2LVJA

Solution structure of hemi-mg-bound phl p 7
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
b'ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Phl p 7
publication title Solution structures of polcalcin Phl p 7 in three ligation states: Apo-, hemi-Mg(2+) -bound, and fully Ca(2+) -bound.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lvjA00
1DJHA 2JU0A 4BY4A 1S6JA 3PN7C 1PSBA 1XK4A 2F33A 4PHKA 1NP8A 3JTDC 5GQQC 4OVNF 2WC8A 1NWDA 3DVJA 3HX4A 3O4YA 4PE4A 2KBMA 3AKAA 4MZLA 4XJKA 1SR6C 2JTTA 2NLNA 1UUSA 3SG6A 2E30A 2JXCA 4QJ4B 2G2BA 1OOJA 1OMRA 1QXPA 1RJVA 2Y4QA 2F2PA 5HKZA 1YTZC 2H61A 2JULA 1OMVA 2LUCA 1CDPA 2JTZA 3VRQA 2FOTA 1LVCD 3DVKA 1QV1A 4CIDA 3CGAA 1TN4A 2K0JA 3LK1A 4OCIA 1QATA 1IQ3A 4E68A 2WCEA 1QJTA 1L7ZA 2Y1NA 4L9MA 2OPOA 2KFGA 1E8AA 1OMDA 2O5GA 1R2UA 2WNDA 3SG5A 4C0JA 3VRPA 1S1EA 1FI6A 1Y1XA 2JNXA 2M7NA 3PLFB 2JXLA 3JVTB 3WHTB 3VROA 2JOJA 4PCWA 1ZUZA 3OHMB 3WXAA 4AQIA 1ODBA 3O2PA 1BR1B 2SCPA 3CR5X 1J7RA 2BBMA 1UHHA 1N2DA 3CS1A 1V1FA 1QTXA 1KFUS 3TDZA 1F55A 1EXRA 3LL8B 2LM5A 3PM8A 1DJWA 2KQ6A 1S6CA 1LA0A 2LV7A 3JVTC 4WQ2A 4PALA 1QVIZ 2JT0A 1RROA 3EK4A 1ALWA 3BXKA 1GGZA 2LC5A 4NDBA 2L0PA 2F8PA 2L5XB 3FIAA 2KYCA 1FF1A 2KYFA 4PE7A 1F4QA 5K89A 2B1UA 2G9BA 1A75B 2MLFC 2LP3A 3I5GB 5HLOA 1K95A 1CM1A 3GK2A 1KK8C 1S36A 2EHBA 2ZNDA 3BUXB 1B8RA 2BECA 3O6BA 2M1KB 1JF2A 3BYAA 4P5OE 2EGDA 2L2EA 3LCPC 2JPTA 1Y1UA 3HCMA 1GJYA 1DJIA 1NCYA 2LVVA 2IS9A 2EC6C 5ER5A 4YRUA 1IWQA 1FPWA 4N1GA 2K7OA 1L2OB 1QIWA 2WORA 1S5GY 3IF7A 4GGFA 1K90D 2K7BA 4P2YB 3SJSA 1QX5B 2ZKMX 4YGCB 3ZNIA 1TNPA 2JRFA 5JOLA 4GFTA 1DF0B 2M1UA 1CNPA 1TIZA 1J7PA 4ICBA 1XFYO 4GBAA 3ICBA 3K21A 4U8DA 5AERA 2NCOA 2JNFA 1SPYA 4A4BA 1QIVA 4MN0A 1B8LA 4DS7A 1KFXL 1NPQA 2BL0B 3I5HB 4ORAB 2BBNA 2L4IA 2KBIA 2GGMA 1XA5A 4DIRA 1CFDA 1EJ3A 2KNEA 4BY5A 3FS7A 1K9UA 5KU1A 2O60A 3DF0A 1K9PA 1B4CA 5KTYA 1LA3A 5AFPA 1JFJA 2JQ6A 5KSZA 1IKUA 2LNKA 3TZ1A 3TS5B 1CDLA 1LXFC 1KK7Z 1JWDA 2L4HA 1IG5A 1NSHA 2WCFA 1SL8A 3OB1B 1DJYA 1DJXA 2OS8C 3SIAA 1U5IB 4N5XA 4PDZA 2KAVA 3CTNA 1VRKA 3BUNB 1MXLC 1FW4A 1TCOB 1W7IB 1XFUO 3TS5C 1BLQA 1TTXA 3EKJA 2KFHA 1H8BA 1DT7B 3GK1A 5FYXA 3KO0A 3KPXA 2LVJA 3VGOA 4GAOA 3AAKA 5JJGA 1C07A 2Y1MA 4D1EA 2CTNA 3SG2A 3CR2A 1XO5A 4A4CA 5HYDA 1F70A 2ZN8A 1PULA 1SK6D 1QS7A 2I18A 4YI8A 1NCZA 1AK8A 1BODA 1BMOA 3PSRA 2M49B 1BU3A 1UP5A 2F2OA 1QX7A 4R1EA 5G08A 1F54A 2BCBA 2CCMA 3BUMB 2M7LA 4DUQA 1WRLA 3SG4A 2AMIA 3CWGA 1LKJA 3SG3A 1K8UA 1CB1A 3IQOA 5CSJA 2SASA 5AXIA 1NYAA 1BR4B 2CT9A 2RGIA 4FQOA 2MA2A 3PATA 1TNWA 1SMGA 2LHLA 2M9GA 4OKHA 2QACA 2LAPA 1RK9A 2KGRA 4PE1A 4ORCB 4DCKA 1MHOA 1NX0A 1OE9B 1Y0VH 1C7VA 3TUYB 4TNCA 4ETOA 5CSNA 3ZWHA 2HQ8A 2K7DA 1KSOA 2L98A 2M29A 2PMYA 5I8NA 3NSLA 4CFQA 2KDHA 4OV2A 1A4PA 2KFFA 3WNXB 4C0LA 2K2AA 1MQ1A 1PALA 3FWBA 1QLSA 5IBWA 1CLBA 4JWQA 1KQMB 3D0YA 5CSIA 4YGBB 3TUYC 3FWCA 1BOCA 1PVBA 3LLEA 1F8HA 2ZNEA 1HT9A 1SKTA 3O78A 4YGDB 2LUXA 2KI6D 2DOQA 2KQYA 1DMOA 2R2IA 4AOMA 1KCYA 4UPGA 1WRZA 4DRWA 1TRFA 2K61A 1TNQA 3EVRA 3H4SE 3AAJA 1S6IA 1KQMC 1G8IA 1SYMA 2PVBA 2CNPA 1EG3A 3BOWB 2LHIA 1SL7A 3I5GC 2PSRA 1QASA 1RTP1 1M46A 4NQGA 2HPSA 2I2RE 1G4YR 4NDDA 1YUTA 1WDCB 2Q91A 1SBJA 2KAYA 3DF0B 3VRNA 2F3ZA 2BKIB 2WCBA 5PALA 2KHNA 1IH0A 1UHIA 3E3RA 2LMVA 4YGAA 2LMTA 3KF9A 5B8IB 1SCMB 1L2OC 1J7OA 1FI5A 1CFFA 1UHKA 1HQVA 3RM1A 1K2HA 1K9KA 1YX8A 4CLNA 4N1FA 4USLA 4ZCVA 1UHJA 1XFXO 2AUCA 3BUWB 5DKNA 1K96A 1A75A 1N0YA 3AKBA 5TNCA 2BE4A 2I7AA 2Y5IA 3OX6A 4YBHB 3WHUB 1IGVA 1CDNA 4XJKB 5HLVA 1DVIA 1S26D 1SCMC 2FCDA 2MRDA 2KAXA 2K2FA 2KI4B 2M0RA 1DGVA 1KSMA 1JUOA 4FTGA 2A4JA 3EKHA 4M2QA 2LVIA 1CLMA 1XK4C 1XFVO 2BL0C 2HETA 3I5HC 1CTRA 3KEVA 4I5KA 1NUBA 3OB2B 1ZACA 2K7CA 3VRRA 2NXQA 1AJ4A 1YX7A 2BCXA 2LCPA 5J3XA 1F71A 1WRKA 2JT3A 3PALA 1CKKA 4YGEB 1W7JB 3EVUA 3C1VA 1B47A 3PN7B 2HF5A 3QRXA 2PASA 2ZFDA 3KHEA 4GGNA 4HREE 1YUUA 4MEWA 4WQ3A 3JTDB 1NCXA 1DF0A 2LLUA 2ZN9A 1J55A 4M2OA 2H2KA 1QX2A 1YVHA 1A03A 1BF5A 2LLTA 1K94A 4HRGA 1JSAA 2JZIA 4MRYA 1SR6B 2ZRSA 3PFVA 3OP0A 1AP4A 1IJ5A 1BJFA 1B7TZ 1Y6WA 1PK0D 2JWWA 1IRJA 3EK7A 1KFUL 1QVIY 1IQ5A 1V1GA 1OSAA 2F3YA 2MLEC 3M0WA 1F4OA 1R6PA 1JBAA 1SRAA 1QLKA 1YRUB 5CSFA 2M97A 4PHMA 5HKWA 5I2QA 3F45A 1KFXS 1TOPA 1NX3A 3D10A 4MLWA 2PALA 4ORBB 2K8MB 2NZ0A 3A4UB 1J1DA 4MBEA 1YRTB 1YURA 4ZCUA 1CMGA 2V53A 3GOFA 4PE0A 4HRHA 4Q04A 1QV0A 1A29A 3RLZA 2D8NA 3DVMA 2KI6C 2MHHA 2GGZA 3D0YB 3NSOA 5F6TA 2PRUA 3CR4X 4MSPA 1U5IA 3I5FB 1MXEA 1XYDA 2FCEA 1XFZO 2TN4A 1UWOA 1M39A 1UHNA 4I5NB 1B9AA 4I5JA 2CBLA 1IJ6A 3NSKA 4GNKB 2VRGA 4GUKA 1A2XA 2HQWA 1FBVA 1NX2A 3I5FC 2MJWB 4CFRA 3TDIA 1WLMA 1JFKA 4YI9A 1CDMA 4JQ0D 1JF0A 2LANA 1PRWA 1CFCA 3BUOB 3CLNA 2LVKA 5ER4X 1N65A 1MUXA 2ZRTA 3SG7A 1ZFSA 1J1EA 1EG4A 1KWOB 1AJ5A 5HKYA 2COLB 2M3WA 1EH2A 1WLZA 3I5IB 2P6BB 5DKRA 1UURA 2OTGB 2Q4UA 1KK8B 4XYNA 2JC2A 3GK4X 4MVFA 2KGBC 1J7QA 1XFWO 1M31A 1SL9A 4GGFC 1OZOA 1GGWA 3EK8A 1AVSA 1ZMZA 1KK7Y 3A8RA 4PHJA 4AQJA 2EC6B 4GPLB 1PVAA 3NSIA 1KWOC 2QPTA 1BT6A 4I5LB 3I5IC 1B8CA 2OTGC 1YVLA 1TCFA 1DTLA 5DKQA 2I94A 1RWYA 1S3PA 4F0ZB 2BCAA 2KSPA 1B1GA 1KQVA 4PHNA 4WRIA 2FJUB 1DJGA 1MF8B 1WDCC 3BQ3A 4IL1A 3SIBA 5BPJA 4HSZA 1ZOTB 1RECA 2LP2A 1TNXA 2LMUA 1Q80A 1YR5A 4NDCA 3DVEA 1X02A 1AUIB 1B7TY 2GV5A 2MBXA 3NXAA 2AAOA 3IQQA 2WOSA 1SCVA 1CFPA 2CXJA 3EVVA 3CZTX 1CLLA 1K93D 1GQMA 2BKHB 4MZKA 5D7FA 1SW8A 1Y1AA 1M63B 3DD4A 2MAZA 5I2OA 4MRXA 1MWNA 4CPVA 2NCPA 1YUSA 1NX1A 1LINA 2LLSA 4MZJA 4M2PA 1SY9A 2E6WA 5CPVA 4JPZB 3BOWA 2LE9B 5AEQA 3MSEB 3TDUA 1SNLA 2L50A 1OZSA 4QJ3B 2M8UA 3LK0A 2KI4C 1WY9A 1ALVA 1CM4A 2OS8B 1NIWA 1BG1A 4C0KA 1OQPA 1XVJA 1G33A 1M45A 3OX5A 2KOTA 1H4BA 1CMFA 1MR8A 5AANA 4QJ5B 1RFJA 1EL4A 2BE6A 5D69A 1C7WA 1DGUA 2H61C 1D1OA 1AHRA 1DJZA 1PSRA 5I2LA 1JC2A 2L51A 1S5GZ 2JT8A 4OR9B 2ISDA
