1N0YA

Crystal structure of pb-bound calmodulin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Domain flexibility in the 1.75 A resolution structure of Pb2+-calmodulin.
pubmed doi rcsb
source organism Paramecium tetraurelia
total genus 29
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n0yA00
1K93D 1K96A 2K61A 2KI4C 3FIAA 1W7JB 5K89A 1QTXA 4ETOA 1VRKA 1UHNA 4WRIA 5IBWA 2D8NA 4ZCUA 1LVCD 3HX4A 1WDCB 2EC6B 1DJZA 1PVAA 1DGUA 1OMRA 2R2IA 1XFYO 4DUQA 1F4OA 3QRXA 3I5IC 3ZWHA 2WOSA 1CMFA 1QX2A 2LAPA 1C7WA 1M46A 4MSPA 1BG1A 2JU0A 4YRUA 2LMUA 2LM5A 1X02A 2M3WA 1TN4A 5I2QA 2BCBA 2MRDA 1TNPA 1UUSA 4U8DA 4FTGA 3MSEB 1IQ5A 3AKBA 4JQ0D 3FWBA 4M2OA 1HQVA 1AJ5A 3OX6A 5CSFA 1LA3A 1NUBA 1IKUA 2B1UA 1QASA 4GGFC 4MZKA 3NSLA 2KAXA 2Q4UA 2KHNA 2LHIA 1EXRA 1MQ1A 1QVIZ 5JOLA 2OTGC 2Y1NA 4IL1A 2GGMA 1OMVA 1YR5A 5DKQA 1C7VA 3EK8A 5TNCA 4PE1A 3E3RA 1S6CA 2JXCA 4DRWA 5KU1A 4YGAA 1TNXA 1WRZA 4MVFA 2F33A 3LL8B 2LP2A 4XJKB 1M31A 1R6PA 5G08A 2VRGA 1ZACA 2M1UA 3SG3A 5ER5A 2LCPA 2JXLA 1CB1A 1D1OA 1XK4C 1S6IA 4BY4A 2JQ6A 2LLUA 1J7PA 1J7OA 4GBAA 2JOJA 4R1EA 1YUTA 2L4IA 4N5XA 1XFVO 3DF0A 4MRXA 3PN7C 5GQQC 3LK0A 3BOWA 1FI5A 1S6JA 1CTRA 1SY9A 1ZUZA 5AEQA 1JF0A 1XFWO 2CT9A 1DTLA 1DVIA 2G9BA 2RGIA 1F70A 3OB2B 1V1GA 1K94A 1Y1XA 1UHJA 1YTZC 4PHJA 1OE9B 1K9KA 2E6WA 1PSRA 1YVLA 1CMGA 3D0YA 2PALA 1CFDA 3NSKA 1JC2A 1IJ6A 3FS7A 1CFCA 2JT8A 2BKIB 1DF0A 1NX2A 2CTNA 4A4CA 1XFZO 1PSBA 1GGWA 3I5GC 1WLZA 1CLMA 3KF9A 1UHKA 2K7DA 2ZRTA 1MXEA 3JVTB 3AKAA 3KO0A 1B4CA 1KQMC 2NCPA 2TN4A 1JSAA 4MZLA 1F71A 4MRYA 3I5HC 2WCEA 2KI4B 1LKJA 4HRGA 1ZFSA 1QX7A 2WNDA 1N2DA 2KFHA 4PCWA 1CFFA 2M7NA 1K8UA 2L51A 4F0ZB 3NXAA 5KSZA 1UHHA 2LMVA 5CPVA 4AQIA 1TOPA 1CKKA 1IRJA 1TIZA 3DF0B 2LUCA 3I5IB 4YI8A 1BLQA 2M49B 2Y5IA 3BOWB 4CIDA 5CSIA 1CM1A 2LVIA 4WQ2A 3WHTB 4QJ4B 1M39A 1J7QA 2BKHB 3TUYC 3F45A 1SBJA 2LANA 2LVVA 3EVRA 4I5NB 1RWYA 5D7FA 3BXKA 1KFUS 1KQVA 2I94A 1B1GA 1WLMA 1A4PA 2L2EA 2ZNEA 4P5OE 2K8MB 1YX7A 4MZJA 4XJKA 1J1DA 2KGBC 1CDMA 1CDPA 1V1FA 3D0YB 1UP5A 3KEVA 1K9UA 1M63B 2OS8C 2WC8A 3I5FB 2ISDA 1DF0B 2KGRA 2OTGB 3OHMB 5AFPA 3FWCA 2CCMA 4GPLB 3A8RA 3TS5C 3SG7A 3IF7A 1KCYA 1EJ3A 1NIWA 3GOFA 4PE7A 5J3XA 1L2OC 1HT9A 2ZN9A 1S36A 2F8PA 2BL0B 4QJ5B 2H61A 2LVJA 4ORBB 2BE6A 2H2KA 3BYAA 3TZ1A 4NDCA 5JJGA 4YBHB 3NSIA 1AP4A 1JFJA 1BR1B 2K2AA 1EG4A 5F6TA 3WXAA 2M97A 3CR2A 1SK6D 1R2UA 1TCFA 2ZN8A 4GGNA 3OP0A 1IJ5A 1PK0D 4OCIA 2KNEA 3NSOA 1OOJA 2Y4QA 3K21A 2COLB 2HETA 3A4UB 3VGOA 3SG6A 1AHRA 3M0WA 2E30A 3PM8A 2MLEC 1S26D 5HLOA 2SASA 3PN7B 3VRNA 5D69A 1YRTB 1SNLA 2M1KB 2BCAA 4I5LB 2HPSA 1W7IB 2KFGA 1CNPA 3O2PA 1PRWA 2BECA 3O4YA 2JRFA 4M2PA 3O78A 1YURA 4HRHA 5DKRA 1NP8A 3CZTX 1FI6A 1A2XA 1XFUO 2LE9B 3CWGA 1NX3A 2CNPA 2PVBA 2QPTA 3PATA 1CLLA 3CS1A 3OX5A 2K0JA 1AVSA 1FBVA 1OSAA 1KK7Y 1OZOA 2EHBA 1RTP1 2EGDA 1CDLA 1B7TZ 3DVJA 2L0PA 4ORCB 4A4BA 2ZRSA 2JT3A 4UPGA 5I2OA 1WY9A 4MEWA 1SKTA 1KWOB 2HF5A 2FJUB 2KAYA 4BY5A 4YGDB 1QIVA 1BMOA 3I5HB 1SL7A 2AMIA 1RROA 1LA0A 1L7ZA 1QLKA 1QV1A 1YX8A 3VROA 1J55A 1NPQA 4C0KA 5HKYA 4GGFA 1BR4B 2BBMA 2JC2A 5FYXA 1JBAA 1ALWA 2MLFC 1QV0A 1SL8A 2JNFA 1SR6B 1RECA 1MXLC 3CR4X 1QX5B 3HCMA 3WHUB 4AQJA 1K90D 1NWDA 1NSHA 4FQOA 2FCDA 3EVUA 3TUYB 1SCMB 3JTDC 2AUCA 1K2HA 1KK8B 1LINA 2ZKMX 1GQMA 1SCVA 1XA5A 1TRFA 2LP3A 5KTYA 3PFVA 1G33A 3PLFB 5AANA 1ZMZA 2PSRA 4PHNA 1FF1A 1GJYA 2WCFA 3EKJA 3EKHA 1A75B 3EK7A 2JPTA 1JFKA 2MHHA 3AAKA 2KFFA 1DJXA 3GK4X 5ER4X 4PE4A 1RFJA 2KYFA 1S5GY 2OS8B 1KSOA 2LNKA 3WNXB 2M8UA 2O5GA 4PDZA 2BE4A 1IWQA 1B47A 3CGAA 4OV2A 1XK4A 2L50A 1WRKA 2CXJA 2LUXA 3DVMA 3KHEA 4GAOA 3SG5A 3VRPA 1UHIA 4CPVA 1SRAA 1L2OB 2P6BB 2PMYA 1KFXL 1H4BA 1Y1AA 2I18A 2KQ6A 5DKNA 1DJHA 3OB1B 2L98A 5HKZA 2NCOA 3DD4A 3RLZA 4MLWA 2Q91A 3IQQA 1TNWA 2CBLA 2JTTA 4I5JA 4OR9B 4CFRA 1TNQA 3BQ3A 2HQ8A 1NX0A 1S3PA 1ZOTB 2DOQA 2LHLA 4OKHA 1XYDA 3GK1A 4GUKA 4JPZB 1EL4A 2K7OA 4HREE 2F3ZA 1DT7B 1CLBA 3IQOA 1Y0VH 1MHOA 4USLA 4AOMA 1OQPA 1SW8A 2KBMA 1M45A 2AAOA 1OMDA 2I7AA 4NDBA 5HYDA 1KFUL 1F54A 1UWOA 4ZCVA 3LK1A 1AJ4A 2L4HA 1KK7Z 1GGZA 1N0YA 1NCZA 4YI9A 1F4QA 2BBNA 1YUUA 1BJFA 1QLSA 4N1FA 1JF2A 3PSRA 1G4YR 3RM1A 1H8BA 2KI6C 2FOTA 4YGEB 2M7LA 4PHKA 1IGVA 1F55A 2SCPA 4E68A 2K7BA 1N65A 4XYNA 4CFQA 4HSZA 1NCYA 3TDIA 4C0JA 1YUSA 1AUIB 5I8NA 4JWQA 1MR8A 1E8AA 1WDCC 2EC6C 1Y1UA 4P2YB 2GV5A 2M29A 2L5XB 1AK8A 4NQGA 3I5FC 4CLNA 1XVJA 1G8IA 2JNXA 1B8CA 1S1EA 2MAZA 3DVKA 1UURA 2ZNDA 1U5IA 2KSPA 4QJ3B 3TDZA 3BUOB 1BODA 2KAVA 1DGVA 1XO5A 2JWWA 1SL9A 1MUXA 1A75A 2BL0C 1PALA 2A4JA 3VRRA 4NDDA 5AERA 3EK4A 3ICBA 3LCPC 5PALA 1NCXA 2K7CA 1ALVA 1J7RA 4L9MA 1K9PA 2BCXA 3BUWB 2WORA 3SG4A 3KPXA 3TDUA 3I5GB 3GK2A 2MBXA 2O60A 1WRLA 4PE0A 1S5GZ 1YRUB 3SIBA 3JTDB 1SPYA 1K95A 1QIWA 1TCOB 2I2RE 3EVVA 3PALA 1KQMB 2JTZA 4MBEA 2K2FA 1QJTA 2MJWB 2NXQA 3H4SE 2HQWA 4M2QA 1A29A 2Y1MA 1IH0A 2KOTA 2OPOA 4I5KA 5CSJA 4GNKB 1J1EA 3SJSA 2M9GA 1QXPA 2LMTA 1QVIY 1CM4A 3SIAA 1DJYA 1IG5A 4D1EA 1RJVA 1BU3A 2FCEA 2NZ0A 4PALA 3BUXB 3O6BA 1OZSA 1FPWA 2F2PA 2LVKA 5I2LA 2LLSA 1U5IB 2V53A 3D10A 3BUMB 4DIRA 1B8LA 4WQ3A 5HKWA 1JUOA 1PULA 1C07A 1CDNA 1BF5A 2H61C 4N1GA 5B8IB 4C0LA 1DJIA 1MF8B 1EH2A 2KYCA 1NX1A 3DVEA 5CSNA 1CFPA 3SG2A 4YGCB 1KFXS 1QS7A 1B9AA 1Y6WA 1YVHA 4Q04A 1DMOA 2KQYA 3TS5B 1FW4A 1SYMA 1IQ3A 3ZNIA 4DCKA 5BPJA 1KWOC 1PVBA 1SMGA 2JULA 2LC5A 1BOCA 1JWDA 2IS9A 1A03A 2PRUA 1NYAA 1F8HA 2JZIA 2M0RA 2PASA 2GGZA 1BT6A 1LXFC 3BUNB 2G2BA 1MWNA 4GFTA 5HLVA 3C1VA 1TTXA 4TNCA 1DJWA 2LV7A 3LLEA 1B8RA 2KBIA 4OVNF 1B7TY 2KI6D 1DJGA 2ZFDA 1QATA 1SR6C 2JT0A 3AAJA 4DS7A 2KDHA 2F3YA 4MN0A 1Q80A 1EG3A 2NLNA 5AXIA 2QACA 1RK9A 4ORAB 3VRQA 1XFXO 1SCMC 4YGBB 3JVTC 1KK8C 1ODBA 3CLNA 3CTNA 2WCBA 4ICBA 2LLTA 1KSMA 4PHMA 2MA2A 2F2OA 3CR5X
