;  4N1G A;  2KBM A;  2KYC A;  1CDN A;  4A4C A;  1F71 A;  1KFU S;  4M2O A;  1XFU O;  3EKJ A;  3NSK A;  3RLZ A;  4PE0 A;  1B1G A;  1BOD A;  1XFV O;  1FI5 A;  3H4S E;  2I94 A;  3I5F C;  3MSE B;  2LHL A;  4GGF C;  3AKA A;  1NSH A;  3PM8 A;  3AKB A;  1K2H A;  1ZOT B;  3ZNI A;  4NDC A;  5CPV A;  4MZL A;  1PK0 D;  1XA5 A;  3LL8 B;  1OE9 B;  1KK7 Z;  1BMO A;  2NLN A;  2KI6 C;  1CDP A;  1NX1 A;  3JTD B;  3DVK A;  5D7F A;  2L4I A;  1BR1 B;  1CDL A;  3SIB A;  2K7O A;  3BQ3 A;  2KSP A;  3DVM A;  2NCP A;  3TS5 C;  1AK8 A;  4XJK A;  1YVH A;  1R6P A;  1SCM C;  5I2O A; 
#chains in the Genus database with same CATH topology
 1WLM A;  2CNP A;  3O78 A;  5IBW A;  3EVR A;  1K94 A;  2KI4 C;  1TOP A;  3D75 A;  2LVI A;  1BU3 A;  2WC6 A;  1Y1U A;  1SR6 B;  1W9Z A;  2MLF C;  1DGU A;  1EXR A;  3BFB A;  2ZNE A;  1MF8 B;  3BFH A;  3O4X A;  4ORB B;  1AVS A;  5CSJ A;  5JOL A;  1YUT A;  3RZS A;  1DT7 B;  3S0D A;  1YVL A;  1JC2 A;  1IWQ A;  1KK7 Y;  1IGV A;  3IF7 A;  2PSR A;  2LP3 A;  5D3O A;  1SSE B;  3BOW A;  3CR5 X;  3IQO A;  4DRW A;  3BUN B;  1XO5 A;  5HKZ A;  2NCO A;  1J1D A;  3FWC A;  3D76 A;  1GM0 A;  2K60 A;  4ORA B;  4PHN A;  5I2Q A;  1ODB A;  2Q91 A;  5I2L A;  3S0F A;  1S1E A;  2BBM A;  4CFR A;  4C0K A;  1JF0 A;  1TTX A;  2LV7 A;  2WOR A;  3NHI A;  2KAX A;  3DXL A;  3HCM A;  1BT6 A;  1DF0 B;  2LAP A;  2QAC A;  5GQQ C;  1QX5 B;  2WCH A;  3BFA A;  1MQ1 A;  2L0P A;  3L4L A;  4NDB A;  2FJY A;  1SK6 D;  3DZT A;  1M45 A;  1IQ5 A;  2BBN A;  4FQO A;  1D1O A;  2M1K B;  2M49 B;  4GFT A;  1S5G Z;  2F2O A;  4HSZ A;  1YRT B;  1QVI Z;  1WDC B;  2ZN9 A;  3CGA A;  1A29 A;  1PAL A;  2WOS A;  4L9M A;  1V1F A;  3BUX B;  2EC6 B;  3N7H A;  1LXF C;  5EL2 A;  4NDD A;  1J1E A;  4YGA A;  3S0B A;  2FCD A;  1OOH A;  1DJI A;  4CID A;  3I5I B;  1NCZ A;  1OZO A;  3LK0 A;  1F55 A;  2HQW A;  3WHU B;  3OBV A;  2LUX A;  1AHR A;  1JFK A;  2D8N A;  1NCY A;  1KWO C;  1SBJ A;  1BJF A;  3PSR A;  2PQL A;  3BYA A;  1WLZ A;  2M29 A;  3I5G C;  1K90 D;  5DKQ A;  1F4O A;  2L2C A;  2YGU A;  5ER5 A;  2KQ6 A;  1QV0 A;  3PAL A;  1A2X A;  2KHN A;  1B47 A;  2KGR A;  2NXQ A;  2ZRS A;  4NQG A;  2Y1M A;  3R1P A;  5CSN A;  4ETO A;  4HRH A;  2P71 A;  2BKH B;  3D0Y A;  1K8U A;  1S5G Y;  4YGE B;  