1N0YA

Crystal structure of pb-bound calmodulin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
AEQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Domain flexibility in the 1.75 A resolution structure of Pb2+-calmodulin.
pubmed doi rcsb
source organism Paramecium tetraurelia
molecule tags Metal binding protein
total genus 29
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n0yA00
2H61A 1CFPA 3PLFB 3O4YA 1C07A 2TN4A 1CKKA 3BUWB 2M8UA 2JC2A 1Y6WA 2LVVA 1XK4A 2KYFA 2FJUB 2EC6B 2K2FA 5DKRA 2LM5A 2KI6D 4ORAB 1JSAA 1S5GZ 2BCBA 4NDBA 5ER5A 4DRWA 2O60A 3BYAA 4DCKA 2FCEA 1K9UA 3RLZA 3VROA 1BOCA 4ORBB 1KK7Y 1WLZA 3I5IC 2BECA 1IQ5A 4BY5A 1TCFA 2KFGA 3KHEA 4YI9A 1NUBA 4PE0A 1SCMC 1TNXA 2F2PA 1A03A 4GAOA 1Y1XA 3HCMA 3PATA 4ETOA 1KFUL 1SL9A 1Y0VH 1UHNA 2K2AA 2MAZA 3PALA 3A8RA 4JWQA 2KAYA 2BL0B 4GGNA 3ZWHA 3OX5A 1WRKA 1ZOTB 1RTP1 2ZKMX 1AVSA 2KAXA 3I5HB 5CPVA 4GBAA 2NLNA 1QIWA 3TS5C 2OTGC 2GV5A 4HREE 1B7TZ 1N2DA 2L2EA 1AUIB 4P5OE 1SNLA 2M97A 4ZCVA 1QIVA 4DIRA 2JNFA 2FOTA 4PE1A 2RGIA 1KQMC 2K0JA 3LLEA 4YGDB 1JBAA 2HQWA 1AJ5A 1WRLA 1S3PA 3A4UB 1K96A 1CDLA 1Y1AA 3NSLA 3EVRA 2LVKA 3IF7A 2BBNA 1DTLA 3GK4X 4PHJA 2M3WA 2PALA 3TUYB 2FCDA 1M31A 3FS7A 1FI5A 4N1GA 1EJ3A 1UHIA 4I5JA 2WCBA 3VRNA 1JUOA 1B1GA 2BKIB 2NZ0A 5HYDA 1DMOA 4IL1A 2KI4C 2JT3A 1FF1A 1MF8B 2M49B 2LP3A 2KI6C 1KQVA 2D8NA 1RJVA 1XFXO 1QV0A 3BQ3A 4F0ZB 3LK0A 4MVFA 3SG4A 1BT6A 2DOQA 2ZFDA 3FIAA 4FTGA 4R1EA 1OMDA 2EHBA 3K21A 2JXLA 1K90D 1RWYA 1NCXA 3AKAA 3JTDB 2V53A 1DGVA 1UUSA 2BE6A 2LCPA 2OPOA 3WHUB 4USLA 1NCYA 1KWOB 1MHOA 2NXQA 1DJXA 4ICBA 2M7LA 1NPQA 2L4IA 3CR2A 1JF0A 4MRXA 1CNPA 4M2PA 1A29A 4OKHA 2WC8A 1ZUZA 3M0WA 1KSMA 1NCZA 3I5GB 1PALA 1EH2A 1WDCC 3H4SE 2KAVA 2JOJA 2WCFA 1CLBA 1BG1A 1IQ3A 1FBVA 1QXPA 1S36A 2BL0C 2L0PA 1J55A 3KF9A 3NSKA 1BJFA 1LVCD 3BOWB 5HKWA 1LA0A 5JOLA 3DF0A 2JT8A 4C0KA 1K9PA 1DJIA 3EK7A 1AJ4A 4TNCA 2NCPA 3JVTC 4CPVA 4L9MA 4C0JA 2QACA 1KFXS 2PVBA 2SCPA 1XYDA 2MBXA 3WNXB 1OMRA 1IGVA 3F45A 1QLKA 4YGAA 4YRUA 2HF5A 2OS8C 3CTNA 3I5FB 1XO5A 4YGEB 5IBWA 1F70A 2KGRA 1SY9A 1PK0D 1DF0B 2BBMA 2LVJA 4N5XA 1NSHA 1PVBA 1JF2A 2L50A 1YRUB 1IRJA 1KFXL 2BCXA 3D0YB 4QJ5B 3EKJA 3ICBA 1KCYA 1DJHA 2KBMA 2L4HA 1CB1A 2ZNEA 1A2XA 4PE7A 2O5GA 4PDZA 1SL7A 5J3XA 2F3ZA 1CM1A 1QTXA 1ZACA 4MRYA 2JULA 4YBHB 1RK9A 1S5GY 2KBIA 1TNPA 2JPTA 1YX7A 4OR9B 2I7AA 1SPYA 2KHNA 4YGCB 1ZMZA 1NX2A 1NIWA 1SR6C 4PHKA 2L51A 2LNKA 5ER4X 1R6PA 1MXLC 4ORCB 5I2LA 5I2OA 4P2YB 2ZN9A 2I2RE 2F3YA 1NX3A 3BUNB 3BUOB 1B47A 5AFPA 1PRWA 3CZTX 1QVIZ 1J7RA 2H61C 3SG6A 1EG4A 2LUXA 1FPWA 1G8IA 2LMVA 3O2PA 2JZIA 2PRUA 1XK4C 2G9BA 1FW4A 3EKHA 1UHHA 4MBEA 2K61A 2K7OA 3D0YA 2MLFC 3GOFA 1DVIA 4ZCUA 1GGWA 1FI6A 1V1FA 1J7QA 4HRHA 2CXJA 2KFFA 1LA3A 1B8LA 5PALA 1CLMA 1HQVA 4CFRA 2Y5IA 1B7TY 1F4QA 1S6CA 1L7ZA 2A4JA 1ALVA 1RFJA 3NSIA 3PN7B 4PE4A 5I2QA 1OZOA 2Y1NA 1A75B 1IG5A 3CGAA 4I5NB 1J7PA 3SG5A 1KK8C 3FWCA 4HRGA 1CTRA 3VGOA 1UWOA 2Y4QA 4DUQA 1CFFA 3SG2A 2GGZA 1NX1A 1NYAA 5K89A 2LMTA 3GK1A 1XVJA 4DS7A 1PSBA 1SCVA 5BPJA 1N65A 3IQOA 3O6BA 1YRTB 1OOJA 1IWQA 2ZRSA 4GUKA 4UPGA 3CS1A 3QRXA 5TNCA 2EC6C 3PM8A 1K8UA 4CFQA 1C7VA 2G2BA 3O78A 2KDHA 1CDNA 3LK1A 1OMVA 2HPSA 5HKZA 1YVHA 3I5IB 1DJZA 1SK6D 3AKBA 2LP2A 1K9KA 1XFVO 4GPLB 3CR4X 5B8IB 4AQIA 1A75A 1GGZA 1MUXA 1SMGA 1TCOB 1TRFA 1QS7A 1QJTA 1SBJA 1IJ5A 2KOTA 3NXAA 1SCMB 3HX4A 4CLNA 1DJYA 4FQOA 1B9AA 4OVNF 3DVMA 2AUCA 2WOSA 2KGBC 1VRKA 1CLLA 2WCEA 1G4YR 3PSRA 4PCWA 3D10A 2M1UA 2JTZA 3CR5X 1XA5A 2LUCA 3SG3A 2AMIA 2CBLA 5F6TA 1J1DA 2ZNDA 5DKNA 1QV1A 4QJ4B 3I5HC 3VRPA 1K94A 3TS5B 2OTGB 2Q91A 2R2IA 2SASA 3SIAA 1RECA 1DGUA 5HLVA 1B4CA 1QLSA 1V1GA 2KFHA 2P6BB 5GQQC 1MR8A 1ODBA 3BUXB 1KQMB 3EVUA 5KU1A 4MLWA 4MZKA 4QJ3B 3DVJA 4GNKB 4NQGA 1XFWO 1F8HA 5I8NA 4AOMA 2BCAA 2KNEA 1AK8A 1E8AA 5KTYA 2KYCA 4I5KA 1RROA 3OP0A 4GFTA 2LE9B 1JFKA 2M1KB 1MXEA 1SRAA 1N0YA 3TUYC 1YUUA 1OZSA 2BKHB 2E30A 2QPTA 3OHMB 2B1UA 1S6IA 1AHRA 1XFUO 1U5IB 1PVAA 2KQYA 5HLOA 2JXCA 2BE4A 1EG3A 1PULA 2E6WA 2KI4B 2MHHA 3BOWA 1YURA 2GGMA 3ZNIA 1KK7Z 1L2OB 3IQQA 4C0LA 1H4BA 1SL8A 1HT9A 1M45A 2CTNA 2L98A 1MWNA 1K95A 2M29A 3EK8A 1GJYA 2JWWA 4CIDA 5JJGA 5DKQA 1KFUS 1J7OA 3DVEA 1BR1B 2CT9A 4XYNA 1DF0A 1TOPA 2IS9A 3AAJA 3CLNA 5AXIA 1JWDA 1K2HA 3JTDC 1B8CA 4JQ0D 1H8BA 3AAKA 1TNQA 1KSOA 2JNXA 2LHIA 1KWOC 4OCIA 3VRRA 2HETA 3FWBA 1OQPA 1CFCA 2MLEC 1S1EA 1TTXA 1A4PA 1ALWA 4MEWA 1UURA 1LINA 1SYMA 1U5IA 1LXFC 4BY4A 1TN4A 1WDCB 1QVIY 2M9GA 2KSPA 2LLTA 1B8RA 2I94A 5CSFA 3I5GC 1DT7B 1BF5A 3LCPC 1GQMA 4HSZA 3TDUA 5CSNA 3KPXA 1CDPA 4WRIA 4M2OA 3DVKA 1MQ1A 2LVIA 5AANA 1CMFA 1K93D 2M0RA 1BU3A 1DJGA 3JVTB 3SJSA 2ZN8A 2HQ8A 2ISDA 4MSPA 4WQ2A 3BUMB 1OSAA 4M2QA 3SIBA 1OE9B 2JRFA 4GGFA 4WQ3A 4XJKB 5KSZA 3CWGA 3KEVA 2LLUA 2CNPA 1YUTA 1AP4A 4D1EA 1JC2A 3C1VA 2OS8B 2LV7A 2F33A 3SG7A 1NX0A 1X02A 3DD4A 4YI8A 1F54A 2M7NA 3I5FC 1M39A 2K7BA 3LL8B 1LKJA 1JFJA 2EGDA 1S6JA 1WLMA 1TNWA 2ZRTA 5CSJA 3E3RA 1G33A 1IJ6A 2LAPA 4OV2A 1YX8A 1Y1UA 1S26D 2LLSA 4N1FA 1W7JB 2L5XB 1W7IB 3WHTB 1NP8A 1C7WA 3TDIA 2I18A 2LHLA 1UHKA 2MA2A 1YR5A 1D1OA 3PFVA 5AEQA 5D69A 1M46A 2NCOA 1QX7A 2F2OA 3RM1A 3GK2A 2LANA 2WNDA 1L2OC 3OB1B 1R2UA 4NDDA 1BODA 3MSEB 1QX5B 2CCMA 1CM4A 2JTTA 2PSRA 1XFZO 4XJKA 1SR6B 3DF0B 4A4BA 3VRQA 1TIZA 4I5LB 2K8MB 4E68A 1F55A 2VRGA 1UHJA 3TZ1A 3KO0A 1YVLA 1BMOA 3BXKA 3EK4A 5AERA 2AAOA 4GGFC 1QASA 1YUSA 4MZLA 2PMYA 1IH0A 1DJWA 3OB2B 2JQ6A 4PHMA 1SKTA 5HKYA 1F71A 2MJWB 1YTZC 1F4OA 2Q4UA 4NDCA 1CFDA 1EXRA 1M63B 2LMUA 2Y1MA 3NSOA 1WY9A 3EVVA 2JT0A 4A4CA 1EL4A 2WORA 2K7CA 1SW8A 2H2KA 4MN0A 4PHNA 1CMGA 1UP5A 1Q80A 5FYXA 1BLQA 5G08A 4AQJA 1WRZA 4MZJA 1QX2A 2LC5A 1IKUA 1CDMA 3PN7C 2COLB 1BR4B 1KK8B 1J1EA 1QATA 1XFYO 4Q04A 4YGBB 1NWDA 4PALA 3WXAA 3TDZA 2PASA 2JU0A 5D7FA 2MRDA 2F8PA 2K7DA 1ZFSA 2KQ6A 4U8DA 5CSIA 3OX6A 1PSRA 4JPZB
