2LVJA

Solution structure of hemi-mg-bound phl p 7
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Phl p 7
publication title Solution structures of polcalcin Phl p 7 in three ligation states: Apo-, hemi-Mg(2+) -bound, and fully Ca(2+) -bound.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lvjA00
1OMRA 1QVIZ 3EK8A 2HQ8A 3I5FB 2PASA 2ZN8A 3D0YB 2L5XB 4JWQA 2HPSA 4WQ3A 2LNKA 2JULA 3TZ1A 1CDMA 1SPYA 2JXCA 2WNDA 1XO5A 1QASA 3FIAA 1DJXA 3CTNA 2RGIA 1PSRA 1U5IA 4UPGA 1XFVO 3I5FC 3C1VA 4DS7A 1OOJA 1YUUA 1QJTA 1TOPA 1XFZO 1PK0D 1B7TY 1K93D 3KO0A 2B1UA 3VGOA 4MEWA 4BY5A 1NX2A 3PATA 2OTGB 2F3ZA 1M31A 2I94A 1KK8C 2KNEA 2L2EA 5KU1A 1ZMZA 2KAYA 1F4QA 1KSOA 1KFUL 1KSMA 1SRAA 2Y5IA 1ZUZA 1AP4A 2M9GA 4M2PA 4YBHB 1NX3A 2OTGC 4MRYA 1D1OA 2MRDA 1SKTA 2H2KA 2WCBA 1JFJA 1WRKA 2I2RE 1RK9A 2K8MB 1SNLA 1ODBA 3BOWA 5HLVA 4GGFC 1EJ3A 2G2BA 1FBVA 1S26D 2LAPA 2NLNA 2JTTA 2LMUA 1RTP1 1ALVA 2JTZA 2ZFDA 5DKRA 1KFXS 1A03A 1TNXA 2BL0B 3AKAA 1IKUA 2Q91A 3BXKA 4MN0A 4MLWA 2JRFA 4AQJA 1KQMB 2WC8A 2E30A 4C0KA 4D1EA 3MSEB 3O78A 2WORA 1Q80A 1NX0A 4FTGA 2K7BA 4MZKA 2Y1NA 2BL0C 3IQQA 1MQ1A 5F6TA 1BODA 1SK6D 1UHKA 2ZNEA 2BCBA 1OZOA 1XK4A 4XYNA 1CNPA 1CMGA 2JZIA 5AERA 1MF8B 2JT3A 1N2DA 2ZN9A 2LHIA 4MSPA 5HLOA 2CCMA 3KF9A 1K94A 3I5GB 1RJVA 3E3RA 3DVMA 1AJ4A 3BUMB 1EG3A 1BJFA 1LA0A 1M39A 1NYAA 1HT9A 2WCEA 1NX1A 1F8HA 1S3PA 1QIWA 3HCMA 1K8UA 2K7CA 3WHUB 1GJYA 1FF1A 1JBAA 1SCMB 2R2IA 1L7ZA 3EVUA 1CDPA 1G4YR 1YUSA 3FWBA 1L2OC 1DJZA 1SL9A 2ISDA 4YI8A 4CIDA 4WQ2A 1UHHA 3EKHA 3GK4X 2OS8C 5G08A 3O4YA 4I5NB 1K9KA 1F4OA 2JNXA 1LXFC 1PVAA 3NSLA 3OX5A 2NXQA 5KTYA 2AUCA 3WHTB 3EK7A 1DJGA 1R2UA 1XFWO 2O5GA 4C0JA 1B8LA 4HREE 1TRFA 4PHMA 4GAOA 2Q4UA 2MA2A 2EGDA 3LLEA 4GFTA 1CLBA 1N0YA 2MHHA 3F45A 4DCKA 1FI6A 3AAJA 1NUBA 1MR8A 3GK1A 1Y1AA 2COLB 1H4BA 3OB1B 2K2FA 3JTDC 2BBNA 3CGAA 4JPZB 3D0YA 2G9BA 1DF0B 1S1EA 3TDIA 1F54A 4YGEB 1OMVA 5AFPA 1OE9B 4N1FA 4MZLA 1Y6WA 1CTRA 3CR5X 2L51A 3DF0B 2LC5A 2KQ6A 1W7IB 1AHRA 1NIWA 5GQQC 1BR4B 1TTXA 4L9MA 2KGBC 1CDNA 1C07A 2F8PA 3LK0A 4I5LB 1S5GZ 3DVEA 4PHNA 3CR4X 1MXEA 3OHMB 1IRJA 3ZNIA 2GGMA 2NZ0A 3TUYB 1LKJA 2KFGA 4CFQA 3DVJA 4HRHA 1J7PA 2PRUA 1BMOA 1A2XA 1YR5A 5TNCA 1JFKA 1QV0A 2KFFA 5BPJA 4NQGA 2BE6A 1QLSA 4NDBA 4OCIA 2M7LA 1SY9A 1KK8B 4QJ3B 1PRWA 3TUYC 2BE4A 3RM1A 1S6JA 2KQYA 1G33A 1CFPA 1FI5A 1V1GA 2MAZA 1A75B 2JPTA 1CFCA 3GK2A 4DIRA 4A4CA 1ZOTB 1UWOA 1AK8A 1KCYA 4ICBA 2Y1MA 1YVLA 4YI9A 1F55A 2PALA 3VROA 4HRGA 4YRUA 1BR1B 2KOTA 4XJKB 1CLLA 4M2QA 4DRWA 3D10A 3PSRA 3VRQA 4YGAA 1N65A 2H61C 2PVBA 2E6WA 1PULA 1NCYA 1SBJA 4PE7A 1CLMA 1YX7A 1NWDA 1CDLA 4ZCUA 2LMTA 1MXLC 1RWYA 3GOFA 3SIBA 3SG4A 1UP5A 4P5OE 1TIZA 2F2PA 1IJ6A 2PSRA 1YTZC 4CLNA 5ER5A 1XFXO 3AKBA 1MUXA 3VRRA 4CFRA 3I5HB 3SJSA 1CKKA 1B8CA 2L4HA 3SG6A 1E8AA 2WOSA 2AMIA 1BLQA 1HQVA 1ZFSA 1WRLA 2QPTA 1QX5B 5CSNA 1RROA 1B9AA 4ORAB 1BF5A 2A4JA 1DGVA 1WDCC 2JXLA 4MRXA 4QJ5B 2BKIB 1XA5A 2O60A 3VRNA 1B4CA 2ZRSA 1DTLA 2FCDA 3I5HC 1IH0A 2K61A 1QTXA 2LV7A 3M0WA 3OB2B 2DOQA 5DKNA 3PN7C 3WNXB 3CS1A 4N5XA 5D69A 1J7QA 1JWDA 2P6BB 2VRGA 2CXJA 1L2OB 2KI6C 2LCPA 2I7AA 2KGRA 4OVNF 2JQ6A 5I8NA 3BOWB 2OS8B 1KK7Z 3SG5A 3TDZA 1TNWA 1KWOB 1DJYA 4GBAA 1EH2A 1DMOA 5I2LA 4E68A 1YVHA 1YRTB 4ZCVA 5I2QA 3TDUA 3SG2A 1IQ3A 2LANA 4ORCB 1CM4A 1S6CA 2L50A 4N1GA 5I2OA 2AAOA 1S6IA 1TN4A 2ZRTA 1SW8A 1LINA 3NSKA 4WRIA 2OPOA 1KWOC 1OQPA 3H4SE 1NPQA 1K95A 1DF0A 2KI6D 3JTDB 2JNFA 2LHLA 2K7OA 1XYDA 4AQIA 1YX8A 3DF0A 4OKHA 1SR6B 1GGZA 5IBWA 3A8RA 3EK4A 4GNKB 1QS7A 2ZKMX 1G8IA 3CWGA 2SCPA 3BYAA 3ICBA 1QIVA 2KDHA 4TNCA 1AUIB 2KHNA 5CPVA 4Q04A 1SR6C 1XFYO 1J7OA 1LVCD 4U8DA 2I18A 1H8BA 1TCFA 2HETA 2LVKA 3KEVA 1SL8A 1XK4C 1SYMA 5PALA 1KFUS 4R1EA 1YURA 4PCWA 1J1EA 3PALA 4NDCA 1CMFA 3FWCA 2LLTA 3BUWB 5AEQA 1QVIY 4C0LA 2LUXA 3A4UB 1OSAA 3FS7A 1IG5A 1MWNA 1C7WA 1CFDA 2L4IA 1A75A 2LP2A 2LMVA 1ALWA 2H61A 4PDZA 2M3WA 1NCXA 1F70A 1PSBA 2MLEC 3TS5B 4HSZA 1AVSA 2JC2A 1VRKA 4GGFA 4PE1A 5HYDA 3PLFB 1X02A 5D7FA 5HKWA 4YGBB 2KI4B 2V53A 1JUOA 1CM1A 1SL7A 2MJWB 5AXIA 1IJ5A 1RFJA 1A4PA 2FJUB 3TS5C 1QXPA 1EL4A 3I5IC 1B8RA 3NXAA 2K0JA 2QACA 4JQ0D 2SASA 4I5JA 2NCPA 1BOCA 2FCEA 1BG1A 1XFUO 1IGVA 4FQOA 2CBLA 1QLKA 1SMGA 1YRUB 1Y0VH 2KI4C 1TCOB 1MHOA 1YUTA 1RECA 3PM8A 1NP8A 1UHJA 1SCVA 3LCPC 1B7TZ 3RLZA 1JC2A 2HQWA 2WCFA 4GUKA 1DJIA 1DGUA 4OR9B 2Y4QA 4DUQA 2M1UA 1GGWA 1DJHA 1IWQA 1OMDA 1UUSA 2L0PA 4MZJA 2EC6B 1C7VA 4P2YB 4I5KA 1XVJA 2F33A 1WDCB 1U5IB 4NDDA 3BUXB 3IQOA 4GGNA 4F0ZB 1WRZA 4YGDB 4AOMA 1A29A 5HKYA 2GV5A 4ORBB 2BECA 2KBIA 2KAXA 2EC6C 1IQ5A 2MLFC 1UURA 1K9PA 3OP0A 3PN7B 5JOLA 4MBEA 3SG3A 3SG7A 1KQVA 3SIAA 1DVIA 2M49B 1CFFA 1K96A 1PVBA 1UHNA 2KAVA 2CTNA 5J3XA 5K89A 2KYCA 1NCZA 1TNPA 2NCOA 2KFHA 2K2AA 2EHBA 1UHIA 2L98A 1B1GA 1K9UA 3NSIA 1CB1A 1WY9A 2FOTA 4IL1A 3WXAA 1WLZA 2M97A 1FPWA 3O2PA 5DKQA 4ETOA 5FYXA 1NSHA 3EVVA 2JT0A 1JF2A 3CZTX 2KYFA 3BUOB 4M2OA 1QV1A 1EXRA 2PMYA 1KK7Y 3HX4A 1B47A 2KBMA 4YGCB 2M7NA 4MVFA 1V1FA 1Y1UA 3DD4A 2BKHB 3KPXA 1M63B 2KSPA 1BT6A 2TN4A 5CSJA 1KQMC 1DT7B 1OZSA 3BQ3A 1FW4A 1JF0A 2LP3A 2M1KB 2HF5A 5CSIA 2F2OA 2LE9B 2LVIA 2ZNDA 3NSOA 4CPVA 2GGZA 1K2HA 4A4BA 2BBMA 1M45A 2K7DA 4PHKA 1BU3A 1PALA 1ZACA 3KHEA 3VRPA 4PE4A 1DJWA 1KFXL 1WLMA 1Y1XA 2LVVA 3CLNA 3I5GC 4GPLB 5AANA 5JJGA 3OX6A 4QJ4B 2LLSA 5CSFA 2JU0A 1J7RA 2M29A 4OV2A 2LM5A 3LL8B 1EG4A 4PHJA 1JSAA 3AAKA 3ZWHA 1GQMA 4USLA 1SCMC 1QX2A 1R6PA 1AJ5A 4PE0A 3EKJA 4PALA 2CT9A 3DVKA 2JT8A 2F3YA 3K21A 3EVRA 1W7JB 1F71A 2MBXA 1S5GY 2JOJA 5KSZA 2LVJA 1K90D 2CNPA 3JVTB 1QATA 2M8UA 2BCXA 1LA3A 1QX7A 3BUNB 3QRXA 5ER4X 3IF7A 4BY4A 2D8NA 3CR2A 2LUCA 3O6BA 2BCAA 3PFVA 1TNQA 3I5IB 1J1DA 1J55A 5HKZA 1M46A 2IS9A 2JWWA 5B8IB 4XJKA 2LLUA 3LK1A 2M0RA 1S36A 3JVTC