3KHE A;  1KK8 C;  1OQP A;  2KYF A;  4YGD B;  4JWQ A;  1NCX A;  3ICB A;  1QVI Y;  1SRA A;  3RM1 A;  1HT9 A;  2CXJ A;  2LM5 A;  1C7V A;  3JVT C;  2BCX A;  2WC5 A;  2ZKM X;  4P5O E;  1KQM C;  1TUZ A;  2F2P A;  3LK1 A;  5I8N A;  1RRO A;  1UP5 A;  2AAO A;  4DCK A;  1J7P A;  1Y6W A;  3TDI A;  2MA2 A;  3D74 A;  3SG5 A;  1N2D A;  1SL9 A;  3CR4 X;  1TNP A;  4DIR A;  1G4Y R;  4QJ5 B;  3B6X A;  1KCY A;  1F70 A;  3D77 A;  1UHH A;  2I2R E;  1S36 A;  1S3P A;  3CLN A;  2KFG A;  1AP4 A;  2GTE A;  1YRU B;  3R1V A;  1SL8 A;  1M39 A;  3FE9 A;  4AQJ A;  1OOJ A;  4P2Y B;  1J7O A;  2PRU A;  1TUJ A;  1KSO A;  1QIV A;  3BUW B;  2K2F A;  3DVJ A;  3SS5 A;  1PVA A;  4Q04 A;  1H4B A;  5KSZ A;  2L5X B;  3GOF A;  1DJX A;  3O6B A;  2JC2 A;  3BJH A;  3S0E A;  3SIA A;  3TZ1 A;  1CLM A;  2E6W A;  2CT9 A;  3CDN A;  1QTX A;  4DS7 A;  1BLQ A;  3DF0 B;  2CBL A;  4MEW A;  2JU0 A;  3EK7 A;  1YX8 A;  2ZRT A;  1Y1X A;  4QJ4 B;  1YTZ C;  3DYE A;  1XFX O;  1AUI B;  3QME A;  1M46 A;  4GNK B;  4MSP A;  1K9P A;  5AER A;  2F8P A;  2F3Y A;  1TCF A;  2SCP A;  3SG4 A;  2M97 A;  1LVC D;  1QAS A;  2KFF A;  3UNW A;  2WC8 A;  2PYQ A;  1C3Y A;  2JQ6 A;  2KLE A;  3HX4 A;  2OS8 B;  3FE8 A;  2NZ0 A;  2WCJ A;  4USL A;  5CSF A;  1JWD A;  1IQ3 A;  3B86 A;  4OCI A;  2KNE A;  1XFY O;  1W7I B;  3FS7 A;  2LMU A;  1CMG A;  1ZUZ A;  3F45 A;  3OP0 A;  1CFD A;  2PVB A;  3KPX A;  1CM4 A;  1Z4H A;  1CDM A;  2M7L A;  1GJY A;  1B4C A;  1B8C A;  2ZFD A;  4AQI A;  3L47 A;  5FI6 A;  2L51 A;  4IJ7 A;  1AJ5 A;  1NX3 A;  1S6J A;  1CLL A;  1OMD A;  3LCP C;  4PHJ A;  2JTZ A;  2M8U A;  1G33 A;  3FE6 A;  2HQ8 A;  1F4Q A;  2BL0 C;  1OZS A;  2BCB A;  3VRQ A;  1JBA A;  1K95 A;  2LVJ A;  2PMY A;  4KYN A;  2BEC A;  1TNQ A;  1SW8 A;  2OTG C;  3QRX A;  1UHN A;  1J55 A;  3TUY B;  1L2O C;  1L7Z A;  1CTR A;  2ZND A;  1SKT A;  3M0W A;  3R72 A;  4XYN A;  4F7F A;  1A03 A;  4YRU A;  2ZN8 A;  3TDZ A;  3NSL A;  5J3X A;  3OX6 A;  4R1E A;  1J7R A;  4MRY A;  3DF0 A;  3EVV A;  4I5J A;  1QLS A;  3NHT A;  2WCF A;  1K93 D;  3OB2 B;  2JUL A;  1FI6 A;  1BR4 B;  1QAT A;  1DJY A;  1S6I A;  1U5I B;  2M0R A;  3D10 A;  2JXC A;  3DY9 A;  1QX2 A;  5DIC A;  3PAT A;  1WRK A;  2Y4Q A;  1KQV A;  1MHO A;  4I5L B;  2WND A;  4MVF A;  4C0J