chains in the Genus database with same CATH superfamily
2H61A 1CFPA 3PLFB 3O4YA 3QMEA 1C07A 2TN4A 1CKKA 3BUWB 2M8UA 2WCKA 2JC2A 1Y6WA 2LVVA 1XK4A 2KYFA 2FJUB 2EC6B 2K2FA 5DKRA 2LM5A 2KI6D 4ORAB 1JSAA 1S5GZ 2BCBA 4NDBA 3BFBA 3D75A 5ER5A 4DRWA 2O60A 3VB1A 3BYAA 4DCKA 2FCEA 1K9UA 3RLZA 3VROA 1BOCA 4ORBB 1KK7Y 1WLZA 3I5IC 2BECA 5DICA 2BAPA 1IQ5A 4BY5A 1TCFA 2KFGA 3IVTA 3KHEA 4YI9A 1NUBA 4PE0A 3S0GA 1SCMC 1TNXA 2F2PA 1A03A 4GAOA 1Y1XA 3HCMA 3PATA 4ETOA 3D76A 2WCMA 1KFUL 1SL9A 1Y0VH 1UHNA 2K2AA 2MAZA 2P70A 2WCJA 3A8RA 3PALA 4JWQA 4PT1A 2KAYA 3K1EA 2BL0B 4GGNA 3ZWHA 3OX5A 1WRKA 1ZOTB 1RTP1 2ZKMX 1AVSA 2KAXA 3I5HB 5CPVA 4GBAA 2NLNA 3L4LA 1QIWA 3TS5C 2OTGC 2GV5A 4HREE 1B7TZ 1N2DA 2L2EA 1AUIB 4P5OE 1Z4HA 1SNLA 2L5YA 2M97A 2WCLA 4ZCVA 1QIVA 1TWOA 4DIRA 2JNFA 1TUJA 2FOTA 4PE1A 2RGIA 1KQMC 2K0JA 3LLEA 4YGDB 1JBAA 2HQWA 1AJ5A 1WRLA 1S3PA 3A4UB 1K96A 1CDLA 1Y1AA 3NSLA 3EVRA 2LVKA 3IF7A 2BBNA 1DTLA 3GK4X 4PHJA 1QWVA 3NGVA 2K60A 2M3WA 2PALA 1GM0A 3TUYB 3B7AA 2FCDA 1M31A 3FS7A 1FI5A 4N1GA 1EJ3A 1UHIA 4I5JA 2WCBA 3VRNA 1JUOA 1B1GA 2BKIB 2NZ0A 5HYDA 1DMOA 4IL1A 2KI4C 2JT3A 1FF1A 1MF8B 2M49B 2LP3A 2KI6C 1KQVA 2D8NA 1RJVA 1XFXO 1QV0A 3BQ3A 3SS3A 4F0ZB 3LK0A 4MVFA 3SG4A 1BT6A 2DOQA 2ZFDA 3FIAA 4FTGA 4R1EA 1OMDA 2EHBA 3K21A 2JXLA 1K90D 1RWYA 1NCXA 3AKAA 3JTDB 2V53A 1DGVA 1UUSA 2BE6A 2LCPA 2OPOA 3WHUB 4USLA 1NCYA 3CZ2A 1KWOB 1MHOA 2NXQA 1P28A 1DJXA 4ICBA 2M7LA 1NPQA 2L4IA 3CR2A 1JF0A 4MRXA 1CNPA 4M2PA 3S0FA 1A29A 4OKHA 4JKTA 2WC8A 3O4XA 1ZUZA 3M0WA 1KSMA 1NCZA 3I5GB 1PALA 1EH2A 1WDCC 3H4SE 2KAVA 2JOJA 2WCFA 1CLBA 1BG1A 3L47A 1FBVA 1QXPA 1S36A 2BL0C 2L0PA 1IQ3A 1J55A 3KF9A 3NSKA 3Q8IA 1BJFA 1LVCD 3BOWB 5HKWA 1LA0A 5JOLA 3DY9A 1OOGA 3DF0A 2JT8A 4C0KA 1K9PA 1DJIA 3EK7A 1AJ4A 4TNCA 2NCPA 3B86A 3JVTC 4CPVA 3CZ1A 4L9MA 4C0JA 2L2CA 1KFXS 2PVBA 2QACA 1XYDA 2SCPA 3B6XA 2MBXA 1OMRA 3CZ0A 3WNXB 1IGVA 3F45A 3BJHA 1QLKA 2H8VA 4YGAA 4YRUA 2HF5A 2OS8C 3CTNA 3I5FB 1XO5A 4YGEB 5IBWA 1F70A 2KGRA 1SY9A 1PK0D 1DF0B 2BBMA 2LVJA 4N5XA 1NSHA 1PVBA 1JF2A 2L50A 3ZNIA 2JPOA 1YRUB 1IRJA 1KFXL 2BCXA 3D0YB 5FI6A 3EKJA 3ICBA 3UO9A 2QEHA 1DJHA 2KBMA 2L4HA 4QJ5B 1CB1A 3NHTA 1KCYA 2ZNEA 1A2XA 4PE7A 2O5GA 4PDZA 1SL7A 2GTEA 5J3XA 2F3ZA 1CM1A 1QTXA 1ZACA 4MRYA 2JULA 2WCHA 4YBHB 1RK9A 1S5GY 2KBIA 1TNPA 2JPTA 1YX7A 4OR9B 2I7AA 1SPYA 2KHNA 4YGCB 1ZMZA 1OOIX 3D74A 1NX2A 1NIWA 5HL1A 1SR6C 4PHKA 2L51A 2LNKA 5ER4X 1R6PA 1MXLC 4ORCB 5I2LA 3R1PA 4P2YB 2ZN9A 5I2OA 2I2RE 2F3YA 1NX3A 3BUNB 3BUOB 1B47A 5AFPA 1PRWA 3CZTX 1QVIZ 1J7RA 2H61C 3SG6A 1EG4A 1OOHA 2WC5A 2LUXA 1DELA 3CYZA 1FPWA 1G8IA 2LMVA 3O2PA 2JZIA 2PRUA 1XK4C 2G9BA 1FW4A 3EKHA 1UHHA 5FI7A 4MBEA 2K61A 2K7OA 3D0YA 2PYQA 2MLFC 1W9ZA 3GOFA 1DVIA 4ZCUA 1GGWA 1FI6A 1V1FA 1J7QA 4HRHA 2CXJA 2KFFA 1LA3A 1B8LA 3DXLA 5PALA 1CLMA 1HQVA 4CFRA 2Y5IA 1F54A 1OOFA 1B7TY 1F4QA 1S6CA 1L7ZA 2A4JA 1ALVA 1RFJA 3NSIA 3PN7B 4PE4A 5I2QA 1OZOA 2Y1NA 1A75B 1IG5A 3CGAA 4I5NB 1J7PA 3SG5A 1KK8C 3FWCA 4HRGA 1CTRA 3VGOA 1UWOA 2Y4QA 4DUQA 3BFAA 1DEKA 1CFFA 3SG2A 2GGZA 1NX1A 1NYAA 5K89A 2LMTA 3GK1A 1XVJA 4DS7A 2PQLA 3CABA 1PSBA 1SCVA 5BPJA 1N65A 3IQOA 3O6BA 1YRTB 1OOJA 3NHIA 1IWQA 2ZRSA 4GUKA 4UPGA 3CS1A 3QRXA 5TNCA 2EC6C 3PM8A 1K8UA 4CFQA 1C7VA 2G2BA 3O78A 2KDHA 1CDNA 3LK1A 1OMVA 2HPSA 5HKZA 3RZSA 1YVHA 3I5IB 1DJZA 1SK6D 3AKBA 2LP2A 1K9KA 1XFVO 4GPLB 3CR4X 5B8IB 4AQIA 1A75A 1GGZA 1MUXA 1SMGA 1TCOB 1TRFA 1QS7A 1QJTA 1SBJA 1IJ5A 2KOTA 3NXAA 1SCMB 3HX4A 4CLNA 1DJYA 4FQOA 1B9AA 4OVNF 3DVMA 2AUCA 2WOSA 2KGBC 1VRKA 1CLLA 2WCEA 1G4YR 3PSRA 2KLEA 4PCWA 3D10A 2M1UA 2JTZA 4INWA 3CR5X 1XA5A 2LUCA 3SG3A 2AMIA 2CBLA 5FI2A 5F6TA 1J1DA 2ZNDA 5DKNA 1QV1A 4QJ4B 3I5HC 3VRPA 1K94A 3TS5B 2OTGB 2Q91A 2R2IA 2SASA 3L4AA 3S0BA 1RECA 3SIAA 1ORGA 1DGUA 5HLVA 1B4CA 1OW4A 1QLSA 1V1GA 2KFHA 1TUZA 2P6BB 5GQQC 1MR8A 2KLDA 1ODBA 3BUXB 1KQMB 3EVUA 5KU1A 4MLWA 4MZKA 1IIOA 4QJ3B 3DVJA 4GNKB 4NQGA 1C3ZA 1XFWO 1F8HA 5I8NA 4AOMA 2BCAA 2KNEA 1AK8A 1E8AA 5KTYA 2KYCA 4I5KA 1RROA 1Z2CB 3OP0A 4GFTA 1DQEA 2LE9B 1JFKA 2QEBA 2M1KB 1MXEA 1SRAA 1N0YA 3TUYC 1YUUA 1OZSA 2BKHB 2E30A 2QPTA 5I94A 3OHMB 2B1UA 1S6IA 1AHRA 1XFUO 2QEOA 1U5IB 1PVAA 2KQYA 3D78A 5HLOA 2JXCA 2YGUA 2BE4A 1EG3A 1PULA 2E6WA 2KI4B 2MHHA 3BOWA 1LS8A 1YURA 2GGMA 3S0DA 1KK7Z 1L2OB 3IQQA 4KYNA 4C0LA 1H4BA 1SL8A 3FE6A 1HT9A 1M45A 2CTNA 2L98A 1MWNA 1K95A 2M29A 3EK8A 1GJYA 2JWWA 4CIDA 5JJGA 5DKQA 4IJ7A 1KFUS 1J7OA 3DVEA 1BR1B 2CT9A 4XYNA 1DF0A 1T14A 1TOPA 2IS9A 3AAJA 3CLNA 4JD9A 5AXIA 1JWDA 3PM2A 3JTDC 1K2HA 1B8CA 4JQ0D 1H8BA 3AAKA 1TNQA 1KSOA 2JNXA 2LHIA 3EG5B 1KWOC 4OCIA 3VRRA 2HETA 3FWBA 1OQPA 1CFCA 2MLEC 1S1EA 3UNWA 1TTXA 1A4PA 1ALWA 4MEWA 1UURA 1LINA 1SYMA 3OX6A 1U5IA 1LXFC 4BY4A 3R1VA 1TN4A 1WDCB 1QVIY 2M9GA 2KSPA 2LLTA 1B8RA 2I94A 5CSFA 3I5GC 1DT7B 1BF5A 3LCPC 1GQMA 3OBVA 4HSZA 3TDUA 5CSNA 3FE9A 3KPXA 1CDPA 4WRIA 4M2OA 3DVKA 1MQ1A 2LVIA 5AANA 4F7FA 1CMFA 1K93D 2M0RA 1BU3A 1DJGA 3JVTB 3N7HA 3S0EA 3SJSA 2ZN8A 2HQ8A 2ISDA 2ERBA 4MSPA 4WQ2A 3BUMB 1OSAA 4M2QA 3SIBA 1OE9B 2JRFA 4GGFA 4WQ3A 4XJKB 