1EL4A

Structure of the calcium-regulated photoprotein obelin determined by sulfur sas
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
SSKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBELIN
publication title Structure of the Ca2+-regulated photoprotein obelin at 1.7 A resolution determined directly from its sulfur substructure.
pubmed rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 74
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1el4A00
5AFPA 1CFFA 1NYAA 2O60A 3KO0A 1C07A 1GQMA 1R2UA 3NSKA 2OTGB 1BT6A 1HT9A 3SG2A 4MRYA 2JU0A 1ZOTB 1MXEA 1ZUZA 2L51A 3I5IC 3NSOA 4PALA 4YI8A 1YUSA 2H61C 2SCPA 1CM1A 1K9KA 1UHHA 2K7CA 3O4YA 1SPYA 3OX6A 3WXAA 1BJFA 1MWNA 4U8DA 1DTLA 2BL0B 2FCEA 3RLZA 2Y1NA 3FWCA 2KSPA 1GGZA 2K2AA 1JF2A 5I2QA 1KSMA 1OMDA 4YI9A 3CR2A 3BUWB 1KSOA 3CR5X 1B7TY 1F55A 2NXQA 1K90D 3EVVA 4I5JA 1UURA 1XFXO 3GK1A 5HKZA 1QXPA 1AHRA 3D0YB 1JF0A 4WQ2A 3EKJA 1IQ3A 1B8RA 2PVBA 1AP4A 2H61A 1S36A 1YX7A 3OHMB 1CTRA 1QS7A 5AEQA 3BOWB 3BUXB 4YGAA 1K96A 1IRJA 1KK8C 1TN4A 2KYCA 3VRQA 2AAOA 1LVCD 3TUYB 1RFJA 4OCIA 3SG6A 1ZMZA 1K95A 1DMOA 3JVTC 3PFVA 4AQIA 1CM4A 1DGVA 1MHOA 2JWWA 1VRKA 1NSHA 2LVJA 4GGNA 1AK8A 3KHEA 1SR6C 4XJKA 4GGFA 4UPGA 3LCPC 1YR5A 1MUXA 1TIZA 2E6WA 2L2EA 4NDDA 2COLB 2KI6D 1DJHA 2ZNDA 3I5FB 1FF1A 1IKUA 2JTZA 4ICBA 3VROA 4DIRA 3ZNIA 1BR1B 1B9AA 2KI6C 1IJ5A 2EC6B 1WRLA 5CSJA 5I8NA 3AAJA 4GNKB 5AANA 3PM8A 2KI4C 4MEWA 1BG1A 1TCOB 1ZFSA 1NUBA 2GGMA 1XA5A 4ETOA 1PULA 3HCMA 1LINA 4QJ5B 1S6CA 1XK4C 2PASA 1FPWA 5F6TA 1QJTA 2G9BA 1DJXA 2JNXA 1CDMA 3CZTX 4ZCVA 4USLA 2HQWA 2ZRSA 3O2PA 5KSZA 1EH2A 2MA2A 1J7QA 2ZN8A 1GJYA 1KK7Y 1SL7A 2FJUB 3SJSA 1B4CA 1QX7A 3IQQA 2LANA 2KFFA 4JWQA 1EG3A 2Y1MA 4DRWA 2Y5IA 2JRFA 2JPTA 1BODA 1F4QA 3EK7A 1SCVA 1TOPA 1LKJA 1PK0D 3FWBA 2KAVA 1LA3A 1UWOA 3GK2A 1CLLA 1QLKA 1NCZA 3DVMA 1D1OA 1UUSA 1ALWA 2OS8B 4YGCB 1NX2A 1DJZA 1BR4B 1DVIA 5D69A 5DKNA 1DJIA 3DF0A 2MAZA 4ORCB 3ZWHA 3GK4X 3KEVA 3TDZA 3BUNB 4NDCA 1OMVA 1N65A 2KAYA 4PCWA 2KHNA 1B8CA 2L50A 3CS1A 1NCYA 3RM1A 2QACA 1F54A 1AVSA 1E8AA 1WRZA 2WCFA 1QVIZ 2WCEA 3E3RA 3NSLA 1BF5A 1XFYO 1Q80A 1B1GA 1DF0B 1TRFA 1JFKA 3D10A 2M29A 5HYDA 1SKTA 1J55A 1FW4A 1YRTB 1J1DA 3LK1A 4PE4A 2F2OA 2RGIA 1CDPA 3EKHA 3JVTB 4I5NB 3LL8B 5CSIA 3I5GB 1LA0A 3NSIA 4GFTA 1FI6A 2K8MB 2NCOA 2CTNA 1A75B 4CFRA 3PLFB 4MZKA 1SCMB 1M45A 3TS5B 1S1EA 2F3ZA 2SASA 3JTDC 2JT8A 2ISDA 2M7NA 1XFZO 1EL4A 1AUIB 3OB2B 4PE0A 2BCXA 1K93D 1DJWA 1F70A 1RJVA 2LV7A 2M9GA 2AUCA 2HQ8A 2KQYA 2CXJA 1JWDA 1WDCB 2KGRA 1JC2A 1AJ4A 3C1VA 2JXCA 3GOFA 2LP3A 1OOJA 2F8PA 5J3XA 3OX5A 5I2LA 3CTNA 1S6JA 4D1EA 3TDUA 4GGFC 1QX2A 4YGBB 4I5LB 1Y6WA 1DJGA 1SRAA 1YVLA 1KWOB 1UHKA 1W7JB 3PATA 1M31A 1QIVA 2LLTA 1SNLA 2BE4A 1L2OB 1YVHA 3A4UB 2BE6A 1EJ3A 1GGWA 3I5HC 1TNXA 1H8BA 3LLEA 4GBAA 1CB1A 4A4CA 4N1GA 5AERA 1CMFA 1KQMB 1RTP1 1NX3A 2LHIA 1B47A 1PVAA 2LE9B 2M8UA 3SG5A 1KCYA 1ZACA 2IS9A 4C0KA 1K9UA 2BECA 1Y1AA 4HRHA 2KFHA 1WRKA 3KPXA 1G33A 1J1EA 1V1FA 1WLMA 4MZLA 4QJ3B 1A4PA 1TNPA 1QASA 2D8NA 2NZ0A 2F2PA 3WHUB 4CFQA 1IGVA 1ODBA 2L4HA 4GUKA 4PE7A 2LUCA 2OTGC 4M2QA 4FQOA 1RECA 1A29A 1FBVA 2ZFDA 3VRPA 1KFUS 1TCFA 1IG5A 4YBHB 2TN4A 5B8IB 1U5IB 1YTZC 2L5XB 1QX5B 2PALA 3PN7C 1CDLA 3IQOA 4OR9B 1PVBA 1L7ZA 2BL0C 4CIDA 3FIAA 1CDNA 1F8HA 5ER5A 3DVEA 2KBIA 1XYDA 1DF0A 5ER4X 4DUQA 4TNCA 2HF5A 5K89A 1OMRA 2VRGA 4PHMA 1PSBA 1YRUB 4OKHA 4Q04A 4PHNA 1J7OA 3O6BA 1K9PA 3PALA 1SY9A 1YURA 2K0JA 1RK9A 3VRRA 1PSRA 1QTXA 1BU3A 4MRXA 5JOLA 1C7VA 2I94A 4M2PA 4C0LA 2KBMA 2F3YA 2H2KA 4PDZA 3I5IB 5HKYA 5CPVA 4PHJA 2F33A 4MVFA 2FCDA 3EK4A 3AKBA 2BBMA 4FTGA 1SMGA 1YUTA 2MHHA 5FYXA 3VRNA 2HPSA 4DCKA 1LXFC 1KFXS 3VGOA 2KYFA 4HRGA 3D0YA 4A4BA 5G08A 5D7FA 3MSEB 1S5GZ 1BMOA 3EK8A 2WOSA 2WC8A 1KFUL 3IF7A 4HREE 1K2HA 2EHBA 1TNQA 5DKQA 3CLNA 5CSNA 4P2YB 1NIWA 3BOWA 4XJKB 2LUXA 3I5FC 1M63B 2WNDA 4I5KA 1M46A 2KQ6A 1N0YA 1NX0A 1M39A 4YRUA 2EC6C 2FOTA 1A03A 1UHIA 3EVRA 2JZIA 1XFUO 1XFVO 2JC2A 1NPQA 1KK8B 1NWDA 2MBXA 3WNXB 4BY4A 4PE1A 4F0ZB 1A2XA 1QVIY 3KF9A 1CLBA 3PSRA 2ZKMX 3H4SE 2CCMA 2O5GA 1MR8A 2BBNA 3EVUA 1SR6B 3NXAA 4NQGA 4MSPA 4YGEB 5HKWA 2WCBA 3OB1B 2K7BA 4MLWA 4DS7A 1WY9A 3A8RA 1EXRA 2KNEA 1X02A 4CLNA 4ORAB 4NDBA 3K21A 5DKRA 2M7LA 5GQQC 1U5IA 2Q91A 4OV2A 1K94A 2K2FA 4R1EA 5HLOA 3DVJA 1KFXL 1FI5A 3LK0A 2Y4QA 1J7PA 1ALVA 1SBJA 1B8LA 3DVKA 1S6IA 3OP0A 2KI4B 1B7TZ 2OS8C 1SL8A 2BKIB 1IQ5A 2AMIA 2JT3A 3PN7B 2LAPA 4GAOA 5HLVA 4WRIA 3CWGA 1C7WA 2KOTA 3SIAA 1CFPA 1QV0A 2A4JA 4N1FA 2JQ6A 5IBWA 2K7DA 2L4IA 1XO5A 2M49B 1HQVA 1J7RA 2R2IA 3M0WA 2JOJA 2G2BA 1PALA 4BY5A 1UHJA 3DF0B 1NP8A 2HETA 5KU1A 1SK6D 4CPVA 1YX8A 5JJGA 1EG4A 2PRUA 1OZSA 4GPLB 2LVVA 3AAKA 1Y1XA 2B1UA 2LMTA 3BUOB 2MLFC 2BKHB 1NX1A 1F71A 2KAXA 1JBAA 1QIWA 4ORBB 3SG3A 3CGAA 2M97A 2LP2A 1XVJA 1S26D 4AOMA 2KFGA 2MLEC 5PALA 1DT7B 3FS7A 2NLNA 4AQJA 4L9MA 3I5GC 1QLSA 4M2OA 2PSRA 4N5XA 2LVIA 2OPOA 3WHTB 3BQ3A 1SCMC 1PRWA 2BCBA 4HSZA 3TS5C 2ZNEA 2M1UA 1NCXA 1XFWO 4IL1A 2KDHA 2MJWB 1CMGA 1BOCA 2WORA 2JT0A 1F4OA 1SW8A 2BCAA 1WDCC 4WQ3A 3F45A 1OQPA 2K7OA 4MN0A 1JSAA 1SYMA 2QPTA 2ZN9A 4C0JA 4E68A 2GV5A 1Y1UA 2K61A 2JULA 1KQVA 2LM5A 1CKKA 1A75A 2DOQA 1Y0VH 2I18A 5AXIA 2KGBC 3HX4A 1MXLC 1CFCA 3SIBA 2I2RE 1KWOC 3SG7A 1KK7Z 5BPJA 3BUMB 2JNFA 1DGUA 1L2OC 1OSAA 1SL9A 2CT9A 2EGDA 1QATA 1K8UA 3TUYC 2LC5A 3JTDB 1MQ1A 3TDIA 1R6PA 1AJ5A 2E30A 3CR4X 4XYNA 1UP5A 1RROA 2CNPA 1KQMC 1YUUA 2L98A 2LHLA 2GGZA 1CNPA 1WLZA 2CBLA 2PMYA 4QJ4B 2LMUA 2V53A 3QRXA 2M1KB 2M3WA 4ZCUA 2ZRTA 1G8IA 1IJ6A 2LMVA 4JPZB 3BYAA 1XK4A 1W7IB 2LVKA 4YGDB 1CFDA 1S5GY 1CLMA 1QV1A 2LCPA 2M0RA 3TZ1A 3AKAA 1N2DA 3O78A 3DD4A 5I2OA 4MBEA 2Q4UA 1TNWA 2L0PA 3I5HB 2LNKA 1MF8B 1OZOA 2JTTA 5CSFA 1TTXA 1IWQA 1H4BA 1V1GA 4JQ0D 1JUOA 2LLUA 4P5OE 5KTYA 1BLQA 1IH0A 4MZJA 3ICBA 1G4YR 4PHKA 4OVNF 3BXKA 1DJYA 2LLSA 1RWYA 1JFJA 2MRDA 2NCPA 1S3PA 1UHNA 1OE9B 3SG4A 2P6BB 2JXLA 5TNCA 2I7AA