chains in the Genus database with same CATH superfamily
1K93D 1K96A 2K61A 2KI4C 1QWVA 2QEHA 3FIAA 1W7JB 5K89A 1QTXA 4ETOA 1VRKA 1UHNA 4WRIA 5IBWA 1GM0A 2D8NA 4ZCUA 1LVCD 3HX4A 3SS5A 5EL2A 1WDCB 3B7AA 2EC6B 1DJZA 1PVAA 1DGUA 1OMRA 2R2IA 1XFYO 3D73A 4DUQA 1XFRA 1F4OA 3QRXA 3I5IC 3ZWHA 3S0FA 2BAPA 2WOSA 1CMFA 1QX2A 3R72A 2LAPA 1C7WA 1M46A 3OBVA 4MSPA 2JU0A 4YRUA 1BG1A 2LMUA 2LM5A 1X02A 2M3WA 1TN4A 5I2QA 2BCBA 2MRDA 1TNPA 2WC6A 1UUSA 4U8DA 4FTGA 3MSEB 1IQ5A 3AKBA 4JQ0D 3FWBA 4M2OA 1HQVA 4OV2A 1AJ5A 3OX6A 5CSFA 1LA3A 1NUBA 1IKUA 2B1UA 1QASA 4GGFC 4MZKA 3NSLA 2KAXA 2Q4UA 3S0BA 2QEBA 2KHNA 2LHIA 1EXRA 1MQ1A 1QVIZ 5JOLA 2OTGC 2Y1NA 3BFBA 3BFAA 2GGMA 1OMVA 1YR5A 4IL1A 5DKQA 1C7VA 3EK8A 3DXLA 5TNCA 4PE1A 1Z2CB 3E3RA 1S6CA 2JXCA 3S0AA 4DRWA 5KU1A 4YGAA 1TNXA 1WRZA 4MVFA 3S0EA 2F33A 3LL8B 2LP2A 4XJKB 1M31A 1R6PA 5G08A 1OOFA 2VRGA 1ZACA 2M1UA 3SG3A 5ER5A 2LCPA 2GTEA 2JXLA 1CB1A 1D1OA 1XK4C 4INWA 1S6IA 4BY4A 2JQ6A 2LLUA 1J7PA 1J7OA 4GBAA 2JOJA 4R1EA 5DICA 1YUTA 2L4IA 4N5XA 1C3ZA 1XFVO 3DF0A 4MRXA 3PN7C 5GQQC 3LK0A 3BOWA 1FI5A 1S6JA 1CTRA 3DY9A 1SY9A 1ZUZA 5AEQA 1JF0A 1XFWO 2CT9A 1DTLA 1DVIA 2G9BA 2RGIA 1F70A 3UNWA 3OB2B 1V1GA 2BNXA 1K94A 1Y1XA 1UHJA 1YTZC 4PHJA 5FI7A 1OE9B 1K9KA 2E6WA 1DELA 1PSRA 1YVLA 3FE6A 3R1OA 3D0YA 2PALA 1CFDA 3NSKA 1CMGA 4KYNA 1JC2A 1IJ6A 3OGNA 3FS7A 1CFCA 2JT8A 2BKIB 1DF0A 1NX2A 2CTNA 3B86A 4A4CA 1XFZO 1PSBA 1GGWA 3DYEA 3I5GC 1WLZA 2ERBA 1CLMA 3KF9A 1UHKA 2K7DA 2ZRTA 1MXEA 3JVTB 3AKAA 3KO0A 4IJ7A 1B4CA 1KQMC 1TUJA 2NCPA 2TN4A 4MZLA 1JSAA 1F71A 4MRYA 3I5HC 2WCEA 2KI4B 1LKJA 1ORGA 1ZFSA 1QX7A 2WNDA 1N2DA 2KFHA 4HRGA 4PCWA 3K1EA 3S0DA 1CFFA 2M7NA 1K8UA 2L51A 4F0ZB 3NXAA 5KSZA 1LS8A 1UHHA 2LMVA 2PYQA 5CPVA 4AQIA 1TOPA 1CKKA 1IRJA 1TIZA 3DF0B 2LUCA 3I5IB 4YI8A 1BLQA 2M49B 2Y5IA 3BOWB 3UO9A 4CIDA 5CSIA 1CM1A 2LVIA 4WQ2A 3L4LA 3WHTB 1M39A 4QJ4B 1J7QA 2BKHB 3TUYC 3F45A 1SBJA 2LANA 2H8VA 2LVVA 3EVRA 4I5NB 1RWYA 5D7FA 3D77A 3BXKA 1KFUS 1KQVA 2I94A 1B1GA 1WLMA 1A4PA 2L2EA 2ZNEA 4P5OE 2K8MB 1YX7A 4MZJA 4XJKA 1J1DA 2KGBC 1CDMA 3D74A 1CDPA 3PJIA 1V1FA 3D0YB 1UP5A 3KEVA 1K9UA 1M63B 2OS8C 2WC8A 2WCKA 3BFHA 3I5FB 2ISDA 1DF0B 2KGRA 2OTGB 3OHMB 4F7FA 5AFPA 3FWCA 2CCMA 4GPLB 3A8RA 3TS5C 3SG7A 1T14A 3IF7A 1EJ3A 4FQTA 1KCYA 1NIWA 3GOFA 4PE7A 5J3XA 1L2OC 1HT9A 2ZN9A 1P28A 1S36A 2BL0B 2F8PA 4QJ5B 2H61A 2LVJA 3QMEA 4ORBB 2BE6A 2H2KA 3BYAA 1IIOA 3TZ1A 4NDCA 5JJGA 4YBHB 3NSIA 1AP4A 1JFJA 1BR1B 3V2LA 4JD9A 2K2AA 1EG4A 5F6TA 3WXAA 2M97A 3CR2A 1SK6D 1R2UA 1TCFA 2ZN8A 4GGNA 3OP0A 1IJ5A 1DEKA 1PK0D 4OCIA 2KNEA 3NSOA 1OOJA 2Y4QA 3K21A 2PQLA 2COLB 2HETA 3A4UB 3VGOA 3SG6A 1DC1A 1AHRA 4JKTA 5FI6A 3M0WA 2E30A 3IVTA 3PM8A 2MLEC 1S26D 5HLOA 2SASA 3PN7B 3VRNA 1TWOA 5D69A 5KTYA 1OOHA 1YRTB 1SNLA 2M1KB 2BCAA 4I5LB 2HPSA 1W7IB 2KFGA 2KLDA 3O2PA 1PRWA 2BECA 3O4YA 2JRFA 1CNPA 4M2PA 3O78A 1YURA 3S0GA 4HRHA 5DKRA 1NP8A 2FJYA 3CZTX 1FI6A 1A2XA 1XFUO 2LE9B 3CWGA 2JPOA 1NX3A 2CNPA 2PVBA 2QPTA 3PATA 1CLLA 3CS1A 3OX5A 2K0JA 1AVSA 1FBVA 1OSAA 1KK7Y 1OZOA 2EHBA 1RTP1 2EGDA 1CDLA 1B7TZ 3DVJA 2L0PA 3NGVA 4ORCB 2P71A 4A4BA 2ZRSA 2JT3A 4UPGA 5I2OA 1WY9A 4MEWA 1SKTA 1KWOB 2HF5A 2FJUB 2KAYA 3D76A 4YGDB 4BY5A 1QIVA 1BMOA 3I5HB 1SL7A 2AMIA 1RROA 1LA0A 1L7ZA 1QLKA 1QV1A 1YX8A 3CZ0A 3VROA 1J55A 1NPQA 4C0KA 5HKYA 4GGFA 1BR4B 2BBMA 2JC2A 2K60A 5FYXA 1JBAA 1ALWA 2MLFC 3VB1A 1QV0A 1SL8A 2JNFA 2WCLA 1SR6B 2QEVA 1RECA 1MXLC 3CR4X 1QX5B 3HCMA 3WHUB 4AQJA 1K90D 1NWDA 1NSHA 4FQOA 2FCDA 3EVUA 3TUYB 1SCMB 3JTDC 2AUCA 1K2HA 1KK8B 3D75A 1LINA 2ZKMX 1GQMA 1SCVA 1XA5A 1TRFA 2LP3A 3FE9A 3PFVA 1G33A 3PLFB 5AANA 1ZMZA 2PSRA 4PHNA 1FF1A 5I94A 1GJYA 2WCFA 3EKJA 3EKHA 1A75B 4INXA 3EK7A 2JPTA 1JFKA 2MHHA 3AAKA 2KFFA 1DJXA 3GK4X 5ER4X 4PE4A 1RFJA 2KYFA 1S5GY 2OS8B 1KSOA 2LNKA 3WNXB 2M8UA 2O5GA 4PDZA 2BE4A 1IWQA 1B47A 3CGAA 3NHTA 1XK4A 2L50A 1WRKA 2CXJA 2LUXA 2WCJA 3DVMA 3DZTA 3KHEA 4GAOA 3SG5A 3VRPA 1UHIA 3O4XA 4CPVA 1OW4A 1SRAA 1L2OB 2P6BB 2PMYA 1KFXL 1H4BA 1Y1AA 3BJHA 2I18A 2KQ6A 5DKNA 1DJHA 3OB1B 1OOGA 2L98A 5HKZA 2NCOA 3DD4A 3RLZA 4MLWA 2Q91A 3IQQA 1TNWA 2CBLA 2JTTA 4I5JA 4OR9B 4CFRA 1TNQA 3BQ3A 2L5YA 2HQ8A 1NX0A 1S3PA 4PT1A 1ZOTB 2DOQA 2LHLA 3D78A 4OKHA 1XYDA 3GK1A 4GUKA 3CABA 4JPZB 1EL4A 2L2CA 3FE8A 4OZDA 2K7OA 4HREE 1OOIX 2F3ZA 1DT7B 1CLBA 3IQOA 1Y0VH 1MHOA 4USLA 1Z4HA 4AOMA 1OQPA 1SW8A 2KBMA 1M45A 2AAOA 1OMDA 2I7AA 4NDBA 5HYDA 1KFUL 2WCMA 1F54A 1UWOA 3N7HA 3LK1A 1AJ4A 2L4HA 4ZCVA 1KK7Z 1GGZA 1N0YA 1NCZA 4YI9A 1F4QA 2BBNA 1C3YA 1YUUA 1BJFA 1QLSA 4N1FA 1JF2A 3PSRA 1G4YR 3RM1A 1H8BA 2KI6C 2QEOA 2WCHA 2FOTA 4YGEB 2M7LA 4PHKA 1IGVA 1F55A 2SCPA 4E68A 2K7BA 1N65A 2WC5A 4XYNA 4CFQA 4HSZA 1NCYA 3TDIA 4C0JA 2QDIA 1YUSA 1AUIB 3CZ1A 5I8NA 4JWQA 1MR8A 1E8AA 1W9ZA 1WDCC 1Y1UA 2EC6C 2GV5A 2M29A 2L5XB 4P2YB 1AK8A 1DQEA 4NQGA 3I5FC 4CLNA 1XVJA 1G8IA 2JNXA 1B8CA 1S1EA 2MAZA 3DVKA 1UURA 2ZNDA 1U5IA 2KSPA 4QJ3B 3TDZA 3BUOB 1BODA 2KAVA 1DGVA 3L47A 1TUZA 1XO5A 2JWWA 1SL9A 1MUXA 5FI2A 1SSEB 1A75A 2BL0C 3RZSA 1PALA 2A4JA 3VRRA 4NDDA 3B87A 5AERA 3EK4A 3ICBA 3LCPC 5PALA 1NCXA 2K7CA 1ALVA 1J7RA 4L9MA 1K9PA 2BCXA 3BUWB 2WORA 3SG4A 