5KSZA 3CWGA 3KEVA 2LLUA 2CNPA 1C3YA 1YUTA 1AP4A 4D1EA 1JC2A 3C1VA 2OS8B 2LV7A 2F33A 3SG7A 1NX0A 1X02A 3B88A 3D73A 3DD4A 2M7NA 4YI8A 3I5FC 1M39A 2K7BA 3LL8B 2WC6A 1LKJA 3OGNA 1JFJA 2EGDA 1S6JA 4FQTA 1WLMA 1TNWA 2ZRTA 5CSJA 3E3RA 3B87A 1G33A 3R1OA 1IJ6A 2LAPA 4OV2A 1YX8A 1Y1UA 1S26D 2LLSA 4N1FA 1W7JB 2L5XB 3S0AA 1W7IB 3WHTB 1NP8A 1C7WA 3TDIA 2BNXA 2I18A 2LHLA 1UHKA 2MA2A 3V2LA 1XFRA 1YR5A 2FJYA 2QEVA 1D1OA 3R72A 3PFVA 5AEQA 5D69A 1M46A 2NCOA 1QX7A 2F2OA 3RM1A 3GK2A 2LANA 2WNDA 1L2OC 3OB1B 1R2UA 4NDDA 1BODA 3MSEB 1QX5B 3D77A 2CCMA 1CM4A 2JTTA 2PSRA 1XFZO 4XJKA 1SR6B 3DF0B 4A4BA 3VRQA 1TIZA 4I5LB 2K8MB 4E68A 1F55A 2VRGA 1UHJA 3TZ1A 2QDIA 3KO0A 1YVLA 1BMOA 2P71A 3BXKA 3EK4A 5EL2A 5AERA 2AAOA 4GGFC 1QASA 1YUSA 3SS5A 4MZLA 2PMYA 1IH0A 1DJWA 3OB2B 2JQ6A 4PHMA 1SKTA 5HKYA 1F71A 2MJWB 3DYEA 1YTZC 1F4OA 2Q4UA 4INXA 4NDCA 1CFDA 1EXRA 1M63B 2LMUA 5D3OA 2Y1MA 3NSOA 1WY9A 2KPHA 3EVVA 2JT0A 4A4CA 1EL4A 1SSEB 2K7CA 1SW8A 2H2KA 2WORA 4MN0A 4PHNA 3SS4A 1CMGA 1UP5A 1Q80A 5FYXA 1BLQA 5G08A 4OZDA 4AQJA 1WRZA 3FE8A 1QX2A 2LC5A 4MZJA 1CDMA 3PN7C 1IKUA 2COLB 1BR4B 3PJIA 1KK8B 1J1EA 1QATA 1XFYO 4Q04A 4YGBB 1NWDA 4PALA 3WXAA 1DC1A 3TDZA 2PASA 2JU0A 5D7FA 3BFHA 3DZTA 2MRDA 2F8PA 2K7DA 1ZFSA 2KQ6A 4U8DA 5CSIA 3CDNA 1PSRA 4JPZB
chains in the Genus database with same CATH topology
2H61A 1CFPA 3PLFB 3O4YA 1C07A 2TN4A 1CKKA 3BUWB 2M8UA 2JC2A 1Y6WA 2LVVA 1XK4A 2KYFA 2FJUB 2EC6B 2K2FA 5DKRA 2LM5A 2KI6D 4ORAB 1JSAA 1S5GZ 2BCBA 4NDBA 5ER5A 4DRWA 2O60A 3BYAA 4DCKA 2FCEA 1K9UA 3RLZA 3VROA 1BOCA 4ORBB 1KK7Y 1WLZA 3I5IC 2BECA 1IQ5A 4BY5A 1TCFA 2KFGA 3KHEA 4YI9A 1NUBA 4PE0A 1SCMC 1TNXA 2F2PA 1A03A 4GAOA 1Y1XA 3HCMA 3PATA 4ETOA 1KFUL 1SL9A 1Y0VH 1UHNA 2K2AA 2MAZA 3PALA 3A8RA 4JWQA 2KAYA 2BL0B 4GGNA 3ZWHA 3OX5A 1WRKA 1ZOTB 1RTP1 2ZKMX 1AVSA 2KAXA 3I5HB 5CPVA 4GBAA 2NLNA 1QIWA 3TS5C 2OTGC 2GV5A 4HREE 1B7TZ 1N2DA 2L2EA 1AUIB 4P5OE 1SNLA 2M97A 4ZCVA 1QIVA 4DIRA 2JNFA 2FOTA 4PE1A 2RGIA 1KQMC 2K0JA 3LLEA 4YGDB 1JBAA 2HQWA 1AJ5A 1WRLA 1S3PA 3A4UB 1K96A 1CDLA 1Y1AA 3NSLA 3EVRA 2LVKA 3IF7A 2BBNA 1DTLA 3GK4X 4PHJA 2M3WA 2PALA 3TUYB 2FCDA 1M31A 3FS7A 1FI5A 4N1GA 1EJ3A 1UHIA 4I5JA 2WCBA 3VRNA 1JUOA 1B1GA 2BKIB 2NZ0A 5HYDA 1DMOA 4IL1A 2KI4C 2JT3A 1FF1A 1MF8B 2M49B 2LP3A 2KI6C 1KQVA 2D8NA 1RJVA 1XFXO 1QV0A 3BQ3A 4F0ZB 3LK0A 4MVFA 3SG4A 1BT6A 2DOQA 2ZFDA 3FIAA 4FTGA 4R1EA 1OMDA 2EHBA 3K21A 2JXLA 1K90D 1RWYA 1NCXA 3AKAA 3JTDB 2V53A 1DGVA 1UUSA 2BE6A 2LCPA 2OPOA 3WHUB 4USLA 1NCYA 1KWOB 1MHOA 2NXQA 1DJXA 4ICBA 2M7LA 1NPQA 2L4IA 3CR2A 1JF0A 4MRXA 1CNPA 4M2PA 1A29A 4OKHA 2WC8A 1ZUZA 3M0WA 1KSMA 1NCZA 3I5GB 1PALA 1EH2A 1WDCC 3H4SE 2KAVA 2JOJA 2WCFA 1CLBA 1BG1A 1IQ3A 1FBVA 1QXPA 1S36A 2BL0C 2L0PA 1J55A 3KF9A 3NSKA 1BJFA 1LVCD 3BOWB 5HKWA 1LA0A 5JOLA 3DF0A 2JT8A 4C0KA 1K9PA 1DJIA 3EK7A 1AJ4A 4TNCA 2NCPA 3JVTC 4CPVA 4L9MA 4C0JA 2QACA 1KFXS 2PVBA 2SCPA 1XYDA 2MBXA 3WNXB 1OMRA 1IGVA 3F45A 1QLKA 4YGAA 4YRUA 2HF5A 2OS8C 3CTNA 3I5FB 1XO5A 4YGEB 5IBWA 1F70A 2KGRA 1SY9A 1PK0D 1DF0B 2BBMA 2LVJA 4N5XA 1NSHA 1PVBA 1JF2A 2L50A 1YRUB 1IRJA 1KFXL 2BCXA 3D0YB 4QJ5B 3EKJA 3ICBA 1KCYA 1DJHA 2KBMA 2L4HA 1CB1A 2ZNEA 1A2XA 4PE7A 2O5GA 4PDZA 1SL7A 5J3XA 2F3ZA 1CM1A 1QTXA 1ZACA 4MRYA 2JULA 4YBHB 1RK9A 1S5GY 2KBIA 1TNPA 2JPTA 1YX7A 4OR9B 2I7AA 1SPYA 2KHNA 4YGCB 1ZMZA 1NX2A 1NIWA 1SR6C 4PHKA 2L51A 2LNKA 5ER4X 1R6PA 1MXLC 4ORCB 5I2LA 5I2OA 4P2YB 2ZN9A 2I2RE 2F3YA 1NX3A 3BUNB 3BUOB 1B47A 5AFPA 1PRWA 3CZTX 1QVIZ 1J7RA 2H61C 3SG6A 1EG4A 2LUXA 1FPWA 1G8IA 2LMVA 3O2PA 2JZIA 2PRUA 1XK4C 2G9BA 1FW4A 3EKHA 1UHHA 4MBEA 2K61A 2K7OA 3D0YA 2MLFC 3GOFA 1DVIA 4ZCUA 1GGWA 1FI6A 1V1FA 1J7QA 4HRHA 2CXJA 2KFFA 1LA3A 1B8LA 5PALA 1CLMA 1HQVA 4CFRA 2Y5IA 1B7TY 1F4QA 1S6CA 1L7ZA 2A4JA 1ALVA 1RFJA 3NSIA 3PN7B 4PE4A 5I2QA 1OZOA 2Y1NA 1A75B 1IG5A 3CGAA 4I5NB 1J7PA 3SG5A 1KK8C 3FWCA 4HRGA 1CTRA 3VGOA 1UWOA 2Y4QA 4DUQA 1CFFA 3SG2A 2GGZA 1NX1A 1NYAA 5K89A 2LMTA 3GK1A 1XVJA 4DS7A 1PSBA 1SCVA 5BPJA 1N65A 3IQOA 3O6BA 1YRTB 1OOJA 1IWQA 2ZRSA 4GUKA 4UPGA 3CS1A 3QRXA 5TNCA 2EC6C 3PM8A 1K8UA 4CFQA 1C7VA 2G2BA 3O78A 2KDHA 1CDNA 3LK1A 1OMVA 2HPSA 5HKZA 1YVHA 3I5IB 1DJZA 1SK6D 3AKBA 2LP2A 1K9KA 1XFVO 4GPLB 3CR4X 5B8IB 4AQIA 1A75A 1GGZA 1MUXA 1SMGA 1TCOB 1TRFA 1QS7A 1QJTA 1SBJA 1IJ5A 2KOTA 3NXAA 1SCMB 3HX4A 4CLNA 1DJYA 4FQOA 1B9AA 4OVNF 3DVMA 2AUCA 2WOSA 2KGBC 1VRKA 1CLLA 2WCEA 1G4YR 3PSRA 4PCWA 3D10A 2M1UA 2JTZA 3CR5X 1XA5A 2LUCA 3SG3A 2AMIA 2CBLA 5F6TA 1J1DA 2ZNDA 5DKNA 1QV1A 4QJ4B 3I5HC 3VRPA 1K94A 3TS5B 2OTGB 2Q91A 2R2IA 2SASA 3SIAA 1RECA 1DGUA 5HLVA 1B4CA 1QLSA 1V1GA 2KFHA 2P6BB 5GQQC 1MR8A 1ODBA 3BUXB 1KQMB 3EVUA 5KU1A 4MLWA 4MZKA 4QJ3B 3DVJA 4GNKB 4NQGA 1XFWO 1F8HA 5I8NA 4AOMA 2BCAA 2KNEA 1AK8A 1E8AA 5KTYA 2KYCA 4I5KA 1RROA 3OP0A 4GFTA 2LE9B 1JFKA 2M1KB 1MXEA 1SRAA 1N0YA 3TUYC 1YUUA 1OZSA 2BKHB 2E30A 2QPTA 3OHMB 2B1UA 1S6IA 1AHRA 1XFUO 1U5IB 1PVAA 2KQYA 5HLOA 2JXCA 2BE4A 1EG3A 1PULA 2E6WA 2KI4B 2MHHA 3BOWA 1YURA 2GGMA 3ZNIA 1KK7Z 1L2OB 3IQQA 4C0LA 1H4BA 1SL8A 1HT9A 1M45A 2CTNA 2L98A 1MWNA 1K95A 2M29A 3EK8A 1GJYA 2JWWA 4CIDA 5JJGA 5DKQA 1KFUS 1J7OA 3DVEA 1BR1B 2CT9A 4XYNA 1DF0A 1TOPA 2IS9A 3AAJA 3CLNA 5AXIA 1JWDA 1K2HA 3JTDC 1B8CA 4JQ0D 1H8BA 3AAKA 1TNQA 1KSOA 2JNXA 2LHIA 1KWOC 4OCIA 3VRRA 2HETA 3FWBA 1OQPA 1CFCA 2MLEC 1S1EA 1TTXA 1A4PA 1ALWA 4MEWA 1UURA 1LINA 1SYMA 1U5IA 1LXFC 4BY4A 1TN4A 1WDCB 1QVIY 2M9GA 2KSPA 2LLTA 1B8RA 2I94A 5CSFA 3I5GC 1DT7B 