chains in the Genus database with same CATH superfamily
5AFPA 5FI7A 1NYAA 2O60A 3DXLA 2QEOA 3FE8A 3KO0A 1C07A 1CFFA 1GQMA 1QWVA 1R2UA 3NSKA 2OTGB 1BT6A 1C3ZA 1HT9A 3SG2A 4MRYA 2JU0A 1OOHA 1ZOTB 2KPHA 1MXEA 1ZUZA 2L51A 3I5IC 3NSOA 4PALA 4YI8A 1YUSA 2H61C 2SCPA 1CM1A 1K9KA 1UHHA 2K7CA 3O4YA 1SPYA 3OX6A 3WXAA 1BJFA 1MWNA 4U8DA 1DTLA 2BL0B 2FCEA 3RLZA 2Y1NA 3FWCA 2KSPA 1GGZA 2K2AA 1JF2A 5I2QA 1KSMA 1OMDA 4YI9A 3CR2A 3BUWB 2GTEA 1KSOA 3CR5X 1B7TY 1F55A 1DQEA 2NXQA 1K90D 3EVVA 2WCKA 4I5JA 1UURA 1XFXO 3GK1A 5HKZA 1QXPA 1AHRA 3D0YB 1JF0A 4WQ2A 3EKJA 1IQ3A 1B8RA 2PVBA 1AP4A 2H8VA 3CZ1A 2H61A 1S36A 1YX7A 3OHMB 1CTRA 1QS7A 1LS8A 5AEQA 3BOWB 3BUXB 2JPOA 4YGAA 1K96A 1IRJA 1KK8C 1TN4A 2L5YA 3OBVA 2KYCA 3VRQA 2AAOA 3N7HA 3D78A 1LVCD 3TUYB 3B7AA 1RFJA 4OCIA 3SG6A 1ZMZA 1K95A 1DMOA 3JVTC 3PFVA 4AQIA 1CM4A 1DGVA 1MHOA 2JWWA 5HL1A 1VRKA 1NSHA 2LVJA 4GGNA 1AK8A 1OW4A 3KHEA 1SR6C 4XJKA 4GGFA 4UPGA 4IJ7A 3LCPC 1YR5A 2WCMA 1MUXA 1TIZA 2E6WA 2L2EA 4NDDA 2COLB 2KI6D 1DJHA 2ZNDA 3I5FB 1FF1A 1IKUA 2BAPA 2JTZA 4ICBA 3VROA 4DIRA 5I94A 1SSEB 1BR1B 1B9AA 2KI6C 3NGVA 3ZNIA 1IJ5A 2EC6B 1WRLA 5CSJA 5I8NA 3AAJA 4GNKB 5AANA 3PM8A 2KI4C 4MEWA 1BG1A 1TCOB 1ZFSA 3BFAA 1NUBA 2GGMA 1XA5A 4ETOA 1PULA 3HCMA 1LINA 2KLEA 3CYZA 4QJ5B 3BFHA 1S6CA 1XK4C 2PASA 1FPWA 5F6TA 1QJTA 2G9BA 2P71A 3BFBA 1DJXA 3VB1A 2JNXA 1CDMA 3CZTX 4ZCVA 4USLA 1OOGA 2HQWA 2ZRSA 3S0BA 3O2PA 5KSZA 1EH2A 2MA2A 1J7QA 2ZN8A 1GJYA 1KK7Y 1SL7A 2FJUB 3SJSA 1B4CA 1DEKA 1QX7A 3IQQA 2LANA 2KFFA 4JWQA 2FJYA 1EG3A 2Y1MA 4DRWA 2Y5IA 2JRFA 2JPTA 1BODA 1F4QA 3EK7A 1DELA 1SCVA 1TOPA 1LKJA 1PK0D 3FWBA 2KAVA 1LA3A 1UWOA 3GK2A 1CLLA 1QLKA 3R1OA 1NCZA 3DVMA 1D1OA 1UUSA 1ALWA 2OS8B 3UNWA 4YGCB 1NX2A 3K1EA 1DJZA 1BR4B 1DVIA 5D69A 1P28A 5DKNA 1DJIA 3OGNA 3DF0A 2MAZA 4ORCB 3S0EA 2BNXA 3ZWHA 3GK4X 3KEVA 2PYQA 3BUNB 3TDZA 4NDCA 1OMVA 1N65A 2KAYA 4OZDA 4PCWA 2KHNA 1B8CA 2L50A 3CS1A 1NCYA 3RM1A 3R1PA 2QACA 1F54A 1AVSA 3D74A 1E8AA 1WRZA 2WCFA 1QVIZ 2WCEA 3E3RA 3NSLA 1BF5A 2YGUA 1XFYO 1Q80A 3DYEA 1B1GA 1DF0B 3DZTA 1TRFA 1JFKA 3D10A 1TWOA 2M29A 2QEVA 1SKTA 1J55A 1FW4A 3R1VA 5HYDA 1YRTB 1J1DA 3LK1A 4PE4A 2F2OA 2RGIA 3RZSA 1CDPA 3EKHA 1XFRA 3JVTB 4I5NB 3LL8B 5CSIA 3I5GB 1LA0A 3NSIA 4GFTA 1FI6A 2K8MB 2NCOA 2CTNA 1A75B 4CFRA 3PLFB 4MZKA 1SCMB 1M45A 3TS5B 1S1EA 2F3ZA 2SASA 3JTDC 2JT8A 3B88A 2M7NA 2ISDA 1XFZO 1EL4A 1AUIB 3OB2B 4PE0A 2BCXA 1K93D 1DJWA 1F70A 1RJVA 2LV7A 4F7FA 2M9GA 1IIOA 2AUCA 2HQ8A 2KQYA 2CXJA 2PQLA 1JWDA 1WDCB 2KGRA 1JC2A 1AJ4A 3C1VA 2JXCA 3B86A 3GOFA 2LP3A 1OOJA 2F8PA 5J3XA 3SS5A 3OX5A 5I2LA 3CTNA 1S6JA 4D1EA 3SS3A 3TDUA 4GGFC 1QX2A 5FI6A 4YGBB 4I5LB 1Y6WA 1DJGA 3FE9A 1SRAA 1YVLA 1KWOB 1UHKA 1W7JB 1T14A 3PATA 1M31A 1QIVA 2LLTA 1SNLA 2BE4A 1L2OB 1YVHA 3A4UB 2BE6A 1EJ3A 1GGWA 3I5HC 1TNXA 1H8BA 3LLEA 4GBAA 1DC1A 1CB1A 4A4CA 4N1GA 5AERA 1Z2CB 1KQMB 1RTP1 1NX3A 1CMFA 2LHIA 1B47A 1PVAA 2LE9B 2M8UA 3SG5A 1KCYA 1ZACA 2IS9A 3V2LA 4C0KA 3SS4A 1K9UA 2BECA 4PT1A 1Y1AA 4HRHA 2KFHA 3D73A 4INXA 1WRKA 3KPXA 1G33A 1J1EA 1V1FA 1WLMA 4MZLA 4QJ3B 1A4PA 1TNPA 1QASA 2D8NA 2NZ0A 2F2PA 3CZ2A 3WHUB 4CFQA 1IGVA 1ODBA 2L4HA 3Q8IA 4GUKA 4PE7A 2LUCA 2OTGC 4M2QA 4FQOA 1RECA 1A29A 1FBVA 2ZFDA 3VRPA 1KFUS 1TCFA 1IG5A 4YBHB 2TN4A 5B8IB 1U5IB 2WCJA 1YTZC 2L5XB 1QX5B 2PALA 3PN7C 1CDLA 3IQOA 4OR9B 1PVBA 1L7ZA 2BL0C 4CIDA 2KLDA 3FIAA 1CDNA 1F8HA 5ER5A 3DVEA 2KBIA 1XYDA 1DF0A 5ER4X 4DUQA 2K60A 4TNCA 2HF5A 5K89A 1OMRA 3R72A 2VRGA 4PHMA 1PSBA 1YRUB 4OKHA 4Q04A 4PHNA 1J7OA 3O6BA 1K9PA 3PALA 1SY9A 1YURA 2K0JA 1RK9A 3VRRA 1PSRA 1TUZA 1QTXA 1BU3A 1W9ZA 4MRXA 5JOLA 1C7VA 2I94A 4M2PA 4C0LA 2KBMA 2F3YA 1OOFA 3S0DA 2H2KA 3NHTA 4JKTA 4PDZA 3I5IB 5HKYA 5CPVA 2WCLA 4PHJA 2F33A 4MVFA 2FCDA 3EK4A 3AKBA 2BBMA 4FTGA 1SMGA 1YUTA 2MHHA 3L4LA 3PJIA 2HPSA 3EG5B 5FYXA 3VRNA 4DCKA 1LXFC 1KFXS 3VGOA 2KYFA 4HRGA 3D0YA 4A4BA 5G08A 5D7FA 3MSEB 1S5GZ 1BMOA 3EK8A 2WOSA 2WC8A 1KFUL 3FE6A 3IF7A 4HREE 1K2HA 2EHBA 1TNQA 5DKQA 3CLNA 5CSNA 4P2YB 1NIWA 3BOWA 4XJKB 2LUXA 3I5FC 1M63B 2WNDA 3D77A 4I5KA 1M46A 2KQ6A 1N0YA 1NX0A 1M39A 1OOIX 2EC6C 2FOTA 4YRUA 1UHIA 3EVRA 1A03A 2JZIA 1XFUO 1XFVO 2JC2A 1NPQA 1KK8B 1NWDA 2MBXA 3WNXB 4BY4A 4PE1A 4F0ZB 1A2XA 1QVIY 3DY9A 3KF9A 1Z4HA 1CLBA 3PSRA 3L47A 2ZKMX 3H4SE 4KYNA 2CCMA 2O5GA 1MR8A 2BBNA 3EVUA 1SR6B 3NXAA 4NQGA 4MSPA 4YGEB 5HKWA 2WCBA 3OB1B 2K7BA 4MLWA 4DS7A 1WY9A 2QEBA 3A8RA 1EXRA 2KNEA 1X02A 4CLNA 4ORAB 4NDBA 3K21A 3D76A 5DKRA 2M7LA 5GQQC 1U5IA 4JD9A 2Q91A 3PM2A 1K94A 2K2FA 4OV2A 4R1EA 3NHIA 5HLOA 3DVJA 1KFXL 1FI5A 3LK0A 2Y4QA 3S0GA 1J7PA 1ALVA 1SBJA 1B8LA 3DVKA 1S6IA 3O4XA 3OP0A 2WC5A 2KI4B 1B7TZ 1TUJA 2OS8C 3BJHA 3S0AA 1SL8A 2BKIB 1IQ5A 2AMIA 2JT3A 3PN7B 2LAPA 4GAOA 5HLVA 4WRIA 3CWGA 1C7WA 2KOTA 3SIAA 2WCHA 1QV0A 1CFPA 2A4JA 4N1FA 2JQ6A 3UO9A 2K7DA 5IBWA 2L4IA 1XO5A 2M49B 1HQVA 1J7RA 2R2IA 3B87A 3M0WA 3S0FA 2JOJA 5EL2A 4FQTA 2G2BA 1PALA 4BY5A 1UHJA 3DF0B 1NP8A 2HETA 5KU1A 1SK6D 4CPVA 1YX8A 5JJGA 1EG4A 2PRUA 1OZSA 4GPLB 2LVVA 3QMEA 