chains in the Genus database with same CATH superfamily
1OMRA 1TUZA 1QVIZ 3EK8A 2HQ8A 3I5FB 2PASA 2ZN8A 3D0YB 3S0GA 2L5XB 4JWQA 2HPSA 4WQ3A 2LNKA 2JULA 3TZ1A 1CDMA 4JKTA 1SPYA 2JXCA 2WNDA 1XO5A 1QASA 3FIAA 1DJXA 3CTNA 2RGIA 1PSRA 1U5IA 1W9ZA 3RZSA 4UPGA 1XFVO 3I5FC 3C1VA 4DS7A 1OOJA 1YUUA 1QJTA 1TOPA 1XFZO 1PK0D 1B7TY 1K93D 3KO0A 2B1UA 3VGOA 4MEWA 4BY5A 1NX2A 3PATA 2OTGB 3EG5B 2F3ZA 1M31A 2I94A 2WCLA 1KK8C 2KNEA 2L2EA 5KU1A 5I94A 1ZMZA 2KAYA 1F4QA 1KSOA 1KFUL 1KSMA 1SRAA 2Y5IA 1ZUZA 1AP4A 2M9GA 4M2PA 4YBHB 3Q8IA 1NX3A 2OTGC 4MRYA 1D1OA 2MRDA 1SKTA 2H2KA 2WCBA 1JFJA 1WRKA 2I2RE 1RK9A 2K8MB 3D78A 1SNLA 1ODBA 3BOWA 5HLVA 3CZ0A 4GGFC 1EJ3A 2G2BA 1FBVA 1S26D 2LAPA 2NLNA 1DC1A 2JTTA 3S0AA 2LMUA 1RTP1 1ALVA 2JTZA 2ZFDA 5DKRA 3BFBA 1KFXS 1A03A 1TNXA 2BL0B 3AKAA 1IKUA 2Q91A 3BXKA 4MN0A 4MLWA 2JRFA 4AQJA 1KQMB 2WC8A 2E30A 1C3YA 3B87A 4C0KA 4D1EA 3MSEB 3O78A 2WORA 1Q80A 3S0EA 1NX0A 4FTGA 2K7BA 4MZKA 2Y1NA 2BL0C 3BJHA 3IQQA 1MQ1A 5F6TA 1BODA 1SK6D 1UHKA 2ZNEA 2BCBA 3L4LA 1OZOA 1XK4A 4XYNA 1CNPA 1CMGA 2JZIA 5AERA 1MF8B 2JT3A 1N2DA 2ZN9A 2LHIA 3D76A 4MSPA 5HLOA 2CCMA 1ORGA 1GM0A 3KF9A 1K94A 3I5GB 1RJVA 2YGUA 3E3RA 3DVMA 1AJ4A 3BUMB 1EG3A 1BJFA 1LA0A 1M39A 1NYAA 1HT9A 2WCEA 1NX1A 1DEKA 1F8HA 1S3PA 1QIWA 3B88A 3HCMA 1K8UA 2K7CA 3WHUB 1GJYA 1FF1A 1JBAA 1SCMB 2R2IA 1L7ZA 3EVUA 1CDPA 1G4YR 1YUSA 3FWBA 2L5YA 4JD9A 1L2OC 1DJZA 1SL9A 2ISDA 4YI8A 4CIDA 4WQ2A 1UHHA 2QEHA 3EKHA 2OS8C 3GK4X 5G08A 3O4YA 4I5NB 1K9KA 1F4OA 2JNXA 1LXFC 1PVAA 3NSLA 3OX5A 2NXQA 5KTYA 2AUCA 3WHTB 3EK7A 1DJGA 1R2UA 1XFWO 1OW4A 2O5GA 4C0JA 1B8LA 4HREE 1TRFA 2BAPA 4PHMA 4GAOA 2Q4UA 2MA2A 2EGDA 3LLEA 4GFTA 1CLBA 1N0YA 2MHHA 3F45A 4DCKA 1FI6A 3AAJA 1NUBA 3SS5A 1MR8A 2WCJA 3GK1A 1Y1AA 2COLB 1H4BA 3UNWA 3OB1B 2K2FA 3JTDC 2BBNA 3CGAA 4JPZB 3CABA 3D0YA 2G9BA 1DF0B 1S1EA 3TDIA 1F54A 4YGEB 3B6XA 1OMVA 5AFPA 1OE9B 3N7HA 4N1FA 4MZLA 1Y6WA 1CTRA 3CR5X 2JPOA 2L51A 2LC5A 3DF0B 3DYEA 2KQ6A 1W7IB 1AHRA 1NIWA 5GQQC 1BR4B 1TTXA 4L9MA 2KGBC 1CDNA 1C07A 2F8PA 2PYQA 3LK0A 4I5LB 1S5GZ 3BFAA 3DVEA 4PHNA 3CR4X 1MXEA 3OHMB 1IRJA 3ZNIA 2GGMA 2NZ0A 3TUYB 1LKJA 2KFGA 4CFQA 3DVJA 4HRHA 3S0FA 1J7PA 2PRUA 1BMOA 1A2XA 1YR5A 5TNCA 1JFKA 1QV0A 2KFFA 5BPJA 4NQGA 2BE6A 1QLSA 3B86A 4NDBA 4OCIA 2M7LA 1SY9A 1KK8B 3NGVA 4QJ3B 1PRWA 2QDIA 3TUYC 2BE4A 3RM1A 1S6JA 2KQYA 1G33A 1CFPA 1FI5A 1V1GA 2MAZA 1A75B 2QEBA 2JPTA 1CFCA 3GK2A 3SS4A 4DIRA 4A4CA 4INWA 1ZOTB 3D77A 2KLEA 1UWOA 1AK8A 1KCYA 4ICBA 2Y1MA 1OOGA 1YVLA 4PT1A 2PALA 4YI9A 3VROA 1F55A 4HRGA 4YRUA 1BR1B 2KOTA 3R1OA 1CLLA 4M2QA 4XJKB 4DRWA 4KYNA 3D10A 3PSRA 3VRQA 4YGAA 1N65A 1TUJA 2H61C 2PVBA 2E6WA 1PULA 1NCYA 1SBJA 4PE7A 1CLMA 1YX7A 1NWDA 1CDLA 4ZCUA 2LMTA 1MXLC 1RWYA 3GOFA 3SIBA 2QEVA 2FJYA 3SG4A 1UP5A 4P5OE 1TIZA 2F2PA 1IJ6A 2PSRA 1YTZC 4CLNA 5ER5A 1XFXO 3AKBA 1Z4HA 1MUXA 3FE9A 3VRRA 4CFRA 3I5HB 3SJSA 1CKKA 1B8CA 2L4HA 3SG6A 1E8AA 2WOSA 2AMIA 1BLQA 1OOIX 1HQVA 1ZFSA 1WRLA 2BNXA 1QX5B 2QPTA 1RROA 3OGNA 5CSNA 1B9AA 4ORAB 1BF5A 2A4JA 1DGVA 1WDCC 1XFRA 2JXLA 4MRXA 4QJ5B 2BKIB 1XA5A 2O60A 3VRNA 1B4CA 2ZRSA 1DTLA 2FCDA 3I5HC 3R1PA 1IH0A 2K61A 1QTXA 2LV7A 3M0WA 3OB2B 1TWOA 2DOQA 3SS3A 5DKNA 3PN7C 3WNXB 3CS1A 4N5XA 5D69A 1J7QA 1JWDA 2P6BB 2VRGA 2CXJA 1L2OB 2KI6C 3O4XA 2LCPA 2I7AA 2KGRA 2L2CA 2JQ6A 3CZ2A 4OVNF 5I8NA 3BOWB 2OS8B 1KK7Z 3SG5A 3TDZA 1TNWA 1KWOB 1DJYA 4GBAA 1EH2A 1DMOA 5I2LA 3S0BA 4E68A 1OOFA 1YVHA 1YRTB 4ZCVA 5I2QA 3B7AA 2WCMA 3TDUA 3SG2A 1Z2CB 1IQ3A 2LANA 4ORCB 1CM4A 1S6CA 2L50A 4N1GA 5I2OA 2AAOA 1S6IA 1TN4A 2ZRTA 3IVTA 1SW8A 1LINA 3NSKA 4WRIA 2OPOA 1KWOC 1OQPA 3H4SE 1NPQA 4OZDA 3V2LA 1DELA 1K95A 1DF0A 2KI6D 3JTDB 2JNFA 2LHLA 2K7OA 1XYDA 4AQIA 1YX8A 3DF0A 4OKHA 1SR6B 1GGZA 5IBWA 3A8RA 3EK4A 4GNKB 1QS7A 2ZKMX 1G8IA 3CWGA 2WCHA 2SCPA 3BYAA 3ICBA 1QIVA 2KDHA 4IJ7A 4TNCA 1QWVA 1AUIB 2KHNA 5CPVA 4Q04A 1SR6C 1XFYO 1J7OA 5EL2A 1LVCD 4U8DA 5FI6A 2I18A 1H8BA 1TCFA 2HETA 2LVKA 3KEVA 1SL8A 1XK4C 1SYMA 5PALA 1KFUS 3D74A 1YURA 3OBVA 4PCWA 4R1EA 1J1EA 3PALA 4NDCA 1CMFA 3FWCA 2LLTA 3BUWB 5AEQA 1QVIY 4C0LA 2LUXA 3A4UB 1OSAA 3FS7A 1IG5A 1MWNA 1C7WA 1CFDA 2L4IA 3L47A 1A75A 2LP2A 2LMVA 1ALWA 2H61A 4PDZA 2M3WA 1NCXA 1F70A 1PSBA 3L4AA 2MLEC 3TS5B 3K1EA 3PM2A 4HSZA 1AVSA 2JC2A 1VRKA 4GGFA 4PE1A 3NHIA 5HYDA 3PLFB 1X02A 5D7FA 5HKWA 4YGBB 2KI4B 2V53A 1JUOA 1CM1A 1SL7A 2MJWB 5AXIA 1IJ5A 5DICA 1RFJA 1A4PA 2FJUB 3TS5C 1QXPA 1EL4A 3I5IC 1B8RA 3NXAA 2K0JA 2QACA 3R1VA 4JQ0D 2SASA 4I5JA 2NCPA 1BOCA 2FCEA 1BG1A 2GTEA 1XFUO 1IGVA 3VB1A 4FQOA 2CBLA 1QLKA 1SMGA 1YRUB 3CZ1A 1Y0VH 2KLDA 2KI4C 1TCOB 3PJIA 1MHOA 1T14A 1YUTA 1RECA 3DZTA 4INXA 2H8VA 3PM8A 1NP8A 1UHJA 1SCVA 3S0DA 3LCPC 1B7TZ 3RLZA 1JC2A 2P71A 2HQWA 2WCFA 4GUKA 1DJIA 1DGUA 4OR9B 2Y4QA 4DUQA 2M1UA 1GGWA 1DJHA 1IWQA 1OMDA 1UUSA 2L0PA 4MZJA 2EC6B 1C7VA 2QEOA 4P2YB 4I5KA 1XVJA 2F33A 1WDCB 1U5IB 4NDDA 3BUXB 3IQOA 3UO9A 4GGNA 4F0ZB 1WRZA 5FI7A 4YGDB 4AOMA 1A29A 5HKYA 2GV5A 4ORBB 2BECA 2KBIA 2KAXA 3CDNA 3D75A 4F7FA 2EC6C 1IQ5A 2MLFC 1UURA 1K9PA 3D73A 3OP0A 3PN7B 4MBEA 5JOLA 3SG7A 3SG3A 1KQVA 5JJGA 5D3OA 3SIAA 3QMEA 1DVIA 3CYZA 1DQEA 2M49B 5FI2A 