3KPXA 3TDUA 3I5GB 3GK2A 2MBXA 2O60A 1WRLA 4PE0A 1S5GZ 1YRUB 3SIBA 3JTDB 1SPYA 1K95A 1QIWA 1TCOB 2I2RE 3EVVA 3PALA 1KQMB 2JTZA 4MBEA 2K2FA 1QJTA 2MJWB 2NXQA 3H4SE 2HQWA 4M2QA 1A29A 2Y1MA 3CDNA 1IH0A 2KOTA 2OPOA 4I5KA 3B88A 5CSJA 4GNKB 1J1EA 3SJSA 2M9GA 1QXPA 2LMTA 3SS4A 1QVIY 3R1VA 1CM4A 3SIAA 1DJYA 1IG5A 4D1EA 2KLEA 1RJVA 1BU3A 2FCEA 2NZ0A 4PALA 3BUXB 3O6BA 1OZSA 2P70A 1FPWA 2F2PA 2LVKA 3EG5B 5I2LA 2LLSA 1U5IB 2V53A 3D10A 3BUMB 3CZ2A 4DIRA 1B8LA 4WQ3A 5HKWA 1JUOA 1PULA 3L4AA 1C07A 1CDNA 1BF5A 2H61C 4N1GA 5B8IB 4C0LA 1DJIA 1MF8B 1EH2A 2KYCA 1NX1A 3DVEA 5CSNA 1CFPA 3SG2A 4YGCB 1KFXS 1QS7A 2YGUA 1B9AA 1Y6WA 1YVHA 4Q04A 1DMOA 3R1PA 2KQYA 3TS5B 1FW4A 1SYMA 1IQ3A 3ZNIA 4DCKA 5BPJA 1KWOC 1PVBA 1SMGA 2JULA 2LC5A 1BOCA 1JWDA 2IS9A 1A03A 2PRUA 1NYAA 1F8HA 3B6XA 2JZIA 2M0RA 5D3OA 2PASA 2GGZA 1BT6A 1LXFC 3BUNB 2G2BA 1MWNA 4GFTA 5HLVA 3C1VA 1TTXA 4TNCA 1DJWA 2LV7A 3LLEA 1B8RA 2KBIA 4OVNF 1B7TY 3NHIA 2KI6D 1DJGA 2ZFDA 1QATA 1SR6C 2JT0A 3PM2A 3AAJA 3SS3A 4DS7A 2KDHA 2F3YA 4MN0A 1Q80A 2KPHA 1EG3A 2NLNA 5AXIA 3Q8IA 2QACA 1RK9A 4ORAB 3VRQA 3CYZA 1XFXO 1SCMC 5HL1A 4YGBB 3JVTC 1KK8C 1ODBA 3CLNA 3CTNA 2WCBA 4ICBA 2LLTA 1KSMA 4PHMA 2MA2A 2F2OA 3CR5X
chains in the Genus database with same CATH topology
1K93D 1K96A 2K61A 2KI4C 3FIAA 1W7JB 5K89A 1QTXA 4ETOA 1VRKA 1UHNA 4WRIA 5IBWA 2D8NA 4ZCUA 1LVCD 3HX4A 1WDCB 2EC6B 1DJZA 1PVAA 1DGUA 1OMRA 2R2IA 1XFYO 4DUQA 1F4OA 3QRXA 3I5IC 3ZWHA 2WOSA 1CMFA 1QX2A 2LAPA 1C7WA 1M46A 4MSPA 1BG1A 2JU0A 4YRUA 2LMUA 2LM5A 1X02A 2M3WA 1TN4A 5I2QA 2BCBA 2MRDA 1TNPA 1UUSA 4U8DA 4FTGA 3MSEB 1IQ5A 3AKBA 4JQ0D 3FWBA 4M2OA 1HQVA 1AJ5A 3OX6A 5CSFA 1LA3A 1NUBA 1IKUA 2B1UA 1QASA 4GGFC 4MZKA 3NSLA 2KAXA 2Q4UA 2KHNA 2LHIA 1EXRA 1MQ1A 1QVIZ 5JOLA 2OTGC 2Y1NA 4IL1A 2GGMA 1OMVA 1YR5A 5DKQA 1C7VA 3EK8A 5TNCA 4PE1A 3E3RA 1S6CA 2JXCA 4DRWA 5KU1A 4YGAA 1TNXA 1WRZA 4MVFA 2F33A 3LL8B 2LP2A 4XJKB 1M31A 1R6PA 5G08A 2VRGA 1ZACA 2M1UA 3SG3A 5ER5A 2LCPA 2JXLA 1CB1A 1D1OA 1XK4C 1S6IA 4BY4A 2JQ6A 2LLUA 1J7PA 1J7OA 4GBAA 2JOJA 4R1EA 1YUTA 2L4IA 4N5XA 1XFVO 3DF0A 4MRXA 3PN7C 5GQQC 3LK0A 3BOWA 1FI5A 1S6JA 1CTRA 1SY9A 1ZUZA 5AEQA 1JF0A 1XFWO 2CT9A 1DTLA 1DVIA 2G9BA 2RGIA 1F70A 3OB2B 1V1GA 1K94A 1Y1XA 1UHJA 1YTZC 4PHJA 1OE9B 1K9KA 2E6WA 1PSRA 1YVLA 1CMGA 3D0YA 2PALA 1CFDA 3NSKA 1JC2A 1IJ6A 3FS7A 1CFCA 2JT8A 2BKIB 1DF0A 1NX2A 2CTNA 4A4CA 1XFZO 1PSBA 1GGWA 3I5GC 1WLZA 1CLMA 3KF9A 1UHKA 2K7DA 2ZRTA 1MXEA 3JVTB 3AKAA 3KO0A 1B4CA 1KQMC 2NCPA 2TN4A 1JSAA 4MZLA 1F71A 4MRYA 3I5HC 2WCEA 2KI4B 1LKJA 4HRGA 1ZFSA 1QX7A 2WNDA 1N2DA 2KFHA 4PCWA 1CFFA 2M7NA 1K8UA 2L51A 4F0ZB 3NXAA 5KSZA 1UHHA 2LMVA 5CPVA 4AQIA 1TOPA 1CKKA 1IRJA 1TIZA 3DF0B 2LUCA 3I5IB 4YI8A 1BLQA 2M49B 2Y5IA 3BOWB 4CIDA 5CSIA 1CM1A 2LVIA 4WQ2A 3WHTB 4QJ4B 1M39A 1J7QA 2BKHB 3TUYC 3F45A 1SBJA 2LANA 2LVVA 3EVRA 4I5NB 1RWYA 5D7FA 3BXKA 1KFUS 1KQVA 2I94A 1B1GA 1WLMA 1A4PA 2L2EA 2ZNEA 4P5OE 2K8MB 1YX7A 4MZJA 4XJKA 1J1DA 2KGBC 1CDMA 1CDPA 1V1FA 3D0YB 1UP5A 3KEVA 1K9UA 1M63B 2OS8C 2WC8A 3I5FB 2ISDA 1DF0B 2KGRA 2OTGB 3OHMB 5AFPA 3FWCA 2CCMA 4GPLB 3A8RA 3TS5C 3SG7A 3IF7A 1KCYA 1EJ3A 1NIWA 3GOFA 4PE7A 5J3XA 1L2OC 1HT9A 2ZN9A 1S36A 2F8PA 2BL0B 4QJ5B 2H61A 2LVJA 4ORBB 2BE6A 2H2KA 3BYAA 3TZ1A 4NDCA 5JJGA 4YBHB 3NSIA 1AP4A 1JFJA 1BR1B 2K2AA 1EG4A 5F6TA 3WXAA 2M97A 3CR2A 1SK6D 1R2UA 1TCFA 2ZN8A 4GGNA 3OP0A 1IJ5A 1PK0D 4OCIA 2KNEA 3NSOA 1OOJA 2Y4QA 3K21A 2COLB 2HETA 3A4UB 3VGOA 3SG6A 1AHRA 3M0WA 2E30A 3PM8A 2MLEC 1S26D 5HLOA 2SASA 3PN7B 3VRNA 5D69A 1YRTB 1SNLA 2M1KB 2BCAA 4I5LB 2HPSA 1W7IB 2KFGA 1CNPA 3O2PA 1PRWA 2BECA 3O4YA 2JRFA 4M2PA 3O78A 1YURA 4HRHA 5DKRA 1NP8A 3CZTX 1FI6A 1A2XA 1XFUO 2LE9B 3CWGA 1NX3A 2CNPA 2PVBA 2QPTA 3PATA 1CLLA 3CS1A 3OX5A 2K0JA 1AVSA 1FBVA 1OSAA 1KK7Y 1OZOA 2EHBA 1RTP1 2EGDA 1CDLA 1B7TZ 3DVJA 2L0PA 4ORCB 4A4BA 2ZRSA 2JT3A 4UPGA 5I2OA 1WY9A 4MEWA 1SKTA 1KWOB 2HF5A 2FJUB 2KAYA 4BY5A 4YGDB 1QIVA 1BMOA 3I5HB 1SL7A 2AMIA 1RROA 1LA0A 1L7ZA 1QLKA 1QV1A 1YX8A 3VROA 1J55A 1NPQA 4C0KA 5HKYA 4GGFA 1BR4B 2BBMA 2JC2A 5FYXA 1JBAA 1ALWA 2MLFC 1QV0A 1SL8A 2JNFA 1SR6B 1RECA 1MXLC 3CR4X 1QX5B 3HCMA 3WHUB 4AQJA 1K90D 1NWDA 1NSHA 4FQOA 2FCDA 3EVUA 3TUYB 1SCMB 3JTDC 2AUCA 1K2HA 1KK8B 1LINA 2ZKMX 1GQMA 1SCVA 1XA5A 1TRFA 2LP3A 5KTYA 3PFVA 1G33A 3PLFB 5AANA 1ZMZA 2PSRA 4PHNA 1FF1A 1GJYA 2WCFA 3EKJA 3EKHA 1A75B 3EK7A 2JPTA 1JFKA 2MHHA 3AAKA 2KFFA 1DJXA 3GK4X 5ER4X 4PE4A 1RFJA 2KYFA 1S5GY 2OS8B 1KSOA 2LNKA 3WNXB 2M8UA 2O5GA 4PDZA 2BE4A 1IWQA 1B47A 3CGAA 4OV2A 1XK4A 2L50A 1WRKA 2CXJA 2LUXA 3DVMA 3KHEA 4GAOA 3SG5A 3VRPA 1UHIA 4CPVA 1SRAA 1L2OB 2P6BB 2PMYA 1KFXL 1H4BA 1Y1AA 2I18A 2KQ6A 5DKNA 1DJHA 3OB1B 2L98A 5HKZA 2NCOA 3DD4A 3RLZA 4MLWA 2Q91A 3IQQA 1TNWA 2CBLA 2JTTA 4I5JA 4OR9B 4CFRA 1TNQA 3BQ3A 2HQ8A 1NX0A 1S3PA 1ZOTB 2DOQA 2LHLA 4OKHA 1XYDA 3GK1A 4GUKA 4JPZB 1EL4A 2K7OA 4HREE 2F3ZA 1DT7B 1CLBA 3IQOA 1Y0VH 1MHOA 4USLA 4AOMA 1OQPA 1SW8A 2KBMA 1M45A 2AAOA 1OMDA 2I7AA 4NDBA 5HYDA 1KFUL 1F54A 1UWOA 4ZCVA 3LK1A 1AJ4A 2L4HA 1KK7Z 1GGZA 1N0YA 1NCZA 4YI9A 1F4QA 2BBNA 1YUUA 1BJFA 1QLSA 4N1FA 1JF2A 3PSRA 1G4YR 3RM1A 1H8BA 2KI6C 2FOTA 4YGEB 2M7LA 4PHKA 1IGVA 1F55A 2SCPA 4E68A 2K7BA 1N65A 4XYNA 4CFQA 4HSZA 1NCYA 3TDIA 4C0JA 1YUSA 1AUIB 5I8NA 4JWQA 1MR8A 1E8AA 1WDCC 2EC6C 1Y1UA 4P2YB 2GV5A 2M29A 2L5XB 1AK8A 4NQGA 3I5FC 4CLNA 1XVJA 1G8IA 2JNXA 1B8CA 1S1EA 2MAZA 3DVKA 1UURA 2ZNDA 1U5IA 2KSPA 4QJ3B 3TDZA 3BUOB 1BODA 2KAVA 