3AAKA 1Y1XA 2B1UA 2LMTA 3BUOB 2MLFC 2BKHB 1C3YA 1NX1A 5FI2A 1ORGA 1F71A 2KAXA 1JBAA 1QIWA 4ORBB 3SG3A 3CGAA 2M97A 2LP2A 1XVJA 1S26D 4AOMA 2KFGA 2MLEC 5PALA 1DT7B 3FS7A 2NLNA 4AQJA 4L9MA 3I5GC 1QLSA 4M2OA 2PSRA 4N5XA 2WC6A 3L4AA 2LVIA 2OPOA 3WHTB 3BQ3A 3CDNA 3IVTA 1SCMC 1PRWA 2BCBA 4HSZA 5D3OA 3TS5C 2ZNEA 2M1UA 3CABA 1NCXA 1XFWO 2QEHA 4IL1A 2KDHA 2MJWB 1CMGA 1BOCA 2WORA 2JT0A 1F4OA 1SW8A 2BCAA 1WDCC 4WQ3A 3F45A 1OQPA 2K7OA 4MN0A 1JSAA 1SYMA 2QDIA 2QPTA 2ZN9A 4C0JA 4E68A 2GV5A 1Y1UA 2K61A 2JULA 1KQVA 2LM5A 1CKKA 1A75A 2DOQA 1Y0VH 2I18A 5AXIA 2KGBC 3HX4A 1MXLC 1CFCA 3SIBA 2I2RE 1KWOC 3SG7A 1KK7Z 5BPJA 4INWA 3BUMB 2JNFA 1DGUA 1L2OC 1OSAA 1SL9A 2CT9A 2EGDA 3B6XA 1QATA 1K8UA 3TUYC 2LC5A 3JTDB 1MQ1A 3TDIA 1R6PA 1AJ5A 2E30A 3CR4X 4XYNA 1UP5A 1RROA 2CNPA 1KQMC 1YUUA 2L98A 2LHLA 2GGZA 1CNPA 1WLZA 2CBLA 2PMYA 4QJ4B 2LMUA 2V53A 3QRXA 2M1KB 2M3WA 4ZCUA 2ZRTA 1G8IA 1IJ6A 2LMVA 4JPZB 3BYAA 1XK4A 1W7IB 2LVKA 4YGDB 1CFDA 1S5GY 1CLMA 1QV1A 2LCPA 2M0RA 3TZ1A 3AKAA 1N2DA 3O78A 3DD4A 2ERBA 3CZ0A 5I2OA 1GM0A 4MBEA 2Q4UA 1TNWA 2L0PA 3I5HB 2LNKA 1MF8B 1OZOA 2JTTA 2L2CA 1TTXA 5CSFA 1IWQA 1H4BA 2P70A 1V1GA 4JQ0D 1JUOA 5DICA 2LLUA 4P5OE 5KTYA 1BLQA 1IH0A 4MZJA 3ICBA 1G4YR 4PHKA 3D75A 4OVNF 3BXKA 1DJYA 2LLSA 1RWYA 1JFJA 2MRDA 2NCPA 1S3PA 1UHNA 1OE9B 3SG4A 2P6BB 2JXLA 5TNCA 2I7AA
chains in the Genus database with same CATH topology
5AFPA 1CFFA 1NYAA 2O60A 3KO0A 1C07A 1GQMA 1R2UA 3NSKA 2OTGB 1BT6A 1HT9A 3SG2A 4MRYA 2JU0A 1ZOTB 1MXEA 1ZUZA 2L51A 3I5IC 3NSOA 4PALA 4YI8A 1YUSA 2H61C 2SCPA 1CM1A 1K9KA 1UHHA 2K7CA 3O4YA 1SPYA 3OX6A 3WXAA 1BJFA 1MWNA 4U8DA 1DTLA 2BL0B 2FCEA 3RLZA 2Y1NA 3FWCA 2KSPA 1GGZA 2K2AA 1JF2A 5I2QA 1KSMA 1OMDA 4YI9A 3CR2A 3BUWB 1KSOA 3CR5X 1B7TY 1F55A 2NXQA 1K90D 3EVVA 4I5JA 1UURA 1XFXO 3GK1A 5HKZA 1QXPA 1AHRA 3D0YB 1JF0A 4WQ2A 3EKJA 1IQ3A 1B8RA 2PVBA 1AP4A 2H61A 1S36A 1YX7A 3OHMB 1CTRA 1QS7A 5AEQA 3BOWB 3BUXB 4YGAA 1K96A 1IRJA 1KK8C 1TN4A 2KYCA 3VRQA 2AAOA 1LVCD 3TUYB 1RFJA 4OCIA 3SG6A 1ZMZA 1K95A 1DMOA 3JVTC 3PFVA 4AQIA 1CM4A 1DGVA 1MHOA 2JWWA 1VRKA 1NSHA 2LVJA 4GGNA 1AK8A 3KHEA 1SR6C 4XJKA 4GGFA 4UPGA 3LCPC 1YR5A 1MUXA 1TIZA 2E6WA 2L2EA 4NDDA 2COLB 2KI6D 1DJHA 2ZNDA 3I5FB 1FF1A 1IKUA 2JTZA 4ICBA 3VROA 4DIRA 3ZNIA 1BR1B 1B9AA 2KI6C 1IJ5A 2EC6B 1WRLA 5CSJA 5I8NA 3AAJA 4GNKB 5AANA 3PM8A 2KI4C 4MEWA 1BG1A 1TCOB 1ZFSA 1NUBA 2GGMA 1XA5A 4ETOA 1PULA 3HCMA 1LINA 4QJ5B 1S6CA 1XK4C 2PASA 1FPWA 5F6TA 1QJTA 2G9BA 1DJXA 2JNXA 1CDMA 3CZTX 4ZCVA 4USLA 2HQWA 2ZRSA 3O2PA 5KSZA 1EH2A 2MA2A 1J7QA 2ZN8A 1GJYA 1KK7Y 1SL7A 2FJUB 3SJSA 1B4CA 1QX7A 3IQQA 2LANA 2KFFA 4JWQA 1EG3A 2Y1MA 4DRWA 2Y5IA 2JRFA 2JPTA 1BODA 1F4QA 3EK7A 1SCVA 1TOPA 1LKJA 1PK0D 3FWBA 2KAVA 1LA3A 1UWOA 3GK2A 1CLLA 1QLKA 1NCZA 3DVMA 1D1OA 1UUSA 1ALWA 2OS8B 4YGCB 1NX2A 1DJZA 1BR4B 1DVIA 5D69A 5DKNA 1DJIA 3DF0A 2MAZA 4ORCB 3ZWHA 3GK4X 3KEVA 3TDZA 3BUNB 4NDCA 1OMVA 1N65A 2KAYA 4PCWA 2KHNA 1B8CA 2L50A 3CS1A 1NCYA 3RM1A 2QACA 1F54A 1AVSA 1E8AA 1WRZA 2WCFA 1QVIZ 2WCEA 3E3RA 3NSLA 1BF5A 1XFYO 1Q80A 1B1GA 1DF0B 1TRFA 1JFKA 3D10A 2M29A 5HYDA 1SKTA 1J55A 1FW4A 1YRTB 1J1DA 3LK1A 4PE4A 2F2OA 2RGIA 1CDPA 3EKHA 3JVTB 4I5NB 3LL8B 5CSIA 3I5GB 1LA0A 3NSIA 4GFTA 1FI6A 2K8MB 2NCOA 2CTNA 1A75B 4CFRA 3PLFB 4MZKA 1SCMB 1M45A 3TS5B 1S1EA 2F3ZA 2SASA 3JTDC 2JT8A 2ISDA 2M7NA 1XFZO 1EL4A 1AUIB 3OB2B 4PE0A 2BCXA 1K93D 1DJWA 1F70A 1RJVA 2LV7A 2M9GA 2AUCA 2HQ8A 2KQYA 2CXJA 1JWDA 1WDCB 2KGRA 1JC2A 1AJ4A 3C1VA 2JXCA 3GOFA 2LP3A 1OOJA 2F8PA 5J3XA 3OX5A 5I2LA 3CTNA 1S6JA 4D1EA 3TDUA 4GGFC 1QX2A 4YGBB 4I5LB 1Y6WA 1DJGA 1SRAA 1YVLA 1KWOB 1UHKA 1W7JB 3PATA 1M31A 1QIVA 2LLTA 1SNLA 2BE4A 1L2OB 1YVHA 3A4UB 2BE6A 1EJ3A 1GGWA 3I5HC 1TNXA 1H8BA 3LLEA 4GBAA 1CB1A 4A4CA 4N1GA 5AERA 1CMFA 1KQMB 1RTP1 1NX3A 2LHIA 1B47A 1PVAA 2LE9B 2M8UA 3SG5A 1KCYA 1ZACA 2IS9A 4C0KA 1K9UA 2BECA 1Y1AA 4HRHA 2KFHA 1WRKA 3KPXA 1G33A 1J1EA 1V1FA 1WLMA 4MZLA 4QJ3B 1A4PA 1TNPA 1QASA 2D8NA 2NZ0A 2F2PA 3WHUB 4CFQA 1IGVA 1ODBA 2L4HA 4GUKA 4PE7A 2LUCA 2OTGC 4M2QA 4FQOA 1RECA 1A29A 1FBVA 2ZFDA 3VRPA 1KFUS 1TCFA 1IG5A 4YBHB 2TN4A 5B8IB 1U5IB 1YTZC 2L5XB 1QX5B 2PALA 3PN7C 1CDLA 3IQOA 4OR9B 1PVBA 1L7ZA 2BL0C 4CIDA 3FIAA 1CDNA 1F8HA 5ER5A 3DVEA 2KBIA 1XYDA 1DF0A 5ER4X 4DUQA 4TNCA 2HF5A 5K89A 1OMRA 2VRGA 4PHMA 1PSBA 1YRUB 4OKHA 4Q04A 4PHNA 1J7OA 3O6BA 1K9PA 3PALA 1SY9A 1YURA 2K0JA 1RK9A 3VRRA 1PSRA 1QTXA 1BU3A 4MRXA 5JOLA 1C7VA 2I94A 4M2PA 4C0LA 2KBMA 2F3YA 2H2KA 4PDZA 3I5IB 5HKYA 5CPVA 4PHJA 2F33A 4MVFA 2FCDA 3EK4A 3AKBA 2BBMA 4FTGA 1SMGA 1YUTA 2MHHA 5FYXA 3VRNA 2HPSA 4DCKA 1LXFC 1KFXS 3VGOA 2KYFA 4HRGA 3D0YA 4A4BA 5G08A 5D7FA 3MSEB 1S5GZ 1BMOA 3EK8A 2WOSA 2WC8A 1KFUL 3IF7A 4HREE 1K2HA 2EHBA 1TNQA 5DKQA 3CLNA 5CSNA 4P2YB 1NIWA 3BOWA 4XJKB 2LUXA 3I5FC 1M63B 2WNDA 4I5KA 1M46A 2KQ6A 1N0YA 1NX0A 1M39A 4YRUA 2EC6C 2FOTA 1A03A 1UHIA 3EVRA 2JZIA 1XFUO 1XFVO 2JC2A 1NPQA 1KK8B 1NWDA 2MBXA 3WNXB 4BY4A 4PE1A 4F0ZB 1A2XA 1QVIY 3KF9A 1CLBA 3PSRA 2ZKMX 3H4SE 2CCMA 2O5GA 1MR8A 2BBNA 3EVUA 1SR6B 3NXAA 4NQGA 4MSPA 4YGEB 5HKWA 2WCBA 3OB1B 2K7BA 4MLWA 4DS7A 1WY9A 3A8RA 1EXRA 2KNEA 1X02A 4CLNA 4ORAB 4NDBA 3K21A 5DKRA 2M7LA 5GQQC 1U5IA 2Q91A 4OV2A 1K94A 2K2FA 4R1EA 5HLOA 3DVJA 1KFXL 1FI5A 3LK0A 2Y4QA 1J7PA 1ALVA 1SBJA 1B8LA 3DVKA 1S6IA 3OP0A 2KI4B 1B7TZ 2OS8C 1SL8A 2BKIB 1IQ5A 2AMIA 2JT3A 3PN7B 2LAPA 4GAOA 5HLVA 4WRIA 3CWGA 1C7WA 2KOTA 3SIAA 1CFPA 1QV0A 2A4JA 4N1FA 2JQ6A 5IBWA 2K7DA 2L4IA 1XO5A 