2LVJA

Solution structure of hemi-mg-bound phl p 7
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Phl p 7
publication title Solution structures of polcalcin Phl p 7 in three ligation states: Apo-, hemi-Mg(2+) -bound, and fully Ca(2+) -bound.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lvjA00
4WRIA 1RROA 1TNWA 1DJGA 2LUCA 2QACA 1M45A 4PHKA 1A75B 2KHNA 3EKJA 5J3XA 1OSAA 2JWWA 2BE4A 2EC6C 1B4CA 1CFCA 2JOJA 1KSOA 2M1UA 2PMYA 5IBWA 1B7TY 1W7IB 4XYNA 2PALA 5HLOA 4A4CA 1XA5A 1K96A 3TDZA 2F33A 3DVKA 2M8UA 1F4OA 3CR5X 3E3RA 1JUOA 2COLB 1HT9A 4CFQA 1DF0B 4MVFA 3AAKA 1IRJA 5I2QA 1AK8A 1SMGA 2KOTA 1F4QA 2KFGA 1S3PA 1K9UA 1KFXS 3VRRA 1CM4A 1SL8A 2I18A 2MBXA 4HRGA 2LMUA 1KQVA 2B1UA 3VRNA 1SCMC 1HQVA 1QATA 2LVKA 2NLNA 1W7JB 1K2HA 4GPLB 1BR1B 2KAYA 1VRKA 1KK7Y 4L9MA 2SCPA 4M2PA 2BL0C 2LMTA 2L51A 3DVJA 1TOPA 1J1DA 1LKJA 2BCXA 2FCDA 1B7TZ 1RTP1 1TTXA 1QIVA 3O78A 2LLSA 2CTNA 1KFUS 1CDPA 1KFXL 2BKIB 1LA3A 1OMDA 1H4BA 1UHHA 1QX7A 2OTGC 4PHMA 2KQYA 3RLZA 1TNQA 3LK1A 4AQIA 2L4HA 1K95A 4JQ0D 3WHTB 4C0LA 4D1EA 4M2OA 1BMOA 2CT9A 3NSOA 1PALA 3KF9A 1K8UA 1M39A 3JTDB 3PFVA 1MUXA 1WRKA 5PALA 1F8HA 3WHUB 1KFUL 3TDUA 1B8RA 2VRGA 2M7LA 3TDIA 2PSRA 3TUYC 4OR9B 1KK7Z 1SW8A 2MHHA 3PATA 1BG1A 4ORCB 2JU0A 2LVIA 1MF8B 3I5FC 2AAOA 4GGFC 1CMFA 1J7QA 4N1FA 2M29A 1C7WA 2F8PA 2L4IA 3LK0A 1X02A 3DF0A 3PN7C 5CSNA 1NX3A 1AHRA 2M97A 1JFJA 1TCFA 1BR4B 5FYXA 1IQ5A 1PSRA 1C7VA 2M3WA 4NDDA 1EG4A 1SKTA 1B8LA 4MRXA 5CSIA 3I5FB 2EGDA 3SJSA 4GGFA 2LC5A 1ALVA 4OV2A 4YGBB 2E6WA 1JF2A 1SPYA 1WDCC 1EJ3A 3BOWB 3BXKA 2LHLA 3PLFB 1XFXO 2QPTA 1G8IA 3ICBA 3JVTB 5TNCA 2H2KA 4C0JA 1CNPA 2L0PA 1J7RA 2F2PA 3SG2A 1CLLA 1KCYA 2R2IA 5ER5A 2WCBA 