1BF5A 3LCPC 1GQMA 4HSZA 3TDUA 5CSNA 3KPXA 1CDPA 4WRIA 4M2OA 3DVKA 1MQ1A 2LVIA 5AANA 1CMFA 1K93D 2M0RA 1BU3A 1DJGA 3JVTB 3SJSA 2ZN8A 2HQ8A 2ISDA 4MSPA 4WQ2A 3BUMB 1OSAA 4M2QA 3SIBA 1OE9B 2JRFA 4GGFA 4WQ3A 4XJKB 5KSZA 3CWGA 3KEVA 2LLUA 2CNPA 1YUTA 1AP4A 4D1EA 1JC2A 3C1VA 2OS8B 2LV7A 2F33A 3SG7A 1NX0A 1X02A 3DD4A 4YI8A 1F54A 2M7NA 3I5FC 1M39A 2K7BA 3LL8B 1LKJA 1JFJA 2EGDA 1S6JA 1WLMA 1TNWA 2ZRTA 5CSJA 3E3RA 1G33A 1IJ6A 2LAPA 4OV2A 1YX8A 1Y1UA 1S26D 2LLSA 4N1FA 1W7JB 2L5XB 1W7IB 3WHTB 1NP8A 1C7WA 3TDIA 2I18A 2LHLA 1UHKA 2MA2A 1YR5A 1D1OA 3PFVA 5AEQA 5D69A 1M46A 2NCOA 1QX7A 2F2OA 3RM1A 3GK2A 2LANA 2WNDA 1L2OC 3OB1B 1R2UA 4NDDA 1BODA 3MSEB 1QX5B 2CCMA 1CM4A 2JTTA 2PSRA 1XFZO 4XJKA 1SR6B 3DF0B 4A4BA 3VRQA 1TIZA 4I5LB 2K8MB 4E68A 1F55A 2VRGA 1UHJA 3TZ1A 3KO0A 1YVLA 1BMOA 3BXKA 3EK4A 5AERA 2AAOA 4GGFC 1QASA 1YUSA 4MZLA 2PMYA 1IH0A 1DJWA 3OB2B 2JQ6A 4PHMA 1SKTA 5HKYA 1F71A 2MJWB 1YTZC 1F4OA 2Q4UA 4NDCA 1CFDA 1EXRA 1M63B 2LMUA 2Y1MA 3NSOA 1WY9A 3EVVA 2JT0A 4A4CA 1EL4A 2WORA 2K7CA 1SW8A 2H2KA 4MN0A 4PHNA 1CMGA 1UP5A 1Q80A 5FYXA 1BLQA 5G08A 4AQJA 1WRZA 4MZJA 1QX2A 2LC5A 1IKUA 1CDMA 3PN7C 2COLB 1BR4B 1KK8B 1J1EA 1QATA 1XFYO 4Q04A 4YGBB 1NWDA 4PALA 3WXAA 3TDZA 2PASA 2JU0A 5D7FA 2MRDA 2F8PA 2K7DA 1ZFSA 2KQ6A 4U8DA 5CSIA 3OX6A 1PSRA 4JPZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H61 A;  1CFP A;  3PLF B;  3O4Y A;  1C07 A;  2TN4 A;  1CKK A;  3BUW B;  2M8U A;  2JC2 A;  1Y6W A;  2LVV A;  1XK4 A;  2KYF A;  2FJU B;  2EC6 B;  2K2F A;  5DKR A;  2LM5 A;  2KI6 D;  4ORA B;  1JSA A;  1S5G Z;  2BCB A;  4NDB A;  5ER5 A;  4DRW A;  2O60 A;  3BYA A;  4DCK A;  2FCE A;  1K9U A;  3RLZ A;  3VRO A;  1BOC A;  4ORB B;  1KK7 Y;  1WLZ A;  3I5I C;  2BEC A;  1IQ5 A;  4BY5 A;  1TCF A;  2KFG A;  3KHE A;  4YI9 A;  1NUB A;  4PE0 A;  1SCM C;  1TNX A;  2F2P A;  1A03 A;  4GAO A;  1Y1X A;  3HCM A;  3PAT A;  4ETO A;  1KFU L;  1SL9 A;  1Y0V H;  1UHN A;  2K2A A;  2MAZ A;  3PAL A;  3A8R A;  4JWQ A;  2KAY A;  2BL0 B;  4GGN A;  3ZWH A;  3OX5 A;  1WRK A;  1ZOT B;  1RTP 1;  2ZKM X;  1AVS A;  2KAX A;  3I5H B;  5CPV A;  4GBA A;  2NLN A;  1QIW A;  3TS5 C;  2OTG C;  2GV5 A;  4HRE E;  1B7T Z;  1N2D A;  2L2E A;  1AUI B;  4P5O E;  1SNL A;  2M97 A;  4ZCV A;  1QIV A;  4DIR A;  2JNF A;  2FOT A;  4PE1 A;  2RGI A;  1KQM C;  2K0J A;  3LLE A;  4YGD B;  1JBA A;  2HQW A;  1AJ5 A;  1WRL A;  1S3P A;  3A4U B;  1K96 A;  1CDL A;  1Y1A A;  3NSL A;  3EVR A;  2LVK A;  3IF7 A;  2BBN A;  1DTL A;  3GK4 X;  4PHJ A;  2M3W A;  2PAL A;  3TUY B;  2FCD A;  1M31 A;  3FS7 A;  1FI5 A;  4N1G A;  1EJ3 A;  1UHI A;  4I5J A;  2WCB A;  3VRN A;  1JUO A;  1B1G A;  2BKI B;  2NZ0 A;  5HYD A;  1DMO A;  4IL1 A;  2KI4 C;  2JT3 A;  1FF1 A;  1MF8 B;  2M49 B;  2LP3 A;  2KI6 C;  1KQV A;  2D8N A;  1RJV A;  1XFX O;  1QV0 A;  3BQ3 A;  4F0Z B;  3LK0 A;  4MVF A;  3SG4 A;  1BT6 A;  2DOQ A;  2ZFD A;  3FIA A;  4FTG A;  4R1E A;  1OMD A;  2EHB A;  3K21 A;  2JXL A;  1K90 D;  1RWY A;  1NCX A;  3AKA A;  3JTD B;  2V53 A;  1DGV A;  1UUS A;  2BE6 A;  2LCP A;  2OPO A;  3WHU B;  4USL A;  1NCY A;  1KWO B;  1MHO A;  2NXQ A;  1DJX A;  4ICB A;  2M7L A;  1NPQ A;  2L4I A;  3CR2 A;  1JF0 A;  4MRX A;  1CNP A;  4M2P A;  1A29 A;  4OKH A;  2WC8 A;  1ZUZ A;  3M0W A;  1KSM A;  1NCZ A;  3I5G B;  1PAL A;  1EH2 A;  1WDC C;  3H4S E;  2KAV A;  2JOJ A;  2WCF A;  1CLB A;  1BG1 A;  1IQ3 A;  1FBV A;  1QXP A;  1S36 A;  2BL0 C;  2L0P A;  1J55 A;  3KF9 A;  3NSK A;  1BJF A;  1LVC D;  3BOW B;  5HKW A;  1LA0 A;  5JOL A;  3DF0 A;  2JT8 A;  4C0K A;  1K9P A;  1DJI A;  3EK7 A;  1AJ4 A;  4TNC A;  2NCP A;  3JVT C;  4CPV A;  4L9M A;  4C0J A;  2QAC A;  1KFX S;  2PVB A;  2SCP A;  1XYD A;  2MBX A;  3WNX B;  1OMR A;  1IGV A;  3F45 A;  1QLK A;  4YGA A;  4YRU A;  2HF5 A;  2OS8 C;  3CTN A;  3I5F B;  1XO5 A;  4YGE B;  5IBW A;  1F70 A;  2KGR A;  1SY9 A;  1PK0 D;  1DF0 B;  2BBM A;  2LVJ A;  4N5X A;  1NSH A;  1PVB A;  1JF2 A;  2L50 A;  1YRU B;  1IRJ A;  1KFX L;  2BCX A;  3D0Y B;  4QJ5 B;  3EKJ A;  3ICB A;  1KCY A;  1DJH A;  2KBM A;  2L4H A;  1CB1 A;  2ZNE A;  1A2X A;  4PE7 A;  2O5G A;  4PDZ A;  1SL7 A;  5J3X A;  2F3Z A;  1CM1 A;  1QTX A;  1ZAC A;  4MRY A;  2JUL A;  4YBH B;  1RK9 A;  1S5G Y;  2KBI A;  1TNP A;  2JPT A;  1YX7 A;  4OR9 B;  2I7A A;  1SPY A;  2KHN A;  4YGC B;  1ZMZ A;  1NX2 A;  1NIW A;  1SR6 C;  4PHK A;  2L51 A;  2LNK A;  5ER4 X;  1R6P A;  1MXL C;  4ORC B;  5I2L A;  5I2O A;  4P2Y B;  2ZN9 A;  2I2R E;  2F3Y A;  1NX3 A;  3BUN B;  3BUO B;  1B47 A;  5AFP A;  1PRW A;  3CZT X;  1QVI Z;  1J7R A;  2H61 C;  3SG6 A;  1EG4 A;  2LUX A;  1FPW A;  1G8I A;  2LMV A;  3O2P A;  2JZI A;  2PRU A;  1XK4 C;  2G9B A;  1FW4 A;  3EKH A;  1UHH A;  4MBE A;  2K61 A;  2K7O A;  3D0Y A;  2MLF C;  3GOF A;  1DVI A;  4ZCU A;  1GGW A;  1FI6 A;  1V1F A;  1J7Q A;  4HRH A;  2CXJ A;  2KFF A;  1LA3 A;  1B8L A;  5PAL A;  1CLM A;  1HQV A;  4CFR A;  2Y5I A;  1B7T Y;  1F4Q A;  1S6C A;  1L7Z A;  2A4J A;  1ALV A;  1RFJ A;  3NSI A;  3PN7 B;  4PE4 A;  5I2Q A;  1OZO A;  2Y1N A;  1A75 B;  1IG5 A;  3CGA A;  4I5N B;  1J7P A;  3SG5 A;  1KK8 C;  3FWC A;  4HRG A;  1CTR A;  3VGO A;  1UWO A;  2Y4Q A;  4DUQ A;  1CFF A;  3SG2 A;  2GGZ A;  1NX1 A;  1NYA A;  5K89 A;  2LMT A;  3GK1 A;  1XVJ A;  4DS7 A;  1PSB A;  1SCV A;  5BPJ A;  1N65 A;  3IQO A;  3O6B A;  1YRT B;  1OOJ A;  1IWQ A;  2ZRS A;  4GUK A;  4UPG A;  3CS1 A;  3QRX A;  5TNC A;  2EC6 