2M49B 1HQVA 1J7RA 2R2IA 3M0WA 2JOJA 2G2BA 1PALA 4BY5A 1UHJA 3DF0B 1NP8A 2HETA 5KU1A 1SK6D 4CPVA 1YX8A 5JJGA 1EG4A 2PRUA 1OZSA 4GPLB 2LVVA 3AAKA 1Y1XA 2B1UA 2LMTA 3BUOB 2MLFC 2BKHB 1NX1A 1F71A 2KAXA 1JBAA 1QIWA 4ORBB 3SG3A 3CGAA 2M97A 2LP2A 1XVJA 1S26D 4AOMA 2KFGA 2MLEC 5PALA 1DT7B 3FS7A 2NLNA 4AQJA 4L9MA 3I5GC 1QLSA 4M2OA 2PSRA 4N5XA 2LVIA 2OPOA 3WHTB 3BQ3A 1SCMC 1PRWA 2BCBA 4HSZA 3TS5C 2ZNEA 2M1UA 1NCXA 1XFWO 4IL1A 2KDHA 2MJWB 1CMGA 1BOCA 2WORA 2JT0A 1F4OA 1SW8A 2BCAA 1WDCC 4WQ3A 3F45A 1OQPA 2K7OA 4MN0A 1JSAA 1SYMA 2QPTA 2ZN9A 4C0JA 4E68A 2GV5A 1Y1UA 2K61A 2JULA 1KQVA 2LM5A 1CKKA 1A75A 2DOQA 1Y0VH 2I18A 5AXIA 2KGBC 3HX4A 1MXLC 1CFCA 3SIBA 2I2RE 1KWOC 3SG7A 1KK7Z 5BPJA 3BUMB 2JNFA 1DGUA 1L2OC 1OSAA 1SL9A 2CT9A 2EGDA 1QATA 1K8UA 3TUYC 2LC5A 3JTDB 1MQ1A 3TDIA 1R6PA 1AJ5A 2E30A 3CR4X 4XYNA 1UP5A 1RROA 2CNPA 1KQMC 1YUUA 2L98A 2LHLA 2GGZA 1CNPA 1WLZA 2CBLA 2PMYA 4QJ4B 2LMUA 2V53A 3QRXA 2M1KB 2M3WA 4ZCUA 2ZRTA 1G8IA 1IJ6A 2LMVA 4JPZB 3BYAA 1XK4A 1W7IB 2LVKA 4YGDB 1CFDA 1S5GY 1CLMA 1QV1A 2LCPA 2M0RA 3TZ1A 3AKAA 1N2DA 3O78A 3DD4A 5I2OA 4MBEA 2Q4UA 1TNWA 2L0PA 3I5HB 2LNKA 1MF8B 1OZOA 2JTTA 5CSFA 1TTXA 1IWQA 1H4BA 1V1GA 4JQ0D 1JUOA 2LLUA 4P5OE 5KTYA 1BLQA 1IH0A 4MZJA 3ICBA 1G4YR 4PHKA 4OVNF 3BXKA 1DJYA 2LLSA 1RWYA 1JFJA 2MRDA 2NCPA 1S3PA 1UHNA 1OE9B 3SG4A 2P6BB 2JXLA 5TNCA 2I7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFP A;  1CFF A;  1NYA A;  2O60 A;  3KO0 A;  1C07 A;  1GQM A;  1R2U A;  3NSK A;  2OTG B;  1BT6 A;  1HT9 A;  3SG2 A;  4MRY A;  2JU0 A;  1ZOT B;  1MXE A;  1ZUZ A;  2L51 A;  3I5I C;  3NSO A;  4PAL A;  4YI8 A;  1YUS A;  2H61 C;  2SCP A;  1CM1 A;  1K9K A;  1UHH A;  2K7C A;  3O4Y A;  1SPY A;  3OX6 A;  3WXA A;  1BJF A;  1MWN A;  4U8D A;  1DTL A;  2BL0 B;  2FCE A;  3RLZ A;  2Y1N A;  3FWC A;  2KSP A;  1GGZ A;  2K2A A;  1JF2 A;  5I2Q A;  1KSM A;  1OMD A;  4YI9 A;  3CR2 A;  3BUW B;  1KSO A;  3CR5 X;  1B7T Y;  1F55 A;  2NXQ A;  1K90 D;  3EVV A;  4I5J A;  1UUR A;  1XFX O;  3GK1 A;  5HKZ A;  1QXP A;  1AHR A;  3D0Y B;  1JF0 A;  4WQ2 A;  3EKJ A;  1IQ3 A;  1B8R A;  2PVB A;  1AP4 A;  2H61 A;  1S36 A;  1YX7 A;  3OHM B;  1CTR A;  1QS7 A;  5AEQ A;  3BOW B;  3BUX B;  4YGA A;  1K96 A;  1IRJ A;  1KK8 C;  1TN4 A;  2KYC A;  3VRQ A;  2AAO A;  1LVC D;  3TUY B;  1RFJ A;  4OCI A;  3SG6 A;  1ZMZ A;  1K95 A;  1DMO A;  3JVT C;  3PFV A;  4AQI A;  1CM4 A;  1DGV A;  1MHO A;  2JWW A;  1VRK A;  1NSH A;  2LVJ A;  4GGN A;  1AK8 A;  3KHE A;  1SR6 C;  4XJK A;  4GGF A;  4UPG A;  3LCP C;  1YR5 A;  1MUX A;  1TIZ A;  2E6W A;  2L2E A;  4NDD A;  2COL B;  2KI6 D;  1DJH A;  2ZND A;  3I5F B;  1FF1 A;  1IKU A;  2JTZ A;  4ICB A;  3VRO A;  4DIR A;  3ZNI A;  1BR1 B;  1B9A A;  2KI6 C;  1IJ5 A;  2EC6 B;  1WRL A;  5CSJ A;  5I8N A;  3AAJ A;  4GNK B;  5AAN A;  3PM8 A;  2KI4 C;  4MEW A;  1BG1 A;  1TCO B;  1ZFS A;  1NUB A;  2GGM A;  1XA5 A;  4ETO A;  1PUL A;  3HCM A;  1LIN A;  4QJ5 B;  1S6C A;  1XK4 C;  2PAS A;  1FPW A;  5F6T A;  1QJT A;  2G9B A;  1DJX A;  2JNX A;  1CDM A;  3CZT X;  4ZCV A;  4USL A;  2HQW A;  2ZRS A;  3O2P A;  5KSZ A;  1EH2 A;  2MA2 A;  1J7Q A;  2ZN8 A;  1GJY A;  1KK7 Y;  1SL7 A;  2FJU B;  3SJS A;  1B4C A;  1QX7 A;  3IQQ A;  2LAN A;  2KFF A;  4JWQ A;  1EG3 A;  2Y1M A;  4DRW A;  2Y5I A;  2JRF A;  2JPT A;  1BOD A;  1F4Q A;  3EK7 A;  1SCV A;  1TOP A;  1LKJ A;  1PK0 D;  3FWB A;  2KAV A;  1LA3 A;  1UWO A;  3GK2 A;  1CLL A;  1QLK A;  1NCZ A;  3DVM A;  1D1O A;  1UUS A;  1ALW A;  2OS8 B;  4YGC B;  1NX2 A;  1DJZ A;  1BR4 B;  1DVI A;  5D69 A;  5DKN A;  1DJI A;  3DF0 A;  2MAZ A;  4ORC B;  3ZWH A;  3GK4 X;  3KEV A;  3TDZ A;  3BUN B;  4NDC A;  1OMV A;  1N65 A;  2KAY A;  4PCW A;  2KHN A;  1B8C A;  2L50 A;  3CS1 A;  1NCY A;  3RM1 A;  2QAC A;  1F54 A;  1AVS A;  1E8A A;  1WRZ A;  2WCF A;  1QVI Z;  2WCE A;  3E3R A;  3NSL A;  1BF5 A;  1XFY O;  1Q80 A;  1B1G A;  1DF0 B;  1TRF A;  1JFK A;  3D10 A;  2M29 A;  5HYD A;  1SKT A;  1J55 A;  1FW4 A;  1YRT B;  1J1D A;  3LK1 A;  4PE4 A;  2F2O A;  2RGI A;  1CDP A;  3EKH A;  3JVT B;  4I5N B;  3LL8 B;  5CSI A;  3I5G B;  1LA0 A;  3NSI A;  4GFT A;  1FI6 A;  2K8M B;  2NCO A;  2CTN A;  1A75 B;  4CFR A;  3PLF B;  4MZK A;  1SCM B;  1M45 A;  3TS5 B;  1S1E A;  2F3Z A;  2SAS A;  3JTD C;  2JT8 A;  2ISD A;  2M7N A;  1XFZ O;  1EL4 A;  1AUI B;  3OB2 B;  4PE0 A;  2BCX A;  1K93 D;  1DJW A;  1F70 A;  1RJV A;  2LV7 A;  2M9G A;  2AUC A;  2HQ8 A;  2KQY A;  2CXJ A;  1JWD A;  1WDC B;  2KGR A;  1JC2 A;  1AJ4 A;  3C1V A;  2JXC A;  3GOF A;  2LP3 A;  1OOJ A;  2F8P A;  5J3X A;  3OX5 A;  5I2L A;  3CTN A;  1S6J A;  4D1E A;  3TDU A;  4GGF C;  1QX2 A;  4YGB B;  4I5L B;  1Y6W A;  1DJG A;  1SRA A;  1YVL A;  1KWO B;  1UHK A;  1W7J B;  3PAT A;  1M31 A;  1QIV A;  2LLT A;  1SNL A;  2BE4 A;  1L2O B;  1YVH A;  3A4U B;  2BE6 A;  1EJ3 A;  1GGW A;  3I5H C;  1TNX A;  1H8B A;  3LLE A;  4GBA A;  1CB1 A;  4A4C A;  4N1G A;  5AER A;  1CMF A;  1KQM B;  1RTP 1;  1NX3 A;  2LHI A;  1B47 A;  1PVA A;  2LE9 B;  2M8U A;  3SG5 A;  1KCY A;  1ZAC A;  2IS9 A;  4C0K A;  1K9U A;  2BEC A;  1Y1A A;  4HRH A;  2KFH A;  1WRK A;  3KPX A;  1G33 A;  1J1E A;  1V1F A;  1WLM A;  4MZL A;  4QJ3 B;  1A4P A;  1TNP A;  1QAS A;  2D8N A;  2NZ0 A;  2F2P A;  3WHU B;  4CFQ A;  1IGV A;  1ODB A;  2L4H A;  4GUK A;  4PE7 A;  2LUC A;  2OTG C;  4M2Q A;  4FQO A;  1REC A;  1A29 A;  1FBV A;  2ZFD A;  3VRP A;  1KFU S;  1TCF A;  1IG5 A;  4YBH