A;  2F3Z A;  3D73 A;  2HET A;  1RK9 A;  2V53 A;  1FPW A;  4GGN A;  1F54 A;  2K7C A;  3PN7 C;  2Q4U A;  3O4Y A;  5BPJ A;  3O2P A;  3VB1 A;  2QEV A;  2LMT A;  2H8V A;  1DJG A;  4GUK A;  3EK4 A;  4BY5 A;  1TWO A;  1RTP 1;  2ISD A;  5CSI A;  1HQV A;  1YX7 A;  1LA0 A;  2LLS A;  1NP8 A;  3EG5 B;  1UUS A;  2JNX A;  2L98 A;  2QPT A;  4I5N B;  4JQ0 D;  2LVV A;  3BUO B;  3I5H C;  4M2Q A;  4FTG A;  1NWD A;  2K61 A;  2MLE C;  1M63 B;  2L4H A;  3I5F B;  3SG7 A;  1UWO A;  1XK4 A;  5TNC A;  3A4U B;  3FWB A;  3SJS A;  2JTT A;  1VRK A;  1TRF A;  5HL1 A;  1UHI A;  2I7A A;  1DMO A;  5AEQ A;  1A75 B;  2WCK A;  4YGC B;  1N0Y A;  4QJ3 B;  1Q80 A;  3WHT B;  3SS4 A;  1GGW A;  2WCM A;  1TCO B;  1PVB A;  3JTD C;  3K21 A;  4C0L A;  2K0J A;  1BOC A;  3TS5 B;  1F8H A;  1RWY A;  1M31 A;  1DGV A;  2G9B A;  1SCM B;  3GK2 A;  3KF9 A;  4PDZ A;  5D69 A;  4ICB A;  2DOQ A;  3PJI A;  1TIZ A;  2HF5 A;  5JJG A;  2LHI A;  1WRZ A;  2KI4 B;  4OV2 A;  3NXA A;  2PAL A;  2BCA A;  2EGD A;  1U5I A;  1LA3 A;  1DJW A;  4PT1 A;  1DF0 A;  1SR6 C;  2L5Y A;  4CPV A;  3SG2 A;  4OR9 B;  1RFJ A;  1TNW A;  3CR2 A;  2KBI A;  2HPS A;  1DJZ A;  2WCL A;  2A4J A;  1MXE A;  4PE4 A;  2GGM A;  4IL1 A;  1UHK A;  1AJ4 A;  4HRG A;  1SPY A;  2LAN A;  1H8B A;  2M3W A;  3Q8I A;  1MR8 A;  1REC A;  3SG3 A;  3WXA A;  2BAP A;  2G2B A;  3E3R A;  2LNK A;  4MBE A;  4YI9 A;  1MUX A;  1MWN A;  2BE4 A;  4D1E A;  1IJ5 A;  1NPQ A;  2LUC A;  4JKT A;  4ORC B;  1C3Z A;  1XYD A;  2KDH A;  4GGF A;  1NX0 A;  4GAO A;  1CKK A;  2Y5I A;  2BE6 A;  4PE7 A;  1JFJ A;  1KFX L;  2QEO A;  1GQM A;  5K89 A;  1YUS A;  5G08 A;  1DEK A;  3KEV A;  3CS1 A;  1UUR A;  5KTY A;  5AAN A;  1IH0 A;  1G8I A;  1LKJ A;  1A75 A;  1GGZ A;  2M7N A;  2M9G A;  1JF2 A;  2IS9 A;  1NUB A;  2LC5 A;  1YUU A;  3BUM B;  1EJ3 A;  1TNX A;  5DKN A;  3R1O A;  4F0Z B;  3NSI A;  3CTN A;  3L4A A;  1WDC C;  1IRJ A;  3IQQ A;  3PM2 A;  1B7T Z;  1IKU A;  2E30 A;  1UHJ A;  1NIW A;  2EC6 C;  2JWW A;  1CNP A;  4MRX A;  1QX7 A;  1A4P A;  2O60 A;  1QJT A;  1KWO B;  3IVT A;  4TNC A;  3VRR A;  1CB1 A;  2Y1N A;  3EK8 A;  3I5I C;  2CCM A;  3VRN A;  3I5G B;  1FBV A;  1NYA A;  2CTN A;  1XFR A;  1C07 A;  4ZCV A;  1ALV A;  4PHK A;  1B9A A;  5I94 A;  4OKH A;  1OOI