1BU3A 1RECA 3I5IC 4R1EA 1N0YA 4PALA 2BCBA 2GGZA 2PRUA 1L2OC 3SG4A 1Y1XA 1JFKA 2HPSA 2L50A 1UHNA 3CR2A 3O6BA 3GK2A 4OKHA 4C0KA 5BPJA 1DJYA 1N2DA 4GUKA 3NSKA 4GFTA 3AKBA 4NQGA 5CSJA 2JT0A 3DVEA 1LXFC 3BUOB 3HX4A 1UHIA 2KAVA 4ETOA 4YBHB 4YI9A 3EVVA 1MXEA 1Q80A 1YURA 1CMGA 2M7NA 1F54A 2BE6A 1IGVA 5G08A 1JC2A 3WXAA 4BY5A 4GGNA 4MEWA 2LVJA 4HRHA 3IQOA 4MZJA 1PK0D 1CDLA 1SL9A 2LANA 2P6BB 2K2FA 2LAPA 3EK4A 1S6CA 3LL8B 1IQ3A 3ZWHA 1TNXA 3D0YB 1G33A 1LVCD 1MXLC 2LCPA 4ZCVA 1F71A 2DOQA 1FBVA 2KI6D 3HCMA 4N5XA 2JRFA 1TIZA 4I5LB 1M63B 3CTNA 2LLUA 1CLMA 4PDZA 5JOLA 4AQJA 1J55A 3CZTX 2L5XB 1L7ZA 5B8IB 1DJIA 5GQQC 4MN0A 1B8CA 1CM1A 3OB1B 2EC6B 1SBJA 1GGWA 1EXRA 2Y4QA 1S6JA 5JJGA 2TN4A 1Y1AA 1CDNA 4DS7A 4GNKB 1MQ1A 2MAZA 1N65A 1TRFA 3CLNA 3LLEA 4GBAA 1WRZA 2LM5A 1MHOA 4NDBA 1PRWA 1KWOC 1TN4A 2D8NA 2I94A 1SR6C 3VGOA 1ODBA 1K93D 2WCEA 1QVIY 3A8RA 3BUWB 3OHMB 4FQOA 2M49B 2G2BA 1SCMB 2EHBA 3DD4A 1UHJA 4P5OE 4MRYA 1YRUB 5AEQA 3I5HC 2ZFDA 1E8AA 1ALWA 1WLMA 2K0JA 4BY4A 1DJXA 1XFZO 1XO5A 2BL0B 1KQMC 1JSAA 3IQQA 2MRDA 1DGUA 3OB2B 5I8NA 1S1EA 4TNCA 3RM1A 2ZNDA 3DVMA 3FWBA 3EKHA 4PE4A 1XFWO 2BCAA 1B9AA 1CDMA 1GJYA 1U5IB 2KBMA 5CPVA 5HLVA 2FJUB 1QX5B 1ZMZA 2PASA 3C1VA 1IWQA 3EK8A 4JPZB 2OTGB 4CIDA 2F2OA 1C07A 2H61A 2K8MB 2M0RA 3LCPC 2Y5IA 1M31A 1SNLA 2KI4C 3TS5C 5DKRA 1DT7B 3WNXB 2KFFA 1QVIZ 5HKZA 4PHNA 3AAJA 2KSPA 4PE0A 4XJKB 1B47A 1CFDA 1OMVA 1PULA 2K7OA 1J7PA 1NX2A 5ER4X 1PVAA 2NZ0A 3OP0A 3TUYB 2CBLA 1MWNA 5HKWA 2FOTA 2F3ZA 1CLBA 3NSIA 2LUXA 4PE1A 3SG6A 1CKKA 4NDCA 4CLNA 1J1EA 1OMRA 1FW4A 2KAXA 1CTRA 1S5GY 3AKAA 3PN7B 2E30A 1KK8C 2KI6C 2LMVA 1AP4A 2JPTA 2JULA 2JT3A 1AVSA 4I5JA 2HQWA 1QLKA 3SG7A 1YRTB 1YVHA 2FCEA 