B;  2TN4 A;  5B8I B;  1U5I B;  1YTZ C;  2L5X B;  1QX5 B;  2PAL A;  3PN7 C;  1CDL A;  3IQO A;  4OR9 B;  1PVB A;  1L7Z A;  2BL0 C;  4CID A;  3FIA A;  1CDN A;  1F8H A;  5ER5 A;  3DVE A;  2KBI A;  1XYD A;  1DF0 A;  5ER4 X;  4DUQ A;  4TNC A;  2HF5 A;  5K89 A;  1OMR A;  2VRG A;  4PHM A;  1PSB A;  1YRU B;  4OKH A;  4Q04 A;  4PHN A;  1J7O A;  3O6B A;  1K9P A;  3PAL A;  1SY9 A;  1YUR A;  2K0J A;  1RK9 A;  3VRR A;  1PSR A;  1QTX A;  1BU3 A;  4MRX A;  5JOL A;  1C7V A;  2I94 A;  4M2P A;  4C0L A;  2KBM A;  2F3Y A;  2H2K A;  4PDZ A;  3I5I B;  5HKY A;  5CPV A;  4PHJ A;  2F33 A;  4MVF A;  2FCD A;  3EK4 A;  3AKB A;  2BBM A;  4FTG A;  1SMG A;  1YUT A;  2MHH A;  5FYX A;  3VRN A;  2HPS A;  4DCK A;  1LXF C;  1KFX S;  3VGO A;  2KYF A;  4HRG A;  3D0Y A;  4A4B A;  5G08 A;  5D7F A;  3MSE B;  1S5G Z;  1BMO A;  3EK8 A;  2WOS A;  2WC8 A;  1KFU L;  3IF7 A;  4HRE E;  1K2H A;  2EHB A;  1TNQ A;  5DKQ A;  3CLN A;  5CSN A;  4P2Y B;  1NIW A;  3BOW A;  4XJK B;  2LUX A;  3I5F C;  1M63 B;  2WND A;  4I5K A;  1M46 A;  2KQ6 A;  1N0Y A;  1NX0 A;  1M39 A;  4YRU A;  2EC6 C;  2FOT A;  1A03 A;  1UHI A;  3EVR A;  2JZI A;  1XFU O;  1XFV O;  2JC2 A;  1NPQ A;  1KK8 B;  1NWD A;  2MBX A;  3WNX B;  4BY4 A;  4PE1 A;  4F0Z B;  1A2X A;  1QVI Y;  3KF9 A;  1CLB A;  3PSR A;  2ZKM X;  3H4S E;  2CCM A;  2O5G A;  1MR8 A;  2BBN A;  3EVU A;  1SR6 B;  3NXA A;  4NQG A;  4MSP A;  4YGE B;  5HKW A;  2WCB A;  3OB1 B;  2K7B A;  4MLW A;  4DS7 A;  1WY9 A;  3A8R A;  1EXR A;  2KNE A;  1X02 A;  4CLN A;  4ORA B;  4NDB A;  3K21 A;  5DKR A;  2M7L A;  5GQQ C;  1U5I A;  2Q91 A;  4OV2 A;  1K94 A;  2K2F A;  4R1E A;  5HLO A;  3DVJ A;  1KFX L;  1FI5 A;  3LK0 A;  2Y4Q A;  1J7P A;  1ALV A;  1SBJ A;  1B8L A;  3DVK A;  1S6I A;  3OP0 A;  2KI4 B;  1B7T Z;  2OS8 C;  1SL8 A;  2BKI B;  1IQ5 A;  2AMI A;  2JT3 A;  3PN7 B;  2LAP A;  4GAO A;  5HLV A;  4WRI A;  3CWG A;  1C7W A;  2KOT A;  3SIA A;  1CFP A;  1QV0 A;  2A4J A;  4N1F A;  2JQ6 A;  5IBW A;  2K7D A;  2L4I A;  1XO5 A;  2M49 B;  1HQV A;  1J7R A;  2R2I A;  3M0W A;  2JOJ A;  2G2B A;  1PAL A;  4BY5 A;  1UHJ A;  3DF0 B;  1NP8 A;  2HET A;  5KU1 A;  1SK6 D;  4CPV A;  1YX8 A;  5JJG A;  1EG4 A;  2PRU A;  1OZS A;  4GPL B;  2LVV A;  3AAK A;  1Y1X A;  2B1U A;  2LMT A;  3BUO B;  2MLF C;  2BKH B;  1NX1 A;  1F71 A;  2KAX A;  1JBA A;  1QIW A;  4ORB B;  3SG3 A;  3CGA A;  2M97 A;  2LP2 A;  1XVJ A;  1S26 D;  4AOM A;  2KFG A;  2MLE C;  5PAL A;  1DT7 B;  3FS7 A;  2NLN A;  4AQJ A;  4L9M A;  3I5G C;  1QLS A;  4M2O A;  2PSR A;  4N5X A;  2LVI A;  2OPO A;  3WHT B;  3BQ3 A;  1SCM C;  1PRW A;  2BCB A;  4HSZ A;  3TS5 C;  2ZNE A;  2M1U A;  1NCX A;  1XFW O;  4IL1 A;  2KDH A;  2MJW B;  1CMG A;  1BOC A;  2WOR A;  2JT0 A;  1F4O A;  1SW8 A;  2BCA A;  1WDC C;  4WQ3 A;  3F45 A;  1OQP A;  2K7O A;  4MN0 A;  1JSA A;  1SYM A;  2QPT A;  2ZN9 A;  4C0J A;  4E68 A;  2GV5 A;  1Y1U A;  2K61 A;  2JUL A;  1KQV A;  2LM5 A;  1CKK A;  1A75 A;  2DOQ A;  1Y0V H;  2I18 A;  5AXI A;  2KGB C;  3HX4 A;  1MXL C;  1CFC A;  3SIB A;  2I2R E;  1KWO C;  3SG7 A;  1KK7 Z;  5BPJ A;  3BUM B;  2JNF A;  1DGU A;  1L2O C;  1OSA A;  1SL9 A;  2CT9 A;  2EGD A;  1QAT A;  1K8U A;  3TUY C;  2LC5 A;  3JTD B;  1MQ1 A;  3TDI A;  1R6P A;  1AJ5 A;  2E30 A;  3CR4 X;  4XYN A;  1UP5 A;  1RRO A;  2CNP A;  1KQM C;  1YUU A;  2L98 A;  2LHL A;  2GGZ A;  1CNP A;  1WLZ A;  2CBL A;  2PMY A;  4QJ4 B;  2LMU A;  2V53 A;  3QRX A;  2M1K B;  2M3W A;  4ZCU A;  2ZRT A;  1G8I A;  1IJ6 A;  2LMV A;  4JPZ B;  3BYA A;  1XK4 A;  1W7I B;  2LVK A;  4YGD B;  1CFD A;  1S5G Y;  1CLM A;  1QV1 A;  2LCP A;  2M0R A;  3TZ1 A;  3AKA A;  1N2D A;  3O78 A;  3DD4 A;  5I2O A;  4MBE A;  2Q4U A;  1TNW A;  2L0P A;  3I5H B;  2LNK A;  1MF8 B;  1OZO A;  2JTT A;  5CSF A;  1TTX A;  1IWQ A;  1H4B A;  1V1G A;  4JQ0 D;  1JUO A;  2LLU A;  4P5O E;  5KTY A;  1BLQ A;  1IH0 A;  4MZJ A;  3ICB A;  1G4Y R;  4PHK A;  4OVN F;  3BXK A;  1DJY A;  2LLS A;  1RWY A;  1JFJ A;  2MRD A;  2NCP A;  1S3P A;  1UHN A;  1OE9 B;  3SG4 A;  2P6B B;  2JXL A;  5TNC A;  2I7A A; 
#chains in the Genus database with same CATH topology
 5AFP A;  5FI7 A;  1NYA A;  2O60 A;  3DXL A;  2QEO A;  3FE8 A;  3KO0 A;  1C07 A;  1CFF A;  1GQM A;  1QWV A;  1R2U A;  3NSK A;  2OTG B;  1BT6 A;  1C3Z A;  1HT9 A;  3SG2 A;  4MRY A;  2JU0 A;  1OOH A;  1ZOT B;  2KPH A;  1MXE A;  1ZUZ A;  2L51 A;  3I5I C;  3NSO A;  4PAL A;  4YI8 A;  1YUS A;  2H61 C;  2SCP A;  1CM1 A;  1K9K A;  1UHH A;  2K7C A;  3O4Y A;  1SPY A;  3OX6 A;  3WXA A;  1BJF A;  1MWN A;  4U8D A;  1DTL A;  2BL0 B;  2FCE A;  3RLZ A;  2Y1N A;  3FWC A;  2KSP A;  1GGZ A;  2K2A A;  1JF2 A;  5I2Q A;  1KSM A;  1OMD A;  4YI9 A;  3CR2 A;  3BUW B;  2GTE A;  1KSO A;  3CR5 X;  1B7T Y;  1F55 A;  1DQE A;  2NXQ A;  1K90 D;  3EVV A;  2WCK A;  4I5J A;  1UUR A;  1XFX O;  3GK1 A;  5HKZ A;  1QXP A;  1AHR A;  3D0Y B;  1JF0 A;  4WQ2 A;  3EKJ A;  1IQ3 A;  1B8R A;  2PVB A;  1AP4 A;  2H8V A;  3CZ1 A;  2H61 A;  1S36 A;  1YX7 A;  3OHM B;  1CTR A;  1QS7 A;  1LS8 A;  5AEQ A;  3BOW B;  3BUX B;  2JPO A;  4YGA A;  1K96 A;  1IRJ A;  1KK8 C;  1TN4 A;  2L5Y A;  3OBV A;  2KYC A;  3VRQ A;  2AAO A;  3N7H A;  3D78 A;  1LVC D;  3TUY B;  3B7A A;  1RFJ A;  4OCI A;  3SG6 A;  1ZMZ A;  1K95 A;  1DMO A;  3JVT C;  3PFV A;  4AQI A;  1CM4 A;  1DGV A;  1MHO A;  2JWW A;  5HL1 A;  1VRK A;  1NSH A;  2LVJ A;  4GGN A;  1AK8 A;  1OW4 A;  3KHE A;  1SR6 C;  4XJK