1DGVA 1XO5A 2JWWA 1SL9A 1MUXA 1A75A 2BL0C 1PALA 2A4JA 3VRRA 4NDDA 5AERA 3EK4A 3ICBA 3LCPC 5PALA 1NCXA 2K7CA 1ALVA 1J7RA 4L9MA 1K9PA 2BCXA 3BUWB 2WORA 3SG4A 3KPXA 3TDUA 3I5GB 3GK2A 2MBXA 2O60A 1WRLA 4PE0A 1S5GZ 1YRUB 3SIBA 3JTDB 1SPYA 1K95A 1QIWA 1TCOB 2I2RE 3EVVA 3PALA 1KQMB 2JTZA 4MBEA 2K2FA 1QJTA 2MJWB 2NXQA 3H4SE 2HQWA 4M2QA 1A29A 2Y1MA 1IH0A 2KOTA 2OPOA 4I5KA 5CSJA 4GNKB 1J1EA 3SJSA 2M9GA 1QXPA 2LMTA 1QVIY 1CM4A 3SIAA 1DJYA 1IG5A 4D1EA 1RJVA 1BU3A 2FCEA 2NZ0A 4PALA 3BUXB 3O6BA 1OZSA 1FPWA 2F2PA 2LVKA 5I2LA 2LLSA 1U5IB 2V53A 3D10A 3BUMB 4DIRA 1B8LA 4WQ3A 5HKWA 1JUOA 1PULA 1C07A 1CDNA 1BF5A 2H61C 4N1GA 5B8IB 4C0LA 1DJIA 1MF8B 1EH2A 2KYCA 1NX1A 3DVEA 5CSNA 1CFPA 3SG2A 4YGCB 1KFXS 1QS7A 1B9AA 1Y6WA 1YVHA 4Q04A 1DMOA 2KQYA 3TS5B 1FW4A 1SYMA 1IQ3A 3ZNIA 4DCKA 5BPJA 1KWOC 1PVBA 1SMGA 2JULA 2LC5A 1BOCA 1JWDA 2IS9A 1A03A 2PRUA 1NYAA 1F8HA 2JZIA 2M0RA 2PASA 2GGZA 1BT6A 1LXFC 3BUNB 2G2BA 1MWNA 4GFTA 5HLVA 3C1VA 1TTXA 4TNCA 1DJWA 2LV7A 3LLEA 1B8RA 2KBIA 4OVNF 1B7TY 2KI6D 1DJGA 2ZFDA 1QATA 1SR6C 2JT0A 3AAJA 4DS7A 2KDHA 2F3YA 4MN0A 1Q80A 1EG3A 2NLNA 5AXIA 2QACA 1RK9A 4ORAB 3VRQA 1XFXO 1SCMC 4YGBB 3JVTC 1KK8C 1ODBA 3CLNA 3CTNA 2WCBA 4ICBA 2LLTA 1KSMA 4PHMA 2MA2A 2F2OA 3CR5X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K93 D;  1K96 A;  2K61 A;  2KI4 C;  3FIA A;  1W7J B;  5K89 A;  1QTX A;  4ETO A;  1VRK A;  1UHN A;  4WRI A;  5IBW A;  2D8N A;  4ZCU A;  1LVC D;  3HX4 A;  1WDC B;  2EC6 B;  1DJZ A;  1PVA A;  1DGU A;  1OMR A;  2R2I A;  1XFY O;  4DUQ A;  1F4O A;  3QRX A;  3I5I C;  3ZWH A;  2WOS A;  1CMF A;  1QX2 A;  2LAP A;  1C7W A;  1M46 A;  4MSP A;  1BG1 A;  2JU0 A;  4YRU A;  2LMU A;  2LM5 A;  1X02 A;  2M3W A;  1TN4 A;  5I2Q A;  2BCB A;  2MRD A;  1TNP A;  1UUS A;  4U8D A;  4FTG A;  3MSE B;  1IQ5 A;  3AKB A;  4JQ0 D;  3FWB A;  4M2O A;  1HQV A;  1AJ5 A;  3OX6 A;  5CSF A;  1LA3 A;  1NUB A;  1IKU A;  2B1U A;  1QAS A;  4GGF C;  4MZK A;  3NSL A;  2KAX A;  2Q4U A;  2KHN A;  2LHI A;  1EXR A;  1MQ1 A;  1QVI Z;  5JOL A;  2OTG C;  2Y1N A;  4IL1 A;  2GGM A;  1OMV A;  1YR5 A;  5DKQ A;  1C7V A;  3EK8 A;  5TNC A;  4PE1 A;  3E3R A;  1S6C A;  2JXC A;  4DRW A;  5KU1 A;  4YGA A;  1TNX A;  1WRZ A;  4MVF A;  2F33 A;  3LL8 B;  2LP2 A;  4XJK B;  1M31 A;  1R6P A;  5G08 A;  2VRG A;  1ZAC A;  2M1U A;  3SG3 A;  5ER5 A;  2LCP A;  2JXL A;  1CB1 A;  1D1O A;  1XK4 C;  1S6I A;  4BY4 A;  2JQ6 A;  2LLU A;  1J7P A;  1J7O A;  4GBA A;  2JOJ A;  4R1E A;  1YUT A;  2L4I A;  4N5X A;  1XFV O;  3DF0 A;  4MRX A;  3PN7 C;  5GQQ C;  3LK0 A;  3BOW A;  1FI5 A;  1S6J A;  1CTR A;  1SY9 A;  1ZUZ A;  5AEQ A;  1JF0 A;  1XFW O;  2CT9 A;  1DTL A;  1DVI A;  2G9B A;  2RGI A;  1F70 A;  3OB2 B;  1V1G A;  1K94 A;  1Y1X A;  1UHJ A;  1YTZ C;  4PHJ A;  1OE9 B;  1K9K A;  2E6W A;  1PSR A;  1YVL A;  1CMG A;  3D0Y A;  2PAL A;  1CFD A;  3NSK A;  1JC2 A;  1IJ6 A;  3FS7 A;  1CFC A;  2JT8 A;  2BKI B;  1DF0 A;  1NX2 A;  2CTN A;  4A4C A;  1XFZ O;  1PSB A;  1GGW A;  3I5G C;  1WLZ A;  1CLM A;  3KF9 A;  1UHK A;  2K7D A;  2ZRT A;  1MXE A;  3JVT B;  3AKA A;  3KO0 A;  1B4C A;  1KQM C;  2NCP A;  2TN4 A;  1JSA A;  4MZL A;  1F71 A;  4MRY A;  3I5H C;  2WCE A;  2KI4 B;  1LKJ A;  4HRG A;  1ZFS A;  1QX7 A;  2WND A;  1N2D A;  2KFH A;  4PCW A;  1CFF A;  2M7N A;  1K8U A;  2L51 A;  4F0Z B;  3NXA A;  5KSZ A;  1UHH A;  2LMV A;  5CPV A;  4AQI A;  1TOP A;  1CKK A;  1IRJ A;  1TIZ A;  3DF0 B;  2LUC A;  3I5I B;  4YI8 A;  1BLQ A;  2M49 B;  2Y5I A;  3BOW B;  4CID A;  5CSI A;  1CM1 A;  2LVI A;  4WQ2 A;  3WHT B;  4QJ4 B;  1M39 A;  1J7Q A;  2BKH B;  3TUY C;  3F45 A;  1SBJ A;  2LAN A;  2LVV A;  3EVR A;  4I5N B;  1RWY A;  5D7F A;  3BXK A;  1KFU S;  1KQV A;  2I94 A;  1B1G A;  1WLM A;  1A4P A;  2L2E A;  2ZNE A;  4P5O E;  2K8M B;  1YX7 A;  4MZJ A;  4XJK A;  1J1D A;  2KGB C;  1CDM A;  1CDP A;  1V1F A;  3D0Y B;  1UP5 A;  3KEV A;  1K9U A;  1M63 B;  2OS8 C;  2WC8 A;  3I5F B;  2ISD A;  1DF0 B;  2KGR A;  2OTG B;  3OHM B;  5AFP A;  3FWC A;  2CCM A;  4GPL B;  3A8R A;  3TS5 C;  3SG7 A;  3IF7 A;  1KCY A;  1EJ3 A;  1NIW A;  3GOF A;  4PE7 A;  5J3X A;  1L2O C;  1HT9 A;  2ZN9 A;  1S36 A;  2F8P A;  2BL0 B;  4QJ5 B;  2H61 A;  2LVJ A;  4ORB B;  2BE6 A;  2H2K A;  3BYA A;  3TZ1 A;  4NDC A;  5JJG A;  4YBH B;  3NSI A;  1AP4 A;  1JFJ A;  1BR1 B;  2K2A A;  1EG4 A;  5F6T A;  3WXA A;  2M97 A;  3CR2 A;  1SK6 D;  1R2U A;  1TCF A;  2ZN8 A;  4GGN A;  3OP0 A;  1IJ5 A;  1PK0 D;  4OCI A;  2KNE A;  3NSO A;  1OOJ A;  2Y4Q A;  3K21 A;  2COL B;  2HET A;  3A4U B;  3VGO A;  3SG6 A;  1AHR A;  3M0W A;  2E30 A;  3PM8 A;  2MLE C;  1S26 D;  5HLO A;  2SAS A;  3PN7 B;  3VRN A;  5D69 A;  1YRT B;  1SNL A;  2M1K B;  2BCA A;  4I5L B;  2HPS A;  1W7I B;  2KFG A;  1CNP A;  3O2P A;  1PRW A;  2BEC A;  3O4Y A;  2JRF A;  4M2P A;  3O78 A;  1YUR A;  4HRH A;  5DKR A;  1NP8 A;  3CZT X;  1FI6 A;  1A2X A;  1XFU O;  2LE9 B;  3CWG A;  1NX3 A;  2CNP A;  2PVB A;  2QPT A;  3PAT A;  1CLL A;  3CS1 A;  3OX5 A;  2K0J A;  1AVS A;  1FBV A;  1OSA A;  1KK7 Y;  1OZO A;  2EHB A;  1RTP 1;  2EGD A;  1CDL A;  1B7T Z;  3DVJ A;  2L0P A;  4ORC B;  4A4B A;  2ZRS A;  2JT3 A;  4UPG A;  5I2O A;  1WY9 A;  4MEW A;  1SKT A;  1KWO B;  2HF5 A;  2FJU B;  2KAY A;  4BY5 A;  4YGD B;  1QIV A;  1BMO A;  3I5H B;  1SL7 A;  2AMI A;  1RRO A;  1LA0 A;  1L7Z A;  1QLK A;  1QV1 A;  1YX8 A;  3VRO A;  1J55 A;  1NPQ A;  4C0K A;  5HKY