C;  3PM8 A;  1K8U A;  4CFQ A;  1C7V A;  2G2B A;  3O78 A;  2KDH A;  1CDN A;  3LK1 A;  1OMV A;  2HPS A;  5HKZ A;  1YVH A;  3I5I B;  1DJZ A;  1SK6 D;  3AKB A;  2LP2 A;  1K9K A;  1XFV O;  4GPL B;  3CR4 X;  5B8I B;  4AQI A;  1A75 A;  1GGZ A;  1MUX A;  1SMG A;  1TCO B;  1TRF A;  1QS7 A;  1QJT A;  1SBJ A;  1IJ5 A;  2KOT A;  3NXA A;  1SCM B;  3HX4 A;  4CLN A;  1DJY A;  4FQO A;  1B9A A;  4OVN F;  3DVM A;  2AUC A;  2WOS A;  2KGB C;  1VRK A;  1CLL A;  2WCE A;  1G4Y R;  3PSR A;  4PCW A;  3D10 A;  2M1U A;  2JTZ A;  3CR5 X;  1XA5 A;  2LUC A;  3SG3 A;  2AMI A;  2CBL A;  5F6T A;  1J1D A;  2ZND A;  5DKN A;  1QV1 A;  4QJ4 B;  3I5H C;  3VRP A;  1K94 A;  3TS5 B;  2OTG B;  2Q91 A;  2R2I A;  2SAS A;  3SIA A;  1REC A;  1DGU A;  5HLV A;  1B4C A;  1QLS A;  1V1G A;  2KFH A;  2P6B B;  5GQQ C;  1MR8 A;  1ODB A;  3BUX B;  1KQM B;  3EVU A;  5KU1 A;  4MLW A;  4MZK A;  4QJ3 B;  3DVJ A;  4GNK B;  4NQG A;  1XFW O;  1F8H A;  5I8N A;  4AOM A;  2BCA A;  2KNE A;  1AK8 A;  1E8A A;  5KTY A;  2KYC A;  4I5K A;  1RRO A;  3OP0 A;  4GFT A;  2LE9 B;  1JFK A;  2M1K B;  1MXE A;  1SRA A;  1N0Y A;  3TUY C;  1YUU A;  1OZS A;  2BKH B;  2E30 A;  2QPT A;  3OHM B;  2B1U A;  1S6I A;  1AHR A;  1XFU O;  1U5I B;  1PVA A;  2KQY A;  5HLO A;  2JXC A;  2BE4 A;  1EG3 A;  1PUL A;  2E6W A;  2KI4 B;  2MHH A;  3BOW A;  1YUR A;  2GGM A;  3ZNI A;  1KK7 Z;  1L2O B;  3IQQ A;  4C0L A;  1H4B A;  1SL8 A;  1HT9 A;  1M45 A;  2CTN A;  2L98 A;  1MWN A;  1K95 A;  2M29 A;  3EK8 A;  1GJY A;  2JWW A;  4CID A;  5JJG A;  5DKQ A;  1KFU S;  1J7O A;  3DVE A;  1BR1 B;  2CT9 A;  4XYN A;  1DF0 A;  1TOP A;  2IS9 A;  3AAJ A;  3CLN A;  5AXI A;  1JWD A;  1K2H A;  3JTD C;  1B8C A;  4JQ0 D;  1H8B A;  3AAK A;  1TNQ A;  1KSO A;  2JNX A;  2LHI A;  1KWO C;  4OCI A;  3VRR A;  2HET A;  3FWB A;  1OQP A;  1CFC A;  2MLE C;  1S1E A;  1TTX A;  1A4P A;  1ALW A;  4MEW A;  1UUR A;  1LIN A;  1SYM A;  1U5I A;  1LXF C;  4BY4 A;  1TN4 A;  1WDC B;  1QVI Y;  2M9G A;  2KSP A;  2LLT A;  1B8R A;  2I94 A;  5CSF A;  3I5G C;  1DT7 B;  1BF5 A;  3LCP C;  1GQM A;  4HSZ A;  3TDU A;  5CSN A;  3KPX A;  1CDP A;  4WRI A;  4M2O A;  3DVK A;  1MQ1 A;  2LVI A;  5AAN A;  1CMF A;  1K93 D;  2M0R A;  1BU3 A;  1DJG A;  3JVT B;  3SJS A;  2ZN8 A;  2HQ8 A;  2ISD A;  4MSP A;  4WQ2 A;  3BUM B;  1OSA A;  4M2Q A;  3SIB A;  1OE9 B;  2JRF A;  4GGF A;  4WQ3 A;  4XJK B;  5KSZ A;  3CWG A;  3KEV A;  2LLU A;  2CNP A;  1YUT A;  1AP4 A;  4D1E A;  1JC2 A;  3C1V A;  2OS8 B;  2LV7 A;  2F33 A;  3SG7 A;  1NX0 A;  1X02 A;  3DD4 A;  4YI8 A;  1F54 A;  2M7N A;  3I5F C;  1M39 A;  2K7B A;  3LL8 B;  1LKJ A;  1JFJ A;  2EGD A;  1S6J A;  1WLM A;  1TNW A;  2ZRT A;  5CSJ A;  3E3R A;  1G33 A;  1IJ6 A;  2LAP A;  4OV2 A;  1YX8 A;  1Y1U A;  1S26 D;  2LLS A;  4N1F A;  1W7J B;  2L5X B;  1W7I B;  3WHT B;  1NP8 A;  1C7W A;  3TDI A;  2I18 A;  2LHL A;  1UHK A;  2MA2 A;  1YR5 A;  1D1O A;  3PFV A;  5AEQ A;  5D69 A;  1M46 A;  2NCO A;  1QX7 A;  2F2O A;  3RM1 A;  3GK2 A;  2LAN A;  2WND A;  1L2O C;  3OB1 B;  1R2U A;  4NDD A;  1BOD A;  3MSE B;  1QX5 B;  2CCM A;  1CM4 A;  2JTT A;  2PSR A;  1XFZ O;  4XJK A;  1SR6 B;  3DF0 B;  4A4B A;  3VRQ A;  1TIZ A;  4I5L B;  2K8M B;  4E68 A;  1F55 A;  2VRG A;  1UHJ A;  3TZ1 A;  3KO0 A;  1YVL A;  1BMO A;  3BXK A;  3EK4 A;  5AER A;  2AAO A;  4GGF C;  1QAS A;  1YUS A;  4MZL A;  2PMY A;  1IH0 A;  1DJW A;  3OB2 B;  2JQ6 A;  4PHM A;  1SKT A;  5HKY A;  1F71 A;  2MJW B;  1YTZ C;  1F4O A;  2Q4U A;  4NDC A;  1CFD A;  1EXR A;  1M63 B;  2LMU A;  2Y1M A;  3NSO A;  1WY9 A;  3EVV A;  2JT0 A;  4A4C A;  1EL4 A;  2WOR A;  2K7C A;  1SW8 A;  2H2K A;  4MN0 A;  4PHN A;  1CMG A;  1UP5 A;  1Q80 A;  5FYX A;  1BLQ A;  5G08 A;  4AQJ A;  1WRZ A;  4MZJ A;  1QX2 A;  2LC5 A;  1IKU A;  1CDM A;  3PN7 C;  2COL B;  1BR4 B;  1KK8 B;  1J1E A;  1QAT A;  1XFY O;  4Q04 A;  4YGB B;  1NWD A;  4PAL A;  3WXA A;  3TDZ A;  2PAS A;  2JU0 A;  5D7F A;  2MRD A;  2F8P A;  2K7D A;  1ZFS A;  2KQ6 A;  4U8D A;  5CSI A;  3OX6 A;  1PSR A;  4JPZ B; 
#chains in the Genus database with same CATH topology
 2H61 A;  1CFP A;  3PLF B;  3O4Y A;  3QME A;  1C07 A;  2TN4 A;  1CKK A;  3BUW B;  2M8U A;  2WCK A;  2JC2 A;  1Y6W A;  2LVV A;  1XK4 A;  2KYF A;  2FJU B;  2EC6 B;  2K2F A;  5DKR A;  2LM5 A;  2KI6 D;  4ORA B;  1JSA A;  1S5G Z;  2BCB A;  4NDB A;  3BFB A;  3D75 A;  5ER5 A;  4DRW A;  2O60 A;  3VB1 A;  3BYA A;  4DCK A;  2FCE A;  1K9U A;  3RLZ A;  3VRO A;  1BOC A;  4ORB B;  1KK7 Y;  1WLZ A;  3I5I C;  2BEC A;  5DIC A;  2BAP A;  1IQ5 A;  4BY5 A;  1TCF A;  2KFG A;  3IVT A;  3KHE A;  4YI9 A;  1NUB A;  4PE0 A;  3S0G A;  1SCM C;  1TNX A;  2F2P A;  1A03 A;  4GAO A;  1Y1X A;  3HCM A;  3PAT A;  4ETO A;  3D76 A;  2WCM A;  1KFU L;  1SL9 A;  1Y0V H;  1UHN A;  2K2A A;  2MAZ A;  2P70 A;  2WCJ A;  3A8R A;  3PAL A;  4JWQ A;  4PT1 A;  2KAY A;  3K1E A;  2BL0 B;  4GGN A;  3ZWH A;  3OX5 A;  1WRK A;  1ZOT B;  1RTP 1;  2ZKM X;  1AVS A;  2KAX A;  3I5H B;  5CPV A;  4GBA A;  2NLN A;  3L4L A;  1QIW A;  3TS5 C;  2OTG C;  2GV5 A;  4HRE E;  1B7T Z;  1N2D A;  2L2E A;  1AUI B;  4P5O E;  1Z4H A;  1SNL A;  2L5Y A;  2M97 A;  2WCL A;  4ZCV A;  1QIV A;  1TWO A;  4DIR A;  2JNF A;  1TUJ A;  2FOT A;  4PE1 A;  2RGI A;  1KQM C;  2K0J A;  3LLE A;  4YGD B;  1JBA A;  2HQW A;  1AJ5 A;  1WRL A;  1S3P A;  3A4U B;  1K96 A;  1CDL A;  1Y1A A;  3NSL A;  3EVR A;  2LVK A;  3IF7 A;  2BBN A;  1DTL