A;  4GGF A;  4UPG A;  4IJ7 A;  3LCP C;  1YR5 A;  2WCM A;  1MUX A;  1TIZ A;  2E6W A;  2L2E A;  4NDD A;  2COL B;  2KI6 D;  1DJH A;  2ZND A;  3I5F B;  1FF1 A;  1IKU A;  2BAP A;  2JTZ A;  4ICB A;  3VRO A;  4DIR A;  5I94 A;  1SSE B;  1BR1 B;  1B9A A;  2KI6 C;  3NGV A;  3ZNI A;  1IJ5 A;  2EC6 B;  1WRL A;  5CSJ A;  5I8N A;  3AAJ A;  4GNK B;  5AAN A;  3PM8 A;  2KI4 C;  4MEW A;  1BG1 A;  1TCO B;  1ZFS A;  3BFA A;  1NUB A;  2GGM A;  1XA5 A;  4ETO A;  1PUL A;  3HCM A;  1LIN A;  2KLE A;  3CYZ A;  4QJ5 B;  3BFH A;  1S6C A;  1XK4 C;  2PAS A;  1FPW A;  5F6T A;  1QJT A;  2G9B A;  2P71 A;  3BFB A;  1DJX A;  3VB1 A;  2JNX A;  1CDM A;  3CZT X;  4ZCV A;  4USL A;  1OOG A;  2HQW A;  2ZRS A;  3S0B A;  3O2P A;  5KSZ A;  1EH2 A;  2MA2 A;  1J7Q A;  2ZN8 A;  1GJY A;  1KK7 Y;  1SL7 A;  2FJU B;  3SJS A;  1B4C A;  1DEK A;  1QX7 A;  3IQQ A;  2LAN A;  2KFF A;  4JWQ A;  2FJY A;  1EG3 A;  2Y1M A;  4DRW A;  2Y5I A;  2JRF A;  2JPT A;  1BOD A;  1F4Q A;  3EK7 A;  1DEL A;  1SCV A;  1TOP A;  1LKJ A;  1PK0 D;  3FWB A;  2KAV A;  1LA3 A;  1UWO A;  3GK2 A;  1CLL A;  1QLK A;  3R1O A;  1NCZ A;  3DVM A;  1D1O A;  1UUS A;  1ALW A;  2OS8 B;  3UNW A;  4YGC B;  1NX2 A;  3K1E A;  1DJZ A;  1BR4 B;  1DVI A;  5D69 A;  1P28 A;  5DKN A;  1DJI A;  3OGN A;  3DF0 A;  2MAZ A;  4ORC B;  3S0E A;  2BNX A;  3ZWH A;  3GK4 X;  3KEV A;  2PYQ A;  3BUN B;  3TDZ A;  4NDC A;  1OMV A;  1N65 A;  2KAY A;  4OZD A;  4PCW A;  2KHN A;  1B8C A;  2L50 A;  3CS1 A;  1NCY A;  3RM1 A;  3R1P A;  2QAC A;  1F54 A;  1AVS A;  3D74 A;  1E8A A;  1WRZ A;  2WCF A;  1QVI Z;  2WCE A;  3E3R A;  3NSL A;  1BF5 A;  2YGU A;  1XFY O;  1Q80 A;  3DYE A;  1B1G A;  1DF0 B;  3DZT A;  1TRF A;  1JFK A;  3D10 A;  1TWO A;  2M29 A;  2QEV A;  1SKT A;  1J55 A;  1FW4 A;  3R1V A;  5HYD A;  1YRT B;  1J1D A;  3LK1 A;  4PE4 A;  2F2O A;  2RGI A;  3RZS A;  1CDP A;  3EKH A;  1XFR A;  3JVT B;  4I5N B;  3LL8 B;  5CSI A;  3I5G B;  1LA0 A;  3NSI A;  4GFT A;  1FI6 A;  2K8M B;  2NCO A;  2CTN A;  1A75 B;  4CFR A;  3PLF B;  4MZK A;  1SCM B;  1M45 A;  3TS5 B;  1S1E A;  2F3Z A;  2SAS A;  3JTD C;  2JT8 A;  3B88 A;  2M7N A;  2ISD A;  1XFZ O;  1EL4 A;  1AUI B;  3OB2 B;  4PE0 A;  2BCX A;  1K93 D;  1DJW A;  1F70 A;  1RJV A;  2LV7 A;  4F7F A;  2M9G A;  1IIO A;  2AUC A;  2HQ8 A;  2KQY A;  2CXJ A;  2PQL A;  1JWD A;  1WDC B;  2KGR A;  1JC2 A;  1AJ4 A;  3C1V A;  2JXC A;  3B86 A;  3GOF A;  2LP3 A;  1OOJ A;  2F8P A;  5J3X A;  3SS5 A;  3OX5 A;  5I2L A;  3CTN A;  1S6J A;  4D1E A;  3SS3 A;  3TDU A;  4GGF C;  1QX2 A;  5FI6 A;  4YGB B;  4I5L B;  1Y6W A;  1DJG A;  3FE9 A;  1SRA A;  1YVL A;  1KWO B;  1UHK A;  1W7J B;  1T14 A;  3PAT A;  1M31 A;  1QIV A;  2LLT A;  1SNL A;  2BE4 A;  1L2O B;  1YVH A;  3A4U B;  2BE6 A;  1EJ3 A;  1GGW A;  3I5H C;  1TNX A;  1H8B A;  3LLE A;  4GBA A;  1DC1 A;  1CB1 A;  4A4C A;  4N1G A;  5AER A;  1Z2C B;  1KQM B;  1RTP 1;  1NX3 A;  1CMF A;  2LHI A;  1B47 A;  1PVA A;  2LE9 B;  2M8U A;  3SG5 A;  1KCY A;  1ZAC A;  2IS9 A;  3V2L A;  4C0K A;  3SS4 A;  1K9U A;  2BEC A;  4PT1 A;  1Y1A A;  4HRH A;  2KFH A;  3D73 A;  4INX A;  1WRK A;  3KPX A;  1G33 A;  1J1E A;  1V1F A;  1WLM A;  4MZL A;  4QJ3 B;  1A4P A;  1TNP A;  1QAS A;  2D8N A;  2NZ0 A;  2F2P A;  3CZ2 A;  3WHU B;  4CFQ A;  1IGV A;  1ODB A;  2L4H A;  3Q8I A;  4GUK A;  4PE7 A;  2LUC A;  2OTG C;  4M2Q A;  4FQO A;  1REC A;  1A29 A;  1FBV A;  2ZFD A;  3VRP A;  1KFU S;  1TCF A;  1IG5 A;  4YBH B;  2TN4 A;  5B8I B;  1U5I B;  2WCJ A;  1YTZ C;  2L5X B;  1QX5 B;  2PAL A;  3PN7 C;  1CDL A;  3IQO A;  4OR9 B;  1PVB A;  1L7Z A;  2BL0 C;  4CID A;  2KLD A;  3FIA A;  1CDN A;  1F8H A;  5ER5 A;  3DVE A;  2KBI A;  1XYD A;  1DF0 A;  5ER4 X;  4DUQ A;  2K60 A;  4TNC A;  2HF5 A;  5K89 A;  1OMR A;  3R72 A;  2VRG A;  4PHM A;  1PSB A;  1YRU B;  4OKH A;  4Q04 A;  4PHN A;  1J7O A;  3O6B A;  1K9P A;  3PAL A;  1SY9 A;  1YUR A;  2K0J A;  1RK9 A;  3VRR A;  1PSR A;  1TUZ A;  1QTX A;  1BU3 A;  1W9Z A;  4MRX A;  5JOL A;  1C7V A;  2I94 A;  4M2P A;  4C0L A;  2KBM A;  2F3Y A;  1OOF A;  3S0D A;  2H2K A;  3NHT A;  4JKT A;  4PDZ A;  3I5I B;  5HKY A;  5CPV A;  2WCL A;  4PHJ A;  2F33 A;  4MVF A;  2FCD A;  3EK4 A;  3AKB A;  2BBM A;  4FTG A;  1SMG A;  1YUT A;  2MHH A;  3L4L A;  3PJI A;  2HPS A;  3EG5 B;  5FYX A;  3VRN A;  4DCK A;  1LXF C;  1KFX S;  3VGO A;  2KYF A;  4HRG A;  3D0Y A;  4A4B A;  5G08 A;  5D7F A;  3MSE B;  1S5G Z;  1BMO A;  3EK8 A;  2WOS A;  2WC8 A;  1KFU L;  3FE6 A;  3IF7 A;  4HRE E;  1K2H A;  2EHB A;  1TNQ A;  5DKQ A;  3CLN A;  5CSN A;  4P2Y B;  1NIW A;  3BOW A;  4XJK B;  2LUX A;  3I5F C;  1M63 B;  2WND A;  3D77 A;  4I5K A;  1M46 A;  2KQ6 A;  1N0Y A;  1NX0 A;  1M39 A;  1OOI X;  2EC6 C;  2FOT A;  4YRU A;  1UHI A;  3EVR A;  1A03 A;  2JZI A;  1XFU O;  1XFV O;  2JC2 A;  1NPQ A;  1KK8 B;  1NWD A;  2MBX A;  3WNX B;  4BY4 A;  4PE1 A;  4F0Z B;  1A2X A;  1QVI Y;  3DY9 A;  3KF9 A;  1Z4H A;  1CLB A;  3PSR A;  3L47 A;  2ZKM X;  3H4S E;  4KYN A;  2CCM A;  2O5G A;  1MR8 A;  2BBN A;  3EVU A;  1SR6 B;  3NXA A;  4NQG A;  4MSP A;  4YGE B;  5HKW A;  2WCB A;  3OB1 B;  2K7B A;  4MLW A;  4DS7 A;  1WY9 A;  2QEB A;  3A8R A;  1EXR A;  2KNE A;  1X02 A;  4CLN A;  4ORA B;  4NDB A;  3K21 A;  3D76 A;  5DKR A;  2M7L A;  5GQQ C;  1U5I A;  4JD9 A;  2Q91 A;  3PM2 A;  1K94 A;  2K2F A;  4OV2 A;  4R1E A;  3NHI A;  5HLO A;  3DVJ A;  1KFX L;  1FI5 A;  3LK0 A;  2Y4Q A;  3S0G A;  1J7P