1CFFA 1K96A 1PVBA 1UHNA 2KAVA 2CTNA 5J3XA 5K89A 2KYCA 1NCZA 3BFHA 1TNPA 2NCOA 2KFHA 2K2AA 2EHBA 1UHIA 2L98A 1B1GA 1K9UA 3NSIA 1CB1A 1WY9A 2FOTA 4IL1A 3WXAA 1WLZA 2M97A 1FPWA 3O2PA 5DKQA 4ETOA 5FYXA 1NSHA 2K60A 2JT0A 1JF2A 1SSEB 2WC6A 2KYFA 3CZTX 3BUOB 3EVVA 4M2OA 1QV1A 1EXRA 2PMYA 1KK7Y 3HX4A 1B47A 1OOHA 2KBMA 4YGCB 2M7NA 4MVFA 1V1FA 1Y1UA 2PQLA 3DD4A 2BKHB 3KPXA 1M63B 2KSPA 1IIOA 1BT6A 2TN4A 5CSJA 1KQMC 1DT7B 1OZSA 3BQ3A 1FW4A 1JF0A 2LP3A 2M1KB 2WC5A 2HF5A 5CSIA 2F2OA 2LE9B 2LVIA 2ZNDA 3R72A 3NSOA 4CPVA 2WCKA 2GGZA 1K2HA 4FQTA 4A4BA 2BBMA 2KPHA 1M45A 2K7DA 4PHKA 1BU3A 1PALA 1ZACA 3KHEA 3VRPA 4PE4A 1DJWA 1KFXL 1WLMA 1Y1XA 2LVVA 3CLNA 3FE8A 3I5GC 4GPLB 5AANA 3OX6A 4QJ4B 2LLSA 5CSFA 2JU0A 1J7RA 2M29A 3NHTA 4OV2A 2LM5A 3LL8B 1EG4A 4PHJA 1JSAA 3AAKA 3ZWHA 1P28A 1GQMA 4USLA 1SCMC 1QX2A 1R6PA 1AJ5A 4PE0A 3EKJA 1LS8A 2CT9A 4PALA 3DVKA 3DXLA 2JT8A 2P70A 2F3YA 3DY9A 3K21A 3EVRA 5HL1A 1W7JB 1F71A 2MBXA 1S5GY 2JOJA 5KSZA 2LVJA 1K90D 2CNPA 3JVTB 1QATA 2M8UA 2BCXA 1LA3A 1QX7A 3BUNB 3QRXA 5ER4X 3IF7A 4BY4A 2D8NA 3CR2A 2LUCA 3O6BA 2BCAA 3PFVA 1TNQA 2ERBA 1J1DA 1J55A 3I5IB 1M46A 2IS9A 2JWWA 3FE6A 5HKZA 5B8IB 4XJKA 2LLUA 3LK1A 1C3ZA 2M0RA 1S36A 3JVTC
chains in the Genus database with same CATH topology
1OMRA 1QVIZ 3EK8A 2HQ8A 3I5FB 2PASA 2ZN8A 3D0YB 2L5XB 4JWQA 2HPSA 4WQ3A 2LNKA 2JULA 3TZ1A 1CDMA 1SPYA 2JXCA 2WNDA 1XO5A 1QASA 3FIAA 1DJXA 3CTNA 2RGIA 1PSRA 1U5IA 4UPGA 1XFVO 3I5FC 3C1VA 4DS7A 1OOJA 1YUUA 1QJTA 1TOPA 1XFZO 1PK0D 1B7TY 1K93D 3KO0A 2B1UA 3VGOA 4MEWA 4BY5A 1NX2A 3PATA 2OTGB 2F3ZA 1M31A 2I94A 1KK8C 2KNEA 2L2EA 5KU1A 1ZMZA 2KAYA 1F4QA 1KSOA 1KFUL 1KSMA 1SRAA 2Y5IA 1ZUZA 1AP4A 2M9GA 4M2PA 4YBHB 1NX3A 2OTGC 4MRYA 1D1OA 2MRDA 1SKTA 2H2KA 2WCBA 1JFJA 1WRKA 2I2RE 1RK9A 2K8MB 1SNLA 1ODBA 3BOWA 5HLVA 4GGFC 1EJ3A 2G2BA 1FBVA 1S26D 2LAPA 2NLNA 2JTTA 2LMUA 1RTP1 1ALVA 2JTZA 2ZFDA 5DKRA 1KFXS 1A03A 1TNXA 2BL0B 3AKAA 1IKUA 2Q91A 3BXKA 4MN0A 4MLWA 2JRFA 4AQJA 1KQMB 2WC8A 2E30A 4C0KA 4D1EA 3MSEB 3O78A 2WORA 1Q80A 1NX0A 4FTGA 2K7BA 4MZKA 2Y1NA 2BL0C 3IQQA 1MQ1A 5F6TA 1BODA 1SK6D 1UHKA 2ZNEA 2BCBA 1OZOA 1XK4A 4XYNA 1CNPA 1CMGA 2JZIA 5AERA 1MF8B 2JT3A 1N2DA 2ZN9A 2LHIA 4MSPA 5HLOA 2CCMA 3KF9A 1K94A 3I5GB 1RJVA 3E3RA 3DVMA 1AJ4A 3BUMB 1EG3A 1BJFA 1LA0A 1M39A 1NYAA 1HT9A 2WCEA 1NX1A 1F8HA 1S3PA 1QIWA 3HCMA 1K8UA 2K7CA 3WHUB 1GJYA 1FF1A 1JBAA 1SCMB 2R2IA 1L7ZA 3EVUA 1CDPA 1G4YR 1YUSA 3FWBA 1L2OC 1DJZA 1SL9A 2ISDA 4YI8A 4CIDA 4WQ2A 1UHHA 3EKHA 3GK4X 2OS8C 5G08A 3O4YA 4I5NB 1K9KA 1F4OA 2JNXA 1LXFC 1PVAA 3NSLA 3OX5A 2NXQA 5KTYA 2AUCA 3WHTB 3EK7A 1DJGA 1R2UA 1XFWO 2O5GA 4C0JA 1B8LA 4HREE 1TRFA 4PHMA 4GAOA 2Q4UA 2MA2A 2EGDA 3LLEA 4GFTA 1CLBA 1N0YA 2MHHA 3F45A 4DCKA 1FI6A 3AAJA 1NUBA 1MR8A 3GK1A 1Y1AA 2COLB 1H4BA 3OB1B 2K2FA 3JTDC 2BBNA 3CGAA 4JPZB 3D0YA 2G9BA 1DF0B 1S1EA 3TDIA 1F54A 4YGEB 1OMVA 5AFPA 1OE9B 4N1FA 4MZLA 1Y6WA 1CTRA 3CR5X 2L51A 3DF0B 2LC5A 2KQ6A 1W7IB 1AHRA 1NIWA 5GQQC 1BR4B 1TTXA 4L9MA 2KGBC 1CDNA 1C07A 2F8PA 3LK0A 4I5LB 1S5GZ 3DVEA 4PHNA 3CR4X 1MXEA 3OHMB 1IRJA 3ZNIA 2GGMA 2NZ0A 3TUYB 1LKJA 2KFGA 4CFQA 3DVJA 4HRHA 1J7PA 2PRUA 1BMOA 1A2XA 1YR5A 5TNCA 1JFKA 1QV0A 2KFFA 5BPJA 4NQGA 2BE6A 1QLSA 4NDBA 4OCIA 2M7LA 1SY9A 1KK8B 4QJ3B 1PRWA 3TUYC 2BE4A 3RM1A 1S6JA 2KQYA 1G33A 1CFPA 1FI5A 1V1GA 2MAZA 1A75B 2JPTA 1CFCA 3GK2A 4DIRA 4A4CA 1ZOTB 1UWOA 1AK8A 1KCYA 4ICBA 2Y1MA 1YVLA 4YI9A 1F55A 2PALA 3VROA 4HRGA 4YRUA 1BR1B 2KOTA 4XJKB 1CLLA 4M2QA 4DRWA 3D10A 3PSRA 3VRQA 4YGAA 1N65A 2H61C 2PVBA 2E6WA 1PULA 1NCYA 1SBJA 4PE7A 1CLMA 1YX7A 1NWDA 1CDLA 4ZCUA 2LMTA 1MXLC 1RWYA 3GOFA 3SIBA 3SG4A 1UP5A 4P5OE 1TIZA 2F2PA 1IJ6A 2PSRA 1YTZC 4CLNA 5ER5A 1XFXO 3AKBA 1MUXA 3VRRA 4CFRA 3I5HB 3SJSA 1CKKA 1B8CA 2L4HA 3SG6A 1E8AA 2WOSA 2AMIA 1BLQA 1HQVA 1ZFSA 1WRLA 2QPTA 1QX5B 5CSNA 1RROA 1B9AA 4ORAB 1BF5A 2A4JA 1DGVA 1WDCC 2JXLA 4MRXA 4QJ5B 2BKIB 1XA5A 2O60A 3VRNA 1B4CA 2ZRSA 1DTLA 2FCDA 3I5HC 1IH0A 2K61A 1QTXA 2LV7A 3M0WA 3OB2B 2DOQA 5DKNA 3PN7C 3WNXB 3CS1A 4N5XA 5D69A 1J7QA 1JWDA 2P6BB 2VRGA 2CXJA 1L2OB 2KI6C 2LCPA 2I7AA 2KGRA 4OVNF 2JQ6A 5I8NA 3BOWB 2OS8B 1KK7Z 3SG5A 3TDZA 1TNWA 1KWOB 1DJYA 4GBAA 1EH2A 1DMOA 5I2LA 4E68A 1YVHA 1YRTB 4ZCVA 5I2QA 3TDUA 3SG2A 1IQ3A 2LANA 4ORCB 1CM4A 1S6CA 2L50A 4N1GA 5I2OA 2AAOA 1S6IA 1TN4A 2ZRTA 1SW8A 1LINA 3NSKA 4WRIA 2OPOA 1KWOC 1OQPA 3H4SE 1NPQA 1K95A 1DF0A 2KI6D 3JTDB 2JNFA 2LHLA 2K7OA 1XYDA 4AQIA 1YX8A 3DF0A 4OKHA 1SR6B 1GGZA 5IBWA 3A8RA 3EK4A 4GNKB 1QS7A 2ZKMX 1G8IA 3CWGA 2SCPA 3BYAA 3ICBA 1QIVA 2KDHA 4TNCA 1AUIB 2KHNA 5CPVA 4Q04A 1SR6C 1XFYO 1J7OA 1LVCD 4U8DA 2I18A 1H8BA 1TCFA 2HETA 2LVKA 3KEVA 1SL8A 1XK4C 1SYMA 5PALA 1KFUS 4R1EA 1YURA 4PCWA 1J1EA 3PALA 4NDCA 1CMFA 3FWCA 2LLTA 3BUWB 5AEQA 1QVIY 4C0LA 2LUXA 3A4UB 1OSAA 3FS7A 1IG5A 1MWNA 1C7WA 1CFDA 2L4IA 1A75A 2LP2A 2LMVA 1ALWA 2H61A 4PDZA 2M3WA 1NCXA 1F70A 1PSBA 2MLEC 3TS5B 4HSZA 1AVSA 2JC2A 1VRKA 4GGFA 4PE1A 5HYDA 3PLFB 1X02A 5D7FA 5HKWA 4YGBB 2KI4B 2V53A 1JUOA 1CM1A 1SL7A 2MJWB 5AXIA 1IJ5A 1RFJA 1A4PA 2FJUB 3TS5C 1QXPA 1EL4A 3I5IC 1B8RA 3NXAA 2K0JA 2QACA 4JQ0D 2SASA 4I5JA 2NCPA 1BOCA 2FCEA 1BG1A 1XFUO 1IGVA 4FQOA 2CBLA 1QLKA 1SMGA 1YRUB 1Y0VH 2KI4C 1TCOB 1MHOA 1YUTA 1RECA 3PM8A 1NP8A 1UHJA 1SCVA 3LCPC 1B7TZ 3RLZA 1JC2A 2HQWA 2WCFA 4GUKA 1DJIA 1DGUA 4OR9B 2Y4QA 4DUQA 2M1UA 1GGWA 1DJHA 1IWQA 1OMDA 1UUSA 2L0PA 4MZJA 2EC6B 1C7VA 4P2YB 4I5KA 1XVJA 2F33A 1WDCB 1U5IB 4NDDA 3BUXB 