chains in the Genus database with same CATH superfamily
1DJHA 2JU0A 4BY4A 1S6JA 3PN7C 1PSBA 1TUJA 1XK4A 2F33A 3FE9A 4PHKA 1NP8A 3D77A 3JTDC 5GQQC 1P28A 4OVNF 2WC8A 1NWDA 3DVJA 3HX4A 3O4YA 4PE4A 2KBMA 3AKAA 4MZLA 4XJKA 3CABA 1SR6C 2JTTA 2NLNA 1UUSA 3FE6A 4KYNA 3SG6A 2E30A 2JXCA 2KLDA 4QJ4B 2G2BA 1OOJA 2WCLA 3OBVA 1OMRA 1QXPA 1RJVA 2Y4QA 2F2PA 5HKZA 1C3ZA 1YTZC 2H61A 2JULA 3NHIA 1OMVA 2LUCA 1CDPA 2JTZA 3VRQA 3SS3A 2FOTA 1LVCD 3DVKA 1QV1A 4CIDA 3CGAA 1TN4A 2K0JA 3LK1A 4OCIA 2QEBA 1QATA 1IQ3A 5FI6A 4E68A 2WCEA 1QJTA 1L7ZA 2Y1NA 4L9MA 2OPOA 2KFGA 4IJ7A 1E8AA 1OMDA 1CMGA 2O5GA 1XFRA 1R2UA 3CZ1A 2WNDA 3SG5A 4C0JA 3VRPA 1S1EA 3B6XA 1FI6A 1Y1XA 2JNXA 2M7NA 3N7HA 2JXLA 3PLFB 3JVTB 3WHTB 3VROA 2JOJA 4PCWA 1ZUZA 3OHMB 3WXAA 4AQIA 1ODBA 3O2PA 1BR1B 2SCPA 2YGUA 4INXA 3CR5X 1J7RA 3D78A 2BBMA 1UHHA 1N2DA 5FI7A 1C3YA 3CS1A 1V1FA 1QTXA 1KFUS 3TDZA 1F55A 1EXRA 3LL8B 2LM5A 3PM8A 1DJWA 2KQ6A 1S6CA 1LA0A 2LV7A 2WCJA 3JVTC 4WQ2A 4PALA 1QVIZ 2JT0A 1RROA 3EK4A 1ALWA 3BXKA 1GGZA 2LC5A 4NDBA 2L0PA 2F8PA 3S0GA 2L5XB 3FIAA 2KYCA 1FF1A 2KYFA 4PE7A 1F4QA 1GM0A 5K89A 2B1UA 2G9BA 1A75B 2MLFC 2LP3A 3I5GB 5HLOA 1K95A 1CM1A 3GK2A 1KK8C 1S36A 2EHBA 2ZNDA 3BUXB 1B8RA 2BECA 3O6BA 2M1KB 1JF2A 3BYAA 4P5OE 2EGDA 2L2EA 3BFBA 3LCPC 2JPTA 1Y1UA 3HCMA 1GJYA 1DJIA 1NCYA 2LVVA 2IS9A 2EC6C 5ER5A 4YRUA 1IWQA 1OOFA 1FPWA 4N1GA 3UO9A 2K7OA 1L2OB 1QIWA 2WORA 1S5GY 3IF7A 3R1VA 4GGFA 3CYZA 2WC6A 1K90D 2K7BA 4P2YB 3SJSA 1QX5B 2ZKMX 3R72A 4YGCB 3ZNIA 1TNPA 2JRFA 5JOLA 1OOGA 4GFTA 1DF0B 2M1UA 1CNPA 1TIZA 1J7PA 4ICBA 1XFYO 4GBAA 3ICBA 3K21A 4U8DA 5AERA 1W9ZA 2NCOA 2JNFA 3R1PA 1SPYA 2QEOA 1QIVA 4MN0A 1B8LA 4A4BA 4DS7A 1KFXL 1NPQA 2BL0B 3EG5B 3I5HB 4ORAB 2BBNA 2L4IA 3L4AA 2KBIA 2GGMA 1XA5A 3BFAA 4DIRA 1CFDA 1EJ3A 2KNEA 4BY5A 3FS7A 1K9UA 5KU1A 2O60A 3DF0A 1K9PA 1B4CA 5KTYA 1LA3A 5AFPA 3NGVA 2JQ6A 5KSZA 1IKUA 1JFJA 2LNKA 3TZ1A 3TS5B 3O4XA 1CDLA 1LXFC 2KPHA 3D75A 1KK7Z 1JWDA 2L4HA 1IG5A 1NSHA 2WCFA 1SL8A 3OB1B 4FQTA 1DJYA 1DJXA 3UNWA 2OS8C 3SIAA 1U5IB 4N5XA 4PDZA 2KAVA 3CTNA 3V2LA 1VRKA 3BUNB 1MXLC 1FW4A 1TCOB 1XFUO 1W7IB 3TS5C 2WCMA 1BLQA 1TTXA 3EKJA 2KFHA 1H8BA 1DT7B 1Z2CB 2PYQA 3GK1A 5FYXA 3KO0A 3KPXA 2LVJA 3VGOA 4GAOA 3AAKA 5JJGA 1C07A 2P70A 2Y1MA 4D1EA 2CTNA 3SG2A 3CR2A 1XO5A 4A4CA 5HYDA 1F70A 2ZN8A 1PULA 1SK6D 1QS7A 2I18A 4YI8A 1NCZA 1AK8A 1BODA 1BMOA 3PSRA 2M49B 1BU3A 1ORGA 1UP5A 2F2OA 1QX7A 2L2CA 4R1EA 5G08A 2QDIA 2BCBA 1F54A 2CCMA 3BUMB 2M7LA 1T14A 4DUQA 1WRLA 3SG4A 3IVTA 2AMIA 3CWGA 1LKJA 3OGNA 3SG3A 1K8UA 1CB1A 3IQOA 5CSJA 2SASA 5AXIA 1NYAA 1DQEA 1BR4B 2CT9A 2RGIA 4FQOA 5HL1A 2MA2A 3PATA 1TNWA 1SMGA 1Z4HA 2LHLA 2M9GA 4OKHA 2QACA 2LAPA 1RK9A 2KGRA 4PE1A 4ORCB 5DICA 4DCKA 1MHOA 1NX0A 1OE9B 1Y0VH 1C7VA 3TUYB 4TNCA 4ETOA 5CSNA 3ZWHA 2HQ8A 2K7DA 1KSOA 2L98A 2M29A 2PMYA 5I8NA 3NSLA 4CFQA 3DYEA 2KDHA 4OV2A 1A4PA 1OOHA 2KFFA 3WNXB 4C0LA 2K2AA 1MQ1A 1PALA 3FWBA 1QLSA 5IBWA 1CLBA 4JWQA 5FI2A 1KQMB 3R1OA 3D0YA 5CSIA 4YGBB 3TUYC 3FWCA 1BOCA 1PVBA 2FJYA 3LLEA 1F8HA 2ZNEA 1HT9A 1SKTA 3O78A 4YGDB 2LUXA 2KI6D 2DOQA 2KQYA 1DMOA 2R2IA 3VB1A 4AOMA 1KCYA 2QEVA 4UPGA 1WRZA 4DRWA 1TRFA 3B87A 2BAPA 2K61A 1TNQA 3EVRA 3H4SE 3AAJA 1S6IA 1KQMC 1G8IA 1SYMA 2PVBA 2CNPA 1EG3A 3BOWB 2LHIA 1SL7A 3I5GC 2PSRA 1QASA 1RTP1 2JPOA 1M46A 4NQGA 2HPSA 2I2RE 1G4YR 4NDDA 1YUTA 1WDCB 2Q91A 1SBJA 1TWOA 2KAYA 2KLEA 3DF0B 3VRNA 2F3ZA 2BKIB 2WCBA 3L47A 5PALA 2KHNA 2WCHA 1IH0A 1DC1A 3NHTA 1OW4A 1UHIA 3E3RA 3K1EA 2LMVA 4YGAA 2LMTA 3KF9A 2BNXA 1SCMB 1L2OC 5B8IB 1J7OA 1FI5A 3L4LA 1CFFA 1UHKA 1HQVA 3RM1A 1K2HA 1K9KA 1YX8A 4CLNA 4N1FA 4USLA 4ZCVA 1UHJA 1TUZA 1XFXO 3S0FA 2AUCA 3BUWB 5DKNA 1K96A 1A75A 1N0YA 3AKBA 5TNCA 2BE4A 2I7AA 2Y5IA 3OX6A 4YBHB 3WHUB 1IGVA 2L5YA 1CDNA 4XJKB 5HLVA 1DVIA 1S26D 1SCMC 2FCDA 2MRDA 2KAXA 2K2FA 2KI4B 2M0RA 1DGVA 3BFHA 1KSMA 1JUOA 4FTGA 2A4JA 3EKHA 4M2QA 2LVIA 1CLMA 1XK4C 1XFVO 2BL0C 2HETA 3I5HC 1CTRA 3KEVA 4INWA 4I5KA 1NUBA 3OB2B 1ZACA 2K7CA 3VRRA 2NXQA 1AJ4A 1YX7A 2BCXA 2LCPA 5J3XA 3S0EA 2K60A 1F71A 3PM2A 1WRKA 2JT3A 3PALA 1CKKA 3DY9A 3D73A 1W7JB 4YGEB 3EVUA 3C1VA 1B47A 3PN7B 2HF5A 3QRXA 2PASA 3FE8A 4JD9A 2ZFDA 3KHEA 4GGNA 3PJIA 1YUUA 3CZ0A 4HREE 4MEWA 3JTDB 4PT1A 4WQ3A 1NCXA 1DF0A 2LLUA 2ZN9A 1J55A 4M2OA 2H2KA 1QX2A 1LS8A 1YVHA 1DEKA 1A03A 1BF5A 2LLTA 1K94A 4HRGA 1JSAA 2JZIA 4MRYA 1SR6B 1QWVA 2ZRSA 3PFVA 3DZTA 3OP0A 1AP4A 1IJ5A 1BJFA 1B7TZ 1Y6WA 1PK0D 2JWWA 1IRJA 3EK7A 1KFUL 2WCKA 2WC5A 1QVIY 1IQ5A 1V1GA 1OSAA 2F3YA 2MLEC 3B86A 1F4OA 1R6PA 3M0WA 1JBAA 1SRAA 1QLKA 1YRUB 5CSFA 2M97A 4PHMA 5HKWA 5I2QA 3F45A 5I94A 1KFXS 1TOPA 1NX3A 3D10A 4MLWA 2PALA 4ORBB 2K8MB 2NZ0A 3A4UB 1J1DA 4JKTA 1YRTB 1YURA 4MBEA 4ZCUA 2V53A 3GOFA 4PE0A 4HRHA 4Q04A 1QV0A 1JC2A 1A29A 3RLZA 2D8NA 3DVMA 2KI6C 2MHHA 2GGZA 3D0YB 3NSOA 5F6TA 2PRUA 3CR4X 2ERBA 4MSPA 1U5IA 3I5FB 1MXEA 1XYDA 2FCEA 1XFZO 2TN4A 1UWOA 1M39A 1DELA 3S0BA 1UHNA 4I5NB 3B88A 1B9AA 4I5JA 2CBLA 1IJ6A 3NSKA 4GNKB 3D76A 2VRGA 4GUKA 5EL2A 1A2XA 2HQWA 1FBVA 1NX2A 3I5FC 2MJWB 4CFRA 3TDIA 1WLMA 1JFKA 4YI9A 1CDMA 4JQ0D 1JF0A 2LANA 5D3OA 