A;  3GK4 X;  4PHJ A;  1QWV A;  3NGV A;  2K60 A;  2M3W A;  2PAL A;  1GM0 A;  3TUY B;  3B7A A;  2FCD A;  1M31 A;  3FS7 A;  1FI5 A;  4N1G A;  1EJ3 A;  1UHI A;  4I5J A;  2WCB A;  3VRN A;  1JUO A;  1B1G A;  2BKI B;  2NZ0 A;  5HYD A;  1DMO A;  4IL1 A;  2KI4 C;  2JT3 A;  1FF1 A;  1MF8 B;  2M49 B;  2LP3 A;  2KI6 C;  1KQV A;  2D8N A;  1RJV A;  1XFX O;  1QV0 A;  3BQ3 A;  3SS3 A;  4F0Z B;  3LK0 A;  4MVF A;  3SG4 A;  1BT6 A;  2DOQ A;  2ZFD A;  3FIA A;  4FTG A;  4R1E A;  1OMD A;  2EHB A;  3K21 A;  2JXL A;  1K90 D;  1RWY A;  1NCX A;  3AKA A;  3JTD B;  2V53 A;  1DGV A;  1UUS A;  2BE6 A;  2LCP A;  2OPO A;  3WHU B;  4USL A;  1NCY A;  3CZ2 A;  1KWO B;  1MHO A;  2NXQ A;  1P28 A;  1DJX A;  4ICB A;  2M7L A;  1NPQ A;  2L4I A;  3CR2 A;  1JF0 A;  4MRX A;  1CNP A;  4M2P A;  3S0F A;  1A29 A;  4OKH A;  4JKT A;  2WC8 A;  3O4X A;  1ZUZ A;  3M0W A;  1KSM A;  1NCZ A;  3I5G B;  1PAL A;  1EH2 A;  1WDC C;  3H4S E;  2KAV A;  2JOJ A;  2WCF A;  1CLB A;  1BG1 A;  3L47 A;  1FBV A;  1QXP A;  1S36 A;  2BL0 C;  2L0P A;  1IQ3 A;  1J55 A;  3KF9 A;  3NSK A;  3Q8I A;  1BJF A;  1LVC D;  3BOW B;  5HKW A;  1LA0 A;  5JOL A;  3DY9 A;  1OOG A;  3DF0 A;  2JT8 A;  4C0K A;  1K9P A;  1DJI A;  3EK7 A;  1AJ4 A;  4TNC A;  2NCP A;  3B86 A;  3JVT C;  4CPV A;  3CZ1 A;  4L9M A;  4C0J A;  2L2C A;  1KFX S;  2PVB A;  2QAC A;  1XYD A;  2SCP A;  3B6X A;  2MBX A;  1OMR A;  3CZ0 A;  3WNX B;  1IGV A;  3F45 A;  3BJH A;  1QLK A;  2H8V A;  4YGA A;  4YRU A;  2HF5 A;  2OS8 C;  3CTN A;  3I5F B;  1XO5 A;  4YGE B;  5IBW A;  1F70 A;  2KGR A;  1SY9 A;  1PK0 D;  1DF0 B;  2BBM A;  2LVJ A;  4N5X A;  1NSH A;  1PVB A;  1JF2 A;  2L50 A;  3ZNI A;  2JPO A;  1YRU B;  1IRJ A;  1KFX L;  2BCX A;  3D0Y B;  5FI6 A;  3EKJ A;  3ICB A;  3UO9 A;  2QEH A;  1DJH A;  2KBM A;  2L4H A;  4QJ5 B;  1CB1 A;  3NHT A;  1KCY A;  2ZNE A;  1A2X A;  4PE7 A;  2O5G A;  4PDZ A;  1SL7 A;  2GTE A;  5J3X A;  2F3Z A;  1CM1 A;  1QTX A;  1ZAC A;  4MRY A;  2JUL A;  2WCH A;  4YBH B;  1RK9 A;  1S5G Y;  2KBI A;  1TNP A;  2JPT A;  1YX7 A;  4OR9 B;  2I7A A;  1SPY A;  2KHN A;  4YGC B;  1ZMZ A;  1OOI X;  3D74 A;  1NX2 A;  1NIW A;  5HL1 A;  1SR6 C;  4PHK A;  2L51 A;  2LNK A;  5ER4 X;  1R6P A;  1MXL C;  4ORC B;  5I2L A;  3R1P A;  4P2Y B;  2ZN9 A;  5I2O A;  2I2R E;  2F3Y A;  1NX3 A;  3BUN B;  3BUO B;  1B47 A;  5AFP A;  1PRW A;  3CZT X;  1QVI Z;  1J7R A;  2H61 C;  3SG6 A;  1EG4 A;  1OOH A;  2WC5 A;  2LUX A;  1DEL A;  3CYZ A;  1FPW A;  1G8I A;  2LMV A;  3O2P A;  2JZI A;  2PRU A;  1XK4 C;  2G9B A;  1FW4 A;  3EKH A;  1UHH A;  5FI7 A;  4MBE A;  2K61 A;  2K7O A;  3D0Y A;  2PYQ A;  2MLF C;  1W9Z A;  3GOF A;  1DVI A;  4ZCU A;  1GGW A;  1FI6 A;  1V1F A;  1J7Q A;  4HRH A;  2CXJ A;  2KFF A;  1LA3 A;  1B8L A;  3DXL A;  5PAL A;  1CLM A;  1HQV A;  4CFR A;  2Y5I A;  1F54 A;  1OOF A;  1B7T Y;  1F4Q A;  1S6C A;  1L7Z A;  2A4J A;  1ALV A;  1RFJ A;  3NSI A;  3PN7 B;  4PE4 A;  5I2Q A;  1OZO A;  2Y1N A;  1A75 B;  1IG5 A;  3CGA A;  4I5N B;  1J7P A;  3SG5 A;  1KK8 C;  3FWC A;  4HRG A;  1CTR A;  3VGO A;  1UWO A;  2Y4Q A;  4DUQ A;  3BFA A;  1DEK A;  1CFF A;  3SG2 A;  2GGZ A;  1NX1 A;  1NYA A;  5K89 A;  2LMT A;  3GK1 A;  1XVJ A;  4DS7 A;  2PQL A;  3CAB A;  1PSB A;  1SCV A;  5BPJ A;  1N65 A;  3IQO A;  3O6B A;  1YRT B;  1OOJ A;  3NHI A;  1IWQ A;  2ZRS A;  4GUK A;  4UPG A;  3CS1 A;  3QRX A;  5TNC A;  2EC6 C;  3PM8 A;  1K8U A;  4CFQ A;  1C7V A;  2G2B A;  3O78 A;  2KDH A;  1CDN A;  3LK1 A;  1OMV A;  2HPS A;  5HKZ A;  3RZS A;  1YVH A;  3I5I B;  1DJZ A;  1SK6 D;  3AKB A;  2LP2 A;  1K9K A;  1XFV O;  4GPL B;  3CR4 X;  5B8I B;  4AQI A;  1A75 A;  1GGZ A;  1MUX A;  1SMG A;  1TCO B;  1TRF A;  1QS7 A;  1QJT A;  1SBJ A;  1IJ5 A;  2KOT A;  3NXA A;  1SCM B;  3HX4 A;  4CLN A;  1DJY A;  4FQO A;  1B9A A;  4OVN F;  3DVM A;  2AUC A;  2WOS A;  2KGB C;  1VRK A;  1CLL A;  2WCE A;  1G4Y R;  3PSR A;  2KLE A;  4PCW A;  3D10 A;  2M1U A;  2JTZ A;  4INW A;  3CR5 X;  1XA5 A;  2LUC A;  3SG3 A;  2AMI A;  2CBL A;  5FI2 A;  5F6T A;  1J1D A;  2ZND A;  5DKN A;  1QV1 A;  4QJ4 B;  3I5H C;  3VRP A;  1K94 A;  3TS5 B;  2OTG B;  2Q91 A;  2R2I A;  2SAS A;  3L4A A;  3S0B A;  1REC A;  3SIA A;  1ORG A;  1DGU A;  5HLV A;  1B4C A;  1OW4 A;  1QLS A;  1V1G A;  2KFH A;  1TUZ A;  2P6B B;  5GQQ C;  1MR8 A;  2KLD A;  1ODB A;  3BUX B;  1KQM B;  3EVU A;  5KU1 A;  4MLW A;  4MZK A;  1IIO A;  4QJ3 B;  3DVJ A;  4GNK B;  4NQG A;  1C3Z A;  1XFW O;  1F8H A;  5I8N A;  4AOM A;  2BCA A;  2KNE A;  1AK8 A;  1E8A A;  5KTY A;  2KYC A;  4I5K A;  1RRO A;  1Z2C B;  3OP0 A;  4GFT A;  1DQE A;  2LE9 B;  1JFK A;  2QEB A;  2M1K B;  1MXE A;  1SRA A;  1N0Y A;  3TUY C;  1YUU A;  1OZS A;  2BKH B;  2E30 A;  2QPT A;  5I94 A;  3OHM B;  2B1U A;  1S6I A;  1AHR A;  1XFU O;  2QEO A;  1U5I B;  1PVA A;  2KQY A;  3D78 A;  5HLO A;  2JXC A;  2YGU A;  2BE4 A;  1EG3 A;  1PUL A;  2E6W A;  2KI4 B;  2MHH A;  3BOW A;  1LS8 A;  1YUR A;  2GGM A;  3S0D A;  1KK7 Z;  1L2O B;  3IQQ A;  4KYN A;  4C0L A;  1H4B A;  1SL8 A;  3FE6 A;  1HT9 A;  1M45 A;  2CTN A;  2L98 A;  1MWN A;  1K95 A;  2M29 A;  3EK8 A;  1GJY A;  2JWW A;  4CID A;  5JJG A;  5DKQ A;  4IJ7 A;  1KFU S;  1J7O A;  3DVE A;  1BR1 B;  2CT9 A;  4XYN A;  1DF0 A;  1T14 A;  1TOP A;  2IS9 A;  3AAJ A;  3CLN A;  4JD9 A;  5AXI A;  1JWD A;  3PM2 A;  3JTD C;  1K2H A;  1B8C A;  4JQ0 D;  1H8B A;  3AAK A;  1TNQ A;  1KSO A;  2JNX A;  2LHI A;  3EG5 