3IQOA 4GGNA 4F0ZB 1WRZA 4YGDB 4AOMA 1A29A 5HKYA 2GV5A 4ORBB 2BECA 2KBIA 2KAXA 2EC6C 1IQ5A 2MLFC 1UURA 1K9PA 3OP0A 3PN7B 5JOLA 4MBEA 3SG3A 3SG7A 1KQVA 3SIAA 1DVIA 2M49B 1CFFA 1K96A 1PVBA 1UHNA 2KAVA 2CTNA 5J3XA 5K89A 2KYCA 1NCZA 1TNPA 2NCOA 2KFHA 2K2AA 2EHBA 1UHIA 2L98A 1B1GA 1K9UA 3NSIA 1CB1A 1WY9A 2FOTA 4IL1A 3WXAA 1WLZA 2M97A 1FPWA 3O2PA 5DKQA 4ETOA 5FYXA 1NSHA 3EVVA 2JT0A 1JF2A 3CZTX 2KYFA 3BUOB 4M2OA 1QV1A 1EXRA 2PMYA 1KK7Y 3HX4A 1B47A 2KBMA 4YGCB 2M7NA 4MVFA 1V1FA 1Y1UA 3DD4A 2BKHB 3KPXA 1M63B 2KSPA 1BT6A 2TN4A 5CSJA 1KQMC 1DT7B 1OZSA 3BQ3A 1FW4A 1JF0A 2LP3A 2M1KB 2HF5A 5CSIA 2F2OA 2LE9B 2LVIA 2ZNDA 3NSOA 4CPVA 2GGZA 1K2HA 4A4BA 2BBMA 1M45A 2K7DA 4PHKA 1BU3A 1PALA 1ZACA 3KHEA 3VRPA 4PE4A 1DJWA 1KFXL 1WLMA 1Y1XA 2LVVA 3CLNA 3I5GC 4GPLB 5AANA 5JJGA 3OX6A 4QJ4B 2LLSA 5CSFA 2JU0A 1J7RA 2M29A 4OV2A 2LM5A 3LL8B 1EG4A 4PHJA 1JSAA 3AAKA 3ZWHA 1GQMA 4USLA 1SCMC 1QX2A 1R6PA 1AJ5A 4PE0A 3EKJA 4PALA 2CT9A 3DVKA 2JT8A 2F3YA 3K21A 3EVRA 1W7JB 1F71A 2MBXA 1S5GY 2JOJA 5KSZA 2LVJA 1K90D 2CNPA 3JVTB 1QATA 2M8UA 2BCXA 1LA3A 1QX7A 3BUNB 3QRXA 5ER4X 3IF7A 4BY4A 2D8NA 3CR2A 2LUCA 3O6BA 2BCAA 3PFVA 1TNQA 3I5IB 1J1DA 1J55A 5HKZA 1M46A 2IS9A 2JWWA 5B8IB 4XJKA 2LLUA 3LK1A 2M0RA 1S36A 3JVTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMR A;  1QVI Z;  3EK8 A;  2HQ8 A;  3I5F B;  2PAS A;  2ZN8 A;  3D0Y B;  2L5X B;  4JWQ A;  2HPS A;  4WQ3 A;  2LNK A;  2JUL A;  3TZ1 A;  1CDM A;  1SPY A;  2JXC A;  2WND A;  1XO5 A;  1QAS A;  3FIA A;  1DJX A;  3CTN A;  2RGI A;  1PSR A;  1U5I A;  4UPG A;  1XFV O;  3I5F C;  3C1V A;  4DS7 A;  1OOJ A;  1YUU A;  1QJT A;  1TOP A;  1XFZ O;  1PK0 D;  1B7T Y;  1K93 D;  3KO0 A;  2B1U A;  3VGO A;  4MEW A;  4BY5 A;  1NX2 A;  3PAT A;  2OTG B;  2F3Z A;  1M31 A;  2I94 A;  1KK8 C;  2KNE A;  2L2E A;  5KU1 A;  1ZMZ A;  2KAY A;  1F4Q A;  1KSO A;  1KFU L;  1KSM A;  1SRA A;  2Y5I A;  1ZUZ A;  1AP4 A;  2M9G A;  4M2P A;  4YBH B;  1NX3 A;  2OTG C;  4MRY A;  1D1O A;  2MRD A;  1SKT A;  2H2K A;  2WCB A;  1JFJ A;  1WRK A;  2I2R E;  1RK9 A;  2K8M B;  1SNL A;  1ODB A;  3BOW A;  5HLV A;  4GGF C;  1EJ3 A;  2G2B A;  1FBV A;  1S26 D;  2LAP A;  2NLN A;  2JTT A;  2LMU A;  1RTP 1;  1ALV A;  2JTZ A;  2ZFD A;  5DKR A;  1KFX S;  1A03 A;  1TNX A;  2BL0 B;  3AKA A;  1IKU A;  2Q91 A;  3BXK A;  4MN0 A;  4MLW A;  2JRF A;  4AQJ A;  1KQM B;  2WC8 A;  2E30 A;  4C0K A;  4D1E A;  3MSE B;  3O78 A;  2WOR A;  1Q80 A;  1NX0 A;  4FTG A;  2K7B A;  4MZK A;  2Y1N A;  2BL0 C;  3IQQ A;  1MQ1 A;  5F6T A;  1BOD A;  1SK6 D;  1UHK A;  2ZNE A;  2BCB A;  1OZO A;  1XK4 A;  4XYN A;  1CNP A;  1CMG A;  2JZI A;  5AER A;  1MF8 B;  2JT3 A;  1N2D A;  2ZN9 A;  2LHI A;  4MSP A;  5HLO A;  2CCM A;  3KF9 A;  1K94 A;  3I5G B;  1RJV A;  3E3R A;  3DVM A;  1AJ4 A;  3BUM B;  1EG3 A;  1BJF A;  1LA0 A;  1M39 A;  1NYA A;  1HT9 A;  2WCE A;  1NX1 A;  1F8H A;  1S3P A;  1QIW A;  3HCM A;  1K8U A;  2K7C A;  3WHU B;  1GJY A;  1FF1 A;  1JBA A;  1SCM B;  2R2I A;  1L7Z A;  3EVU A;  1CDP A;  1G4Y R;  1YUS A;  3FWB A;  1L2O C;  1DJZ A;  1SL9 A;  2ISD A;  4YI8 A;  4CID A;  4WQ2 A;  1UHH A;  3EKH A;  3GK4 X;  2OS8 C;  5G08 A;  3O4Y A;  4I5N B;  1K9K A;  1F4O A;  2JNX A;  1LXF C;  1PVA A;  3NSL A;  3OX5 A;  2NXQ A;  5KTY A;  2AUC A;  3WHT B;  3EK7 A;  1DJG A;  1R2U A;  1XFW O;  2O5G A;  4C0J A;  1B8L A;  4HRE E;  1TRF A;  4PHM A;  4GAO A;  2Q4U A;  2MA2 A;  2EGD A;  3LLE A;  4GFT A;  1CLB A;  1N0Y A;  2MHH A;  3F45 A;  4DCK A;  1FI6 A;  3AAJ A;  1NUB A;  1MR8 A;  3GK1 A;  1Y1A A;  2COL B;  1H4B A;  3OB1 B;  2K2F A;  3JTD C;  2BBN A;  3CGA A;  4JPZ B;  3D0Y A;  2G9B A;  1DF0 B;  1S1E A;  3TDI A;  1F54 A;  4YGE B;  1OMV A;  5AFP A;  1OE9 B;  4N1F A;  4MZL A;  1Y6W A;  1CTR A;  3CR5 X;  2L51 A;  3DF0 B;  2LC5 A;  2KQ6 A;  1W7I B;  1AHR A;  1NIW A;  5GQQ C;  1BR4 B;  1TTX A;  4L9M A;  2KGB C;  1CDN A;  1C07 A;  2F8P A;  3LK0 A;  4I5L B;  1S5G Z;  3DVE A;  4PHN A;  3CR4 X;  1MXE A;  3OHM B;  1IRJ A;  3ZNI A;  2GGM A;  2NZ0 A;  3TUY B;  1LKJ A;  2KFG A;  4CFQ A;  3DVJ A;  4HRH A;  1J7P A;  2PRU A;  1BMO A;  1A2X A;  1YR5 A;  5TNC A;  1JFK A;  1QV0 A;  2KFF A;  5BPJ A;  4NQG A;  2BE6 A;  1QLS A;  4NDB A;  4OCI A;  2M7L A;  1SY9 A;  1KK8 B;  4QJ3 B;  1PRW A;  3TUY C;  2BE4 A;  3RM1 A;  1S6J A;  2KQY A;  1G33 A;  1CFP A;  1FI5 A;  1V1G A;  2MAZ A;  1A75 B;  2JPT A;  1CFC A;  3GK2 A;  4DIR A;  4A4C A;  1ZOT B;  1UWO A;  1AK8 A;  1KCY A;  4ICB A;  2Y1M A;  1YVL A;  4YI9 A;  1F55 A;  2PAL A;  3VRO A;  4HRG A;  4YRU A;  1BR1 B;  2KOT A;  4XJK B;  1CLL A;  4M2Q A;  4DRW A;  3D10 A;  3PSR A;  3VRQ A;  4YGA A;  1N65 A;  2H61 C;  2PVB A;  2E6W A;  1PUL A;  1NCY A;  1SBJ A;  4PE7 A;  1CLM A;  1YX7 A;  1NWD A;  1CDL A;  4ZCU A;  2LMT A;  1MXL C;  1RWY A;  3GOF A;  3SIB A;  3SG4 A;  1UP5 A;  4P5O E;  1TIZ A;  2F2P A;  1IJ6 A;  2PSR A;  1YTZ C;  4CLN A;  5ER5 A;  1XFX O;  3AKB A;  1MUX A;  3VRR A;  4CFR A;  3I5H B;  3SJS A;  1CKK A;  1B8C A;  2L4H A;  3SG6 A;  1E8A A;  2WOS A;  2AMI A;  1BLQ A;  1HQV A;  1ZFS A;  1WRL A;  2QPT A;  1QX5 B;  5CSN A;  1RRO A;  1B9A A;  4ORA B;  1BF5 A;  2A4J A;  1DGV A;  1WDC C;  2JXL A;  4MRX A;  4QJ5 B;  2BKI B;  1XA5 A;  2O60 A;  3VRN A;  1B4C A;  2ZRS A;  1DTL A;  2FCD A;  3I5H C;  1IH0 A;  2K61 A;  1QTX A;  2LV7 A;  3M0W A;  3OB2 B;  2DOQ A;  5DKN A;  3PN7 C;  3WNX B;  3CS1 A;  4N5X A;  5D69 