1PRWA 1CFCA 3BUOB 3CLNA 2LVKA 3CZ2A 5ER4X 1N65A 1MUXA 2ZRTA 3SG7A 1ZFSA 1J1EA 1EG4A 1KWOB 1AJ5A 5HKYA 2COLB 2M3WA 1EH2A 1WLZA 3I5IB 2P6BB 5DKRA 1UURA 2OTGB 2Q4UA 1KK8B 4XYNA 2JC2A 3GK4X 4MVFA 2KGBC 1J7QA 1XFWO 1M31A 1SL9A 4GGFC 1OZOA 2H8VA 1GGWA 3EK8A 2P71A 1AVSA 1ZMZA 1KK7Y 3A8RA 4PHJA 4AQJA 2EC6B 4GPLB 1PVAA 3NSIA 1KWOC 2QPTA 1BT6A 3B7AA 4I5LB 3I5IC 1B8CA 2OTGC 3DXLA 1YVLA 1TCFA 1DTLA 5DKQA 2I94A 1RWYA 3BJHA 3S0DA 1S3PA 4F0ZB 2BCAA 2KSPA 3SS5A 1IIOA 1B1GA 1KQVA 4PHNA 4WRIA 2FJUB 1DJGA 1MF8B 1WDCC 3BQ3A 4IL1A 3SS4A 3SIBA 5BPJA 4HSZA 1ZOTB 1RECA 2LP2A 1TNXA 2LMUA 1Q80A 1SSEB 1YR5A 4NDCA 3DVEA 3CDNA 1X02A 1AUIB 1B7TY 1OOIX 2GV5A 2MBXA 3NXAA 2AAOA 3IQQA 2WOSA 1SCVA 1CFPA 2CXJA 3EVVA 3CZTX 1CLLA 1K93D 1GQMA 2BKHB 3QMEA 4MZKA 4OZDA 1SW8A 1Y1AA 5D7FA 1M63B 3DD4A 2MAZA 2QEHA 4MRXA 5I2OA 1MWNA 4CPVA 2NCPA 1YUSA 1NX1A 1LINA 2LLSA 3D74A 2PQLA 4M2PA 4MZJA 1SY9A 2E6WA 5CPVA 4JPZB 3BOWA 2LE9B 5AEQA 3MSEB 3TDUA 1SNLA 2L50A 1OZSA 3Q8IA 4QJ3B 2M8UA 3LK0A 2KI4C 3S0AA 1WY9A 1ALVA 1CM4A 2OS8B 1NIWA 1BG1A 4C0KA 1OQPA 1XVJA 1G33A 1M45A 3OX5A 2KOTA 4F7FA 1H4BA 1CMFA 1MR8A 5AANA 4QJ5B 3RZSA 1RFJA 1EL4A 2BE6A 5D69A 1C7WA 1DGUA 2H61C 1D1OA 1AHRA 1DJZA 1PSRA 2GTEA 5I2LA 2L51A 1S5GZ 2JT8A 4OR9B 2ISDA
chains in the Genus database with same CATH topology
1DJHA 2JU0A 4BY4A 1S6JA 3PN7C 1PSBA 1XK4A 2F33A 4PHKA 1NP8A 3JTDC 5GQQC 4OVNF 2WC8A 1NWDA 3DVJA 3HX4A 3O4YA 4PE4A 2KBMA 3AKAA 4MZLA 4XJKA 1SR6C 2JTTA 2NLNA 1UUSA 3SG6A 2E30A 2JXCA 4QJ4B 2G2BA 1OOJA 1OMRA 1QXPA 1RJVA 2Y4QA 2F2PA 5HKZA 1YTZC 2H61A 2JULA 1OMVA 2LUCA 1CDPA 2JTZA 3VRQA 2FOTA 1LVCD 3DVKA 1QV1A 4CIDA 3CGAA 1TN4A 2K0JA 3LK1A 4OCIA 1QATA 1IQ3A 4E68A 2WCEA 1QJTA 1L7ZA 2Y1NA 4L9MA 2OPOA 2KFGA 1E8AA 1OMDA 2O5GA 1R2UA 2WNDA 3SG5A 4C0JA 3VRPA 1S1EA 1FI6A 1Y1XA 2JNXA 2M7NA 3PLFB 2JXLA 3JVTB 3WHTB 3VROA 2JOJA 4PCWA 1ZUZA 3OHMB 3WXAA 4AQIA 1ODBA 3O2PA 1BR1B 2SCPA 3CR5X 1J7RA 2BBMA 1UHHA 1N2DA 3CS1A 1V1FA 1QTXA 1KFUS 3TDZA 1F55A 1EXRA 3LL8B 2LM5A 3PM8A 1DJWA 2KQ6A 1S6CA 1LA0A 2LV7A 3JVTC 4WQ2A 4PALA 1QVIZ 2JT0A 1RROA 3EK4A 1ALWA 3BXKA 1GGZA 2LC5A 4NDBA 2L0PA 2F8PA 2L5XB 3FIAA 2KYCA 1FF1A 2KYFA 4PE7A 1F4QA 5K89A 2B1UA 2G9BA 1A75B 2MLFC 2LP3A 3I5GB 5HLOA 1K95A 1CM1A 3GK2A 1KK8C 1S36A 2EHBA 2ZNDA 3BUXB 1B8RA 2BECA 3O6BA 2M1KB 1JF2A 3BYAA 4P5OE 2EGDA 2L2EA 3LCPC 2JPTA 1Y1UA 3HCMA 1GJYA 1DJIA 1NCYA 2LVVA 2IS9A 2EC6C 5ER5A 4YRUA 1IWQA 1FPWA 4N1GA 2K7OA 1L2OB 1QIWA 2WORA 1S5GY 3IF7A 4GGFA 1K90D 2K7BA 4P2YB 3SJSA 1QX5B 2ZKMX 4YGCB 3ZNIA 1TNPA 2JRFA 5JOLA 4GFTA 1DF0B 2M1UA 1CNPA 1TIZA 1J7PA 4ICBA 1XFYO 4GBAA 3ICBA 3K21A 4U8DA 5AERA 2NCOA 2JNFA 1SPYA 4A4BA 1QIVA 4MN0A 1B8LA 4DS7A 1KFXL 1NPQA 2BL0B 3I5HB 4ORAB 2BBNA 2L4IA 2KBIA 2GGMA 1XA5A 4DIRA 1CFDA 1EJ3A 2KNEA 4BY5A 3FS7A 1K9UA 5KU1A 2O60A 3DF0A 1K9PA 1B4CA 5KTYA 1LA3A 5AFPA 1JFJA 2JQ6A 5KSZA 1IKUA 2LNKA 3TZ1A 3TS5B 1CDLA 1LXFC 1KK7Z 1JWDA 2L4HA 1IG5A 1NSHA 2WCFA 1SL8A 3OB1B 1DJYA 1DJXA 2OS8C 3SIAA 1U5IB 4N5XA 4PDZA 2KAVA 3CTNA 1VRKA 3BUNB 1MXLC 1FW4A 1TCOB 1W7IB 1XFUO 3TS5C 1BLQA 1TTXA 3EKJA 2KFHA 1H8BA 1DT7B 3GK1A 5FYXA 3KO0A 3KPXA 2LVJA 3VGOA 4GAOA 3AAKA 5JJGA 1C07A 2Y1MA 4D1EA 2CTNA 3SG2A 3CR2A 1XO5A 4A4CA 5HYDA 1F70A 2ZN8A 1PULA 1SK6D 1QS7A 2I18A 4YI8A 1NCZA 1AK8A 1BODA 1BMOA 3PSRA 2M49B 1BU3A 1UP5A 2F2OA 1QX7A 4R1EA 5G08A 1F54A 2BCBA 2CCMA 3BUMB 2M7LA 4DUQA 1WRLA 3SG4A 2AMIA 3CWGA 1LKJA 3SG3A 1K8UA 1CB1A 3IQOA 5CSJA 2SASA 5AXIA 1NYAA 1BR4B 2CT9A 2RGIA 4FQOA 2MA2A 3PATA 1TNWA 1SMGA 2LHLA 2M9GA 4OKHA 2QACA 2LAPA 1RK9A 2KGRA 4PE1A 4ORCB 4DCKA 1MHOA 1NX0A 1OE9B 1Y0VH 1C7VA 3TUYB 4TNCA 4ETOA 5CSNA 3ZWHA 2HQ8A 2K7DA 1KSOA 2L98A 2M29A 2PMYA 5I8NA 3NSLA 4CFQA 2KDHA 4OV2A 1A4PA 2KFFA 3WNXB 4C0LA 2K2AA 1MQ1A 1PALA 3FWBA 1QLSA 5IBWA 1CLBA 4JWQA 1KQMB 3D0YA 5CSIA 4YGBB 3TUYC 3FWCA 1BOCA 1PVBA 3LLEA 1F8HA 2ZNEA 1HT9A 1SKTA 3O78A 4YGDB 2LUXA 2KI6D 2DOQA 2KQYA 1DMOA 2R2IA 4AOMA 1KCYA 4UPGA 1WRZA 4DRWA 1TRFA 2K61A 1TNQA 3EVRA 3H4SE 3AAJA 1S6IA 1KQMC 1G8IA 1SYMA 2PVBA 2CNPA 1EG3A 3BOWB 2LHIA 1SL7A 3I5GC 2PSRA 1QASA 1RTP1 1M46A 4NQGA 2HPSA 2I2RE 1G4YR 4NDDA 1YUTA 1WDCB 2Q91A 1SBJA 2KAYA 3DF0B 3VRNA 2F3ZA 2BKIB 2WCBA 5PALA 2KHNA 1IH0A 1UHIA 3E3RA 2LMVA 4YGAA 2LMTA 3KF9A 5B8IB 1SCMB 1L2OC 1J7OA 1FI5A 1CFFA 1UHKA 1HQVA 3RM1A 1K2HA 1K9KA 1YX8A 4CLNA 4N1FA 4USLA 4ZCVA 1UHJA 1XFXO 2AUCA 3BUWB 5DKNA 1K96A 1A75A 1N0YA 3AKBA 5TNCA 2BE4A 2I7AA 2Y5IA 3OX6A 4YBHB 3WHUB 1IGVA 1CDNA 4XJKB 5HLVA 1DVIA 1S26D 1SCMC 2FCDA 2MRDA 2KAXA 2K2FA 2KI4B 2M0RA 1DGVA 1KSMA 1JUOA 4FTGA 2A4JA 3EKHA 4M2QA 2LVIA 1CLMA 1XK4C 1XFVO 2BL0C 2HETA 3I5HC 1CTRA 3KEVA 4I5KA 1NUBA 3OB2B 1ZACA 2K7CA 3VRRA 2NXQA 1AJ4A 1YX7A 2BCXA 2LCPA 5J3XA 1F71A 1WRKA 2JT3A 3PALA 1CKKA 4YGEB 1W7JB 3EVUA 3C1VA 1B47A 3PN7B 2HF5A 3QRXA 2PASA 2ZFDA 3KHEA 4GGNA 4HREE 1YUUA 4MEWA 4WQ3A 3JTDB 1NCXA 1DF0A 2LLUA 2ZN9A 1J55A 4M2OA 2H2KA 1QX2A 1YVHA 1A03A 1BF5A 2LLTA 1K94A 4HRGA 1JSAA 2JZIA 4MRYA 1SR6B 2ZRSA 3PFVA 3OP0A 1AP4A 1IJ5A 1BJFA 1B7TZ 1Y6WA 1PK0D 2JWWA 1IRJA 3EK7A 1KFUL 1QVIY 1IQ5A 1V1GA 1OSAA 2F3YA 2MLEC 3M0WA 1F4OA 1R6PA 1JBAA 1SRAA 1QLKA 1YRUB 5CSFA 2M97A 4PHMA 5HKWA 5I2QA 3F45A 1KFXS 1TOPA 1NX3A 3D10A 4MLWA 2PALA 4ORBB 2K8MB 2NZ0A 3A4UB 1J1DA 4MBEA 1YRTB 1YURA 4ZCUA 1CMGA 2V53A 3GOFA 4PE0A 4HRHA 4Q04A 1QV0A 1A29A 3RLZA 2D8NA 3DVMA 2KI6C 2MHHA 2GGZA 3D0YB 3NSOA 5F6TA 2PRUA 3CR4X 4MSPA 1U5IA 3I5FB 1MXEA 1XYDA 2FCEA 1XFZO 2TN4A 