X;  1B8L A;  1KK8 B;  2AMI A;  2H61 A;  2F33 A;  1K96 A;  3VRO A;  2K7B A;  2KQY A;  3GK4 X;  4PAL A;  2JT8 A;  3AAK A;  3JVT B;  4YI8 A;  4N1F A;  4OZD A;  1WY9 A;  1CFF A;  1KQM B;  3VRP A;  2KFH A;  1B7T Y;  1PSR A;  2JZI A;  1R2U A;  1QIW A;  2LVK A;  2OPO A;  3S0A A;  2JXL A;  5FYX A;  1KFU L;  2RGI A;  4WQ2 A;  3VGO A;  1T14 A;  1C7W A;  4ZCU A;  1CMF A;  1XVJ A;  1CM1 A;  3PLF B;  1PUL A;  1Y1A A;  4YBH B;  1LIN A;  1W7J B;  2LP2 A;  3CZ2 A;  1IG5 A;  5HLV A;  1E8A A;  1PRW A;  3NSO A;  2QDI A;  2MJW B;  3OHM B;  3EVU A;  4INW A;  1JSA A;  1Z2C B;  3D0Y B;  4JD9 A;  2H61 C;  2M1U A;  1MXL C;  4A4B A;  5HYD A;  2COL B;  1OMV A;  4I5K A;  1BG1 A;  3D78 A;  2KOT A;  3B88 A;  3BXK A;  2LE9 B;  1Y0V H;  2GV5 A;  4MZK A;  2FOT A;  1JUO A;  1FF1 A;  2LCP A;  2KAV A;  2P6B B;  5HKY A;  5ER4 X;  2L2E A;  3AAJ A;  1DEL A;  2K2A A;  1ALW A;  1XFW O;  2JPO A;  1EG3 A;  1TN4 A;  2AUC A;  1QV1 A;  1RJV A;  1N65 A;  2KI6 D;  2MHH A;  1QXP A;  1SMG A;  3K1E A;  4AOM A;  2K7D A;  5B8I B;  4WRI A;  3ZWH A;  1SL7 A;  2BNX A;  4MN0 A;  2JRF A;  3OB1 B;  2JOJ A;  3B87 A;  2GGZ A;  2OS8 C;  3LLE A;  3TDU A;  4CLN A;  1SCV A;  1IJ6 A;  1EG4 A;  1X02 A;  1DJH A;  1ZAC A;  2TN4 A;  4OVN F;  5FI2 A;  4BY4 A;  4YGB B;  1NX2 A;  1PSB A;  4DUQ A;  3PFV A;  1DQE A;  1CFP A;  1CLB A;  1S6C A;  4U8D A;  5AFP A;  1OMR A;  3KO0 A;  3GK1 A;  1XFZ O;  2FCE A;  4GPL B;  1J7Q A;  3FIA A;  1XK4 C;  3SS3 A;  1KFX S;  1EL4 A;  3CAB A;  4HRE E;  1K9U A;  1DC1 A;  1OSA A;  1EH2 A;  2BL0 B;  4GBA A;  3CYZ A;  1SNL A;  3NGV A;  3EKH A;  4CFQ A;  1FW4 A;  1DVI A;  2EHB A;  2I18 A;  2KGB C;  2OTG B;  2JPT A;  1DTL A;  1ZMZ A;  1L2O B;  3OX5 A;  4N5X A;  4MZJ A;  1SYM A;  4PCW A;  5HLO A;  2LLU A;  1BF5 A;  4PE1 A;  2O5G A;  3TUY C;  1S26 D;  1KSM A;  2KPH A;  3DVE A;  4JPZ B;  4XJK B;  1OW4 A;  4PHM A;  2K8M B;  4UPG A;  1QLK A;  2JT3 A;  1QS7 A;  2BKI B;  2MAZ A;  1YR5 A;  3CZT X;  5FI7 A;  5KU1 A;  1OOF A;  4FQT A;  4MLW A;  5AXI A;  4INX A;  5F6T A;  1K9K A;  4WQ3 A;  1B8R A;  1WRL A;  2QEB A;  2L50 A;  2R2I A;  2SAS A;  1V1G A;  2H2K A;  4M2P A;  3B7A A;  3C1V A;  1QWV A;  3PN7 B;  3CZ0 A;  5I2O A;  4E68 A;  3SG6 A;  5DKR A;  3DD4 A;  2KAY A;  1ZFS A;  