B;  1KWO C;  4OCI A;  3VRR A;  2HET A;  3FWB A;  1OQP A;  1CFC A;  2MLE C;  1S1E A;  3UNW A;  1TTX A;  1A4P A;  1ALW A;  4MEW A;  1UUR A;  1LIN A;  1SYM A;  3OX6 A;  1U5I A;  1LXF C;  4BY4 A;  3R1V A;  1TN4 A;  1WDC B;  1QVI Y;  2M9G A;  2KSP A;  2LLT A;  1B8R A;  2I94 A;  5CSF A;  3I5G C;  1DT7 B;  1BF5 A;  3LCP C;  1GQM A;  3OBV A;  4HSZ A;  3TDU A;  5CSN A;  3FE9 A;  3KPX A;  1CDP A;  4WRI A;  4M2O A;  3DVK A;  1MQ1 A;  2LVI A;  5AAN A;  4F7F A;  1CMF A;  1K93 D;  2M0R A;  1BU3 A;  1DJG A;  3JVT B;  3N7H A;  3S0E A;  3SJS A;  2ZN8 A;  2HQ8 A;  2ISD A;  2ERB A;  4MSP A;  4WQ2 A;  3BUM B;  1OSA A;  4M2Q A;  3SIB A;  1OE9 B;  2JRF A;  4GGF A;  4WQ3 A;  4XJK B;  5KSZ A;  3CWG A;  3KEV A;  2LLU A;  2CNP A;  1C3Y A;  1YUT A;  1AP4 A;  4D1E A;  1JC2 A;  3C1V A;  2OS8 B;  2LV7 A;  2F33 A;  3SG7 A;  1NX0 A;  1X02 A;  3B88 A;  3D73 A;  3DD4 A;  2M7N A;  4YI8 A;  3I5F C;  1M39 A;  2K7B A;  3LL8 B;  2WC6 A;  1LKJ A;  3OGN A;  1JFJ A;  2EGD A;  1S6J A;  4FQT A;  1WLM A;  1TNW A;  2ZRT A;  5CSJ A;  3E3R A;  3B87 A;  1G33 A;  3R1O A;  1IJ6 A;  2LAP A;  4OV2 A;  1YX8 A;  1Y1U A;  1S26 D;  2LLS A;  4N1F A;  1W7J B;  2L5X B;  3S0A A;  1W7I B;  3WHT B;  1NP8 A;  1C7W A;  3TDI A;  2BNX A;  2I18 A;  2LHL A;  1UHK A;  2MA2 A;  3V2L A;  1XFR A;  1YR5 A;  2FJY A;  2QEV A;  1D1O A;  3R72 A;  3PFV A;  5AEQ A;  5D69 A;  1M46 A;  2NCO A;  1QX7 A;  2F2O A;  3RM1 A;  3GK2 A;  2LAN A;  2WND A;  1L2O C;  3OB1 B;  1R2U A;  4NDD A;  1BOD A;  3MSE B;  1QX5 B;  3D77 A;  2CCM A;  1CM4 A;  2JTT A;  2PSR A;  1XFZ O;  4XJK A;  1SR6 B;  3DF0 B;  4A4B A;  3VRQ A;  1TIZ A;  4I5L B;  2K8M B;  4E68 A;  1F55 A;  2VRG A;  1UHJ A;  3TZ1 A;  2QDI A;  3KO0 A;  1YVL A;  1BMO A;  2P71 A;  3BXK A;  3EK4 A;  5EL2 A;  5AER A;  2AAO A;  4GGF C;  1QAS A;  1YUS A;  3SS5 A;  4MZL A;  2PMY A;  1IH0 A;  1DJW A;  3OB2 B;  2JQ6 A;  4PHM A;  1SKT A;  5HKY A;  1F71 A;  2MJW B;  3DYE A;  1YTZ C;  1F4O A;  2Q4U A;  4INX A;  4NDC A;  1CFD A;  1EXR A;  1M63 B;  2LMU A;  5D3O A;  2Y1M A;  3NSO A;  1WY9 A;  2KPH A;  3EVV A;  2JT0 A;  4A4C A;  1EL4 A;  1SSE B;  2K7C A;  1SW8 A;  2H2K A;  2WOR A;  4MN0 A;  4PHN A;  3SS4 A;  1CMG A;  1UP5 A;  1Q80 A;  5FYX A;  1BLQ A;  5G08 A;  4OZD A;  4AQJ A;  1WRZ A;  3FE8 A;  1QX2 A;  2LC5 A;  4MZJ A;  1CDM A;  3PN7 C;  1IKU A;  2COL B;  1BR4 B;  3PJI A;  1KK8 B;  1J1E A;  1QAT A;  1XFY O;  4Q04 A;  4YGB B;  1NWD A;  4PAL A;  3WXA A;  1DC1 A;  3TDZ A;  2PAS A;  2JU0 A;  5D7F A;  3BFH A;  3DZT A;  2MRD A;  2F8P A;  2K7D A;  1ZFS A;  2KQ6 A;  4U8D A;  5CSI A;  3CDN A;  1PSR A;  4JPZ B; 
#chains in the Genus database with same CATH homology
 2H61 A;  1CFP A;  3PLF B;  3O4Y A;  1C07 A;  2TN4 A;  1CKK A;  3BUW B;  2M8U A;  2JC2 A;  1Y6W A;  2LVV A;  1XK4 A;  2KYF A;  2FJU B;  2EC6 B;  2K2F A;  5DKR A;  2LM5 A;  2KI6 D;  4ORA B;  1JSA A;  1S5G Z;  2BCB A;  4NDB A;  5ER5 A;  4DRW A;  2O60 A;  3BYA A;  4DCK A;  2FCE A;  1K9U A;  3RLZ A;  3VRO A;  1BOC A;  4ORB B;  1KK7 Y;  1WLZ A;  3I5I C;  2BEC A;  1IQ5 A;  4BY5 A;  1TCF A;  2KFG A;  3KHE A;  4YI9 A;  1NUB A;  4PE0 A;  1SCM C;  1TNX A;  2F2P A;  1A03 A;  4GAO A;  1Y1X A;  3HCM A;  3PAT A;  4ETO A;  1KFU L;  1SL9 A;  1Y0V H;  1UHN A;  2K2A A;  2MAZ A;  3PAL A;  3A8R A;  4JWQ A;  2KAY A;  2BL0 B;  4GGN A;  3ZWH A;  3OX5 A;  1WRK A;  1ZOT B;  1RTP 1;  2ZKM X;  1AVS A;  2KAX A;  3I5H B;  5CPV A;  4GBA A;  2NLN A;  1QIW A;  3TS5 C;  2OTG C;  2GV5 A;  4HRE E;  1B7T Z;  1N2D A;  2L2E A;  1AUI B;  4P5O E;  1SNL A;  2M97 A;  4ZCV A;  1QIV A;  4DIR A;  2JNF A;  2FOT A;  4PE1 A;  2RGI A;  1KQM C;  2K0J A;  3LLE A;  4YGD B;  1JBA A;  2HQW A;  1AJ5 A;  1WRL A;  1S3P A;  3A4U B;  1K96 A;  1CDL A;  1Y1A A;  3NSL A;  3EVR A;  2LVK A;  3IF7 A;  2BBN A;  1DTL A;  3GK4 X;  4PHJ A;  2M3W A;  2PAL A;  3TUY B;  2FCD A;  1M31 A;  3FS7 A;  1FI5 A;  4N1G A;  1EJ3 A;  1UHI A;  4I5J A;  2WCB A;  3VRN A;  1JUO A;  1B1G A;  2BKI B;  2NZ0 A;  5HYD A;  1DMO A;  4IL1 A;  2KI4 C;  2JT3 A;  1FF1 A;  1MF8 B;  2M49 B;  2LP3 A;  2KI6 C;  1KQV A;  2D8N A;  1RJV A;  1XFX O;  1QV0 A;  3BQ3 A;  4F0Z B;  3LK0 A;  4MVF A;  3SG4 A;  1BT6 A;  2DOQ A;  2ZFD A;  3FIA A;  4FTG A;  4R1E A;  1OMD A;  2EHB A;  3K21 A;  2JXL A;  1K90 D;  1RWY A;  1NCX A;  3AKA A;  3JTD B;  2V53 A;  1DGV A;  1UUS A;  2BE6 A;  2LCP A;  2OPO A;  3WHU B;  4USL A;  1NCY A;  1KWO B;  1MHO A;  2NXQ A;  1DJX A;  4ICB A;  2M7L A;  1NPQ A;  2L4I A;  3CR2 A;  1JF0 A;  4MRX A;  1CNP A;  4M2P A;  1A29 A;  4OKH A;  2WC8 A;  1ZUZ A;  3M0W A;  1KSM A;  1NCZ A;  3I5G B;  1PAL A;  1EH2 A;  1WDC C;  3H4S E;  2KAV A;  2JOJ A;  2WCF A;  1CLB A;  1BG1 A;  1IQ3 A;  1FBV A;  1QXP A;  1S36 A;  2BL0 C;  2L0P A;  1J55 A;  3KF9 A;  3NSK A;  1BJF A;  1LVC D;  3BOW B;  5HKW A;  1LA0 A;  5JOL A;  3DF0 A;  2JT8 A;  4C0K A;  1K9P A;  1DJI A;  3EK7 A;  1AJ4 A;  4TNC A;  2NCP A;  3JVT C;  4CPV A;  4L9M A;  4C0J A;  2QAC A;  1KFX S;  2PVB A;  2SCP A;  1XYD A;  2MBX A;  3WNX B;  1OMR A;  1IGV A;  3F45 A;  1QLK A;  4YGA A;  4YRU A;  2HF5 A;  2OS8 C;  3CTN A;  3I5F B;  1XO5 A;  4YGE B;  5IBW A;  1F70 A;  2KGR A;  1SY9 A;  1PK0 D;  1DF0 B;  2BBM A;  2LVJ A;  4N5X A;  1NSH A;  1PVB A;  1JF2 A;  2L50 A;  1YRU B;  1IRJ A;  1KFX L;  2BCX A;  3D0Y B;  4QJ5 B;  3EKJ A;  3ICB A;  1KCY A;  1DJH A;  2KBM A;  2L4H A;  1CB1 A;  2ZNE