3SIBA 2KYCA 1NUBA 1ZACA 4DIRA 3ZNIA 3H4SE 2WORA 2I2RE 1FF1A 1DVIA 4FTGA 4P2YB 1S36A 4AOMA 2G9BA 1IJ6A 1XYDA 1WDCB 1M46A 2K7CA 1UP5A 2SASA 2ZN9A 1LINA 5DKNA 1BT6A 1V1GA 3EK7A 3VRPA 1A2XA 1QTXA 4HREE 3PM8A 1IG5A 3BQ3A 1GQMA 3BOWA 2JNXA 2JC2A 2WNDA 4QJ4B 1NIWA 4Q04A 1YVLA 4CPVA 1SK6D 2KGBC 1K9PA 3GOFA 1NWDA 1XVJA 3I5IB 1S5GZ 2OS8C 3KPXA 4ICBA 1AJ4A 2JQ6A 1L2OB 5AXIA 5AFPA 3BUXB 1S26D 3FIAA 4QJ5B 2I7AA 2K7BA 1ZFSA 4GAOA 1XK4A 1R6PA 1Y1UA 5HYDA 1BLQA 4M2QA 1RFJA 1A03A 5D69A 3SG3A 2O60A 3FWCA 1CFPA 4ORAB 4F0ZB 5HKYA 3BUMB 2BBNA 3D10A 2MLEC 2O5GA 2LP2A 1NCYA 1CFFA 2LVVA 2K61A 1PVBA 1RK9A 4OCIA 4ZCUA 2Q91A 2ZNEA 1IH0A 1Y0VH 2K7DA 5AERA 3TZ1A 1A29A 1LA0A 3CWGA 5D7FA 2LP3A 4DRWA 1NYAA 2LLTA 2LNKA 1TCOB 1SCVA 4YRUA 1A75A 1NP8A 2JTTA 3PSRA 1NSHA 1SRAA 4E68A 2HQ8A 1AUIB 2WOSA 3KO0A 5KTYA 3NXAA 4MZKA 3D0YA 1D1OA 4UPGA 5I2OA 1MR8A 4YGCB 1IKUA 1KSMA 1YUSA 2MA2A 5I2LA 1JWDA 1EH2A 3CGAA 5AANA 2KFHA 3KEVA 2RGIA 2M9GA 1DF0A 2V53A 1QS7A 1OOJA 1PSBA 3O4YA 2CCMA 4HSZA 1QIWA 5KU1A 1ZUZA 1Y6WA 1DJZA 3CR4X 1G4YR 1XFVO 1KWOB 1K94A 2H61C 1SL7A 2AUCA 4USLA 1SR6B 2JZIA 2WCFA 4OVNF 2Y1NA 3KHEA 1YTZC 3GK4X 1YUTA 1DTLA 1BF5A 4WQ2A 1FI6A 2CXJA 2WC8A 1H8BA 4DUQA 1DMOA 3I5HB 3VROA 2ZKMX 1QX2A 3JTDC 4QJ3B 3K21A 2Q4UA 1KQMB 3GK1A 5F6TA 2JT8A 1RWYA 1QJTA 1UURA 3O2PA 4YGEB 2AMIA 1TNPA 2L2EA 1QV1A 2ZRSA 2LE9B 1IJ5A 2NCOA 1AJ5A 2KNEA 1YX8A 2BECA 3DF0B 4U8DA 1WLZA 1OQPA 2KBIA 4YI8A 3SIAA 1NCZA 2K2AA 1YUUA 4MBEA 4YGDB 3I5GC 1UUSA 1ZOTB 1DGVA 4CFRA 3EVUA 1U5IA 2IS9A 4A4BA 1UHKA 2BKHB 1B1GA 1QV0A 1FPWA 1YR5A 2NXQA 2KYFA 2KI4B 3TS5B 2GV5A 3FS7A 1QLSA 1OZOA 2JXCA 2MJWB 1BJFA 2ZN8A 1XFYO 1SYMA 1R2UA 1NCXA 2LHIA 2LV7A 2ZRTA 4PCWA 1F70A 