3BOW B;  3CWG A;  5PAL A;  2B1U A;  2MRD A;  1SY9 A;  2JNF A;  2JT0 A;  5HKW A;  2FJU B;  3A8R A;  3WNX B;  1IIO A;  2VRG A;  2MBX A;  3S0G A;  1YUR A;  3I5H B;  1LS8 A;  2LLT A;  2QEH A;  2WCB A;  2LMV A;  2KLD A;  1CFC A;  2WCE A;  2PAS A;  4N1G A;  2KBM A;  2KYC A;  1CDN A;  4A4C A;  1F71 A;  1KFU S;  4M2O A;  1XFU O;  3EKJ A;  3NSK A;  3RLZ A;  4PE0 A;  1B1G A;  3CZ1 A;  1XFV O;  1BOD A;  2P70 A;  1FI5 A;  3H4S E;  2I94 A;  3I5F C;  3MSE B;  2LHL A;  4GGF C;  3AKA A;  3UO9 A;  1NSH A;  3PM8 A;  3AKB A;  1K2H A;  1ZOT B;  3ZNI A;  4NDC A;  5CPV A;  4MZL A;  1PK0 D;  1XA5 A;  3LL8 B;  1OE9 B;  1ORG A;  1KK7 Z;  1BMO A;  2NLN A;  2KI6 C;  1CDP A;  1NX1 A;  3JTD B;  3DVK A;  5D7F A;  2L4I A;  1BR1 B;  1CDL A;  1OOG A;  3SIB A;  2K7O A;  1P28 A;  3BQ3 A;  2KSP A;  3DVM A;  3V2L A;  2NCP A;  3OGN A;  3TS5 C;  1AK8 A;  4XJK A;  1YVH A;  1R6P A;  1SCM C;  2ERB A; 
#chains in the Genus database with same CATH homology
 1WLM A;  2CNP A;  3O78 A;  5IBW A;  3EVR A;  1K94 A;  2KI4 C;  1TOP A;  2LVI A;  1BU3 A;  1Y1U A;  1SR6 B;  2MLF C;  1DGU A;  1EXR A;  4ORB B;  2ZNE A;  1MF8 B;  5CSJ A;  5JOL A;  1DT7 B;  1AVS A;  1YUT A;  1YVL A;  1JC2 A;  1IWQ A;  1KK7 Y;  1IGV A;  3IF7 A;  2PSR A;  2LP3 A;  3BOW A;  3CR5 X;  3IQO A;  4DRW A;  3BUN B;  1XO5 A;  5HKZ A;  2NCO A;  1J1D A;  3FWC A;  4ORA B;  4PHN A;  5I2Q A;  1ODB A;  2Q91 A;  5I2L A;  1S1E A;  2BBM A;  4CFR A;  4C0K A;  1JF0 A;  1TTX A;  2LV7 A;  2WOR A;  2KAX A;  5GQQ C;  3HCM A;  1BT6 A;  1DF0 B;  2LAP A;  2QAC A;  1QX5 B;  1MQ1 A;  2L0P A;  4NDB A;  1SK6 D;  1M45 A;  1IQ5 A;  2BBN A;  4FQO A;  1D1O A;  2M1K B;  2M49 B;  4GFT A;  1S5G Z;  2F2O A;  4HSZ A;  1YRT B;  1QVI Z;  1WDC B;  2ZN9 A;  3CGA A;  1A29 A;  1PAL A;  2WOS A;  4L9M A;  1V1F A;  3BUX B;  2EC6 B;  1LXF C;  4NDD A;  1J1E A;  4YGA A;  2FCD A;  1DJI A;  4CID A;  3I5I B;  1NCZ A;  1OZO A;  3LK0 A;  1F55 A;  2HQW A;  3WHU B;  2LUX A;  1AHR A;  1JFK A;  2D8N A;  1NCY A;  1KWO C;  1SBJ A;  1BJF A;  3PSR A;  3BYA A;  1WLZ A;  2M29 A;  3I5G C;  1K90 D;  5DKQ A;  1F4O A;  5ER5 A;  2KQ6 A;  1QV0 A;  3PAL A;  1A2X A;  2KHN A;  1B47 A;  2KGR A;  2NXQ A;  2ZRS A;  4NQG A;  2Y1M A;  5CSN A;  4ETO A;  4HRH A;  2BKH B;  3D0Y