A;  4GGF A;  1BR4 B;  2BBM A;  2JC2 A;  5FYX A;  1JBA A;  1ALW A;  2MLF C;  1QV0 A;  1SL8 A;  2JNF A;  1SR6 B;  1REC A;  1MXL C;  3CR4 X;  1QX5 B;  3HCM A;  3WHU B;  4AQJ A;  1K90 D;  1NWD A;  1NSH A;  4FQO A;  2FCD A;  3EVU A;  3TUY B;  1SCM B;  3JTD C;  2AUC A;  1K2H A;  1KK8 B;  1LIN A;  2ZKM X;  1GQM A;  1SCV A;  1XA5 A;  1TRF A;  2LP3 A;  5KTY A;  3PFV A;  1G33 A;  3PLF B;  5AAN A;  1ZMZ A;  2PSR A;  4PHN A;  1FF1 A;  1GJY A;  2WCF A;  3EKJ A;  3EKH A;  1A75 B;  3EK7 A;  2JPT A;  1JFK A;  2MHH A;  3AAK A;  2KFF A;  1DJX A;  3GK4 X;  5ER4 X;  4PE4 A;  1RFJ A;  2KYF A;  1S5G Y;  2OS8 B;  1KSO A;  2LNK A;  3WNX B;  2M8U A;  2O5G A;  4PDZ A;  2BE4 A;  1IWQ A;  1B47 A;  3CGA A;  4OV2 A;  1XK4 A;  2L50 A;  1WRK A;  2CXJ A;  2LUX A;  3DVM A;  3KHE A;  4GAO A;  3SG5 A;  3VRP A;  1UHI A;  4CPV A;  1SRA A;  1L2O B;  2P6B B;  2PMY A;  1KFX L;  1H4B A;  1Y1A A;  2I18 A;  2KQ6 A;  5DKN A;  1DJH A;  3OB1 B;  2L98 A;  5HKZ A;  2NCO A;  3DD4 A;  3RLZ A;  4MLW A;  2Q91 A;  3IQQ A;  1TNW A;  2CBL A;  2JTT A;  4I5J A;  4OR9 B;  4CFR A;  1TNQ A;  3BQ3 A;  2HQ8 A;  1NX0 A;  1S3P A;  1ZOT B;  2DOQ A;  2LHL A;  4OKH A;  1XYD A;  3GK1 A;  4GUK A;  4JPZ B;  1EL4 A;  2K7O A;  4HRE E;  2F3Z A;  1DT7 B;  1CLB A;  3IQO A;  1Y0V H;  1MHO A;  4USL A;  4AOM A;  1OQP A;  1SW8 A;  2KBM A;  1M45 A;  2AAO A;  1OMD A;  2I7A A;  4NDB A;  5HYD A;  1KFU L;  1F54 A;  1UWO A;  4ZCV A;  3LK1 A;  1AJ4 A;  2L4H A;  1KK7 Z;  1GGZ A;  1N0Y A;  1NCZ A;  4YI9 A;  1F4Q A;  2BBN A;  1YUU A;  1BJF A;  1QLS A;  4N1F A;  1JF2 A;  3PSR A;  1G4Y R;  3RM1 A;  1H8B A;  2KI6 C;  2FOT A;  4YGE B;  2M7L A;  4PHK A;  1IGV A;  1F55 A;  2SCP A;  4E68 A;  2K7B A;  1N65 A;  4XYN A;  4CFQ A;  4HSZ A;  1NCY A;  3TDI A;  4C0J A;  1YUS A;  1AUI B;  5I8N A;  4JWQ A;  1MR8 A;  1E8A A;  1WDC C;  2EC6 C;  1Y1U A;  4P2Y B;  2GV5 A;  2M29 A;  2L5X B;  1AK8 A;  4NQG A;  3I5F C;  4CLN A;  1XVJ A;  1G8I A;  2JNX A;  1B8C A;  1S1E A;  2MAZ A;  3DVK A;  1UUR A;  2ZND A;  1U5I A;  2KSP A;  4QJ3 B;  3TDZ A;  3BUO B;  1BOD A;  2KAV A;  1DGV A;  1XO5 A;  2JWW A;  1SL9 A;  1MUX A;  1A75 A;  2BL0 C;  1PAL A;  2A4J A;  3VRR A;  4NDD A;  5AER A;  3EK4 A;  3ICB A;  3LCP C;  5PAL A;  1NCX A;  2K7C A;  1ALV A;  1J7R A;  4L9M A;  1K9P A;  2BCX A;  3BUW B;  2WOR A;  3SG4 A;  3KPX A;  3TDU A;  3I5G B;  3GK2 A;  2MBX A;  2O60 A;  1WRL A;  4PE0 A;  1S5G Z;  1YRU B;  3SIB A;  3JTD B;  1SPY A;  1K95 A;  1QIW A;  1TCO B;  2I2R E;  3EVV A;  3PAL A;  1KQM B;  2JTZ A;  4MBE A;  2K2F A;  1QJT A;  2MJW B;  2NXQ A;  3H4S E;  2HQW A;  4M2Q A;  1A29 A;  2Y1M A;  1IH0 A;  2KOT A;  2OPO A;  4I5K A;  5CSJ A;  4GNK B;  1J1E A;  3SJS A;  2M9G A;  1QXP A;  2LMT A;  1QVI Y;  1CM4 A;  3SIA A;  1DJY A;  1IG5 A;  4D1E A;  1RJV A;  1BU3 A;  2FCE A;  2NZ0 A;  4PAL A;  3BUX B;  3O6B A;  1OZS A;  1FPW A;  2F2P A;  2LVK A;  5I2L A;  2LLS A;  1U5I B;  2V53 A;  3D10 A;  3BUM B;  4DIR A;  1B8L A;  4WQ3 A;  5HKW A;  1JUO A;  1PUL A;  1C07 A;  1CDN A;  1BF5 A;  2H61 C;  4N1G A;  5B8I B;  4C0L A;  1DJI A;  1MF8 B;  1EH2 A;  2KYC A;  1NX1 A;  3DVE A;  5CSN A;  1CFP A;  3SG2 A;  4YGC B;  1KFX S;  1QS7 A;  1B9A A;  1Y6W A;  1YVH A;  4Q04 A;  1DMO A;  2KQY A;  3TS5 B;  1FW4 A;  1SYM A;  1IQ3 A;  3ZNI A;  4DCK A;  5BPJ A;  1KWO C;  1PVB A;  1SMG A;  2JUL A;  2LC5 A;  1BOC A;  1JWD A;  2IS9 A;  1A03 A;  2PRU A;  1NYA A;  1F8H A;  2JZI A;  2M0R A;  2PAS A;  2GGZ A;  1BT6 A;  1LXF C;  3BUN B;  2G2B A;  1MWN A;  4GFT A;  5HLV A;  3C1V A;  1TTX A;  4TNC A;  1DJW A;  2LV7 A;  3LLE A;  1B8R A;  2KBI A;  4OVN F;  1B7T Y;  2KI6 D;  1DJG A;  2ZFD A;  1QAT A;  1SR6 C;  2JT0 A;  3AAJ A;  4DS7 A;  2KDH A;  2F3Y A;  4MN0 A;  1Q80 A;  1EG3 A;  2NLN A;  5AXI A;  2QAC A;  1RK9 A;  4ORA B;  3VRQ A;  1XFX O;  1SCM C;  4YGB B;  3JVT C;  1KK8 C;  1ODB A;  3CLN A;  3CTN A;  2WCB A;  4ICB A;  2LLT A;  1KSM A;  4PHM A;  2MA2 A;  2F2O A;  3CR5 X; 
#chains in the Genus database with same CATH topology
 1K93 D;  1K96 A;  2K61 A;  2KI4 C;  1QWV A;  2QEH A;  3FIA A;  1W7J B;  5K89 A;  1QTX A;  4ETO A;  1VRK A;  1UHN A;  4WRI A;  5IBW A;  1GM0 A;  2D8N A;  4ZCU A;  1LVC D;  3HX4 A;  3SS5 A;  5EL2 A;  1WDC B;  3B7A A;  2EC6 B;  1DJZ A;  1PVA A;  1DGU A;  1OMR A;  2R2I A;  1XFY O;  3D73 A;  4DUQ A;  1XFR A;  1F4O A;  3QRX A;  3I5I C;  3ZWH A;  3S0F A;  2BAP A;  2WOS A;  1CMF A;  1QX2 A;  3R72 A;  2LAP A;  1C7W A;  1M46 A;  3OBV A;  4MSP A;  2JU0 A;  4YRU A;  1BG1 A;  2LMU A;  2LM5 A;  1X02 A;  2M3W A;  1TN4 A;  5I2Q A;  2BCB A;  2MRD A;  1TNP A;  2WC6 A;  1UUS A;  4U8D A;  4FTG A;  3MSE B;  1IQ5 A;  3AKB A;  4JQ0 D;  3FWB A;  4M2O A;  1HQV A;  4OV2 A;  1AJ5 A;  3OX6 A;  5CSF A;  1LA3 A;  1NUB A;  1IKU A;  2B1U A;  1QAS A;  4GGF C;  4MZK A;  3NSL A;  2KAX A;  2Q4U A;  3S0B A;  2QEB A;  2KHN A;  2LHI A;  1EXR A;  1MQ1 A;  1QVI Z;  5JOL A;  2OTG C;  2Y1N A;  3BFB A;  3BFA A;  2GGM A;  1OMV A;  1YR5 A;  4IL1 A;  5DKQ A;  1C7V A;  3EK8 A;  3DXL A;  5TNC A;  4PE1 A;  1Z2C B;  3E3R A;  1S6C A;  2JXC A;  3S0A A;  4DRW A;  5KU1 A;  4YGA A;  1TNX A;  1WRZ A;  4MVF A;  3S0E A;  2F33 A;  3LL8 B;  2LP2 A;  4XJK B;  1M31 A;  1R6P A;  5G08 A;  1OOF A;  2VRG A;  1ZAC A;  2M1U A;  3SG3 A;  5ER5 A;  2LCP A;  2GTE A;  2JXL A;  1CB1 A;  1D1O A;  1XK4 C;  4INW A;  1S6I A;  4BY4 A;  2JQ6 A;  2LLU