1UWOA 1M39A 1UHNA 4I5NB 1B9AA 4I5JA 2CBLA 1IJ6A 3NSKA 4GNKB 2VRGA 4GUKA 1A2XA 2HQWA 1FBVA 1NX2A 3I5FC 2MJWB 4CFRA 3TDIA 1WLMA 1JFKA 4YI9A 1CDMA 4JQ0D 1JF0A 2LANA 1PRWA 1CFCA 3BUOB 3CLNA 2LVKA 5ER4X 1N65A 1MUXA 2ZRTA 3SG7A 1ZFSA 1J1EA 1EG4A 1KWOB 1AJ5A 5HKYA 2COLB 2M3WA 1EH2A 1WLZA 3I5IB 2P6BB 5DKRA 1UURA 2OTGB 2Q4UA 1KK8B 4XYNA 2JC2A 3GK4X 4MVFA 2KGBC 1J7QA 1XFWO 1M31A 1SL9A 4GGFC 1OZOA 1GGWA 3EK8A 1AVSA 1ZMZA 1KK7Y 3A8RA 4PHJA 4AQJA 2EC6B 4GPLB 1PVAA 3NSIA 1KWOC 2QPTA 1BT6A 4I5LB 3I5IC 1B8CA 2OTGC 1YVLA 1TCFA 1DTLA 5DKQA 2I94A 1RWYA 1S3PA 4F0ZB 2BCAA 2KSPA 1B1GA 1KQVA 4PHNA 4WRIA 2FJUB 1DJGA 1MF8B 1WDCC 3BQ3A 4IL1A 3SIBA 5BPJA 4HSZA 1ZOTB 1RECA 2LP2A 1TNXA 2LMUA 1Q80A 1YR5A 4NDCA 3DVEA 1X02A 1AUIB 1B7TY 2GV5A 2MBXA 3NXAA 2AAOA 3IQQA 2WOSA 1SCVA 1CFPA 2CXJA 3EVVA 3CZTX 1CLLA 1K93D 1GQMA 2BKHB 4MZKA 5D7FA 1SW8A 1Y1AA 1M63B 3DD4A 2MAZA 5I2OA 4MRXA 1MWNA 4CPVA 2NCPA 1YUSA 1NX1A 1LINA 2LLSA 4MZJA 4M2PA 1SY9A 2E6WA 5CPVA 4JPZB 3BOWA 2LE9B 5AEQA 3MSEB 3TDUA 1SNLA 2L50A 1OZSA 4QJ3B 2M8UA 3LK0A 2KI4C 1WY9A 1ALVA 1CM4A 2OS8B 1NIWA 1BG1A 4C0KA 1OQPA 1XVJA 1G33A 1M45A 3OX5A 2KOTA 1H4BA 1CMFA 1MR8A 5AANA 4QJ5B 1RFJA 1EL4A 2BE6A 5D69A 1C7WA 1DGUA 2H61C 1D1OA 1AHRA 1DJZA 1PSRA 5I2LA 1JC2A 2L51A 1S5GZ 2JT8A 4OR9B 2ISDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJH A;  2JU0 A;  4BY4 A;  1S6J A;  3PN7 C;  1PSB A;  1XK4 A;  2F33 A;  4PHK A;  1NP8 A;  3JTD C;  5GQQ C;  4OVN F;  2WC8 A;  1NWD A;  3DVJ A;  3HX4 A;  3O4Y A;  4PE4 A;  2KBM A;  3AKA A;  4MZL A;  4XJK A;  1SR6 C;  2JTT A;  2NLN A;  1UUS A;  3SG6 A;  2E30 A;  2JXC A;  4QJ4 B;  2G2B A;  1OOJ A;  1OMR A;  1QXP A;  1RJV A;  2Y4Q A;  2F2P A;  5HKZ A;  1YTZ C;  2H61 A;  2JUL A;  1OMV A;  2LUC A;  1CDP A;  2JTZ A;  3VRQ A;  2FOT A;  1LVC D;  3DVK A;  1QV1 A;  4CID A;  3CGA A;  1TN4 A;  2K0J A;  3LK1 A;  4OCI A;  1QAT A;  1IQ3 A;  4E68 A;  2WCE A;  1QJT A;  1L7Z A;  2Y1N A;  4L9M A;  2OPO A;  2KFG A;  1E8A A;  1OMD A;  2O5G A;  1R2U A;  2WND A;  3SG5 A;  4C0J A;  3VRP A;  1S1E A;  1FI6 A;  1Y1X A;  2JNX A;  2M7N A;  3PLF B;  2JXL A;  3JVT B;  3WHT B;  3VRO A;  2JOJ A;  4PCW A;  1ZUZ A;  3OHM B;  3WXA A;  4AQI A;  1ODB A;  3O2P A;  1BR1 B;  2SCP A;  3CR5 X;  1J7R A;  2BBM A;  1UHH A;  1N2D A;  3CS1 A;  1V1F A;  1QTX A;  1KFU S;  3TDZ A;  1F55 A;  1EXR A;  3LL8 B;  2LM5 A;  3PM8 A;  1DJW A;  2KQ6 A;  1S6C A;  1LA0 A;  2LV7 A;  3JVT C;  4WQ2 A;  4PAL A;  1QVI Z;  2JT0 A;  1RRO A;  3EK4 A;  1ALW A;  3BXK A;  1GGZ A;  2LC5 A;  4NDB A;  2L0P A;  2F8P A;  2L5X B;  3FIA A;  2KYC A;  1FF1 A;  2KYF A;  4PE7 A;  1F4Q A;  5K89 A;  2B1U A;  2G9B A;  1A75 B;  2MLF C;  2LP3 A;  3I5G B;  5HLO A;  1K95 A;  1CM1 A;  3GK2 A;  1KK8 C;  1S36 A;  2EHB A;  2ZND A;  3BUX B;  1B8R A;  2BEC A;  3O6B A;  2M1K B;  1JF2 A;  3BYA A;  4P5O E;  2EGD A;  2L2E A;  3LCP C;  2JPT A;  1Y1U A;  3HCM A;  1GJY A;  1DJI A;  1NCY A;  2LVV A;  2IS9 A;  2EC6 C;  5ER5 A;  4YRU A;  1IWQ A;  1FPW A;  4N1G A;  2K7O A;  1L2O B;  1QIW A;  2WOR A;  1S5G Y;  3IF7 A;  4GGF A;  1K90 D;  2K7B A;  4P2Y B;  3SJS A;  1QX5 B;  2ZKM X;  4YGC B;  3ZNI A;  1TNP A;  2JRF A;  5JOL A;  4GFT A;  1DF0 B;  2M1U A;  1CNP A;  1TIZ A;  1J7P A;  4ICB A;  1XFY O;  4GBA A;  3ICB A;  3K21 A;  4U8D A;  5AER A;  2NCO A;  2JNF A;  1SPY A;  4A4B A;  1QIV A;  4MN0 A;  1B8L A;  4DS7 A;  1KFX L;  1NPQ A;  2BL0 B;  3I5H B;  4ORA B;  2BBN A;  2L4I A;  2KBI A;  2GGM A;  1XA5 A;  4DIR A;  1CFD A;  1EJ3 A;  2KNE A;  4BY5 A;  3FS7 A;  1K9U A;  5KU1 A;  2O60 A;  3DF0 A;  1K9P A;  1B4C A;  5KTY A;  1LA3 A;  5AFP A;  1JFJ A;  2JQ6 A;  5KSZ A;  1IKU A;  2LNK A;  3TZ1 A;  3TS5 B;  1CDL A;  1LXF C;  1KK7 Z;  1JWD A;  2L4H A;  1IG5 A;  1NSH A;  2WCF A;  1SL8 A;  3OB1 B;  1DJY A;  1DJX A;  2OS8 C;  3SIA A;  1U5I B;  4N5X A;  4PDZ A;  2KAV A;  3CTN A;  1VRK A;  3BUN B;  1MXL C;  1FW4 A;  1TCO B;  1W7I B;  1XFU O;  3TS5 C;  1BLQ A;  1TTX A;  3EKJ A;  2KFH A;  1H8B A;  1DT7 B;  3GK1 A;  5FYX A;  3KO0 A;  3KPX A;  2LVJ A;  3VGO A;  4GAO A;  3AAK A;  5JJG A;  1C07 A;  2Y1M A;  4D1E A;  2CTN A;  3SG2 A;  3CR2 A;  1XO5 A;  4A4C A;  5HYD A;  1F70 A;  2ZN8 A;  1PUL A;  1SK6 D;  1QS7 A;  2I18 A;  4YI8 A;  1NCZ A;  1AK8 A;  1BOD A;  1BMO A;  3PSR A;  2M49 B;  1BU3 A;  1UP5 A;  2F2O A;  1QX7 A;  4R1E A;  5G08 A;  1F54 A;  2BCB A;  2CCM A;  3BUM B;  2M7L A;  4DUQ A;  1WRL A;  3SG4 A;  2AMI A;  3CWG A;  1LKJ A;  3SG3 A;  1K8U A;  1CB1 A;  3IQO A;  5CSJ A;  2SAS A;  5AXI A;  1NYA A;  1BR4 B;  2CT9 A;  2RGI A;  4FQO A;  2MA2 A;  3PAT A;  1TNW A;  1SMG A;  2LHL A;  2M9G A;  4OKH A;  2QAC A;  2LAP A;  1RK9 A;  2KGR A;  4PE1 A;  4ORC B;  4DCK A;  1MHO A;  1NX0 A;  1OE9 B;  1Y0V H;  1C7V A;  3TUY B;  4TNC A;  4ETO A;  5CSN A;  3ZWH A;  2HQ8 A;  2K7D A;  1KSO A;  2L98 A;  2M29 A;  2PMY A;  5I8N A;  3NSL A;  4CFQ A;  2KDH A;  4OV2 A;  1A4P A;  2KFF A;  3WNX B;  4C0L A;  2K2A A;  1MQ1 A;  1PAL A;  3FWB A;  1QLS A;  5IBW A;  1CLB A;  4JWQ A;  1KQM B;  3D0Y A;  5CSI A;  4YGB B;  3TUY C;  3FWC A;  1BOC A;  1PVB A;  3LLE A;  1F8H A;  2ZNE A;  1HT9 A;  1SKT A;  3O78 A;  4YGD B;  2LUX A;  2KI6 D;  2DOQ A;  2KQY A;  1DMO A;  2R2I A;  4AOM A;  1KCY A;  4UPG A;  1WRZ A;  4DRW A;  1TRF A;  2K61 A;  1TNQ A;  3EVR A;  3H4S E;  3AAJ A;  1S6I A;  1KQM C;  1G8I A;  1SYM A;  2PVB A;  2CNP A;  1EG3 A;  3BOW B;  2LHI