A;  1ALV A;  1SBJ A;  1B8L A;  3DVK A;  1S6I A;  3O4X A;  3OP0 A;  2WC5 A;  2KI4 B;  1B7T Z;  1TUJ A;  2OS8 C;  3BJH A;  3S0A A;  1SL8 A;  2BKI B;  1IQ5 A;  2AMI A;  2JT3 A;  3PN7 B;  2LAP A;  4GAO A;  5HLV A;  4WRI A;  3CWG A;  1C7W A;  2KOT A;  3SIA A;  2WCH A;  1QV0 A;  1CFP A;  2A4J A;  4N1F A;  2JQ6 A;  3UO9 A;  2K7D A;  5IBW A;  2L4I A;  1XO5 A;  2M49 B;  1HQV A;  1J7R A;  2R2I A;  3B87 A;  3M0W A;  3S0F A;  2JOJ A;  5EL2 A;  4FQT A;  2G2B A;  1PAL A;  4BY5 A;  1UHJ A;  3DF0 B;  1NP8 A;  2HET A;  5KU1 A;  1SK6 D;  4CPV A;  1YX8 A;  5JJG A;  1EG4 A;  2PRU A;  1OZS A;  4GPL B;  2LVV A;  3QME A;  3AAK A;  1Y1X A;  2B1U A;  2LMT A;  3BUO B;  2MLF C;  2BKH B;  1C3Y A;  1NX1 A;  5FI2 A;  1ORG A;  1F71 A;  2KAX A;  1JBA A;  1QIW A;  4ORB B;  3SG3 A;  3CGA A;  2M97 A;  2LP2 A;  1XVJ A;  1S26 D;  4AOM A;  2KFG A;  2MLE C;  5PAL A;  1DT7 B;  3FS7 A;  2NLN A;  4AQJ A;  4L9M A;  3I5G C;  1QLS A;  4M2O A;  2PSR A;  4N5X A;  2WC6 A;  3L4A A;  2LVI A;  2OPO A;  3WHT B;  3BQ3 A;  3CDN A;  3IVT A;  1SCM C;  1PRW A;  2BCB A;  4HSZ A;  5D3O A;  3TS5 C;  2ZNE A;  2M1U A;  3CAB A;  1NCX A;  1XFW O;  2QEH A;  4IL1 A;  2KDH A;  2MJW B;  1CMG A;  1BOC A;  2WOR A;  2JT0 A;  1F4O A;  1SW8 A;  2BCA A;  1WDC C;  4WQ3 A;  3F45 A;  1OQP A;  2K7O A;  4MN0 A;  1JSA A;  1SYM A;  2QDI A;  2QPT A;  2ZN9 A;  4C0J A;  4E68 A;  2GV5 A;  1Y1U A;  2K61 A;  2JUL A;  1KQV A;  2LM5 A;  1CKK A;  1A75 A;  2DOQ A;  1Y0V H;  2I18 A;  5AXI A;  2KGB C;  3HX4 A;  1MXL C;  1CFC A;  3SIB A;  2I2R E;  1KWO C;  3SG7 A;  1KK7 Z;  5BPJ A;  4INW A;  3BUM B;  2JNF A;  1DGU A;  1L2O C;  1OSA A;  1SL9 A;  2CT9 A;  2EGD A;  3B6X A;  1QAT A;  1K8U A;  3TUY C;  2LC5 A;  3JTD B;  1MQ1 A;  3TDI A;  1R6P A;  1AJ5 A;  2E30 A;  3CR4 X;  4XYN A;  1UP5 A;  1RRO A;  2CNP A;  1KQM C;  1YUU A;  2L98 A;  2LHL A;  2GGZ A;  1CNP A;  1WLZ A;  2CBL A;  2PMY A;  4QJ4 B;  2LMU A;  2V53 A;  3QRX A;  2M1K B;  2M3W A;  4ZCU A;  2ZRT A;  1G8I A;  1IJ6 A;  2LMV A;  4JPZ B;  3BYA A;  1XK4 A;  1W7I B;  2LVK A;  4YGD B;  1CFD A;  1S5G Y;  1CLM A;  1QV1 A;  2LCP A;  2M0R A;  3TZ1 A;  3AKA A;  1N2D A;  3O78 A;  3DD4 A;  2ERB A;  3CZ0 A;  5I2O A;  1GM0 A;  4MBE A;  2Q4U A;  1TNW A;  2L0P A;  3I5H B;  2LNK A;  1MF8 B;  1OZO A;  2JTT A;  2L2C A;  1TTX A;  5CSF A;  1IWQ A;  1H4B A;  2P70 A;  1V1G A;  4JQ0 D;  1JUO A;  5DIC A;  2LLU A;  4P5O E;  5KTY A;  1BLQ A;  1IH0 A;  4MZJ A;  3ICB A;  1G4Y R;  4PHK A;  3D75 A;  4OVN F;  3BXK A;  1DJY A;  2LLS A;  1RWY A;  1JFJ A;  2MRD A;  2NCP A;  1S3P A;  1UHN A;  1OE9 B;  3SG4 A;  2P6B B;  2JXL A;  5TNC A;  2I7A A; 
#chains in the Genus database with same CATH homology
 5AFP A;  1CFF A;  1NYA A;  2O60 A;  3KO0 A;  1C07 A;  1GQM A;  1R2U A;  3NSK A;  2OTG B;  1BT6 A;  1HT9 A;  3SG2 A;  4MRY A;  2JU0 A;  1ZOT B;  1MXE A;  1ZUZ A;  2L51 A;  3I5I C;  3NSO A;  4PAL A;  4YI8 A;  1YUS A;  2H61 C;  2SCP A;  1CM1 A;  1K9K A;  1UHH A;  2K7C A;  3O4Y A;  1SPY A;  3OX6 A;  3WXA A;  1BJF A;  1MWN A;  4U8D A;  1DTL A;  2BL0 B;  2FCE A;  3RLZ A;  2Y1N A;  3FWC A;  2KSP A;  1GGZ A;  2K2A A;  1JF2 A;  5I2Q A;  1KSM A;  1OMD A;  4YI9 A;  3CR2 A;  3BUW B;  1KSO A;  3CR5 X;  1B7T Y;  1F55 A;  2NXQ A;  1K90 D;  3EVV A;  4I5J A;  1UUR A;  1XFX O;  3GK1 A;  5HKZ A;  1QXP A;  1AHR A;  3D0Y B;  1JF0 A;  4WQ2 A;  3EKJ A;  1IQ3 A;  1B8R A;  2PVB A;  1AP4 A;  2H61 A;  1S36 A;  1YX7 A;  3OHM B;  1CTR A;  1QS7 A;  5AEQ A;  3BOW B;  3BUX B;  4YGA A;  1K96 A;  1IRJ A;  1KK8 C;  1TN4 A;  2KYC A;  3VRQ A;  2AAO A;  1LVC D;  3TUY B;  1RFJ A;  4OCI A;  3SG6 A;  1ZMZ A;  1K95 A;  1DMO A;  3JVT C;  3PFV A;  4AQI A;  1CM4 A;  1DGV A;  1MHO A;  2JWW A;  1VRK A;  1NSH A;  2LVJ A;  4GGN A;  1AK8 A;  3KHE A;  1SR6 C;  4XJK A;  4GGF A;  4UPG A;  3LCP C;  1YR5 A;  1MUX A;  1TIZ A;  2E6W A;  2L2E A;  4NDD A;  2COL B;  2KI6 D;  1DJH A;  2ZND A;  3I5F B;  1FF1 A;  1IKU A;  2JTZ A;  4ICB A;  3VRO A;  4DIR A;  3ZNI A;  1BR1 B;  1B9A A;  2KI6 C;  1IJ5 A;  2EC6 B;  1WRL A;  5CSJ A;  5I8N A;  3AAJ A;  4GNK B;  5AAN A;  3PM8 A;  2KI4 C;  4MEW A;  1BG1 A;  1TCO B;  1ZFS A;  1NUB A;  2GGM A;  1XA5 A;  4ETO A;  1PUL A;  3HCM A;  1LIN A;  4QJ5 B;  1S6C A;  1XK4 C;  2PAS A;  1FPW A;  5F6T A;  1QJT A;  2G9B A;  1DJX A;  2JNX A;  1CDM A;  3CZT X;  4ZCV A;  4USL A;  2HQW A;  2ZRS A;  3O2P A;  5KSZ A;  1EH2 A;  2MA2 A;  1J7Q A;  2ZN8 A;  1GJY A;  1KK7 Y;  1SL7 A;  2FJU B;  3SJS A;  1B4C A;  1QX7 A;  3IQQ A;  2LAN A;  2KFF A;  4JWQ A;  1EG3 A;  2Y1M A;  4DRW A;  2Y5I A;  2JRF A;  2JPT A;  1BOD A;  1F4Q A;  3EK7 A;  1SCV A;  1TOP A;  1LKJ A;  1PK0 D;  3FWB A;  2KAV A;  1LA3 A;  1UWO A;  3GK2 A;  1CLL A;  1QLK A;  1NCZ A;  3DVM A;  1D1O A;  1UUS A;  1ALW A;  2OS8 B;  4YGC B;  1NX2 A;  1DJZ A;  1BR4 B;  1DVI A;  5D69 A;  5DKN A;  1DJI A;  3DF0 A;  2MAZ A;  4ORC B;  3ZWH A;  3GK4 X;  3KEV A;  3TDZ A;  3BUN B;  4NDC A;  1OMV A;  1N65 A;  2KAY A;  4PCW A;  2KHN A;  1B8C A;  2L50 A;  3CS1 A;  1NCY A;  3RM1 A;  2QAC A;  1F54 A;  1AVS A;  1E8A A;  1WRZ A;  2WCF A;  1QVI Z;  2WCE A;  3E3R A;  3NSL A;  1BF5 A;  1XFY O;  1Q80 A;  1B1G A;  1DF0 B;  1TRF A;  1JFK A;  3D10 A;  2M29 A;  5HYD A;  1SKT A;  1J55 A;  1FW4 A;  1YRT B;  1J1D A;  3LK1 A;  4PE4 A;  2F2O A;  2RGI A;  1CDP A;  3EKH A;  3JVT B;  4I5N B;  3LL8 B;  5CSI A;  3I5G B;  1LA0 A;  3NSI A;  4GFT