2Y1MA 2HETA 3I5GB 3SG5A 3OX5A 2HF5A 2KDHA 3VRQA 4XJKA 2JNFA 4YGAA 1BODA 3CS1A 1QASA 1UWOA 2KQ6A 1SY9A 2JXLA 3JVTC 2GGMA 3IF7A 1NX1A 1DJHA 1KK8B 4MSPA 1JF0A 2A4JA 1XFUO 1YX7A 2PVBA 1WY9A 3MSEB 4IL1A 2NCPA 1XK4C 1JBAA 1OZSA 5K89A 3BYAA 1BOCA 3F45A 2CNPA 2F3YA 1S6IA 3BUNB 1V1FA 4PHJA 4MZLA 1K90D 3OX6A 2M1KB 4DCKA 2OPOA 2L98A 4ORBB 1DJWA 3EVRA 1EG3A 1CB1A 2KGRA 1FI5A 2MLFC 5CSFA 1EL4A 4MLWA 2ISDA 1OE9B 1NPQA 2BBMA 4I5NB 2OS8B 1NX0A 5KSZA 2JTZA 1J7OA 4JWQA 1K9KA 3A4UB 1RJVA 4I5KA 1GGZA 4WQ3A 5DKQA 3M0WA 1A4PA 1QXPA 3PALA 3QRXA 4PE7A 1F55A 1WRLA 3NSLA 4N1GA
chains in the Genus database with same CATH superfamily
4WRIA 1RROA 1TNWA 1DJGA 2LUCA 2QACA 1M45A 4IJ7A 3D77A 4PHKA 1A75B 2KHNA 3EKJA 5J3XA 3B87A 1OSAA 2FJYA 2BE4A 2JWWA 2EC6C 1B4CA 1CFCA 2JOJA 1KSOA 2M1UA 2PMYA 5IBWA 1B7TY 1W7IB 4XYNA 2PALA 5HLOA 4A4CA 1XA5A 1K96A 3TDZA 2F33A 3DVKA 2M8UA 1F4OA 3CR5X 3E3RA 1JUOA 2COLB 1HT9A 4CFQA 1OOGA 1DF0B 4MVFA 3AAKA 1IRJA 5I2QA 3NGVA 1AK8A 1IIOA 1SMGA 2KOTA 1F4QA 2KFGA 2KLDA 5FI2A 1S3PA 1K9UA 1KFXS 2K60A 1CM4A 3VRRA 1SL8A 2I18A 2H8VA 2MBXA 4HRGA 2WCHA 2LMUA 1KQVA 2B1UA 3VRNA 1SCMC 1HQVA 1OW4A 1QATA 2LVKA 2NLNA 1GM0A 1W7JB 1K2HA 4GPLB 1BR1B 2KAYA 1VRKA 1KK7Y 4L9MA 2SCPA 4M2PA 2BL0C 2LMTA 2WC6A 2L51A 3B7AA 3DVJA 1TOPA 1J1DA 1LKJA 2BCXA 1OOHA 2FCDA 1B7TZ 1RTP1 1TTXA 1QIVA 3O78A 2LLSA 2CTNA 1KFUS 1CDPA 1KFXL 2BKIB 1LA3A 1OMDA 1H4BA 1UHHA 1QX7A 2OTGC 4PHMA 2KQYA 3RLZA 1TNQA 3LK1A 4OZDA 3SS3A 4AQIA 2L4HA 1K95A 4JQ0D 3WHTB 4C0LA 4D1EA 4M2OA 1BMOA 2CT9A 3NSOA 1PALA 2QEBA 3KF9A 1K8UA 1M39A 3JTDB 3PFVA 1MUXA 1WRKA 5PALA 1F8HA 3WHUB 1KFUL 3TDUA 1B8RA 2VRGA 2M7LA 3TDIA 2PSRA 4INWA 3TUYC 2PYQA 4OR9B 1KK7Z 1SW8A 