A;  1SL7 A;  3I5G C;  2PSR A;  1QAS A;  1RTP 1;  1M46 A;  4NQG A;  2HPS A;  2I2R E;  1G4Y R;  4NDD A;  1YUT A;  1WDC B;  2Q91 A;  1SBJ A;  2KAY A;  3DF0 B;  3VRN A;  2F3Z A;  2BKI B;  2WCB A;  5PAL A;  2KHN A;  1IH0 A;  1UHI A;  3E3R A;  2LMV A;  4YGA A;  2LMT A;  3KF9 A;  5B8I B;  1SCM B;  1L2O C;  1J7O A;  1FI5 A;  1CFF A;  1UHK A;  1HQV A;  3RM1 A;  1K2H A;  1K9K A;  1YX8 A;  4CLN A;  4N1F A;  4USL A;  4ZCV A;  1UHJ A;  1XFX O;  2AUC A;  3BUW B;  5DKN A;  1K96 A;  1A75 A;  1N0Y A;  3AKB A;  5TNC A;  2BE4 A;  2I7A A;  2Y5I A;  3OX6 A;  4YBH B;  3WHU B;  1IGV A;  1CDN A;  4XJK B;  5HLV A;  1DVI A;  1S26 D;  1SCM C;  2FCD A;  2MRD A;  2KAX A;  2K2F A;  2KI4 B;  2M0R A;  1DGV A;  1KSM A;  1JUO A;  4FTG A;  2A4J A;  3EKH A;  4M2Q A;  2LVI A;  1CLM A;  1XK4 C;  1XFV O;  2BL0 C;  2HET A;  3I5H C;  1CTR A;  3KEV A;  4I5K A;  1NUB A;  3OB2 B;  1ZAC A;  2K7C A;  3VRR A;  2NXQ A;  1AJ4 A;  1YX7 A;  2BCX A;  2LCP A;  5J3X A;  1F71 A;  1WRK A;  2JT3 A;  3PAL A;  1CKK A;  4YGE B;  1W7J B;  3EVU A;  3C1V A;  1B47 A;  3PN7 B;  2HF5 A;  3QRX A;  2PAS A;  2ZFD A;  3KHE A;  4GGN A;  4HRE E;  1YUU A;  4MEW A;  4WQ3 A;  3JTD B;  1NCX A;  1DF0 A;  2LLU A;  2ZN9 A;  1J55 A;  4M2O A;  2H2K A;  1QX2 A;  1YVH A;  1A03 A;  1BF5 A;  2LLT A;  1K94 A;  4HRG A;  1JSA A;  2JZI A;  4MRY A;  1SR6 B;  2ZRS A;  3PFV A;  3OP0 A;  1AP4 A;  1IJ5 A;  1BJF A;  1B7T Z;  1Y6W A;  1PK0 D;  2JWW A;  1IRJ A;  3EK7 A;  1KFU L;  1QVI Y;  1IQ5 A;  1V1G A;  1OSA A;  2F3Y A;  2MLE C;  3M0W A;  1F4O A;  1R6P A;  1JBA A;  1SRA A;  1QLK A;  1YRU B;  5CSF A;  2M97 A;  4PHM A;  5HKW A;  5I2Q A;  3F45 A;  1KFX S;  1TOP A;  1NX3 A;  3D10 A;  4MLW A;  2PAL A;  4ORB B;  2K8M B;  2NZ0 A;  3A4U B;  1J1D A;  4MBE A;  1YRT B;  1YUR A;  4ZCU A;  1CMG A;  2V53 A;  3GOF A;  4PE0 A;  4HRH A;  4Q04 A;  1QV0 A;  1A29 A;  3RLZ A;  2D8N A;  3DVM A;  2KI6 C;  2MHH A;  2GGZ A;  3D0Y B;  3NSO A;  5F6T A;  2PRU A;  3CR4 X;  4MSP A;  1U5I A;  3I5F B;  1MXE A;  1XYD A;  2FCE A;  1XFZ O;  2TN4 A;  1UWO A;  1M39 A;  1UHN A;  4I5N B;  1B9A A;  4I5J A;  2CBL A;  1IJ6 A;  3NSK A;  4GNK B;  2VRG A;  4GUK A;  1A2X A;  2HQW A;  1FBV A;  1NX2 A;  3I5F C;  2MJW B;  4CFR A;  3TDI A;  1WLM A;  1JFK A;  4YI9 A;  1CDM A;  4JQ0 D;  1JF0 A;  2LAN A;  1PRW A;  1CFC A;  3BUO B;  3CLN A;  2LVK A;  5ER4 X;  1N65 A;  1MUX A;  2ZRT A;  3SG7 A;  1ZFS A;  1J1E A;  1EG4 A;  1KWO B;  1AJ5 A;  5HKY A;  2COL B;  2M3W A;  1EH2 A;  1WLZ A;  3I5I B;  2P6B B;  5DKR A;  1UUR A;  2OTG B;  2Q4U A;  1KK8 B;  4XYN A;  2JC2 A;  3GK4 X;  4MVF A;  2KGB C;  1J7Q A;  1XFW O;  1M31 A;  1SL9 A;  4GGF C;  1OZO A;  1GGW A;  3EK8 A;  1AVS A;  1ZMZ A;  1KK7 Y;  3A8R A;  4PHJ A;  4AQJ A;  2EC6 B;  4GPL B;  1PVA A;  3NSI A;  1KWO C;  2QPT A;  1BT6 A;  4I5L B;  3I5I C;  1B8C A;  2OTG C;  1YVL A;  1TCF A;  1DTL A;  5DKQ A;  2I94 A;  1RWY A;  1S3P A;  4F0Z B;  2BCA A;  2KSP A;  1B1G A;  1KQV A;  4PHN A;  4WRI A;  2FJU B;  1DJG A;  1MF8 B;  1WDC C;  3BQ3 A;  4IL1 A;  3SIB A;  5BPJ A;  4HSZ A;  1ZOT B;  1REC A;  2LP2 A;  1TNX A;  2LMU A;  1Q80 A;  1YR5 A;  4NDC A;  3DVE A;  1X02 A;  1AUI B;  1B7T Y;  2GV5 A;  2MBX A;  3NXA A;  2AAO A;  3IQQ A;  2WOS A;  1SCV A;  1CFP A;  2CXJ A;  3EVV A;  3CZT X;  1CLL A;  1K93 D;  1GQM A;  2BKH B;  4MZK A;  5D7F A;  1SW8 A;  1Y1A A;  1M63 B;  3DD4 A;  2MAZ A;  5I2O A;  4MRX A;  1MWN A;  4CPV A;  2NCP A;  1YUS A;  1NX1 A;  1LIN A;  2LLS A;  4MZJ A;  4M2P A;  1SY9 A;  2E6W A;  5CPV A;  4JPZ B;  3BOW A;  2LE9 B;  5AEQ A;  3MSE B;  3TDU A;  1SNL A;  2L50 A;  1OZS A;  4QJ3 B;  2M8U A;  3LK0 A;  2KI4 C;  1WY9 A;  1ALV A;  1CM4 A;  2OS8 B;  1NIW A;  1BG1 A;  4C0K A;  1OQP A;  1XVJ A;  1G33 A;  1M45 A;  3OX5 A;  2KOT A;  1H4B A;  1CMF A;  1MR8 A;  5AAN A;  4QJ5 B;  1RFJ A;  1EL4 A;  2BE6 A;  5D69 A;  1C7W A;  1DGU A;  2H61 C;  1D1O A;  1AHR A;  1DJZ A;  1PSR A;  5I2L A;  1JC2 A;  2L51 A;  1S5G Z;  2JT8 A;  4OR9 B;  2ISD A; 
#chains in the Genus database with same CATH topology
 1DJH A;  2JU0 A;  4BY4 A;  1S6J A;  3PN7 C;  1PSB A;  1TUJ A;  1XK4 A;  2F33 A;  3FE9 A;  4PHK A;  1NP8 A;  3D77 A;  3JTD C;  5GQQ C;  1P28 A;  4OVN F;  2WC8 A;  1NWD A;  3DVJ A;  3HX4 A;  3O4Y A;  4PE4 A;  2KBM A;  3AKA A;  4MZL A;  4XJK A;  3CAB A;  1SR6 C;  2JTT A;  2NLN A;  1UUS A;  3FE6 A;  4KYN A;  3SG6 A;  2E30 A;  2JXC A;  2KLD A;  4QJ4 B;  2G2B A;  1OOJ A;  2WCL A;  3OBV A;  1OMR A;  1QXP A;  1RJV A;  2Y4Q A;  2F2P A;  5HKZ A;  1C3Z A;  1YTZ C;  2H61 A;  2JUL A;  3NHI A;  1OMV A;  2LUC A;  1CDP A;  2JTZ A;  3VRQ A;  3SS3 A;  2FOT A;  1LVC D;  3DVK A;  1QV1 A;  4CID A;  3CGA A;  1TN4 A;  2K0J A;  3LK1 A;  4OCI A;  2QEB A;  1QAT A;  1IQ3 A;  5FI6 A;  4E68 A;  2WCE A;  1QJT A;  1L7Z A;  2Y1N A;  4L9M A;  2OPO A;  2KFG A;  4IJ7 A;  1E8A A;  1OMD A;  1CMG A;  2O5G A;  1XFR A;  1R2U A;  3CZ1 A;  2WND A;  3SG5 A;  4C0J A;  3VRP A;  1S1E A;  3B6X A;  1FI6 A;  1Y1X A;  2JNX A;  2M7N A;  3N7H A;  2JXL A;  3PLF B;  3JVT B;  3WHT B;  3VRO A;  2JOJ A;  4PCW A;  1ZUZ A;  3OHM B;  3WXA A;  4AQI A;  1ODB A;  3O2P A;  1BR1 B;  2SCP A;  2YGU A;  4INX A;  3CR5 X;  1J7R A;  3D78 A;  2BBM A;  1UHH A;  1N2D A;  5FI7 A;  1C3Y A;  3CS1 A;  1V1F A;  1QTX A;  1KFU S;  3TDZ A;  1F55 A;  1EXR A;  3LL8 B;  2LM5 A;  3PM8 A;  1DJW A;  2KQ6 A;  1S6C A;  1LA0 A;  2LV7 A;  