A;  1K8U A;  1S5G Y;  4YGE B;  3KHE A;  1KK8 C;  1OQP A;  2KYF A;  4YGD B;  4JWQ A;  1NCX A;  3ICB A;  1QVI Y;  1SRA A;  3RM1 A;  1HT9 A;  2CXJ A;  2LM5 A;  1C7V A;  3JVT C;  2BCX A;  2ZKM X;  4P5O E;  1KQM C;  1J7P A;  2F2P A;  3LK1 A;  5I8N A;  1RRO A;  1UP5 A;  2AAO A;  4DCK A;  1Y6W A;  3TDI A;  2MA2 A;  3SG5 A;  1N2D A;  1SL9 A;  3CR4 X;  1TNP A;  4DIR A;  1G4Y R;  4QJ5 B;  1KCY A;  1F70 A;  1UHH A;  2I2R E;  1S36 A;  1S3P A;  3CLN A;  2KFG A;  1AP4 A;  1YRU B;  1SL8 A;  1M39 A;  4AQJ A;  1OOJ A;  4P2Y B;  1J7O A;  2PRU A;  3BUW B;  1KSO A;  1QIV A;  2K2F A;  3DVJ A;  1PVA A;  4Q04 A;  1H4B A;  5KSZ A;  2L5X B;  3GOF A;  1DJX A;  3O6B A;  2JC2 A;  3TZ1 A;  3SIA A;  1CLM A;  2E6W A;  2CT9 A;  1QTX A;  4DS7 A;  1BLQ A;  3DF0 B;  2CBL A;  4MEW A;  2JU0 A;  3EK7 A;  1YX8 A;  2ZRT A;  1Y1X A;  4QJ4 B;  1YTZ C;  1XFX O;  1AUI B;  1M46 A;  4GNK B;  4MSP A;  1K9P A;  5AER A;  2F8P A;  2F3Y A;  1TCF A;  2SCP A;  3SG4 A;  2M97 A;  1LVC D;  1QAS A;  2KFF A;  2WC8 A;  2JQ6 A;  3HX4 A;  2OS8 B;  2NZ0 A;  4USL A;  5CSF A;  1JWD A;  1IQ3 A;  4OCI A;  2KNE A;  1XFY O;  1W7I B;  3FS7 A;  2LMU A;  1CMG A;  1ZUZ A;  3F45 A;  3OP0 A;  1CFD A;  2PVB A;  3KPX A;  1CM4 A;  1CDM A;  2M7L A;  1GJY A;  1B4C A;  1B8C A;  2ZFD A;  4AQI A;  2L51 A;  1AJ5 A;  1NX3 A;  1S6J A;  1CLL A;  1OMD A;  3LCP C;  4PHJ A;  2JTZ A;  2M8U A;  1G33 A;  2HQ8 A;  1F4Q A;  2BL0 C;  1OZS A;  2BCB A;  3VRQ A;  1JBA A;  1K95 A;  2LVJ A;  2PMY A;  2BEC A;  1TNQ A;  1SW8 A;  2OTG C;  3QRX A;  1UHN A;  1J55 A;  3TUY B;  1L2O C;  1L7Z A;  1CTR A;  2ZND A;  1SKT A;  3M0W A;  4XYN A;  1A03 A;  4YRU A;  2ZN8 A;  3TDZ A;  3NSL A;  5J3X A;  3OX6 A;  4R1E A;  1J7R A;  4MRY A;  3DF0 A;  3EVV A;  4I5J A;  1QLS A;  2WCF A;  1K93 D;  3OB2 B;  2JUL A;  1FI6 A;  1BR4 B;  1QAT A;  1DJY A;  1S6I A;  1U5I B;  2M0R A;  3D10 A;  2JXC A;  1QX2 A;  3PAT A;  1WRK A;  2Y4Q A;  1KQV A;  1MHO A;  4I5L B;  2WND A;  4MVF A;  4C0J A;  2F3Z A;  2HET A;  1RK9 A;  2V53 A;  1FPW A;  4GGN A;  1F54 A;  2K7C A;  3PN7 C;  2Q4U A;  3O4Y A;  5BPJ A;  3O2P A;  2LMT A;  1DJG A;  4GUK A;  3EK4 A;  4BY5 A;  1RTP 1;  2ISD A;  5CSI A;  1HQV A;  1YX7 A;  1LA0 A;  2LLS A;  1NP8 A;  1UUS A;  2JNX A;  2L98 