2MHHA 3PATA 1BG1A 4ORCB 2JU0A 2LVIA 1MF8B 3I5FC 2AAOA 4GGFC 1CMFA 1J7QA 4N1FA 2M29A 1C7WA 2F8PA 2L4IA 3LK0A 1X02A 3DF0A 3PN7C 5CSNA 1P28A 1TWOA 3NHTA 1NX3A 1AHRA 2M97A 1JFJA 1TCFA 1BR4B 5FYXA 1IQ5A 1PSRA 1C7VA 2M3WA 5DICA 4NDDA 1EG4A 3DXLA 1SKTA 3S0AA 1B8LA 2WCJA 4MRXA 5CSIA 3I5FB 2EGDA 2PQLA 3SJSA 3D75A 4GGFA 2LC5A 1ALVA 3DYEA 4OV2A 2E6WA 4YGBB 1JF2A 1SPYA 1WDCC 1EJ3A 3BOWB 3BXKA 2LHLA 3PLFB 1XFXO 2QPTA 5D3OA 1G8IA 3ICBA 3JVTB 5TNCA 2H2KA 4C0JA 1CNPA 2L0PA 1J7RA 1OOFA 2F2PA 3D76A 1CLLA 4PT1A 3SG2A 1KCYA 2R2IA 1OOIX 5ER5A 2WCBA 1BU3A 1RECA 3I5IC 4R1EA 4KYNA 1N0YA 3S0EA 4PALA 2BCBA 2GGZA 2PRUA 1L2OC 3SG4A 1Y1XA 1JFKA 2HPSA 2L50A 1UHNA 3CR2A 3O6BA 2QDIA 3GK2A 4OKHA 5EL2A 4C0KA 5BPJA 1DJYA 1N2DA 4GUKA 3NSKA 4GFTA 3AKBA 3EG5B 3CDNA 2JT0A 3DVEA 1LXFC 3BUOB 2KPHA 1UHIA 2KAVA 3HX4A 4ETOA 3S0FA 4YBHB 4YI9A 3EVVA 1MXEA 3UNWA 1Q80A 1YURA 1CMGA 2M7NA 1F54A 2BE6A 1IGVA 5G08A 1DELA 1JC2A 3RZSA 3WXAA 1C3YA 2L2CA 4BY5A 1TUZA 4GGNA 4MEWA 2LVJA 4HRHA 3IQOA 4MZJA 1PK0D 1CDLA 1SL9A 2LANA 2P6BB 2K2FA 2LAPA 3EK4A 1Z4HA 1S6CA 3D78A 3LL8B 1IQ3A 3ZWHA 1TNXA 3D0YB 1G33A 1LVCD 1MXLC 2BAPA 2LCPA 4ZCVA 4F7FA 1F71A 2DOQA 1FBVA 2KI6D 3HCMA 4N5XA 2JRFA 1TIZA 3CZ1A 4I5LB 1M63B 3CTNA 2LLUA 1CLMA 3L4LA 4PDZA 5JOLA 4AQJA 1J55A 3CZTX 2L5XB 1LS8A 1L7ZA 5B8IB 1DJIA 5GQQC 2BNXA 1XFRA 4MN0A 1B8CA 1CM1A 3OB1B 2EC6B 3DY9A 3L4AA 4INXA 1SBJA 1GGWA 1EXRA 2Y4QA 1S6JA 1TUJA 3PM2A 5JJGA 2TN4A 1Y1AA 1CDNA 4DS7A 4GNKB 1MQ1A 2MAZA 1N65A 1TRFA 3CLNA 3LLEA 4GBAA 1WRZA 2LM5A 1MHOA 3B86A 1PRWA 3FE9A 1KWOC 4NDBA 1Z2CB 1TN4A 2D8NA 2I94A 1SR6C 3VGOA 1ODBA 1K93D 2WCEA 1QVIY 3A8RA 3BUWB 3OHMB 3CZ0A 4FQOA 2M49B 2G2BA 1SCMB 2EHBA 3DD4A 1UHJA 4P5OE 