2WCJ A;  3JVT C;  4WQ2 A;  4PAL A;  1QVI Z;  2JT0 A;  1RRO A;  3EK4 A;  1ALW A;  3BXK A;  1GGZ A;  2LC5 A;  4NDB A;  2L0P A;  2F8P A;  3S0G A;  2L5X B;  3FIA A;  2KYC A;  1FF1 A;  2KYF A;  4PE7 A;  1F4Q A;  1GM0 A;  5K89 A;  2B1U A;  2G9B A;  1A75 B;  2MLF C;  2LP3 A;  3I5G B;  5HLO A;  1K95 A;  1CM1 A;  3GK2 A;  1KK8 C;  1S36 A;  2EHB A;  2ZND A;  3BUX B;  1B8R A;  2BEC A;  3O6B A;  2M1K B;  1JF2 A;  3BYA A;  4P5O E;  2EGD A;  2L2E A;  3BFB A;  3LCP C;  2JPT A;  1Y1U A;  3HCM A;  1GJY A;  1DJI A;  1NCY A;  2LVV A;  2IS9 A;  2EC6 C;  5ER5 A;  4YRU A;  1IWQ A;  1OOF A;  1FPW A;  4N1G A;  3UO9 A;  2K7O A;  1L2O B;  1QIW A;  2WOR A;  1S5G Y;  3IF7 A;  3R1V A;  4GGF A;  3CYZ A;  2WC6 A;  1K90 D;  2K7B A;  4P2Y B;  3SJS A;  1QX5 B;  2ZKM X;  3R72 A;  4YGC B;  3ZNI A;  1TNP A;  2JRF A;  5JOL A;  1OOG A;  4GFT A;  1DF0 B;  2M1U A;  1CNP A;  1TIZ A;  1J7P A;  4ICB A;  1XFY O;  4GBA A;  3ICB A;  3K21 A;  4U8D A;  5AER A;  1W9Z A;  2NCO A;  2JNF A;  3R1P A;  1SPY A;  2QEO A;  1QIV A;  4MN0 A;  1B8L A;  4A4B A;  4DS7 A;  1KFX L;  1NPQ A;  2BL0 B;  3EG5 B;  3I5H B;  4ORA B;  2BBN A;  2L4I A;  3L4A A;  2KBI A;  2GGM A;  1XA5 A;  3BFA A;  4DIR A;  1CFD A;  1EJ3 A;  2KNE A;  4BY5 A;  3FS7 A;  1K9U A;  5KU1 A;  2O60 A;  3DF0 A;  1K9P A;  1B4C A;  5KTY A;  1LA3 A;  5AFP A;  3NGV A;  2JQ6 A;  5KSZ A;  1IKU A;  1JFJ A;  2LNK A;  3TZ1 A;  3TS5 B;  3O4X A;  1CDL A;  1LXF C;  2KPH A;  3D75 A;  1KK7 Z;  1JWD A;  2L4H A;  1IG5 A;  1NSH A;  2WCF A;  1SL8 A;  3OB1 B;  4FQT A;  1DJY A;  1DJX A;  3UNW A;  2OS8 C;  3SIA A;  1U5I B;  4N5X A;  4PDZ A;  2KAV A;  3CTN A;  3V2L A;  1VRK A;  3BUN B;  1MXL C;  1FW4 A;  1TCO B;  1XFU O;  1W7I B;  3TS5 C;  2WCM A;  1BLQ A;  1TTX A;  3EKJ A;  2KFH A;  1H8B A;  1DT7 B;  1Z2C B;  2PYQ A;  3GK1 A;  5FYX A;  3KO0 A;  3KPX A;  2LVJ A;  3VGO A;  4GAO A;  3AAK A;  5JJG A;  1C07 A;  2P70 A;  2Y1M A;  4D1E A;  2CTN A;  3SG2 A;  3CR2 A;  1XO5 A;  4A4C A;  5HYD A;  1F70 A;  2ZN8 A;  1PUL A;  1SK6 D;  1QS7 A;  2I18 A;  4YI8 A;  1NCZ A;  1AK8 A;  1BOD A;  1BMO A;  3PSR A;  2M49 B;  1BU3 A;  1ORG A;  1UP5 A;  2F2O A;  1QX7 A;  2L2C A;  4R1E A;  5G08 A;  2QDI A;  2BCB A;  1F54 A;  2CCM A;  3BUM B;  2M7L A;  1T14 A;  4DUQ A;  1WRL A;  3SG4 A;  3IVT A;  2AMI A;  3CWG A;  1LKJ A;  3OGN A;  3SG3 A;  1K8U A;  1CB1 A;  3IQO A;  5CSJ A;  2SAS A;  5AXI A;  1NYA A;  1DQE A;  1BR4 B;  2CT9 A;  2RGI A;  4FQO A;  5HL1 A;  2MA2 A;  3PAT A;  1TNW A;  1SMG A;  1Z4H A;  2LHL A;  2M9G A;  4OKH A;  2QAC A;  2LAP A;  1RK9 A;  2KGR A;  4PE1 A;  4ORC B;  5DIC A;  4DCK A;  1MHO A;  1NX0 A;  1OE9 B;  1Y0V H;  1C7V A;  3TUY B;  4TNC A;  4ETO A;  5CSN A;  3ZWH A;  2HQ8 A;  2K7D A;  1KSO A;  2L98 A;  2M29 A;  2PMY A;  5I8N A;  3NSL A;  4CFQ A;  3DYE A;  2KDH A;  4OV2 A;  1A4P A;  1OOH A;  2KFF A;  3WNX B;  4C0L A;  2K2A A;  1MQ1 A;  1PAL A;  3FWB A;  1QLS A;  5IBW A;  1CLB A;  4JWQ A;  5FI2 A;  1KQM B;  3R1O A;  3D0Y A;  5CSI A;  4YGB B;  3TUY C;  3FWC A;  1BOC A;  1PVB A;  2FJY A;  3LLE A;  1F8H A;  2ZNE A;  1HT9 A;  1SKT A;  3O78 A;  4YGD B;  2LUX A;  2KI6 D;  2DOQ A;  2KQY A;  1DMO A;  2R2I A;  3VB1 A;  4AOM A;  1KCY A;  2QEV A;  4UPG A;  1WRZ A;  4DRW A;  1TRF A;  3B87 A;  2BAP A;  2K61 A;  1TNQ A;  3EVR A;  3H4S E;  3AAJ A;  1S6I A;  1KQM C;  1G8I A;  1SYM A;  2PVB A;  2CNP A;  1EG3 A;  3BOW B;  2LHI A;  1SL7 A;  3I5G C;  2PSR A;  1QAS A;  1RTP 1;  2JPO A;  1M46 A;  4NQG A;  2HPS A;  2I2R E;  1G4Y R;  4NDD A;  1YUT A;  1WDC B;  2Q91 A;  1SBJ A;  1TWO A;  2KAY A;  2KLE A;  3DF0 B;  3VRN A;  2F3Z A;  2BKI B;  2WCB A;  3L47 A;  5PAL A;  2KHN A;  2WCH A;  1IH0 A;  1DC1 A;  3NHT A;  1OW4 A;  1UHI A;  3E3R A;  3K1E A;  2LMV A;  4YGA A;  2LMT A;  3KF9 A;  2BNX A;  1SCM B;  1L2O C;  5B8I B;  1J7O A;  1FI5 A;  3L4L A;  1CFF A;  1UHK A;  1HQV A;  3RM1 A;  1K2H A;  1K9K A;  1YX8 A;  4CLN A;  4N1F A;  4USL A;  4ZCV A;  1UHJ A;  1TUZ A;  1XFX O;  3S0F A;  2AUC A;  3BUW B;  5DKN A;  1K96 A;  1A75 A;  1N0Y A;  3AKB A;  5TNC A;  2BE4 A;  2I7A A;  2Y5I A;  3OX6 A;  4YBH B;  3WHU B;  1IGV A;  2L5Y A;  1CDN A;  4XJK B;  5HLV A;  1DVI A;  1S26 D;  1SCM C;  2FCD A;  2MRD A;  2KAX A;  2K2F A;  2KI4 B;  2M0R A;  1DGV A;  3BFH A;  1KSM A;  1JUO A;  4FTG A;  2A4J A;  3EKH A;  4M2Q A;  2LVI A;  1CLM A;  1XK4 C;  1XFV O;  2BL0 C;  2HET A;  3I5H C;  1CTR A;  3KEV A;  4INW A;  4I5K A;  1NUB A;  3OB2 B;  1ZAC A;  2K7C A;  3VRR A;  2NXQ A;  1AJ4 A;  1YX7 A;  2BCX A;  2LCP A;  5J3X A;  3S0E A;  2K60 A;  1F71 A;  3PM2 A;  1WRK A;  2JT3 A;  3PAL A;  1CKK A;  3DY9 A;  3D73 A;  1W7J B;  4YGE B;  3EVU A;  3C1V A;  1B47 A;  3PN7 B;  2HF5 A;  3QRX A;  2PAS A;  3FE8 A;  4JD9 A;  2ZFD A;  3KHE A;  4GGN A;  3PJI A;  1YUU A;  3CZ0 A;  4HRE E;  4MEW A;  3JTD B;  4PT1 A;  4WQ3 A;  1NCX A;  1DF0 A;  2LLU A;  2ZN9 A;  1J55 A;  4M2O A;  2H2K A;  1QX2 A;  1LS8 A;  1YVH A;  1DEK A;  1A03 A;  1BF5 A;  2LLT A;  1K94 A;  4HRG A;  1JSA A;  2JZI A;  4MRY A;  1SR6 B;  1QWV A;  2ZRS A;  3PFV A;  3DZT A;  3OP0 A;  1AP4 A;  1IJ5 A;  1BJF A;  1B7T Z;  1Y6W A;  1PK0 D;  2JWW A;  1IRJ A;  3EK7 A;  1KFU L;  2WCK A;  2WC5 A;  1QVI Y;  1IQ5 A;  1V1G A;  1OSA A;  2F3Y A;  2MLE C;  3B86 A;  1F4O A;  1R6P A;  3M0W A;  1JBA A;  1SRA A;  1QLK A;  1YRU B;  5CSF A;  2M97 A;  4PHM A;  5HKW A;  5I2Q A;  3F45 A;  5I94 