A;  2QPT A;  4I5N B;  4JQ0 D;  2LVV A;  3BUO B;  3I5H C;  4M2Q A;  4FTG A;  1NWD A;  2K61 A;  2MLE C;  1M63 B;  2L4H A;  3I5F B;  3SG7 A;  1UWO A;  1XK4 A;  5TNC A;  3A4U B;  3FWB A;  3SJS A;  2JTT A;  1VRK A;  1TRF A;  1UHI A;  2I7A A;  1DMO A;  5AEQ A;  1A75 B;  4YGC B;  1N0Y A;  4QJ3 B;  1Q80 A;  3WHT B;  1GGW A;  1TCO B;  1PVB A;  3JTD C;  3K21 A;  4C0L A;  2K0J A;  1BOC A;  3TS5 B;  1F8H A;  1RWY A;  1M31 A;  1DGV A;  2G9B A;  1SCM B;  3GK2 A;  3KF9 A;  4PDZ A;  5D69 A;  4ICB A;  2DOQ A;  1TIZ A;  2HF5 A;  5JJG A;  2LHI A;  1WRZ A;  2KI4 B;  4OV2 A;  3NXA A;  2PAL A;  2BCA A;  2EGD A;  1U5I A;  1LA3 A;  1DJW A;  1DF0 A;  1SR6 C;  4CPV A;  3SG2 A;  4OR9 B;  1RFJ A;  1TNW A;  3CR2 A;  2KBI A;  2HPS A;  1DJZ A;  2A4J A;  1MXE A;  4PE4 A;  2GGM A;  4IL1 A;  1UHK A;  1AJ4 A;  4HRG A;  1SPY A;  2LAN A;  1H8B A;  2M3W A;  3SG3 A;  1MR8 A;  1REC A;  3WXA A;  2G2B A;  3E3R A;  2LNK A;  4MBE A;  4YI9 A;  1MUX A;  1MWN A;  2BE4 A;  4D1E A;  1IJ5 A;  1NPQ A;  2LUC A;  4ORC B;  1XYD A;  2KDH A;  4GGF A;  1NX0 A;  4GAO A;  1CKK A;  2Y5I A;  2BE6 A;  4PE7 A;  1JFJ A;  1KFX L;  1GQM A;  5K89 A;  1YUS A;  5G08 A;  3KEV A;  3CS1 A;  1UUR A;  5KTY A;  5AAN A;  1IH0 A;  1G8I A;  1LKJ A;  1A75 A;  1GGZ A;  2M7N A;  2M9G A;  1JF2 A;  2IS9 A;  1NUB A;  2LC5 A;  1YUU A;  3BUM B;  1EJ3 A;  1TNX A;  5DKN A;  4F0Z B;  3NSI A;  3CTN A;  1WDC C;  1IRJ A;  3IQQ A;  1IKU A;  1B7T Z;  2E30 A;  1UHJ A;  1NIW A;  2EC6 C;  2JWW A;  1CNP A;  4MRX A;  1QX7 A;  1A4P A;  2O60 A;  1QJT A;  1KWO B;  4TNC A;  3VRR A;  1CB1 A;  2Y1N A;  3EK8 A;  3I5I C;  2CCM A;  3VRN A;  3I5G B;  1FBV A;  1NYA A;  2CTN A;  1C07 A;  4ZCV A;  1ALV A;  4PHK A;  1B9A A;  4OKH A;  1B8L A;  1KK8 B;  2AMI A;  2H61 A;  2F33 A;  1K96 A;  3VRO A;  2K7B A;  2KQY A;  3GK4 X;  4PAL A;  2JT8 A;  3AAK A;  3JVT B;  4YI8 A;  4N1F A;  1WY9 A;  1CFF A;  1KQM B;  3VRP A;  2KFH A;  1B7T Y;  1PSR A;  2JZI A;  1R2U A;  1QIW A;  2LVK A;  2OPO A;  2JXL A;  5FYX A;  1KFU L;  2RGI A;  4WQ2 A;  3VGO A;  1C7W A;  4ZCU A;  1CMF A;  1XVJ A;  1CM1 A;  3PLF B;  1PUL A;  1Y1A A;  4YBH B;  1LIN A;  1W7J B;  2LP2 A;  5HLV A;  1IG5 A;  1E8A A;  1PRW A;  3NSO A;  3OHM B;  2MJW B;  3EVU A;  1JSA A;  3D0Y B;  