A;  1J7Q A;  1JWD A;  2P6B B;  2VRG A;  2CXJ A;  1L2O B;  2KI6 C;  2LCP A;  2I7A A;  2KGR A;  4OVN F;  2JQ6 A;  5I8N A;  3BOW B;  2OS8 B;  1KK7 Z;  3SG5 A;  3TDZ A;  1TNW A;  1KWO B;  1DJY A;  4GBA A;  1EH2 A;  1DMO A;  5I2L A;  4E68 A;  1YVH A;  1YRT B;  4ZCV A;  5I2Q A;  3TDU A;  3SG2 A;  1IQ3 A;  2LAN A;  4ORC B;  1CM4 A;  1S6C A;  2L50 A;  4N1G A;  5I2O A;  2AAO A;  1S6I A;  1TN4 A;  2ZRT A;  1SW8 A;  1LIN A;  3NSK A;  4WRI A;  2OPO A;  1KWO C;  1OQP A;  3H4S E;  1NPQ A;  1K95 A;  1DF0 A;  2KI6 D;  3JTD B;  2JNF A;  2LHL A;  2K7O A;  1XYD A;  4AQI A;  1YX8 A;  3DF0 A;  4OKH A;  1SR6 B;  1GGZ A;  5IBW A;  3A8R A;  3EK4 A;  4GNK B;  1QS7 A;  2ZKM X;  1G8I A;  3CWG A;  2SCP A;  3BYA A;  3ICB A;  1QIV A;  2KDH A;  4TNC A;  1AUI B;  2KHN A;  5CPV A;  4Q04 A;  1SR6 C;  1XFY O;  1J7O A;  1LVC D;  4U8D A;  2I18 A;  1H8B A;  1TCF A;  2HET A;  2LVK A;  3KEV A;  1SL8 A;  1XK4 C;  1SYM A;  5PAL A;  1KFU S;  4R1E A;  1YUR A;  4PCW A;  1J1E A;  3PAL A;  4NDC A;  1CMF A;  3FWC A;  2LLT A;  3BUW B;  5AEQ A;  1QVI Y;  4C0L A;  2LUX A;  3A4U B;  1OSA A;  3FS7 A;  1IG5 A;  1MWN A;  1C7W A;  1CFD A;  2L4I A;  1A75 A;  2LP2 A;  2LMV A;  1ALW A;  2H61 A;  4PDZ A;  2M3W A;  1NCX A;  1F70 A;  1PSB A;  2MLE C;  3TS5 B;  4HSZ A;  1AVS A;  2JC2 A;  1VRK A;  4GGF A;  4PE1 A;  5HYD A;  3PLF B;  1X02 A;  5D7F A;  5HKW A;  4YGB B;  2KI4 B;  2V53 A;  1JUO A;  1CM1 A;  1SL7 A;  2MJW B;  5AXI A;  1IJ5 A;  1RFJ A;  1A4P A;  2FJU B;  3TS5 C;  1QXP A;  1EL4 A;  3I5I C;  1B8R A;  3NXA A;  2K0J A;  2QAC A;  4JQ0 D;  2SAS A;  4I5J A;  2NCP A;  1BOC A;  2FCE A;  1BG1 A;  1XFU O;  1IGV A;  4FQO A;  2CBL A;  1QLK A;  1SMG A;  1YRU B;  1Y0V H;  2KI4 C;  1TCO B;  1MHO A;  1YUT A;  1REC A;  3PM8 A;  1NP8 A;  1UHJ A;  1SCV A;  3LCP C;  1B7T Z;  3RLZ A;  1JC2 A;  2HQW A;  2WCF A;  4GUK A;  1DJI A;  1DGU A;  4OR9 B;  2Y4Q A;  4DUQ A;  2M1U A;  1GGW A;  1DJH A;  1IWQ A;  1OMD A;  1UUS A;  2L0P A;  4MZJ A;  2EC6 B;  1C7V A;  4P2Y B;  4I5K A;  1XVJ A;  2F33 A;  1WDC B;  1U5I B;  4NDD A;  3BUX B;  3IQO A;  4GGN A;  4F0Z B;  1WRZ A;  4YGD B;  4AOM A;  1A29 A;  5HKY A;  2GV5 A;  4ORB B;  2BEC A;  2KBI A;  2KAX A;  2EC6 C;  1IQ5 A;  2MLF C;  1UUR A;  1K9P A;  3OP0 A;  3PN7 B;  5JOL A;  4MBE A;  3SG3 A;  3SG7 A;  1KQV A;  3SIA A;  1DVI A;  2M49 B;  1CFF A;  1K96 A;  1PVB A;  1UHN A;  2KAV A;  2CTN A;  5J3X A;  5K89 A;  2KYC A;  1NCZ A;  1TNP A;  2NCO A;  2KFH A;  2K2A A;  2EHB A;  1UHI A;  2L98 A;  1B1G A;  1K9U A;  3NSI A;  1CB1 A;  1WY9 A;  2FOT A;  4IL1 A;  3WXA A;  1WLZ A;  2M97 A;  1FPW A;  3O2P A;  5DKQ A;  4ETO A;  5FYX A;  1NSH A;  3EVV A;  2JT0 A;  1JF2 A;  3CZT X;  2KYF A;  3BUO B;  4M2O A;  1QV1 A;  1EXR A;  2PMY A;  1KK7 Y;  3HX4 A;  1B47 A;  2KBM A;  4YGC B;  2M7N A;  4MVF A;  1V1F A;  1Y1U A;  3DD4 A;  2BKH B;  3KPX A;  1M63 B;  2KSP A;  1BT6 A;  2TN4 A;  5CSJ A;  1KQM C;  1DT7 B;  1OZS A;  3BQ3 A;  1FW4 A;  1JF0 A;  2LP3 A;  2M1K B;  2HF5 A;  5CSI A;  2F2O A;  2LE9 B;  2LVI A;  2ZND A;  3NSO A;  4CPV A;  2GGZ A;  1K2H A;  4A4B A;  2BBM A;  1M45 A;  2K7D A;  4PHK A;  1BU3 A;  1PAL A;  1ZAC A;  3KHE A;  3VRP A;  4PE4 A;  1DJW A;  1KFX L;  1WLM A;  1Y1X A;  2LVV A;  3CLN A;  3I5G C;  4GPL B;  5AAN A;  5JJG A;  3OX6 A;  4QJ4 B;  2LLS A;  5CSF A;  2JU0 A;  1J7R A;  2M29 A;  4OV2 A;  2LM5 A;  3LL8 B;  1EG4 A;  4PHJ A;  1JSA A;  3AAK A;  3ZWH A;  1GQM A;  4USL A;  1SCM C;  1QX2 A;  1R6P A;  1AJ5 A;  4PE0 A;  3EKJ A;  4PAL A;  2CT9 A;  3DVK A;  2JT8 A;  2F3Y A;  3K21 A;  3EVR A;  1W7J B;  1F71 A;  2MBX A;  1S5G Y;  2JOJ A;  5KSZ A;  2LVJ A;  1K90 D;  2CNP A;  3JVT B;  1QAT A;  2M8U A;  2BCX A;  1LA3 A;  1QX7 A;  3BUN B;  3QRX A;  5ER4 X;  3IF7 A;  4BY4 A;  2D8N A;  3CR2 A;  2LUC A;  3O6B A;  2BCA A;  3PFV A;  1TNQ A;  3I5I B;  1J1D A;  1J55 A;  5HKZ A;  1M46 A;  2IS9 A;  2JWW A;  5B8I B;  4XJK A;  2LLU A;  3LK1 A;  2M0R A;  1S36 A;  3JVT C; 
#chains in the Genus database with same CATH topology
 1OMR A;  1TUZ A;  1QVI Z;  3EK8 A;  2HQ8 A;  3I5F B;  2PAS A;  2ZN8 A;  3D0Y B;  3S0G A;  2L5X B;  4JWQ A;  2HPS A;  4WQ3 A;  2LNK A;  2JUL A;  3TZ1 A;  1CDM A;  4JKT A;  1SPY A;  2JXC A;  2WND A;  1XO5 A;  1QAS A;  3FIA A;  1DJX A;  3CTN A;  2RGI A;  1PSR A;  1U5I A;  1W9Z A;  3RZS A;  4UPG A;  1XFV O;  3I5F C;  3C1V A;  4DS7 A;  1OOJ A;  1YUU A;  1QJT A;  1TOP A;  1XFZ O;  1PK0 D;  1B7T Y;  1K93 D;  3KO0 A;  2B1U A;  3VGO A;  4MEW A;  4BY5 A;  1NX2 A;  3PAT A;  2OTG B;  3EG5 B;  2F3Z A;  1M31 A;  2I94 A;  2WCL A;  1KK8 C;  2KNE A;  2L2E A;  5KU1 A;  5I94 A;  1ZMZ A;  2KAY A;  1F4Q A;  1KSO A;  1KFU L;  1KSM A;  1SRA A;  2Y5I A;  1ZUZ A;  1AP4 A;  2M9G A;  4M2P A;  4YBH B;  3Q8I A;  1NX3 A;  2OTG C;  4MRY A;  1D1O A;  2MRD A;  1SKT A;  2H2K A;  2WCB A;  1JFJ A;  1WRK A;  2I2R E;  1RK9 A;  2K8M B;  3D78 A;  1SNL A;  1ODB A;  3BOW A;  5HLV A;  3CZ0 A;  4GGF C;  1EJ3 A;  2G2B A;  1FBV A;  1S26 D;  2LAP A;  2NLN A;  1DC1 A;  2JTT A;  3S0A A;  2LMU A;  1RTP 1;  1ALV A;  2JTZ A;  2ZFD A;  5DKR A;  3BFB A;  1KFX S;  1A03 A;  1TNX A;  2BL0 B;  3AKA A;  1IKU A;  2Q91 A;  3BXK A;  4MN0 A;  4MLW A;  2JRF A;  4AQJ A;  1KQM B;  2WC8 A;  2E30 A;  1C3Y A;  3B87 A;  4C0K A;  4D1E A;  3MSE B;  3O78 A;  2WOR A;  1Q80 A;  3S0E A;  1NX0 A;  4FTG A;  2K7B A;  4MZK A;  2Y1N A;  2BL0 C;  