A;  1KFX S;  1TOP A;  1NX3 A;  3D10 A;  4MLW A;  2PAL A;  4ORB B;  2K8M B;  2NZ0 A;  3A4U B;  1J1D A;  4JKT A;  1YRT B;  1YUR A;  4MBE A;  4ZCU A;  2V53 A;  3GOF A;  4PE0 A;  4HRH A;  4Q04 A;  1QV0 A;  1JC2 A;  1A29 A;  3RLZ A;  2D8N A;  3DVM A;  2KI6 C;  2MHH A;  2GGZ A;  3D0Y B;  3NSO A;  5F6T A;  2PRU A;  3CR4 X;  2ERB A;  4MSP A;  1U5I A;  3I5F B;  1MXE A;  1XYD A;  2FCE A;  1XFZ O;  2TN4 A;  1UWO A;  1M39 A;  1DEL A;  3S0B A;  1UHN A;  4I5N B;  3B88 A;  1B9A A;  4I5J A;  2CBL A;  1IJ6 A;  3NSK A;  4GNK B;  3D76 A;  2VRG A;  4GUK A;  5EL2 A;  1A2X A;  2HQW A;  1FBV A;  1NX2 A;  3I5F C;  2MJW B;  4CFR A;  3TDI A;  1WLM A;  1JFK A;  4YI9 A;  1CDM A;  4JQ0 D;  1JF0 A;  2LAN A;  5D3O A;  1PRW A;  1CFC A;  3BUO B;  3CLN A;  2LVK A;  3CZ2 A;  5ER4 X;  1N65 A;  1MUX A;  2ZRT A;  3SG7 A;  1ZFS A;  1J1E A;  1EG4 A;  1KWO B;  1AJ5 A;  5HKY A;  2COL B;  2M3W A;  1EH2 A;  1WLZ A;  3I5I B;  2P6B B;  5DKR A;  1UUR A;  2OTG B;  2Q4U A;  1KK8 B;  4XYN A;  2JC2 A;  3GK4 X;  4MVF A;  2KGB C;  1J7Q A;  1XFW O;  1M31 A;  1SL9 A;  4GGF C;  1OZO A;  2H8V A;  1GGW A;  3EK8 A;  2P71 A;  1AVS A;  1ZMZ A;  1KK7 Y;  3A8R A;  4PHJ A;  4AQJ A;  2EC6 B;  4GPL B;  1PVA A;  3NSI A;  1KWO C;  2QPT A;  1BT6 A;  3B7A A;  4I5L B;  3I5I C;  1B8C A;  2OTG C;  3DXL A;  1YVL A;  1TCF A;  1DTL A;  5DKQ A;  2I94 A;  1RWY A;  3BJH A;  3S0D A;  1S3P A;  4F0Z B;  2BCA A;  2KSP A;  3SS5 A;  1IIO A;  1B1G A;  1KQV A;  4PHN A;  4WRI A;  2FJU B;  1DJG A;  1MF8 B;  1WDC C;  3BQ3 A;  4IL1 A;  3SS4 A;  3SIB A;  5BPJ A;  4HSZ A;  1ZOT B;  1REC A;  2LP2 A;  1TNX A;  2LMU A;  1Q80 A;  1SSE B;  1YR5 A;  4NDC A;  3DVE A;  3CDN A;  1X02 A;  1AUI B;  1B7T Y;  1OOI X;  2GV5 A;  2MBX A;  3NXA A;  2AAO A;  3IQQ A;  2WOS A;  1SCV A;  1CFP A;  2CXJ A;  3EVV A;  3CZT X;  1CLL A;  1K93 D;  1GQM A;  2BKH B;  3QME A;  4MZK A;  4OZD A;  1SW8 A;  1Y1A A;  5D7F A;  1M63 B;  3DD4 A;  2MAZ A;  2QEH A;  4MRX A;  5I2O A;  1MWN A;  4CPV A;  2NCP A;  1YUS A;  1NX1 A;  1LIN A;  2LLS A;  3D74 A;  2PQL A;  4M2P A;  4MZJ A;  1SY9 A;  2E6W A;  5CPV A;  4JPZ B;  3BOW A;  2LE9 B;  5AEQ A;  3MSE B;  3TDU A;  1SNL A;  2L50 A;  1OZS A;  3Q8I A;  4QJ3 B;  2M8U A;  3LK0 A;  2KI4 C;  3S0A A;  1WY9 A;  1ALV A;  1CM4 A;  2OS8 B;  1NIW A;  1BG1 A;  4C0K A;  1OQP A;  1XVJ A;  1G33 A;  1M45 A;  3OX5 A;  2KOT A;  4F7F A;  1H4B A;  1CMF A;  1MR8 A;  5AAN A;  4QJ5 B;  3RZS A;  1RFJ A;  1EL4 A;  2BE6 A;  5D69 A;  1C7W A;  1DGU A;  2H61 C;  1D1O A;  1AHR A;  1DJZ A;  1PSR A;  2GTE A;  5I2L A;  2L51 A;  1S5G Z;  2JT8 A;  4OR9 B;  2ISD A; 
#chains in the Genus database with same CATH homology
 1DJH A;  2JU0 A;  4BY4 A;  1S6J A;  3PN7 C;  1PSB A;  1XK4 A;  2F33 A;  4PHK A;  1NP8 A;  3JTD C;  5GQQ C;  4OVN F;  2WC8 A;  1NWD A;  3DVJ A;  3HX4 A;  3O4Y A;  4PE4 A;  2KBM A;  3AKA A;  4MZL A;  4XJK A;  1SR6 C;  2JTT A;  2NLN A;  1UUS A;  3SG6 A;  2E30 A;  2JXC A;  4QJ4 B;  2G2B A;  1OOJ A;  1OMR A;  1QXP A;  1RJV A;  2Y4Q A;  2F2P A;  5HKZ A;  1YTZ C;  2H61 A;  2JUL A;  1OMV A;  2LUC A;  1CDP A;  2JTZ A;  3VRQ A;  2FOT A;  1LVC D;  3DVK A;  1QV1 A;  4CID A;  3CGA A;  1TN4 A;  2K0J A;  3LK1 A;  4OCI A;  1QAT A;  1IQ3 A;  4E68 A;  2WCE A;  1QJT A;  1L7Z A;  2Y1N A;  4L9M A;  2OPO A;  2KFG A;  1E8A A;  1OMD A;  2O5G A;  1R2U A;  2WND A;  3SG5 A;  4C0J A;  3VRP A;  1S1E A;  1FI6 A;  1Y1X A;  2JNX A;  2M7N A;  3PLF B;  2JXL A;  3JVT B;  3WHT B;  3VRO A;  2JOJ A;  4PCW A;  1ZUZ A;  3OHM B;  3WXA A;  4AQI A;  1ODB A;  3O2P A;  1BR1 B;  2SCP A;  3CR5 X;  1J7R A;  2BBM A;  1UHH A;  1N2D A;  3CS1 A;  1V1F A;  1QTX A;  1KFU S;  3TDZ A;  1F55 A;  1EXR A;  3LL8 B;  2LM5 A;  3PM8 A;  1DJW A;  2KQ6 A;  1S6C A;  1LA0 A;  2LV7 A;  3JVT C;  4WQ2 A;  4PAL A;  1QVI Z;  2JT0 A;  1RRO A;  3EK4 A;  1ALW A;  3BXK A;  1GGZ A;  2LC5 A;  4NDB A;  2L0P A;  2F8P A;  2L5X B;  3FIA A;  2KYC A;  1FF1 A;  2KYF A;  4PE7 A;  1F4Q A;  5K89 A;  2B1U A;  2G9B A;  1A75 B;  2MLF C;  2LP3 A;  3I5G B;  5HLO A;  1K95 A;  1CM1 A;  3GK2 A;  1KK8 C;  1S36 A;  2EHB A;  2ZND A;  3BUX B;  1B8R A;  2BEC A;  3O6B A;  2M1K B;  1JF2 A;  3BYA A;  4P5O E;  2EGD A;  2L2E A;  3LCP C;  2JPT A;  1Y1U A;  3HCM A;  1GJY A;  1DJI A;  1NCY A;  2LVV A;  2IS9 A;  2EC6 C;  5ER5 A;  4YRU A;  1IWQ A;  1FPW A;  4N1G A;  2K7O A;  1L2O B;  1QIW A;  2WOR A;  1S5G Y;  3IF7 A;  4GGF A;  1K90 D;  2K7B A;  4P2Y B;  3SJS A;  1QX5 B;  2ZKM X;  4YGC B;  3ZNI A;  1TNP A;  2JRF A;  5JOL A;  4GFT A;  1DF0 B;  2M1U A;  1CNP A;  1TIZ A;  1J7P A;  4ICB A;  1XFY O;  4GBA A;  3ICB A;  3K21 A;  4U8D A;  5AER A;  2NCO A;  2JNF A;  1SPY A;  4A4B A;  1QIV A;  4MN0 A;  1B8L A;  4DS7 A;  1KFX L;  1NPQ A;  2BL0 B;  3I5H B;  4ORA B;  2BBN A;  2L4I A;  2KBI A;  2GGM A;  1XA5 A;  4DIR A;  1CFD A;  1EJ3 A;  2KNE A;  4BY5 A;  3FS7 A;  1K9U A;  5KU1 A;  2O60 A;  3DF0 A;  1K9P A;  1B4C A;  5KTY A;  1LA3 A;  5AFP A;  1JFJ A;  2JQ6 A;  5KSZ A;  1IKU A;  2LNK A;  3TZ1 A;  3TS5 B;  1CDL A;  1LXF C;  1KK7 Z;  1JWD A;  2L4H A;  1IG5 A;  1NSH A;  2WCF A;  1SL8 A;  3OB1 B;  1DJY A;  1DJX A;  2OS8 C;  3SIA A;  1U5I B;  4N5X A;  4PDZ A;  2KAV A;  3CTN A;  1VRK A;  3BUN B;  1MXL C;  1FW4 A;  1TCO B;  1W7I B;  1XFU O;  3TS5 C;  1BLQ A;  1TTX A;  3EKJ A;  2KFH A;  1H8B A;  1DT7 B;  3GK1 A;  5FYX A;  3KO0 A;  3KPX A;  2LVJ A;  3VGO A;  