3BFBA 1YRUB 4MRYA 3I5HC 2ZFDA 5AEQA 1WLMA 1E8AA 1ALWA 2K0JA 4BY4A 1DJXA 1XFZO 1XO5A 2BL0B 1KQMC 1JSAA 3IQQA 2MRDA 5HL1A 1DGUA 3OB2B 5I8NA 1S1EA 4TNCA 3RM1A 2ZNDA 3DVMA 3FWBA 3EKHA 4PE4A 1XFWO 2BCAA 5I94A 1B9AA 1CDMA 1GJYA 1U5IB 2KBMA 5CPVA 5HLVA 5CSJA 2FJUB 1QX5B 1ZMZA 2PASA 3C1VA 1IWQA 3EK8A 4JPZB 2OTGB 4CIDA 2F2OA 1C07A 2H61A 2K8MB 2M0RA 3LCPC 2Y5IA 1M31A 1SNLA 2KI4C 3TS5C 5DKRA 1DT7B 3WNXB 2KFFA 1QVIZ 1DQEA 2WC5A 5HKZA 4PHNA 3AAJA 3NHIA 2KSPA 4PE0A 4XJKB 1B47A 1CFDA 1OMVA 1PULA 2K7OA 1J7PA 1NX2A 5ER4X 1PVAA 2NZ0A 3OP0A 3TUYB 2CBLA 1MWNA 5HKWA 2FOTA 2F3ZA 1CLBA 3NSIA 2LUXA 4PE1A 3SG6A 1CKKA 4NDCA 4CLNA 1J1EA 3SS4A 1OMRA 1FW4A 2KAXA 1CTRA 1S5GY 3AKAA 3PN7B 2E30A 1KK8C 3B6XA 2KI6C 2LMVA 3D73A 2JPTA 2JULA 3D74A 2JT3A 1AP4A 1AVSA 2WCLA 4I5JA 2HQWA 1QLKA 3CYZA 1YRTB 1YVHA 2FCEA 3SIBA 3SG7A 2KLEA 2KYCA 1NUBA 2JPOA 1ZACA 4DIRA 3ZNIA 3H4SE 2WORA 2I2RE 1FF1A 1DVIA 4FTGA 4P2YB 3Q8IA 1S36A 4AOMA 2G9BA 1IJ6A 1XYDA 3VB1A 1WDCB 1M46A 2K7CA 1UP5A 1DEKA 2SASA 2ZN9A 1LINA 3S0BA 5DKNA 1BT6A 1W9ZA 1V1GA 3EK7A 3VRPA 1A2XA 1QTXA 4HREE 3CZ2A 3PM8A 1IG5A 3L47A 3BQ3A 1GQMA 3BOWA 2JNXA 2JC2A 2WNDA 3S0DA 1NIWA 4QJ4B 4Q04A 1YVLA 3O4XA 4CPVA 1SK6D 2KGBC 1K9PA 3GOFA 1NWDA 1XVJA 3I5IB 1S5GZ 2OS8C 3KPXA 3OBVA 3PJIA 4ICBA 1AJ4A 2JQ6A 1L2OB 5AXIA 5AFPA 3BUXB 3V2LA 1S26D 3FIAA 4QJ5B 2I7AA 2K7BA 1ZFSA 4GAOA 1XK4A 1R6PA 1Y1UA 4JD9A 5HYDA 1BLQA 4M2QA 1RFJA 1A03A 4FQTA 5D69A 3SG3A 2O60A 3FWCA 1CFPA 3QMEA 4ORAB 4F0ZB 5HKYA 2QEVA 3BUMB 2BBNA 3D10A 1ORGA 2MLEC 2O5GA 2LP2A 1NCYA 3DZTA 1CFFA 2LVVA 2QEOA 2K61A 1PVBA 1RK9A 4OCIA 4ZCUA 2Q91A 2ZNEA 1IH0A 1Y0VH 2K7DA 3BFHA 5AERA 3TZ1A 1A29A 1LA0A 3CWGA 5D7FA 2LP3A 4DRWA 1NYAA 2LLTA 