2H61 C;  2M1U A;  1MXL C;  4A4B A;  5HYD A;  2COL B;  1OMV A;  4I5K A;  1BG1 A;  2KOT A;  3BXK A;  2LE9 B;  1Y0V H;  2GV5 A;  4MZK A;  2FOT A;  1JUO A;  1FF1 A;  2LCP A;  2KAV A;  2P6B B;  5HKY A;  5ER4 X;  2L2E A;  3AAJ A;  2K2A A;  1ALW A;  1XFW O;  1EG3 A;  1TN4 A;  2AUC A;  1QV1 A;  1RJV A;  1N65 A;  2KI6 D;  2MHH A;  1QXP A;  1SMG A;  4AOM A;  2K7D A;  5B8I B;  4WRI A;  3ZWH A;  1SL7 A;  4MN0 A;  2JRF A;  3OB1 B;  2JOJ A;  2GGZ A;  2OS8 C;  3LLE A;  3TDU A;  4CLN A;  1SCV A;  1IJ6 A;  1EG4 A;  1X02 A;  1DJH A;  1ZAC A;  2TN4 A;  4OVN F;  4BY4 A;  4YGB B;  1NX2 A;  1PSB A;  4DUQ A;  3PFV A;  1CFP A;  1CLB A;  1S6C A;  4U8D A;  5AFP A;  1OMR A;  3KO0 A;  3GK1 A;  1XFZ O;  2FCE A;  4GPL B;  1J7Q A;  3FIA A;  1XK4 C;  1KFX S;  1EL4 A;  4HRE E;  1K9U A;  1OSA A;  1EH2 A;  2BL0 B;  4GBA A;  1SNL A;  3EKH A;  4CFQ A;  1FW4 A;  1DVI A;  2EHB A;  2I18 A;  2KGB C;  2OTG B;  2JPT A;  1DTL A;  1ZMZ A;  1L2O B;  3OX5 A;  4N5X A;  4MZJ A;  1SYM A;  4PCW A;  5HLO A;  2LLU A;  1BF5 A;  4PE1 A;  2O5G A;  3TUY C;  1S26 D;  1KSM A;  3DVE A;  4XJK B;  4JPZ B;  4UPG A;  4PHM A;  2K8M B;  1QLK A;  2JT3 A;  1QS7 A;  2BKI B;  2MAZ A;  1YR5 A;  3CZT X;  5KU1 A;  5AXI A;  4MLW A;  5F6T A;  1K9K A;  4WQ3 A;  1B8R A;  1WRL A;  2L50 A;  2R2I A;  2SAS A;  1V1G A;  2H2K A;  4M2P A;  3C1V A;  3PN7 B;  4E68 A;  3SG6 A;  5DKR A;  3DD4 A;  2KAY A;  1ZFS A;  3BOW B;  3CWG A;  5PAL A;  2B1U A;  2MRD A;  1SY9 A;  2JNF A;  2JT0 A;  5HKW A;  2FJU B;  3A8R A;  3WNX B;  2VRG A;  2MBX A;  1YUR A;  3I5H B;  2LLT A;  2WCB A;  2LMV A;  1CFC A;  2WCE A;  2PAS A;  4N1G A;  2KBM A;  2KYC A;  1CDN A;  4A4C A;  1F71 A;  1KFU S;  4M2O A;  1XFU O;  3EKJ A;  3NSK A;  3RLZ A;  4PE0 A;  1B1G A;  1BOD A;  1XFV O;  1FI5 A;  3H4S E;  2I94 A;  3I5F C;  3MSE B;  2LHL A;  4GGF C;  3AKA A;  1NSH A;  3PM8 A;  3AKB A;  1K2H A;  1ZOT B;  3ZNI A;  4NDC A;  5CPV A;  4MZL A;  1PK0 D;  1XA5 A;  3LL8 B;  1OE9 B;  1KK7 Z;  1BMO A;  2NLN A;  2KI6 C;  1CDP A;  1NX1 A;  3JTD B;  3DVK A;  5D7F A;  2L4I A;  1BR1 B;  1CDL A;  3SIB A;  2K7O A;  3BQ3 A;  2KSP A;  3DVM A;  2NCP A;  3TS5 C;  1AK8 A;  4XJK A;  1YVH A;  1R6P A;  1SCM C;  5I2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...