4GAO A;  3AAK A;  5JJG A;  1C07 A;  2Y1M A;  4D1E A;  2CTN A;  3SG2 A;  3CR2 A;  1XO5 A;  4A4C A;  5HYD A;  1F70 A;  2ZN8 A;  1PUL A;  1SK6 D;  1QS7 A;  2I18 A;  4YI8 A;  1NCZ A;  1AK8 A;  1BOD A;  1BMO A;  3PSR A;  2M49 B;  1BU3 A;  1UP5 A;  2F2O A;  1QX7 A;  4R1E A;  5G08 A;  1F54 A;  2BCB A;  2CCM A;  3BUM B;  2M7L A;  4DUQ A;  1WRL A;  3SG4 A;  2AMI A;  3CWG A;  1LKJ A;  3SG3 A;  1K8U A;  1CB1 A;  3IQO A;  5CSJ A;  2SAS A;  5AXI A;  1NYA A;  1BR4 B;  2CT9 A;  2RGI A;  4FQO A;  2MA2 A;  3PAT A;  1TNW A;  1SMG A;  2LHL A;  2M9G A;  4OKH A;  2QAC A;  2LAP A;  1RK9 A;  2KGR A;  4PE1 A;  4ORC B;  4DCK A;  1MHO A;  1NX0 A;  1OE9 B;  1Y0V H;  1C7V A;  3TUY B;  4TNC A;  4ETO A;  5CSN A;  3ZWH A;  2HQ8 A;  2K7D A;  1KSO A;  2L98 A;  2M29 A;  2PMY A;  5I8N A;  3NSL A;  4CFQ A;  2KDH A;  4OV2 A;  1A4P A;  2KFF A;  3WNX B;  4C0L A;  2K2A A;  1MQ1 A;  1PAL A;  3FWB A;  1QLS A;  5IBW A;  1CLB A;  4JWQ A;  1KQM B;  3D0Y A;  5CSI A;  4YGB B;  3TUY C;  3FWC A;  1BOC A;  1PVB A;  3LLE A;  1F8H A;  2ZNE A;  1HT9 A;  1SKT A;  3O78 A;  4YGD B;  2LUX A;  2KI6 D;  2DOQ A;  2KQY A;  1DMO A;  2R2I A;  4AOM A;  1KCY A;  4UPG A;  1WRZ A;  4DRW A;  1TRF A;  2K61 A;  1TNQ A;  3EVR A;  3H4S E;  3AAJ A;  1S6I A;  1KQM C;  1G8I A;  1SYM A;  2PVB A;  2CNP A;  1EG3 A;  3BOW B;  2LHI A;  1SL7 A;  3I5G C;  2PSR A;  1QAS A;  1RTP 1;  1M46 A;  4NQG A;  2HPS A;  2I2R E;  1G4Y R;  4NDD A;  1YUT A;  1WDC B;  2Q91 A;  1SBJ A;  2KAY A;  3DF0 B;  3VRN A;  2F3Z A;  2BKI B;  2WCB A;  5PAL A;  2KHN A;  1IH0 A;  1UHI A;  3E3R A;  2LMV A;  4YGA A;  2LMT A;  3KF9 A;  5B8I B;  1SCM B;  1L2O C;  1J7O A;  1FI5 A;  1CFF A;  1UHK A;  1HQV A;  3RM1 A;  1K2H A;  1K9K A;  1YX8 A;  4CLN A;  4N1F A;  4USL A;  4ZCV A;  1UHJ A;  1XFX O;  2AUC A;  3BUW B;  5DKN A;  1K96 A;  1A75 A;  1N0Y A;  3AKB A;  5TNC A;  2BE4 A;  2I7A A;  2Y5I A;  3OX6 A;  4YBH B;  3WHU B;  1IGV A;  1CDN A;  4XJK B;  5HLV A;  1DVI A;  1S26 D;  1SCM C;  2FCD A;  2MRD A;  2KAX A;  2K2F A;  2KI4 B;  2M0R A;  1DGV A;  1KSM A;  1JUO A;  4FTG A;  2A4J A;  3EKH A;  4M2Q A;  2LVI A;  1CLM A;  1XK4 C;  1XFV O;  2BL0 C;  2HET A;  3I5H C;  1CTR A;  3KEV A;  4I5K A;  1NUB A;  3OB2 B;  1ZAC A;  2K7C A;  3VRR A;  2NXQ A;  1AJ4 A;  1YX7 A;  2BCX A;  2LCP A;  5J3X A;  1F71 A;  1WRK A;  2JT3 A;  3PAL A;  1CKK A;  4YGE B;  1W7J B;  3EVU A;  3C1V A;  1B47 A;  3PN7 B;  2HF5 A;  3QRX A;  2PAS A;  2ZFD A;  3KHE A;  4GGN A;  4HRE E;  1YUU A;  4MEW A;  4WQ3 A;  3JTD B;  1NCX A;  1DF0 A;  2LLU A;  2ZN9 A;  1J55 A;  4M2O A;  2H2K A;  1QX2 A;  1YVH A;  1A03 A;  1BF5 A;  2LLT A;  1K94 A;  4HRG A;  1JSA A;  2JZI A;  4MRY A;  1SR6 B;  2ZRS A;  3PFV A;  3OP0 A;  1AP4 A;  1IJ5 A;  1BJF A;  1B7T Z;  1Y6W A;  1PK0 D;  2JWW A;  1IRJ A;  3EK7 A;  1KFU L;  1QVI Y;  1IQ5 A;  1V1G A;  1OSA A;  2F3Y A;  2MLE C;  3M0W A;  1F4O A;  1R6P A;  1JBA A;  1SRA A;  1QLK A;  1YRU B;  5CSF A;  2M97 A;  4PHM A;  5HKW A;  5I2Q A;  3F45 A;  1KFX S;  1TOP A;  1NX3 A;  3D10 A;  4MLW A;  2PAL A;  4ORB B;  2K8M B;  2NZ0 A;  3A4U B;  1J1D A;  4MBE A;  1YRT B;  1YUR A;  4ZCU A;  1CMG A;  2V53 A;  3GOF A;  4PE0 A;  4HRH A;  4Q04 A;  1QV0 A;  1A29 A;  3RLZ A;  2D8N A;  3DVM A;  2KI6 C;  2MHH A;  2GGZ A;  3D0Y B;  3NSO A;  5F6T A;  2PRU A;  3CR4 X;  4MSP A;  1U5I A;  3I5F B;  1MXE A;  1XYD A;  2FCE A;  1XFZ O;  2TN4 A;  1UWO A;  1M39 A;  1UHN A;  4I5N B;  1B9A A;  4I5J A;  2CBL A;  1IJ6 A;  3NSK A;  4GNK B;  2VRG A;  4GUK A;  1A2X A;  2HQW A;  1FBV A;  1NX2 A;  3I5F C;  2MJW B;  4CFR A;  3TDI A;  1WLM A;  1JFK A;  4YI9 A;  1CDM A;  4JQ0 D;  1JF0 A;  2LAN A;  1PRW A;  1CFC A;  3BUO B;  3CLN A;  2LVK A;  5ER4 X;  1N65 A;  1MUX A;  2ZRT A;  3SG7 A;  1ZFS A;  1J1E A;  1EG4 A;  1KWO B;  1AJ5 A;  5HKY A;  2COL B;  2M3W A;  1EH2 A;  1WLZ A;  3I5I B;  2P6B B;  5DKR A;  1UUR A;  2OTG B;  2Q4U A;  1KK8 B;  4XYN A;  2JC2 A;  3GK4 X;  4MVF A;  2KGB C;  1J7Q A;  1XFW O;  1M31 A;  1SL9 A;  4GGF C;  1OZO A;  1GGW A;  3EK8 A;  1AVS A;  1ZMZ A;  1KK7 Y;  3A8R A;  4PHJ A;  4AQJ A;  2EC6 B;  4GPL B;  1PVA A;  3NSI A;  1KWO C;  2QPT A;  1BT6 A;  4I5L B;  3I5I C;  1B8C A;  2OTG C;  1YVL A;  1TCF A;  1DTL A;  5DKQ A;  2I94 A;  1RWY A;  1S3P A;  4F0Z B;  2BCA A;  2KSP A;  1B1G A;  1KQV A;  4PHN A;  4WRI A;  2FJU B;  1DJG A;  1MF8 B;  1WDC C;  3BQ3 A;  4IL1 A;  3SIB A;  5BPJ A;  4HSZ A;  1ZOT B;  1REC A;  2LP2 A;  1TNX A;  2LMU A;  1Q80 A;  1YR5 A;  4NDC A;  3DVE A;  1X02 A;  1AUI B;  1B7T Y;  2GV5 A;  2MBX A;  3NXA A;  2AAO A;  3IQQ A;  2WOS A;  1SCV A;  1CFP A;  2CXJ A;  3EVV A;  3CZT X;  1CLL A;  1K93 D;  1GQM A;  2BKH B;  4MZK A;  5D7F A;  1SW8 A;  1Y1A A;  1M63 B;  3DD4 A;  2MAZ A;  5I2O A;  4MRX A;  1MWN A;  4CPV A;  2NCP A;  1YUS A;  1NX1 A;  1LIN A;  2LLS A;  4MZJ A;  4M2P A;  1SY9 A;  2E6W A;  5CPV A;  4JPZ B;  3BOW A;  2LE9 B;  5AEQ A;  3MSE B;  3TDU A;  1SNL A;  2L50 A;  1OZS A;  4QJ3 B;  2M8U A;  3LK0 A;  2KI4 C;  1WY9 A;  1ALV A;  1CM4 A;  2OS8 B;  1NIW A;  1BG1 A;  4C0K A;  1OQP A;  1XVJ A;  1G33 A;  1M45 A;  3OX5 A;  2KOT A;  1H4B A;  1CMF A;  1MR8 A;  5AAN A;  4QJ5 B;  1RFJ A;  1EL4 A;  2BE6 A;  5D69 A;  1C7W A;  1DGU A;  2H61 C;  1D1O A;  1AHR A;  1DJZ A;  1PSR A;  5I2L A;  1JC2 A;  2L51 A;  1S5G Z;  2JT8 A;  4OR9 B;  2ISD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...