A;  1J7P A;  1J7O A;  4GBA A;  2JOJ A;  4R1E A;  5DIC A;  1YUT A;  2L4I A;  4N5X A;  1C3Z A;  1XFV O;  3DF0 A;  4MRX A;  3PN7 C;  5GQQ C;  3LK0 A;  3BOW A;  1FI5 A;  1S6J A;  1CTR A;  3DY9 A;  1SY9 A;  1ZUZ A;  5AEQ A;  1JF0 A;  1XFW O;  2CT9 A;  1DTL A;  1DVI A;  2G9B A;  2RGI A;  1F70 A;  3UNW A;  3OB2 B;  1V1G A;  2BNX A;  1K94 A;  1Y1X A;  1UHJ A;  1YTZ C;  4PHJ A;  5FI7 A;  1OE9 B;  1K9K A;  2E6W A;  1DEL A;  1PSR A;  1YVL A;  3FE6 A;  3R1O A;  3D0Y A;  2PAL A;  1CFD A;  3NSK A;  1CMG A;  4KYN A;  1JC2 A;  1IJ6 A;  3OGN A;  3FS7 A;  1CFC A;  2JT8 A;  2BKI B;  1DF0 A;  1NX2 A;  2CTN A;  3B86 A;  4A4C A;  1XFZ O;  1PSB A;  1GGW A;  3DYE A;  3I5G C;  1WLZ A;  2ERB A;  1CLM A;  3KF9 A;  1UHK A;  2K7D A;  2ZRT A;  1MXE A;  3JVT B;  3AKA A;  3KO0 A;  4IJ7 A;  1B4C A;  1KQM C;  1TUJ A;  2NCP A;  2TN4 A;  4MZL A;  1JSA A;  1F71 A;  4MRY A;  3I5H C;  2WCE A;  2KI4 B;  1LKJ A;  1ORG A;  1ZFS A;  1QX7 A;  2WND A;  1N2D A;  2KFH A;  4HRG A;  4PCW A;  3K1E A;  3S0D A;  1CFF A;  2M7N A;  1K8U A;  2L51 A;  4F0Z B;  3NXA A;  5KSZ A;  1LS8 A;  1UHH A;  2LMV A;  2PYQ A;  5CPV A;  4AQI A;  1TOP A;  1CKK A;  1IRJ A;  1TIZ A;  3DF0 B;  2LUC A;  3I5I B;  4YI8 A;  1BLQ A;  2M49 B;  2Y5I A;  3BOW B;  3UO9 A;  4CID A;  5CSI A;  1CM1 A;  2LVI A;  4WQ2 A;  3L4L A;  3WHT B;  1M39 A;  4QJ4 B;  1J7Q A;  2BKH B;  3TUY C;  3F45 A;  1SBJ A;  2LAN A;  2H8V A;  2LVV A;  3EVR A;  4I5N B;  1RWY A;  5D7F A;  3D77 A;  3BXK A;  1KFU S;  1KQV A;  2I94 A;  1B1G A;  1WLM A;  1A4P A;  2L2E A;  2ZNE A;  4P5O E;  2K8M B;  1YX7 A;  4MZJ A;  4XJK A;  1J1D A;  2KGB C;  1CDM A;  3D74 A;  1CDP A;  3PJI A;  1V1F A;  3D0Y B;  1UP5 A;  3KEV A;  1K9U A;  1M63 B;  2OS8 C;  2WC8 A;  2WCK A;  3BFH A;  3I5F B;  2ISD A;  1DF0 B;  2KGR A;  2OTG B;  3OHM B;  4F7F A;  5AFP A;  3FWC A;  2CCM A;  4GPL B;  3A8R A;  3TS5 C;  3SG7 A;  1T14 A;  3IF7 A;  1EJ3 A;  4FQT A;  1KCY A;  1NIW A;  3GOF A;  4PE7 A;  5J3X A;  1L2O C;  1HT9 A;  2ZN9 A;  1P28 A;  1S36 A;  2BL0 B;  2F8P A;  4QJ5 B;  2H61 A;  2LVJ A;  3QME A;  4ORB B;  2BE6 A;  2H2K A;  3BYA A;  1IIO A;  3TZ1 A;  4NDC A;  5JJG A;  4YBH B;  3NSI A;  1AP4 A;  1JFJ A;  1BR1 B;  3V2L A;  4JD9 A;  2K2A A;  1EG4 A;  5F6T A;  3WXA A;  2M97 A;  3CR2 A;  1SK6 D;  1R2U A;  1TCF A;  2ZN8 A;  4GGN A;  3OP0 A;  1IJ5 A;  1DEK A;  1PK0 D;  4OCI A;  2KNE A;  3NSO A;  1OOJ A;  2Y4Q A;  3K21 A;  2PQL A;  2COL B;  2HET A;  3A4U B;  3VGO A;  3SG6 A;  1DC1 A;  1AHR A;  4JKT A;  5FI6 A;  3M0W A;  2E30 A;  3IVT A;  3PM8 A;  2MLE C;  1S26 D;  5HLO A;  2SAS A;  3PN7 B;  3VRN A;  1TWO A;  5D69 A;  5KTY A;  1OOH A;  1YRT B;  1SNL A;  2M1K B;  2BCA A;  4I5L B;  2HPS A;  1W7I B;  2KFG A;  2KLD A;  3O2P A;  1PRW A;  2BEC A;  3O4Y A;  2JRF A;  1CNP A;  4M2P A;  3O78 A;  1YUR A;  3S0G A;  4HRH A;  5DKR A;  1NP8 A;  2FJY A;  3CZT X;  1FI6 A;  1A2X A;  1XFU O;  2LE9 B;  3CWG A;  2JPO A;  1NX3 A;  2CNP A;  2PVB A;  2QPT A;  3PAT A;  1CLL A;  3CS1 A;  3OX5 A;  2K0J A;  1AVS A;  1FBV A;  1OSA A;  1KK7 Y;  1OZO A;  2EHB A;  1RTP 1;  2EGD A;  1CDL A;  1B7T Z;  3DVJ A;  2L0P A;  3NGV A;  4ORC B;  2P71 A;  4A4B A;  2ZRS A;  2JT3 A;  4UPG A;  5I2O A;  1WY9 A;  4MEW A;  1SKT A;  1KWO B;  2HF5 A;  2FJU B;  2KAY A;  3D76 A;  4YGD B;  4BY5 A;  1QIV A;  1BMO A;  3I5H B;  1SL7 A;  2AMI A;  1RRO A;  1LA0 A;  1L7Z A;  1QLK A;  1QV1 A;  1YX8 A;  3CZ0 A;  3VRO A;  1J55 A;  1NPQ A;  4C0K A;  5HKY A;  4GGF A;  1BR4 B;  2BBM A;  2JC2 A;  2K60 A;  5FYX A;  1JBA A;  1ALW A;  2MLF C;  3VB1 A;  1QV0 A;  1SL8 A;  2JNF A;  2WCL A;  1SR6 B;  2QEV A;  1REC A;  1MXL C;  3CR4 X;  1QX5 B;  3HCM A;  3WHU B;  4AQJ A;  1K90 D;  1NWD A;  1NSH A;  4FQO A;  2FCD A;  3EVU A;  3TUY B;  1SCM B;  3JTD C;  2AUC A;  1K2H A;  1KK8 B;  3D75 A;  1LIN A;  2ZKM X;  1GQM A;  1SCV A;  1XA5 A;  1TRF A;  2LP3 A;  3FE9 A;  3PFV A;  1G33 A;  3PLF B;  5AAN A;  1ZMZ A;  2PSR A;  4PHN A;  1FF1 A;  5I94 A;  1GJY A;  2WCF A;  3EKJ A;  3EKH A;  1A75 B;  4INX A;  3EK7 A;  2JPT A;  1JFK A;  2MHH A;  3AAK A;  2KFF A;  1DJX A;  3GK4 X;  5ER4 X;  4PE4 A;  1RFJ A;  2KYF A;  1S5G Y;  2OS8 B;  1KSO A;  2LNK A;  3WNX B;  2M8U A;  2O5G A;  4PDZ A;  2BE4 A;  1IWQ A;  1B47 A;  3CGA A;  3NHT A;  1XK4 A;  2L50 A;  1WRK A;  2CXJ A;  2LUX A;  2WCJ A;  3DVM A;  3DZT A;  3KHE A;  4GAO A;  3SG5 A;  3VRP A;  1UHI A;  3O4X A;  4CPV A;  1OW4 A;  1SRA A;  1L2O B;  2P6B B;  2PMY A;  1KFX L;  1H4B A;  1Y1A A;  3BJH A;  2I18 A;  2KQ6 A;  5DKN A;  1DJH A;  3OB1 B;  1OOG A;  2L98 A;  5HKZ A;  2NCO A;  3DD4 A;  3RLZ A;  4MLW A;  2Q91 A;  3IQQ A;  1TNW A;  2CBL A;  2JTT A;  4I5J A;  4OR9 B;  4CFR A;  1TNQ A;  3BQ3 A;  2L5Y A;  2HQ8 A;  1NX0 A;  1S3P A;  4PT1 A;  1ZOT B;  2DOQ A;  2LHL A;  3D78 A;  4OKH A;  1XYD A;  3GK1 A;  4GUK A;  3CAB A;  4JPZ B;  1EL4 A;  2L2C A;  3FE8 A;  4OZD A;  2K7O A;  4HRE E;  1OOI X;  2F3Z A;  1DT7 B;  1CLB A;  3IQO A;  1Y0V H;  1MHO A;  4USL A;  1Z4H A;  4AOM A;  1OQP A;  1SW8 A;  2KBM A;  1M45 A;  2AAO A;  1OMD A;  2I7A A;  4NDB A;  5HYD A;  1KFU L;  2WCM A;  1F54 A;  1UWO A;  3N7H A;  3LK1 A;  1AJ4 A;  2L4H A;  4ZCV A;  1KK7 Z;  1GGZ A;  1N0Y A;  1NCZ A;  4YI9 A;  1F4Q A;  2BBN A;  1C3Y A;  1YUU A;  1BJF A;  1QLS A;  4N1F A;  1JF2 A;  3PSR A;  1G4Y R;  3RM1 A;  1H8B A;  2KI6 C;  2QEO A;  2WCH A;  2FOT A;  4YGE B;  