A;  1A2X A;  4PE7 A;  2O5G A;  4PDZ A;  1SL7 A;  5J3X A;  2F3Z A;  1CM1 A;  1QTX A;  1ZAC A;  4MRY A;  2JUL A;  4YBH B;  1RK9 A;  1S5G Y;  2KBI A;  1TNP A;  2JPT A;  1YX7 A;  4OR9 B;  2I7A A;  1SPY A;  2KHN A;  4YGC B;  1ZMZ A;  1NX2 A;  1NIW A;  1SR6 C;  4PHK A;  2L51 A;  2LNK A;  5ER4 X;  1R6P A;  1MXL C;  4ORC B;  5I2L A;  5I2O A;  4P2Y B;  2ZN9 A;  2I2R E;  2F3Y A;  1NX3 A;  3BUN B;  3BUO B;  1B47 A;  5AFP A;  1PRW A;  3CZT X;  1QVI Z;  1J7R A;  2H61 C;  3SG6 A;  1EG4 A;  2LUX A;  1FPW A;  1G8I A;  2LMV A;  3O2P A;  2JZI A;  2PRU A;  1XK4 C;  2G9B A;  1FW4 A;  3EKH A;  1UHH A;  4MBE A;  2K61 A;  2K7O A;  3D0Y A;  2MLF C;  3GOF A;  1DVI A;  4ZCU A;  1GGW A;  1FI6 A;  1V1F A;  1J7Q A;  4HRH A;  2CXJ A;  2KFF A;  1LA3 A;  1B8L A;  5PAL A;  1CLM A;  1HQV A;  4CFR A;  2Y5I A;  1B7T Y;  1F4Q A;  1S6C A;  1L7Z A;  2A4J A;  1ALV A;  1RFJ A;  3NSI A;  3PN7 B;  4PE4 A;  5I2Q A;  1OZO A;  2Y1N A;  1A75 B;  1IG5 A;  3CGA A;  4I5N B;  1J7P A;  3SG5 A;  1KK8 C;  3FWC A;  4HRG A;  1CTR A;  3VGO A;  1UWO A;  2Y4Q A;  4DUQ A;  1CFF A;  3SG2 A;  2GGZ A;  1NX1 A;  1NYA A;  5K89 A;  2LMT A;  3GK1 A;  1XVJ A;  4DS7 A;  1PSB A;  1SCV A;  5BPJ A;  1N65 A;  3IQO A;  3O6B A;  1YRT B;  1OOJ A;  1IWQ A;  2ZRS A;  4GUK A;  4UPG A;  3CS1 A;  3QRX A;  5TNC A;  2EC6 C;  3PM8 A;  1K8U A;  4CFQ A;  1C7V A;  2G2B A;  3O78 A;  2KDH A;  1CDN A;  3LK1 A;  1OMV A;  2HPS A;  5HKZ A;  1YVH A;  3I5I B;  1DJZ A;  1SK6 D;  3AKB A;  2LP2 A;  1K9K A;  1XFV O;  4GPL B;  3CR4 X;  5B8I B;  4AQI A;  1A75 A;  1GGZ A;  1MUX A;  1SMG A;  1TCO B;  1TRF A;  1QS7 A;  1QJT A;  1SBJ A;  1IJ5 A;  2KOT A;  3NXA A;  1SCM B;  3HX4 A;  4CLN A;  1DJY A;  4FQO A;  1B9A A;  4OVN F;  3DVM A;  2AUC A;  2WOS A;  2KGB C;  1VRK A;  1CLL A;  2WCE A;  1G4Y R;  3PSR A;  4PCW A;  3D10 A;  2M1U A;  2JTZ A;  3CR5 X;  1XA5 A;  2LUC A;  3SG3 A;  2AMI A;  2CBL A;  5F6T A;  1J1D A;  2ZND A;  5DKN A;  1QV1 A;  4QJ4 B;  3I5H C;  3VRP A;  1K94 A;  3TS5 B;  2OTG B;  2Q91 A;  2R2I A;  2SAS A;  3SIA A;  1REC A;  1DGU A;  5HLV A;  1B4C A;  1QLS A;  1V1G A;  2KFH A;  2P6B B;  5GQQ C;  1MR8 A;  1ODB A;  3BUX B;  1KQM B;  3EVU A;  5KU1 A;  4MLW A;  4MZK A;  4QJ3 B;  3DVJ A;  4GNK B;  4NQG A;  1XFW O;  1F8H A;  5I8N A;  4AOM A;  2BCA A;  2KNE A;  1AK8 A;  1E8A A;  5KTY A;  2KYC A;  4I5K A;  1RRO A;  3OP0 A;  4GFT A;  2LE9 B;  1JFK A;  2M1K B;  1MXE A;  1SRA A;  1N0Y A;  3TUY C;  1YUU A;  1OZS A;  2BKH B;  2E30 A;  2QPT A;  3OHM B;  2B1U A;  1S6I A;  1AHR A;  1XFU O;  1U5I B;  1PVA A;  2KQY A;  5HLO A;  2JXC A;  2BE4 A;  1EG3 A;  1PUL A;  2E6W A;  2KI4 B;  2MHH A;  3BOW A;  1YUR A;  2GGM A;  3ZNI A;  1KK7 Z;  1L2O B;  3IQQ A;  4C0L A;  1H4B A;  1SL8 A;  1HT9 A;  1M45 A;  2CTN A;  2L98 A;  1MWN A;  1K95 A;  2M29 A;  3EK8 A;  1GJY A;  2JWW A;  4CID A;  5JJG A;  5DKQ A;  1KFU S;  1J7O A;  3DVE A;  1BR1 B;  2CT9 A;  4XYN A;  1DF0 A;  1TOP A;  2IS9 A;  3AAJ A;  3CLN A;  5AXI A;  1JWD A;  1K2H A;  3JTD C;  1B8C A;  4JQ0 D;  1H8B A;  3AAK A;  1TNQ A;  1KSO A;  2JNX A;  2LHI A;  1KWO C;  4OCI A;  3VRR A;  2HET A;  3FWB A;  1OQP A;  1CFC A;  2MLE C;  1S1E A;  1TTX A;  1A4P A;  1ALW A;  4MEW A;  1UUR A;  1LIN A;  1SYM A;  1U5I A;  1LXF C;  4BY4 A;  1TN4 A;  1WDC B;  1QVI Y;  2M9G A;  2KSP A;  2LLT A;  1B8R A;  2I94 A;  5CSF A;  3I5G C;  1DT7 B;  1BF5 A;  3LCP C;  1GQM A;  4HSZ A;  3TDU A;  5CSN A;  3KPX A;  1CDP A;  4WRI A;  4M2O A;  3DVK A;  1MQ1 A;  2LVI A;  5AAN A;  1CMF A;  1K93 D;  2M0R A;  1BU3 A;  1DJG A;  3JVT B;  3SJS A;  2ZN8 A;  2HQ8 A;  2ISD A;  4MSP A;  4WQ2 A;  3BUM B;  1OSA A;  4M2Q A;  3SIB A;  1OE9 B;  2JRF A;  4GGF A;  4WQ3 A;  4XJK B;  5KSZ A;  3CWG A;  3KEV A;  2LLU A;  2CNP A;  1YUT A;  1AP4 A;  4D1E A;  1JC2 A;  3C1V A;  2OS8 B;  2LV7 A;  2F33 A;  3SG7 A;  1NX0 A;  1X02 A;  3DD4 A;  4YI8 A;  1F54 A;  2M7N A;  3I5F C;  1M39 A;  2K7B A;  3LL8 B;  1LKJ A;  1JFJ A;  2EGD A;  1S6J A;  1WLM A;  1TNW A;  2ZRT A;  5CSJ A;  3E3R A;  1G33 A;  1IJ6 A;  2LAP A;  4OV2 A;  1YX8 A;  1Y1U A;  1S26 D;  2LLS A;  4N1F A;  1W7J B;  2L5X B;  1W7I B;  3WHT B;  1NP8 A;  1C7W A;  3TDI A;  2I18 A;  2LHL A;  1UHK A;  2MA2 A;  1YR5 A;  1D1O A;  3PFV A;  5AEQ A;  5D69 A;  1M46 A;  2NCO A;  1QX7 A;  2F2O A;  3RM1 A;  3GK2 A;  2LAN A;  2WND A;  1L2O C;  3OB1 B;  1R2U A;  4NDD A;  1BOD A;  3MSE B;  1QX5 B;  2CCM A;  1CM4 A;  2JTT A;  2PSR A;  1XFZ O;  4XJK A;  1SR6 B;  3DF0 B;  4A4B A;  3VRQ A;  1TIZ A;  4I5L B;  2K8M B;  4E68 A;  1F55 A;  2VRG A;  1UHJ A;  3TZ1 A;  3KO0 A;  1YVL A;  1BMO A;  3BXK A;  3EK4 A;  5AER A;  2AAO A;  4GGF C;  1QAS A;  1YUS A;  4MZL A;  2PMY A;  1IH0 A;  1DJW A;  3OB2 B;  2JQ6 A;  4PHM A;  1SKT A;  5HKY A;  1F71 A;  2MJW B;  1YTZ C;  1F4O A;  2Q4U A;  4NDC A;  1CFD A;  1EXR A;  1M63 B;  2LMU A;  2Y1M A;  3NSO A;  1WY9 A;  3EVV A;  2JT0 A;  4A4C A;  1EL4 A;  2WOR A;  2K7C A;  1SW8 A;  2H2K A;  4MN0 A;  4PHN A;  1CMG A;  1UP5 A;  1Q80 A;  5FYX A;  1BLQ A;  5G08 A;  4AQJ A;  1WRZ A;  4MZJ A;  1QX2 A;  2LC5 A;  1IKU A;  1CDM A;  3PN7 C;  2COL B;  1BR4 B;  1KK8 B;  1J1E A;  1QAT A;  1XFY O;  4Q04 A;  4YGB B;  1NWD A;  4PAL A;  3WXA A;  3TDZ A;  2PAS A;  2JU0 A;  5D7F A;  2MRD A;  2F8P A;  2K7D A;  1ZFS A;  2KQ6 A;  4U8D A;  5CSI A;  3OX6 A;  1PSR A;  4JPZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...