3BJH A;  3IQQ A;  1MQ1 A;  5F6T A;  1BOD A;  1SK6 D;  1UHK A;  2ZNE A;  2BCB A;  3L4L A;  1OZO A;  1XK4 A;  4XYN A;  1CNP A;  1CMG A;  2JZI A;  5AER A;  1MF8 B;  2JT3 A;  1N2D A;  2ZN9 A;  2LHI A;  3D76 A;  4MSP A;  5HLO A;  2CCM A;  1ORG A;  1GM0 A;  3KF9 A;  1K94 A;  3I5G B;  1RJV A;  2YGU A;  3E3R A;  3DVM A;  1AJ4 A;  3BUM B;  1EG3 A;  1BJF A;  1LA0 A;  1M39 A;  1NYA A;  1HT9 A;  2WCE A;  1NX1 A;  1DEK A;  1F8H A;  1S3P A;  1QIW A;  3B88 A;  3HCM A;  1K8U A;  2K7C A;  3WHU B;  1GJY A;  1FF1 A;  1JBA A;  1SCM B;  2R2I A;  1L7Z A;  3EVU A;  1CDP A;  1G4Y R;  1YUS A;  3FWB A;  2L5Y A;  4JD9 A;  1L2O C;  1DJZ A;  1SL9 A;  2ISD A;  4YI8 A;  4CID A;  4WQ2 A;  1UHH A;  2QEH A;  3EKH A;  2OS8 C;  3GK4 X;  5G08 A;  3O4Y A;  4I5N B;  1K9K A;  1F4O A;  2JNX A;  1LXF C;  1PVA A;  3NSL A;  3OX5 A;  2NXQ A;  5KTY A;  2AUC A;  3WHT B;  3EK7 A;  1DJG A;  1R2U A;  1XFW O;  1OW4 A;  2O5G A;  4C0J A;  1B8L A;  4HRE E;  1TRF A;  2BAP A;  4PHM A;  4GAO A;  2Q4U A;  2MA2 A;  2EGD A;  3LLE A;  4GFT A;  1CLB A;  1N0Y A;  2MHH A;  3F45 A;  4DCK A;  1FI6 A;  3AAJ A;  1NUB A;  3SS5 A;  1MR8 A;  2WCJ A;  3GK1 A;  1Y1A A;  2COL B;  1H4B A;  3UNW A;  3OB1 B;  2K2F A;  3JTD C;  2BBN A;  3CGA A;  4JPZ B;  3CAB A;  3D0Y A;  2G9B A;  1DF0 B;  1S1E A;  3TDI A;  1F54 A;  4YGE B;  3B6X A;  1OMV A;  5AFP A;  1OE9 B;  3N7H A;  4N1F A;  4MZL A;  1Y6W A;  1CTR A;  3CR5 X;  2JPO A;  2L51 A;  2LC5 A;  3DF0 B;  3DYE A;  2KQ6 A;  1W7I B;  1AHR A;  1NIW A;  5GQQ C;  1BR4 B;  1TTX A;  4L9M A;  2KGB C;  1CDN A;  1C07 A;  2F8P A;  2PYQ A;  3LK0 A;  4I5L B;  1S5G Z;  3BFA A;  3DVE A;  4PHN A;  3CR4 X;  1MXE A;  3OHM B;  1IRJ A;  3ZNI A;  2GGM A;  2NZ0 A;  3TUY B;  1LKJ A;  2KFG A;  4CFQ A;  3DVJ A;  4HRH A;  3S0F A;  1J7P A;  2PRU A;  1BMO A;  1A2X A;  1YR5 A;  5TNC A;  1JFK A;  1QV0 A;  2KFF A;  5BPJ A;  4NQG A;  2BE6 A;  1QLS A;  3B86 A;  4NDB A;  4OCI A;  2M7L A;  1SY9 A;  1KK8 B;  3NGV A;  4QJ3 B;  1PRW A;  2QDI A;  3TUY C;  2BE4 A;  3RM1 A;  1S6J A;  2KQY A;  1G33 A;  1CFP A;  1FI5 A;  1V1G A;  2MAZ A;  1A75 B;  2QEB A;  2JPT A;  1CFC A;  3GK2 A;  3SS4 A;  4DIR A;  4A4C A;  4INW A;  1ZOT B;  3D77 A;  2KLE A;  1UWO A;  1AK8 A;  1KCY A;  4ICB A;  2Y1M A;  1OOG A;  1YVL A;  4PT1 A;  2PAL A;  4YI9 A;  3VRO A;  1F55 A;  4HRG A;  4YRU A;  1BR1 B;  2KOT A;  3R1O A;  1CLL A;  4M2Q A;  4XJK B;  4DRW A;  4KYN A;  3D10 A;  3PSR A;  3VRQ A;  4YGA A;  1N65 A;  1TUJ A;  2H61 C;  2PVB A;  2E6W A;  1PUL A;  1NCY A;  1SBJ A;  4PE7 A;  1CLM A;  1YX7 A;  1NWD A;  1CDL A;  4ZCU A;  2LMT A;  1MXL C;  1RWY A;  3GOF A;  3SIB A;  2QEV A;  2FJY A;  3SG4 A;  1UP5 A;  4P5O E;  1TIZ A;  2F2P A;  1IJ6 A;  2PSR A;  1YTZ C;  4CLN A;  5ER5 A;  1XFX O;  3AKB A;  1Z4H A;  1MUX A;  3FE9 A;  3VRR A;  4CFR A;  3I5H B;  3SJS A;  1CKK A;  1B8C A;  2L4H A;  3SG6 A;  1E8A A;  2WOS A;  2AMI A;  1BLQ A;  1OOI X;  1HQV A;  1ZFS A;  1WRL A;  2BNX A;  1QX5 B;  2QPT A;  1RRO A;  3OGN A;  5CSN A;  1B9A A;  4ORA B;  1BF5 A;  2A4J A;  1DGV A;  1WDC C;  1XFR A;  2JXL A;  4MRX A;  4QJ5 B;  2BKI B;  1XA5 A;  2O60 A;  3VRN A;  1B4C A;  2ZRS A;  1DTL A;  2FCD A;  3I5H C;  3R1P A;  1IH0 A;  2K61 A;  1QTX A;  2LV7 A;  3M0W A;  3OB2 B;  1TWO A;  2DOQ A;  3SS3 A;  5DKN A;  3PN7 C;  3WNX B;  3CS1 A;  4N5X A;  5D69 A;  1J7Q A;  1JWD A;  2P6B B;  2VRG A;  2CXJ A;  1L2O B;  2KI6 C;  3O4X A;  2LCP A;  2I7A A;  2KGR A;  2L2C A;  2JQ6 A;  3CZ2 A;  4OVN F;  5I8N A;  3BOW B;  2OS8 B;  1KK7 Z;  3SG5 A;  3TDZ A;  1TNW A;  1KWO B;  1DJY A;  4GBA A;  1EH2 A;  1DMO A;  5I2L A;  3S0B A;  4E68 A;  1OOF A;  1YVH A;  1YRT B;  4ZCV A;  5I2Q A;  3B7A A;  2WCM A;  3TDU A;  3SG2 A;  1Z2C B;  1IQ3 A;  2LAN A;  4ORC B;  1CM4 A;  1S6C A;  2L50 A;  4N1G A;  5I2O A;  2AAO A;  1S6I A;  1TN4 A;  2ZRT A;  3IVT A;  1SW8 A;  1LIN A;  3NSK A;  4WRI A;  2OPO A;  1KWO C;  1OQP A;  3H4S E;  1NPQ A;  4OZD A;  3V2L A;  1DEL A;  1K95 A;  1DF0 A;  2KI6 D;  3JTD B;  2JNF A;  2LHL A;  2K7O A;  1XYD A;  4AQI A;  1YX8 A;  3DF0 A;  4OKH A;  1SR6 B;  1GGZ A;  5IBW A;  3A8R A;  3EK4 A;  4GNK B;  1QS7 A;  2ZKM X;  1G8I A;  3CWG A;  2WCH A;  2SCP A;  3BYA A;  3ICB A;  1QIV A;  2KDH A;  4IJ7 A;  4TNC A;  1QWV A;  1AUI B;  2KHN A;  5CPV A;  4Q04 A;  1SR6 C;  1XFY O;  1J7O A;  5EL2 A;  1LVC D;  4U8D A;  5FI6 A;  2I18 A;  1H8B A;  1TCF A;  2HET A;  2LVK A;  3KEV A;  1SL8 A;  1XK4 C;  1SYM A;  5PAL A;  1KFU S;  3D74 A;  1YUR A;  3OBV A;  4PCW A;  4R1E A;  1J1E A;  3PAL A;  4NDC A;  1CMF A;  3FWC A;  2LLT A;  3BUW B;  5AEQ A;  1QVI Y;  4C0L A;  2LUX A;  3A4U B;  1OSA A;  3FS7 A;  1IG5 A;  1MWN A;  1C7W A;  1CFD A;  2L4I A;  3L47 A;  1A75 A;  2LP2 A;  2LMV A;  1ALW A;  2H61 A;  4PDZ A;  2M3W A;  1NCX A;  1F70 A;  1PSB A;  3L4A A;  2MLE C;  3TS5 B;  3K1E A;  3PM2 A;  4HSZ A;  1AVS A;  2JC2 A;  1VRK A;  4GGF A;  4PE1 A;  3NHI A;  5HYD A;  3PLF B;  1X02 A;  5D7F A;  5HKW A;  4YGB B;  2KI4 B;  2V53 A;  1JUO A;  1CM1 A;  1SL7 A;  2MJW B;  5AXI A;  1IJ5 A;  5DIC A;  1RFJ A;  1A4P A;  2FJU B;  3TS5 C;  1QXP A;  1EL4 A;  3I5I C;  1B8R A;  3NXA A;  2K0J A;  2QAC A;  3R1V A;  4JQ0 D;  2SAS A;  4I5J A;  2NCP A;  1BOC A;  2FCE A;  1BG1 A;  2GTE A;  1XFU O;  1IGV A;  3VB1 A;  4FQO A;  2CBL A;  1QLK A;  1SMG A;  1YRU B;  3CZ1 A;  1Y0V H;  2KLD A;  2KI4 C;  1TCO B;  3PJI A;  1MHO A;  