A;  1FI6 A;  2K8M B;  2NCO A;  2CTN A;  1A75 B;  4CFR A;  3PLF B;  4MZK A;  1SCM B;  1M45 A;  3TS5 B;  1S1E A;  2F3Z A;  2SAS A;  3JTD C;  2JT8 A;  2ISD A;  2M7N A;  1XFZ O;  1EL4 A;  1AUI B;  3OB2 B;  4PE0 A;  2BCX A;  1K93 D;  1DJW A;  1F70 A;  1RJV A;  2LV7 A;  2M9G A;  2AUC A;  2HQ8 A;  2KQY A;  2CXJ A;  1JWD A;  1WDC B;  2KGR A;  1JC2 A;  1AJ4 A;  3C1V A;  2JXC A;  3GOF A;  2LP3 A;  1OOJ A;  2F8P A;  5J3X A;  3OX5 A;  5I2L A;  3CTN A;  1S6J A;  4D1E A;  3TDU A;  4GGF C;  1QX2 A;  4YGB B;  4I5L B;  1Y6W A;  1DJG A;  1SRA A;  1YVL A;  1KWO B;  1UHK A;  1W7J B;  3PAT A;  1M31 A;  1QIV A;  2LLT A;  1SNL A;  2BE4 A;  1L2O B;  1YVH A;  3A4U B;  2BE6 A;  1EJ3 A;  1GGW A;  3I5H C;  1TNX A;  1H8B A;  3LLE A;  4GBA A;  1CB1 A;  4A4C A;  4N1G A;  5AER A;  1CMF A;  1KQM B;  1RTP 1;  1NX3 A;  2LHI A;  1B47 A;  1PVA A;  2LE9 B;  2M8U A;  3SG5 A;  1KCY A;  1ZAC A;  2IS9 A;  4C0K A;  1K9U A;  2BEC A;  1Y1A A;  4HRH A;  2KFH A;  1WRK A;  3KPX A;  1G33 A;  1J1E A;  1V1F A;  1WLM A;  4MZL A;  4QJ3 B;  1A4P A;  1TNP A;  1QAS A;  2D8N A;  2NZ0 A;  2F2P A;  3WHU B;  4CFQ A;  1IGV A;  1ODB A;  2L4H A;  4GUK A;  4PE7 A;  2LUC A;  2OTG C;  4M2Q A;  4FQO A;  1REC A;  1A29 A;  1FBV A;  2ZFD A;  3VRP A;  1KFU S;  1TCF A;  1IG5 A;  4YBH B;  2TN4 A;  5B8I B;  1U5I B;  1YTZ C;  2L5X B;  1QX5 B;  2PAL A;  3PN7 C;  1CDL A;  3IQO A;  4OR9 B;  1PVB A;  1L7Z A;  2BL0 C;  4CID A;  3FIA A;  1CDN A;  1F8H A;  5ER5 A;  3DVE A;  2KBI A;  1XYD A;  1DF0 A;  5ER4 X;  4DUQ A;  4TNC A;  2HF5 A;  5K89 A;  1OMR A;  2VRG A;  4PHM A;  1PSB A;  1YRU B;  4OKH A;  4Q04 A;  4PHN A;  1J7O A;  3O6B A;  1K9P A;  3PAL A;  1SY9 A;  1YUR A;  2K0J A;  1RK9 A;  3VRR A;  1PSR A;  1QTX A;  1BU3 A;  4MRX A;  5JOL A;  1C7V A;  2I94 A;  4M2P A;  4C0L A;  2KBM A;  2F3Y A;  2H2K A;  4PDZ A;  3I5I B;  5HKY A;  5CPV A;  4PHJ A;  2F33 A;  4MVF A;  2FCD A;  3EK4 A;  3AKB A;  2BBM A;  4FTG A;  1SMG A;  1YUT A;  2MHH A;  5FYX A;  3VRN A;  2HPS A;  4DCK A;  1LXF C;  1KFX S;  3VGO A;  2KYF A;  4HRG A;  3D0Y A;  4A4B A;  5G08 A;  5D7F A;  3MSE B;  1S5G Z;  1BMO A;  3EK8 A;  2WOS A;  2WC8 A;  1KFU L;  3IF7 A;  4HRE E;  1K2H A;  2EHB A;  1TNQ A;  5DKQ A;  3CLN A;  5CSN A;  4P2Y B;  1NIW A;  3BOW A;  4XJK B;  2LUX A;  3I5F C;  1M63 B;  2WND A;  4I5K A;  1M46 A;  2KQ6 A;  1N0Y A;  1NX0 A;  1M39 A;  4YRU A;  2EC6 C;  2FOT A;  1A03 A;  1UHI A;  3EVR A;  2JZI A;  1XFU O;  1XFV O;  2JC2 A;  1NPQ A;  1KK8 B;  1NWD A;  2MBX A;  3WNX B;  4BY4 A;  4PE1 A;  4F0Z B;  1A2X A;  1QVI Y;  3KF9 A;  1CLB A;  3PSR A;  2ZKM X;  3H4S E;  2CCM A;  2O5G A;  1MR8 A;  2BBN A;  3EVU A;  1SR6 B;  3NXA A;  4NQG A;  4MSP A;  4YGE B;  5HKW A;  2WCB A;  3OB1 B;  2K7B A;  4MLW A;  4DS7 A;  1WY9 A;  3A8R A;  1EXR A;  2KNE A;  1X02 A;  4CLN A;  4ORA B;  4NDB A;  3K21 A;  5DKR A;  2M7L A;  5GQQ C;  1U5I A;  2Q91 A;  4OV2 A;  1K94 A;  2K2F A;  4R1E A;  5HLO A;  3DVJ A;  1KFX L;  1FI5 A;  3LK0 A;  2Y4Q A;  1J7P A;  1ALV A;  1SBJ A;  1B8L A;  3DVK A;  1S6I A;  3OP0 A;  2KI4 B;  1B7T Z;  2OS8 C;  1SL8 A;  2BKI B;  1IQ5 A;  2AMI A;  2JT3 A;  3PN7 B;  2LAP A;  4GAO A;  5HLV A;  4WRI A;  3CWG A;  1C7W A;  2KOT A;  3SIA A;  1CFP A;  1QV0 A;  2A4J A;  4N1F A;  2JQ6 A;  5IBW A;  2K7D A;  2L4I A;  1XO5 A;  2M49 B;  1HQV A;  1J7R A;  2R2I A;  3M0W A;  2JOJ A;  2G2B A;  1PAL A;  4BY5 A;  1UHJ A;  3DF0 B;  1NP8 A;  2HET A;  5KU1 A;  1SK6 D;  4CPV A;  1YX8 A;  5JJG A;  1EG4 A;  2PRU A;  1OZS A;  4GPL B;  2LVV A;  3AAK A;  1Y1X A;  2B1U A;  2LMT A;  3BUO B;  2MLF C;  2BKH B;  1NX1 A;  1F71 A;  2KAX A;  1JBA A;  1QIW A;  4ORB B;  3SG3 A;  3CGA A;  2M97 A;  2LP2 A;  1XVJ A;  1S26 D;  4AOM A;  2KFG A;  2MLE C;  5PAL A;  1DT7 B;  3FS7 A;  2NLN A;  4AQJ A;  4L9M A;  3I5G C;  1QLS A;  4M2O A;  2PSR A;  4N5X A;  2LVI A;  2OPO A;  3WHT B;  3BQ3 A;  1SCM C;  1PRW A;  2BCB A;  4HSZ A;  3TS5 C;  2ZNE A;  2M1U A;  1NCX A;  1XFW O;  4IL1 A;  2KDH A;  2MJW B;  1CMG A;  1BOC A;  2WOR A;  2JT0 A;  1F4O A;  1SW8 A;  2BCA A;  1WDC C;  4WQ3 A;  3F45 A;  1OQP A;  2K7O A;  4MN0 A;  1JSA A;  1SYM A;  2QPT A;  2ZN9 A;  4C0J A;  4E68 A;  2GV5 A;  1Y1U A;  2K61 A;  2JUL A;  1KQV A;  2LM5 A;  1CKK A;  1A75 A;  2DOQ A;  1Y0V H;  2I18 A;  5AXI A;  2KGB C;  3HX4 A;  1MXL C;  1CFC A;  3SIB A;  2I2R E;  1KWO C;  3SG7 A;  1KK7 Z;  5BPJ A;  3BUM B;  2JNF A;  1DGU A;  1L2O C;  1OSA A;  1SL9 A;  2CT9 A;  2EGD A;  1QAT A;  1K8U A;  3TUY C;  2LC5 A;  3JTD B;  1MQ1 A;  3TDI A;  1R6P A;  1AJ5 A;  2E30 A;  3CR4 X;  4XYN A;  1UP5 A;  1RRO A;  2CNP A;  1KQM C;  1YUU A;  2L98 A;  2LHL A;  2GGZ A;  1CNP A;  1WLZ A;  2CBL A;  2PMY A;  4QJ4 B;  2LMU A;  2V53 A;  3QRX A;  2M1K B;  2M3W A;  4ZCU A;  2ZRT A;  1G8I A;  1IJ6 A;  2LMV A;  4JPZ B;  3BYA A;  1XK4 A;  1W7I B;  2LVK A;  4YGD B;  1CFD A;  1S5G Y;  1CLM A;  1QV1 A;  2LCP A;  2M0R A;  3TZ1 A;  3AKA A;  1N2D A;  3O78 A;  3DD4 A;  5I2O A;  4MBE A;  2Q4U A;  1TNW A;  2L0P A;  3I5H B;  2LNK A;  1MF8 B;  1OZO A;  2JTT A;  5CSF A;  1TTX A;  1IWQ A;  1H4B A;  1V1G A;  4JQ0 D;  1JUO A;  2LLU A;  4P5O E;  5KTY A;  1BLQ A;  1IH0 A;  4MZJ A;  3ICB A;  1G4Y R;  4PHK A;  4OVN F;  3BXK A;  1DJY A;  2LLS A;  1RWY A;  1JFJ A;  2MRD A;  2NCP A;  1S3P A;  1UHN A;  1OE9 B;  3SG4 A;  2P6B B;  2JXL A;  5TNC A;  2I7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...