2M7L A;  4PHK A;  1IGV A;  1F55 A;  2SCP A;  4E68 A;  2K7B A;  1N65 A;  2WC5 A;  4XYN A;  4CFQ A;  4HSZ A;  1NCY A;  3TDI A;  4C0J A;  2QDI A;  1YUS A;  1AUI B;  3CZ1 A;  5I8N A;  4JWQ A;  1MR8 A;  1E8A A;  1W9Z A;  1WDC C;  1Y1U A;  2EC6 C;  2GV5 A;  2M29 A;  2L5X B;  4P2Y B;  1AK8 A;  1DQE A;  4NQG A;  3I5F C;  4CLN A;  1XVJ A;  1G8I A;  2JNX A;  1B8C A;  1S1E A;  2MAZ A;  3DVK A;  1UUR A;  2ZND A;  1U5I A;  2KSP A;  4QJ3 B;  3TDZ A;  3BUO B;  1BOD A;  2KAV A;  1DGV A;  3L47 A;  1TUZ A;  1XO5 A;  2JWW A;  1SL9 A;  1MUX A;  5FI2 A;  1SSE B;  1A75 A;  2BL0 C;  3RZS A;  1PAL A;  2A4J A;  3VRR A;  4NDD A;  3B87 A;  5AER A;  3EK4 A;  3ICB A;  3LCP C;  5PAL A;  1NCX A;  2K7C A;  1ALV A;  1J7R A;  4L9M A;  1K9P A;  2BCX A;  3BUW B;  2WOR A;  3SG4 A;  3KPX A;  3TDU A;  3I5G B;  3GK2 A;  2MBX A;  2O60 A;  1WRL A;  4PE0 A;  1S5G Z;  1YRU B;  3SIB A;  3JTD B;  1SPY A;  1K95 A;  1QIW A;  1TCO B;  2I2R E;  3EVV A;  3PAL A;  1KQM B;  2JTZ A;  4MBE A;  2K2F A;  1QJT A;  2MJW B;  2NXQ A;  3H4S E;  2HQW A;  4M2Q A;  1A29 A;  2Y1M A;  3CDN A;  1IH0 A;  2KOT A;  2OPO A;  4I5K A;  3B88 A;  5CSJ A;  4GNK B;  1J1E A;  3SJS A;  2M9G A;  1QXP A;  2LMT A;  3SS4 A;  1QVI Y;  3R1V A;  1CM4 A;  3SIA A;  1DJY A;  1IG5 A;  4D1E A;  2KLE A;  1RJV A;  1BU3 A;  2FCE A;  2NZ0 A;  4PAL A;  3BUX B;  3O6B A;  1OZS A;  2P70 A;  1FPW A;  2F2P A;  2LVK A;  3EG5 B;  5I2L A;  2LLS A;  1U5I B;  2V53 A;  3D10 A;  3BUM B;  3CZ2 A;  4DIR A;  1B8L A;  4WQ3 A;  5HKW A;  1JUO A;  1PUL A;  3L4A A;  1C07 A;  1CDN A;  1BF5 A;  2H61 C;  4N1G A;  5B8I B;  4C0L A;  1DJI A;  1MF8 B;  1EH2 A;  2KYC A;  1NX1 A;  3DVE A;  5CSN A;  1CFP A;  3SG2 A;  4YGC B;  1KFX S;  1QS7 A;  2YGU A;  1B9A A;  1Y6W A;  1YVH A;  4Q04 A;  1DMO A;  3R1P A;  2KQY A;  3TS5 B;  1FW4 A;  1SYM A;  1IQ3 A;  3ZNI A;  4DCK A;  5BPJ A;  1KWO C;  1PVB A;  1SMG A;  2JUL A;  2LC5 A;  1BOC A;  1JWD A;  2IS9 A;  1A03 A;  2PRU A;  1NYA A;  1F8H A;  3B6X A;  2JZI A;  2M0R A;  5D3O A;  2PAS A;  2GGZ A;  1BT6 A;  1LXF C;  3BUN B;  2G2B A;  1MWN A;  4GFT A;  5HLV A;  3C1V A;  1TTX A;  4TNC A;  1DJW A;  2LV7 A;  3LLE A;  1B8R A;  2KBI A;  4OVN F;  1B7T Y;  3NHI A;  2KI6 D;  1DJG A;  2ZFD A;  1QAT A;  1SR6 C;  2JT0 A;  3PM2 A;  3AAJ A;  3SS3 A;  4DS7 A;  2KDH A;  2F3Y A;  4MN0 A;  1Q80 A;  2KPH A;  1EG3 A;  2NLN A;  5AXI A;  3Q8I A;  2QAC A;  1RK9 A;  4ORA B;  3VRQ A;  3CYZ A;  1XFX O;  1SCM C;  5HL1 A;  4YGB B;  3JVT C;  1KK8 C;  1ODB A;  3CLN A;  3CTN A;  2WCB A;  4ICB A;  2LLT A;  1KSM A;  4PHM A;  2MA2 A;  2F2O A;  3CR5 X; 
#chains in the Genus database with same CATH homology
 1K93 D;  1K96 A;  2K61 A;  2KI4 C;  3FIA A;  1W7J B;  5K89 A;  1QTX A;  4ETO A;  1VRK A;  1UHN A;  4WRI A;  5IBW A;  2D8N A;  4ZCU A;  1LVC D;  3HX4 A;  1WDC B;  2EC6 B;  1DJZ A;  1PVA A;  1DGU A;  1OMR A;  2R2I A;  1XFY O;  4DUQ A;  1F4O A;  3QRX A;  3I5I C;  3ZWH A;  2WOS A;  1CMF A;  1QX2 A;  2LAP A;  1C7W A;  1M46 A;  4MSP A;  1BG1 A;  2JU0 A;  4YRU A;  2LMU A;  2LM5 A;  1X02 A;  2M3W A;  1TN4 A;  5I2Q A;  2BCB A;  2MRD A;  1TNP A;  1UUS A;  4U8D A;  4FTG A;  3MSE B;  1IQ5 A;  3AKB A;  4JQ0 D;  3FWB A;  4M2O A;  1HQV A;  1AJ5 A;  3OX6 A;  5CSF A;  1LA3 A;  1NUB A;  1IKU A;  2B1U A;  1QAS A;  4GGF C;  4MZK A;  3NSL A;  2KAX A;  2Q4U A;  2KHN A;  2LHI A;  1EXR A;  1MQ1 A;  1QVI Z;  5JOL A;  2OTG C;  2Y1N A;  4IL1 A;  2GGM A;  1OMV A;  1YR5 A;  5DKQ A;  1C7V A;  3EK8 A;  5TNC A;  4PE1 A;  3E3R A;  1S6C A;  2JXC A;  4DRW A;  5KU1 A;  4YGA A;  1TNX A;  1WRZ A;  4MVF A;  2F33 A;  3LL8 B;  2LP2 A;  4XJK B;  1M31 A;  1R6P A;  5G08 A;  2VRG A;  1ZAC A;  2M1U A;  3SG3 A;  5ER5 A;  2LCP A;  2JXL A;  1CB1 A;  1D1O A;  1XK4 C;  1S6I A;  4BY4 A;  2JQ6 A;  2LLU A;  1J7P A;  1J7O A;  4GBA A;  2JOJ A;  4R1E A;  1YUT A;  2L4I A;  4N5X A;  1XFV O;  3DF0 A;  4MRX A;  3PN7 C;  5GQQ C;  3LK0 A;  3BOW A;  1FI5 A;  1S6J A;  1CTR A;  1SY9 A;  1ZUZ A;  5AEQ A;  1JF0 A;  1XFW O;  2CT9 A;  1DTL A;  1DVI A;  2G9B A;  2RGI A;  1F70 A;  3OB2 B;  1V1G A;  1K94 A;  1Y1X A;  1UHJ A;  1YTZ C;  4PHJ A;  1OE9 B;  1K9K A;  2E6W A;  1PSR A;  1YVL A;  1CMG A;  3D0Y A;  2PAL A;  1CFD A;  3NSK A;  1JC2 A;  1IJ6 A;  3FS7 A;  1CFC A;  2JT8 A;  2BKI B;  1DF0 A;  1NX2 A;  2CTN A;  4A4C A;  1XFZ O;  1PSB A;  1GGW A;  3I5G C;  1WLZ A;  1CLM A;  3KF9 A;  1UHK A;  2K7D A;  2ZRT A;  1MXE A;  3JVT B;  3AKA A;  3KO0 A;  1B4C A;  1KQM C;  2NCP A;  2TN4 A;  1JSA A;  4MZL A;  1F71 A;  4MRY A;  3I5H C;  2WCE A;  2KI4 B;  1LKJ A;  4HRG A;  1ZFS A;  1QX7 A;  2WND A;  1N2D A;  2KFH A;  4PCW A;  1CFF A;  2M7N A;  1K8U A;  2L51 A;  4F0Z B;  3NXA A;  5KSZ A;  1UHH A;  2LMV A;  5CPV A;  4AQI A;  1TOP A;  1CKK A;  1IRJ A;  1TIZ A;  3DF0 B;  2LUC A;  3I5I B;  4YI8 A;  1BLQ A;  2M49 B;  2Y5I A;  3BOW B;  4CID A;  5CSI A;  1CM1 A;  2LVI A;  4WQ2 A;  3WHT B;  4QJ4 B;  1M39 A;  1J7Q A;  2BKH B;  3TUY C;  3F45 A;  1SBJ A;  2LAN A;  2LVV A;  3EVR A;  4I5N B;  1RWY A;  5D7F A;  3BXK A;  1KFU S;  1KQV A;  2I94 A;  1B1G A;  1WLM A;  1A4P A;  2L2E A;  2ZNE A;  4P5O E;  2K8M B;  1YX7 A;  4MZJ A;  4XJK A;  1J1D A;  2KGB C;  1CDM A;  1CDP A;  1V1F A;  3D0Y B;  1UP5 A;  3KEV A;  1K9U A;  1M63 B;  2OS8 C;  2WC8 A;  3I5F B;  2ISD A;  1DF0 B;  2KGR A;  2OTG B;  3OHM B;  5AFP A;  3FWC A;  2CCM A;  4GPL B;  3A8R A;  