1T14 A;  1YUT A;  1REC A;  3DZT A;  4INX A;  2H8V A;  3PM8 A;  1NP8 A;  1UHJ A;  1SCV A;  3S0D A;  3LCP C;  1B7T Z;  3RLZ A;  1JC2 A;  2P71 A;  2HQW A;  2WCF A;  4GUK A;  1DJI A;  1DGU A;  4OR9 B;  2Y4Q A;  4DUQ A;  2M1U A;  1GGW A;  1DJH A;  1IWQ A;  1OMD A;  1UUS A;  2L0P A;  4MZJ A;  2EC6 B;  1C7V A;  2QEO A;  4P2Y B;  4I5K A;  1XVJ A;  2F33 A;  1WDC B;  1U5I B;  4NDD A;  3BUX B;  3IQO A;  3UO9 A;  4GGN A;  4F0Z B;  1WRZ A;  5FI7 A;  4YGD B;  4AOM A;  1A29 A;  5HKY A;  2GV5 A;  4ORB B;  2BEC A;  2KBI A;  2KAX A;  3CDN A;  3D75 A;  4F7F A;  2EC6 C;  1IQ5 A;  2MLF C;  1UUR A;  1K9P A;  3D73 A;  3OP0 A;  3PN7 B;  4MBE A;  5JOL A;  3SG7 A;  3SG3 A;  1KQV A;  5JJG A;  5D3O A;  3SIA A;  3QME A;  1DVI A;  3CYZ A;  1DQE A;  2M49 B;  5FI2 A;  1CFF A;  1K96 A;  1PVB A;  1UHN A;  2KAV A;  2CTN A;  5J3X A;  5K89 A;  2KYC A;  1NCZ A;  3BFH A;  1TNP A;  2NCO A;  2KFH A;  2K2A A;  2EHB A;  1UHI A;  2L98 A;  1B1G A;  1K9U A;  3NSI A;  1CB1 A;  1WY9 A;  2FOT A;  4IL1 A;  3WXA A;  1WLZ A;  2M97 A;  1FPW A;  3O2P A;  5DKQ A;  4ETO A;  5FYX A;  1NSH A;  2K60 A;  2JT0 A;  1JF2 A;  1SSE B;  2WC6 A;  2KYF A;  3CZT X;  3BUO B;  3EVV A;  4M2O A;  1QV1 A;  1EXR A;  2PMY A;  1KK7 Y;  3HX4 A;  1B47 A;  1OOH A;  2KBM A;  4YGC B;  2M7N A;  4MVF A;  1V1F A;  1Y1U A;  2PQL A;  3DD4 A;  2BKH B;  3KPX A;  1M63 B;  2KSP A;  1IIO A;  1BT6 A;  2TN4 A;  5CSJ A;  1KQM C;  1DT7 B;  1OZS A;  3BQ3 A;  1FW4 A;  1JF0 A;  2LP3 A;  2M1K B;  2WC5 A;  2HF5 A;  5CSI A;  2F2O A;  2LE9 B;  2LVI A;  2ZND A;  3R72 A;  3NSO A;  4CPV A;  2WCK A;  2GGZ A;  1K2H A;  4FQT A;  4A4B A;  2BBM A;  2KPH A;  1M45 A;  2K7D A;  4PHK A;  1BU3 A;  1PAL A;  1ZAC A;  3KHE A;  3VRP A;  4PE4 A;  1DJW A;  1KFX L;  1WLM A;  1Y1X A;  2LVV A;  3CLN A;  3FE8 A;  3I5G C;  4GPL B;  5AAN A;  3OX6 A;  4QJ4 B;  2LLS A;  5CSF A;  2JU0 A;  1J7R A;  2M29 A;  3NHT A;  4OV2 A;  2LM5 A;  3LL8 B;  1EG4 A;  4PHJ A;  1JSA A;  3AAK A;  3ZWH A;  1P28 A;  1GQM A;  4USL A;  1SCM C;  1QX2 A;  1R6P A;  1AJ5 A;  4PE0 A;  3EKJ A;  1LS8 A;  2CT9 A;  4PAL A;  3DVK A;  3DXL A;  2JT8 A;  2P70 A;  2F3Y A;  3DY9 A;  3K21 A;  3EVR A;  5HL1 A;  1W7J B;  1F71 A;  2MBX A;  1S5G Y;  2JOJ A;  5KSZ A;  2LVJ A;  1K90 D;  2CNP A;  3JVT B;  1QAT A;  2M8U A;  2BCX A;  1LA3 A;  1QX7 A;  3BUN B;  3QRX A;  5ER4 X;  3IF7 A;  4BY4 A;  2D8N A;  3CR2 A;  2LUC A;  3O6B A;  2BCA A;  3PFV A;  1TNQ A;  2ERB A;  1J1D A;  1J55 A;  3I5I B;  1M46 A;  2IS9 A;  2JWW A;  3FE6 A;  5HKZ A;  5B8I B;  4XJK A;  2LLU A;  3LK1 A;  1C3Z A;  2M0R A;  1S36 A;  3JVT C; 
#chains in the Genus database with same CATH homology
 1OMR A;  1QVI Z;  3EK8 A;  2HQ8 A;  3I5F B;  2PAS A;  2ZN8 A;  3D0Y B;  2L5X B;  4JWQ A;  2HPS A;  4WQ3 A;  2LNK A;  2JUL A;  3TZ1 A;  1CDM A;  1SPY A;  2JXC A;  2WND A;  1XO5 A;  1QAS A;  3FIA A;  1DJX A;  3CTN A;  2RGI A;  1PSR A;  1U5I A;  4UPG A;  1XFV O;  3I5F C;  3C1V A;  4DS7 A;  1OOJ A;  1YUU A;  1QJT A;  1TOP A;  1XFZ O;  1PK0 D;  1B7T Y;  1K93 D;  3KO0 A;  2B1U A;  3VGO A;  4MEW A;  4BY5 A;  1NX2 A;  3PAT A;  2OTG B;  2F3Z A;  1M31 A;  2I94 A;  1KK8 C;  2KNE A;  2L2E A;  5KU1 A;  1ZMZ A;  2KAY A;  1F4Q A;  1KSO A;  1KFU L;  1KSM A;  1SRA A;  2Y5I A;  1ZUZ A;  1AP4 A;  2M9G A;  4M2P A;  4YBH B;  1NX3 A;  2OTG C;  4MRY A;  1D1O A;  2MRD A;  1SKT A;  2H2K A;  2WCB A;  1JFJ A;  1WRK A;  2I2R E;  1RK9 A;  2K8M B;  1SNL A;  1ODB A;  3BOW A;  5HLV A;  4GGF C;  1EJ3 A;  2G2B A;  1FBV A;  1S26 D;  2LAP A;  2NLN A;  2JTT A;  2LMU A;  1RTP 1;  1ALV A;  2JTZ A;  2ZFD A;  5DKR A;  1KFX S;  1A03 A;  1TNX A;  2BL0 B;  3AKA A;  1IKU A;  2Q91 A;  3BXK A;  4MN0 A;  4MLW A;  2JRF A;  4AQJ A;  1KQM B;  2WC8 A;  2E30 A;  4C0K A;  4D1E A;  3MSE B;  3O78 A;  2WOR A;  1Q80 A;  1NX0 A;  4FTG A;  2K7B A;  4MZK A;  2Y1N A;  2BL0 C;  3IQQ A;  1MQ1 A;  5F6T A;  1BOD A;  1SK6 D;  1UHK A;  2ZNE A;  2BCB A;  1OZO A;  1XK4 A;  4XYN A;  1CNP A;  1CMG A;  2JZI A;  5AER A;  1MF8 B;  2JT3 A;  1N2D A;  2ZN9 A;  2LHI A;  4MSP A;  5HLO A;  2CCM A;  3KF9 A;  1K94 A;  3I5G B;  1RJV A;  3E3R A;  3DVM A;  1AJ4 A;  3BUM B;  1EG3 A;  1BJF A;  1LA0 A;  1M39 A;  1NYA A;  1HT9 A;  2WCE A;  1NX1 A;  1F8H A;  1S3P A;  1QIW A;  3HCM A;  1K8U A;  2K7C A;  3WHU B;  1GJY A;  1FF1 A;  1JBA A;  1SCM B;  2R2I A;  1L7Z A;  3EVU A;  1CDP A;  1G4Y R;  1YUS A;  3FWB A;  1L2O C;  1DJZ A;  1SL9 A;  2ISD A;  4YI8 A;  4CID A;  4WQ2 A;  1UHH A;  3EKH A;  3GK4 X;  2OS8 C;  5G08 A;  3O4Y A;  4I5N B;  1K9K A;  1F4O A;  2JNX A;  1LXF C;  1PVA A;  3NSL A;  3OX5 A;  2NXQ A;  5KTY A;  2AUC A;  3WHT B;  3EK7 A;  1DJG A;  1R2U A;  1XFW O;  2O5G A;  4C0J A;  1B8L A;  4HRE E;  1TRF A;  4PHM A;  4GAO A;  2Q4U A;  2MA2 A;  2EGD A;  3LLE A;  4GFT A;  1CLB A;  1N0Y A;  2MHH A;  3F45 A;  4DCK A;  1FI6 A;  3AAJ A;  1NUB A;  1MR8 A;  3GK1 A;  1Y1A A;  2COL B;  1H4B A;  3OB1 B;  2K2F A;  3JTD C;  2BBN A;  3CGA A;  4JPZ B;  3D0Y A;  2G9B A;  1DF0 B;  1S1E A;  3TDI A;  1F54 A;  4YGE B;  1OMV A;  5AFP A;  1OE9 B;  4N1F A;  4MZL A;  1Y6W A;  1CTR A;  3CR5 X;  2L51 A;  3DF0 B;  2LC5 A;  2KQ6 A;  1W7I B;  1AHR A;  1NIW A;  5GQQ C;  1BR4 B;  1TTX A;  4L9M A;  2KGB C;  1CDN A;  1C07 A;  2F8P A;  3LK0 A;  4I5L B;  1S5G Z;  3DVE A;  4PHN A;  3CR4 X;  1MXE A;  3OHM B;  1IRJ A;  3ZNI A;  2GGM A;  2NZ0 A;  3TUY B;  1LKJ A;  