3TS5 C;  3SG7 A;  3IF7 A;  1KCY A;  1EJ3 A;  1NIW A;  3GOF A;  4PE7 A;  5J3X A;  1L2O C;  1HT9 A;  2ZN9 A;  1S36 A;  2F8P A;  2BL0 B;  4QJ5 B;  2H61 A;  2LVJ A;  4ORB B;  2BE6 A;  2H2K A;  3BYA A;  3TZ1 A;  4NDC A;  5JJG A;  4YBH B;  3NSI A;  1AP4 A;  1JFJ A;  1BR1 B;  2K2A A;  1EG4 A;  5F6T A;  3WXA A;  2M97 A;  3CR2 A;  1SK6 D;  1R2U A;  1TCF A;  2ZN8 A;  4GGN A;  3OP0 A;  1IJ5 A;  1PK0 D;  4OCI A;  2KNE A;  3NSO A;  1OOJ A;  2Y4Q A;  3K21 A;  2COL B;  2HET A;  3A4U B;  3VGO A;  3SG6 A;  1AHR A;  3M0W A;  2E30 A;  3PM8 A;  2MLE C;  1S26 D;  5HLO A;  2SAS A;  3PN7 B;  3VRN A;  5D69 A;  1YRT B;  1SNL A;  2M1K B;  2BCA A;  4I5L B;  2HPS A;  1W7I B;  2KFG A;  1CNP A;  3O2P A;  1PRW A;  2BEC A;  3O4Y A;  2JRF A;  4M2P A;  3O78 A;  1YUR A;  4HRH A;  5DKR A;  1NP8 A;  3CZT X;  1FI6 A;  1A2X A;  1XFU O;  2LE9 B;  3CWG A;  1NX3 A;  2CNP A;  2PVB A;  2QPT A;  3PAT A;  1CLL A;  3CS1 A;  3OX5 A;  2K0J A;  1AVS A;  1FBV A;  1OSA A;  1KK7 Y;  1OZO A;  2EHB A;  1RTP 1;  2EGD A;  1CDL A;  1B7T Z;  3DVJ A;  2L0P A;  4ORC B;  4A4B A;  2ZRS A;  2JT3 A;  4UPG A;  5I2O A;  1WY9 A;  4MEW A;  1SKT A;  1KWO B;  2HF5 A;  2FJU B;  2KAY A;  4BY5 A;  4YGD B;  1QIV A;  1BMO A;  3I5H B;  1SL7 A;  2AMI A;  1RRO A;  1LA0 A;  1L7Z A;  1QLK A;  1QV1 A;  1YX8 A;  3VRO A;  1J55 A;  1NPQ A;  4C0K A;  5HKY A;  4GGF A;  1BR4 B;  2BBM A;  2JC2 A;  5FYX A;  1JBA A;  1ALW A;  2MLF C;  1QV0 A;  1SL8 A;  2JNF A;  1SR6 B;  1REC A;  1MXL C;  3CR4 X;  1QX5 B;  3HCM A;  3WHU B;  4AQJ A;  1K90 D;  1NWD A;  1NSH A;  4FQO A;  2FCD A;  3EVU A;  3TUY B;  1SCM B;  3JTD C;  2AUC A;  1K2H A;  1KK8 B;  1LIN A;  2ZKM X;  1GQM A;  1SCV A;  1XA5 A;  1TRF A;  2LP3 A;  5KTY A;  3PFV A;  1G33 A;  3PLF B;  5AAN A;  1ZMZ A;  2PSR A;  4PHN A;  1FF1 A;  1GJY A;  2WCF A;  3EKJ A;  3EKH A;  1A75 B;  3EK7 A;  2JPT A;  1JFK A;  2MHH A;  3AAK A;  2KFF A;  1DJX A;  3GK4 X;  5ER4 X;  4PE4 A;  1RFJ A;  2KYF A;  1S5G Y;  2OS8 B;  1KSO A;  2LNK A;  3WNX B;  2M8U A;  2O5G A;  4PDZ A;  2BE4 A;  1IWQ A;  1B47 A;  3CGA A;  4OV2 A;  1XK4 A;  2L50 A;  1WRK A;  2CXJ A;  2LUX A;  3DVM A;  3KHE A;  4GAO A;  3SG5 A;  3VRP A;  1UHI A;  4CPV A;  1SRA A;  1L2O B;  2P6B B;  2PMY A;  1KFX L;  1H4B A;  1Y1A A;  2I18 A;  2KQ6 A;  5DKN A;  1DJH A;  3OB1 B;  2L98 A;  5HKZ A;  2NCO A;  3DD4 A;  3RLZ A;  4MLW A;  2Q91 A;  3IQQ A;  1TNW A;  2CBL A;  2JTT A;  4I5J A;  4OR9 B;  4CFR A;  1TNQ A;  3BQ3 A;  2HQ8 A;  1NX0 A;  1S3P A;  1ZOT B;  2DOQ A;  2LHL A;  4OKH A;  1XYD A;  3GK1 A;  4GUK A;  4JPZ B;  1EL4 A;  2K7O A;  4HRE E;  2F3Z A;  1DT7 B;  1CLB A;  3IQO A;  1Y0V H;  1MHO A;  4USL A;  4AOM A;  1OQP A;  1SW8 A;  2KBM A;  1M45 A;  2AAO A;  1OMD A;  2I7A A;  4NDB A;  5HYD A;  1KFU L;  1F54 A;  1UWO A;  4ZCV A;  3LK1 A;  1AJ4 A;  2L4H A;  1KK7 Z;  1GGZ A;  1N0Y A;  1NCZ A;  4YI9 A;  1F4Q A;  2BBN A;  1YUU A;  1BJF A;  1QLS A;  4N1F A;  1JF2 A;  3PSR A;  1G4Y R;  3RM1 A;  1H8B A;  2KI6 C;  2FOT A;  4YGE B;  2M7L A;  4PHK A;  1IGV A;  1F55 A;  2SCP A;  4E68 A;  2K7B A;  1N65 A;  4XYN A;  4CFQ A;  4HSZ A;  1NCY A;  3TDI A;  4C0J A;  1YUS A;  1AUI B;  5I8N A;  4JWQ A;  1MR8 A;  1E8A A;  1WDC C;  2EC6 C;  1Y1U A;  4P2Y B;  2GV5 A;  2M29 A;  2L5X B;  1AK8 A;  4NQG A;  3I5F C;  4CLN A;  1XVJ A;  1G8I A;  2JNX A;  1B8C A;  1S1E A;  2MAZ A;  3DVK A;  1UUR A;  2ZND A;  1U5I A;  2KSP A;  4QJ3 B;  3TDZ A;  3BUO B;  1BOD A;  2KAV A;  1DGV A;  1XO5 A;  2JWW A;  1SL9 A;  1MUX A;  1A75 A;  2BL0 C;  1PAL A;  2A4J A;  3VRR A;  4NDD A;  5AER A;  3EK4 A;  3ICB A;  3LCP C;  5PAL A;  1NCX A;  2K7C A;  1ALV A;  1J7R A;  4L9M A;  1K9P A;  2BCX A;  3BUW B;  2WOR A;  3SG4 A;  3KPX A;  3TDU A;  3I5G B;  3GK2 A;  2MBX A;  2O60 A;  1WRL A;  4PE0 A;  1S5G Z;  1YRU B;  3SIB A;  3JTD B;  1SPY A;  1K95 A;  1QIW A;  1TCO B;  2I2R E;  3EVV A;  3PAL A;  1KQM B;  2JTZ A;  4MBE A;  2K2F A;  1QJT A;  2MJW B;  2NXQ A;  3H4S E;  2HQW A;  4M2Q A;  1A29 A;  2Y1M A;  1IH0 A;  2KOT A;  2OPO A;  4I5K A;  5CSJ A;  4GNK B;  1J1E A;  3SJS A;  2M9G A;  1QXP A;  2LMT A;  1QVI Y;  1CM4 A;  3SIA A;  1DJY A;  1IG5 A;  4D1E A;  1RJV A;  1BU3 A;  2FCE A;  2NZ0 A;  4PAL A;  3BUX B;  3O6B A;  1OZS A;  1FPW A;  2F2P A;  2LVK A;  5I2L A;  2LLS A;  1U5I B;  2V53 A;  3D10 A;  3BUM B;  4DIR A;  1B8L A;  4WQ3 A;  5HKW A;  1JUO A;  1PUL A;  1C07 A;  1CDN A;  1BF5 A;  2H61 C;  4N1G A;  5B8I B;  4C0L A;  1DJI A;  1MF8 B;  1EH2 A;  2KYC A;  1NX1 A;  3DVE A;  5CSN A;  1CFP A;  3SG2 A;  4YGC B;  1KFX S;  1QS7 A;  1B9A A;  1Y6W A;  1YVH A;  4Q04 A;  1DMO A;  2KQY A;  3TS5 B;  1FW4 A;  1SYM A;  1IQ3 A;  3ZNI A;  4DCK A;  5BPJ A;  1KWO C;  1PVB A;  1SMG A;  2JUL A;  2LC5 A;  1BOC A;  1JWD A;  2IS9 A;  1A03 A;  2PRU A;  1NYA A;  1F8H A;  2JZI A;  2M0R A;  2PAS A;  2GGZ A;  1BT6 A;  1LXF C;  3BUN B;  2G2B A;  1MWN A;  4GFT A;  5HLV A;  3C1V A;  1TTX A;  4TNC A;  1DJW A;  2LV7 A;  3LLE A;  1B8R A;  2KBI A;  4OVN F;  1B7T Y;  2KI6 D;  1DJG A;  2ZFD A;  1QAT A;  1SR6 C;  2JT0 A;  3AAJ A;  4DS7 A;  2KDH A;  2F3Y A;  4MN0 A;  1Q80 A;  1EG3 A;  2NLN A;  5AXI A;  2QAC A;  1RK9 A;  4ORA B;  3VRQ A;  1XFX O;  1SCM C;  4YGB B;  3JVT C;  1KK8 C;  1ODB A;  3CLN A;  3CTN A;  2WCB A;  4ICB A;  2LLT A;  1KSM A;  4PHM A;  2MA2 A;  2F2O A;  3CR5 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...