2KFG A;  4CFQ A;  3DVJ A;  4HRH A;  1J7P A;  2PRU A;  1BMO A;  1A2X A;  1YR5 A;  5TNC A;  1JFK A;  1QV0 A;  2KFF A;  5BPJ A;  4NQG A;  2BE6 A;  1QLS A;  4NDB A;  4OCI A;  2M7L A;  1SY9 A;  1KK8 B;  4QJ3 B;  1PRW A;  3TUY C;  2BE4 A;  3RM1 A;  1S6J A;  2KQY A;  1G33 A;  1CFP A;  1FI5 A;  1V1G A;  2MAZ A;  1A75 B;  2JPT A;  1CFC A;  3GK2 A;  4DIR A;  4A4C A;  1ZOT B;  1UWO A;  1AK8 A;  1KCY A;  4ICB A;  2Y1M A;  1YVL A;  4YI9 A;  1F55 A;  2PAL A;  3VRO A;  4HRG A;  4YRU A;  1BR1 B;  2KOT A;  4XJK B;  1CLL A;  4M2Q A;  4DRW A;  3D10 A;  3PSR A;  3VRQ A;  4YGA A;  1N65 A;  2H61 C;  2PVB A;  2E6W A;  1PUL A;  1NCY A;  1SBJ A;  4PE7 A;  1CLM A;  1YX7 A;  1NWD A;  1CDL A;  4ZCU A;  2LMT A;  1MXL C;  1RWY A;  3GOF A;  3SIB A;  3SG4 A;  1UP5 A;  4P5O E;  1TIZ A;  2F2P A;  1IJ6 A;  2PSR A;  1YTZ C;  4CLN A;  5ER5 A;  1XFX O;  3AKB A;  1MUX A;  3VRR A;  4CFR A;  3I5H B;  3SJS A;  1CKK A;  1B8C A;  2L4H A;  3SG6 A;  1E8A A;  2WOS A;  2AMI A;  1BLQ A;  1HQV A;  1ZFS A;  1WRL A;  2QPT A;  1QX5 B;  5CSN A;  1RRO A;  1B9A A;  4ORA B;  1BF5 A;  2A4J A;  1DGV A;  1WDC C;  2JXL A;  4MRX A;  4QJ5 B;  2BKI B;  1XA5 A;  2O60 A;  3VRN A;  1B4C A;  2ZRS A;  1DTL A;  2FCD A;  3I5H C;  1IH0 A;  2K61 A;  1QTX A;  2LV7 A;  3M0W A;  3OB2 B;  2DOQ A;  5DKN A;  3PN7 C;  3WNX B;  3CS1 A;  4N5X A;  5D69 A;  1J7Q A;  1JWD A;  2P6B B;  2VRG A;  2CXJ A;  1L2O B;  2KI6 C;  2LCP A;  2I7A A;  2KGR A;  4OVN F;  2JQ6 A;  5I8N A;  3BOW B;  2OS8 B;  1KK7 Z;  3SG5 A;  3TDZ A;  1TNW A;  1KWO B;  1DJY A;  4GBA A;  1EH2 A;  1DMO A;  5I2L A;  4E68 A;  1YVH A;  1YRT B;  4ZCV A;  5I2Q A;  3TDU A;  3SG2 A;  1IQ3 A;  2LAN A;  4ORC B;  1CM4 A;  1S6C A;  2L50 A;  4N1G A;  5I2O A;  2AAO A;  1S6I A;  1TN4 A;  2ZRT A;  1SW8 A;  1LIN A;  3NSK A;  4WRI A;  2OPO A;  1KWO C;  1OQP A;  3H4S E;  1NPQ A;  1K95 A;  1DF0 A;  2KI6 D;  3JTD B;  2JNF A;  2LHL A;  2K7O A;  1XYD A;  4AQI A;  1YX8 A;  3DF0 A;  4OKH A;  1SR6 B;  1GGZ A;  5IBW A;  3A8R A;  3EK4 A;  4GNK B;  1QS7 A;  2ZKM X;  1G8I A;  3CWG A;  2SCP A;  3BYA A;  3ICB A;  1QIV A;  2KDH A;  4TNC A;  1AUI B;  2KHN A;  5CPV A;  4Q04 A;  1SR6 C;  1XFY O;  1J7O A;  1LVC D;  4U8D A;  2I18 A;  1H8B A;  1TCF A;  2HET A;  2LVK A;  3KEV A;  1SL8 A;  1XK4 C;  1SYM A;  5PAL A;  1KFU S;  4R1E A;  1YUR A;  4PCW A;  1J1E A;  3PAL A;  4NDC A;  1CMF A;  3FWC A;  2LLT A;  3BUW B;  5AEQ A;  1QVI Y;  4C0L A;  2LUX A;  3A4U B;  1OSA A;  3FS7 A;  1IG5 A;  1MWN A;  1C7W A;  1CFD A;  2L4I A;  1A75 A;  2LP2 A;  2LMV A;  1ALW A;  2H61 A;  4PDZ A;  2M3W A;  1NCX A;  1F70 A;  1PSB A;  2MLE C;  3TS5 B;  4HSZ A;  1AVS A;  2JC2 A;  1VRK A;  4GGF A;  4PE1 A;  5HYD A;  3PLF B;  1X02 A;  5D7F A;  5HKW A;  4YGB B;  2KI4 B;  2V53 A;  1JUO A;  1CM1 A;  1SL7 A;  2MJW B;  5AXI A;  1IJ5 A;  1RFJ A;  1A4P A;  2FJU B;  3TS5 C;  1QXP A;  1EL4 A;  3I5I C;  1B8R A;  3NXA A;  2K0J A;  2QAC A;  4JQ0 D;  2SAS A;  4I5J A;  2NCP A;  1BOC A;  2FCE A;  1BG1 A;  1XFU O;  1IGV A;  4FQO A;  2CBL A;  1QLK A;  1SMG A;  1YRU B;  1Y0V H;  2KI4 C;  1TCO B;  1MHO A;  1YUT A;  1REC A;  3PM8 A;  1NP8 A;  1UHJ A;  1SCV A;  3LCP C;  1B7T Z;  3RLZ A;  1JC2 A;  2HQW A;  2WCF A;  4GUK A;  1DJI A;  1DGU A;  4OR9 B;  2Y4Q A;  4DUQ A;  2M1U A;  1GGW A;  1DJH A;  1IWQ A;  1OMD A;  1UUS A;  2L0P A;  4MZJ A;  2EC6 B;  1C7V A;  4P2Y B;  4I5K A;  1XVJ A;  2F33 A;  1WDC B;  1U5I B;  4NDD A;  3BUX B;  3IQO A;  4GGN A;  4F0Z B;  1WRZ A;  4YGD B;  4AOM A;  1A29 A;  5HKY A;  2GV5 A;  4ORB B;  2BEC A;  2KBI A;  2KAX A;  2EC6 C;  1IQ5 A;  2MLF C;  1UUR A;  1K9P A;  3OP0 A;  3PN7 B;  5JOL A;  4MBE A;  3SG3 A;  3SG7 A;  1KQV A;  3SIA A;  1DVI A;  2M49 B;  1CFF A;  1K96 A;  1PVB A;  1UHN A;  2KAV A;  2CTN A;  5J3X A;  5K89 A;  2KYC A;  1NCZ A;  1TNP A;  2NCO A;  2KFH A;  2K2A A;  2EHB A;  1UHI A;  2L98 A;  1B1G A;  1K9U A;  3NSI A;  1CB1 A;  1WY9 A;  2FOT A;  4IL1 A;  3WXA A;  1WLZ A;  2M97 A;  1FPW A;  3O2P A;  5DKQ A;  4ETO A;  5FYX A;  1NSH A;  3EVV A;  2JT0 A;  1JF2 A;  3CZT X;  2KYF A;  3BUO B;  4M2O A;  1QV1 A;  1EXR A;  2PMY A;  1KK7 Y;  3HX4 A;  1B47 A;  2KBM A;  4YGC B;  2M7N A;  4MVF A;  1V1F A;  1Y1U A;  3DD4 A;  2BKH B;  3KPX A;  1M63 B;  2KSP A;  1BT6 A;  2TN4 A;  5CSJ A;  1KQM C;  1DT7 B;  1OZS A;  3BQ3 A;  1FW4 A;  1JF0 A;  2LP3 A;  2M1K B;  2HF5 A;  5CSI A;  2F2O A;  2LE9 B;  2LVI A;  2ZND A;  3NSO A;  4CPV A;  2GGZ A;  1K2H A;  4A4B A;  2BBM A;  1M45 A;  2K7D A;  4PHK A;  1BU3 A;  1PAL A;  1ZAC A;  3KHE A;  3VRP A;  4PE4 A;  1DJW A;  1KFX L;  1WLM A;  1Y1X A;  2LVV A;  3CLN A;  3I5G C;  4GPL B;  5AAN A;  5JJG A;  3OX6 A;  4QJ4 B;  2LLS A;  5CSF A;  2JU0 A;  1J7R A;  2M29 A;  4OV2 A;  2LM5 A;  3LL8 B;  1EG4 A;  4PHJ A;  1JSA A;  3AAK A;  3ZWH A;  1GQM A;  4USL A;  1SCM C;  1QX2 A;  1R6P A;  1AJ5 A;  4PE0 A;  3EKJ A;  4PAL A;  2CT9 A;  3DVK A;  2JT8 A;  2F3Y A;  3K21 A;  3EVR A;  1W7J B;  1F71 A;  2MBX A;  1S5G Y;  2JOJ A;  5KSZ A;  2LVJ A;  1K90 D;  2CNP A;  3JVT B;  1QAT A;  2M8U A;  2BCX A;  1LA3 A;  1QX7 A;  3BUN B;  3QRX A;  5ER4 X;  3IF7 A;  4BY4 A;  2D8N A;  3CR2 A;  2LUC A;  3O6B A;  2BCA A;  3PFV A;  1TNQ A;  3I5I B;  1J1D A;  1J55 A;  5HKZ A;  1M46 A;  2IS9 A;  2JWW A;  5B8I B;  4XJK A;  2LLU A;  3LK1 A;  2M0R A;  1S36 A;  3JVT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...