2LNKA 1TCOB 1SCVA 4YRUA 1A75A 1NP8A 2JTTA 3PSRA 1NSHA 1SRAA 4E68A 2HQ8A 1AUIB 2WOSA 3KO0A 2P70A 5KTYA 3NXAA 4MZKA 3D0YA 1D1OA 4UPGA 5I2OA 1MR8A 4YGCB 1IKUA 1KSMA 1YUSA 2MA2A 5I2LA 1JWDA 1EH2A 3CGAA 5AANA 5FI7A 2KFHA 3KEVA 2RGIA 2M9GA 3BFAA 1DF0A 2V53A 2WCKA 3B88A 3S0GA 1QS7A 1OOJA 1PSBA 3O4YA 2CCMA 4HSZA 1QIWA 3K1EA 5KU1A 1ZUZA 1Y6WA 1DJZA 3CR4X 4NQGA 1G4YR 1XFVO 2QEHA 1KWOB 1K94A 2H61C 1SL7A 2AUCA 4USLA 1SR6B 2JZIA 2WCFA 4OVNF 2Y1NA 3KHEA 1YTZC 3GK4X 1YUTA 1DTLA 3R1PA 1BF5A 4WQ2A 1FI6A 2CXJA 2WC8A 1H8BA 4DUQA 1DMOA 3I5HB 3VROA 2ZKMX 1QX2A 3JTDC 4QJ3B 1DC1A 3K21A 2Q4UA 1KQMB 3GK1A 5F6TA 2JT8A 1RWYA 1QJTA 1UURA 3O2PA 4YGEB 2AMIA 1TNPA 2L2EA 1QV1A 2ZRSA 2LE9B 2ERBA 1C3ZA 1IJ5A 2NCOA 1AJ5A 2KNEA 1YX8A 2BECA 3DF0B 4U8DA 1WLZA 1OQPA 2KBIA 4YI8A 3SIAA 1NCZA 2K2AA 3BJHA 3CABA 1YUUA 4MBEA 4YGDB 3I5GC 1UUSA 1ZOTB 1DGVA 4CFRA 3EVUA 1U5IA 2IS9A 5FI6A 1UHKA 2BKHB 4A4BA 1QV0A 1B1GA 1FPWA 1YR5A 2NXQA 2KYFA 2KI4B 3TS5B 2GV5A 3FS7A 1QLSA 1OZOA 2JXCA 3FE6A 2MJWB 1BJFA 2ZN8A 1SSEB 1XFYO 2L5YA 1SYMA 1R2UA 1NCXA 2LHIA 2LV7A 2ZRTA 4PCWA 1F70A 2Y1MA 2HETA 3I5GB 3SG5A 2P71A 3OX5A 2HF5A 2KDHA 3VRQA 2GTEA 4XJKA 2JNFA 4YGAA 1BODA 1T14A 1QASA 1UWOA 2KQ6A 1SY9A 2JXLA 2WCMA 3CS1A 3JVTC 3R1OA 2GGMA 3IF7A 3FE8A 1NX1A 4JKTA 1DJHA 1KK8B 4MSPA 1JF0A 2A4JA 1XFUO 1YX7A 2PVBA 3OGNA 1WY9A 3MSEB 3R72A 4IL1A 2NCPA 3IVTA 1XK4C 1JBAA 1OZSA 5K89A 3BYAA 1BOCA 3F45A 2CNPA 2F3YA 1S6IA 3BUNB 1V1FA 4PHJA 4MZLA 1K90D 3OX6A 2M1KB 3N7HA 4DCKA 2OPOA 3R1VA 2L98A 4ORBB 1DJWA 3EVRA 3UO9A 1EG3A 1CB1A 2KGRA 1FI5A 2MLFC 3SS5A 5CSFA 1EL4A 4MLWA 2ISDA 1OE9B 1NPQA 2BBMA 4I5NB 2OS8B 1NX0A 1QWVA 2JTZA 5KSZA 1J7OA 4JWQA 1K9KA 3A4UB 1RJVA 4I5KA 1GGZA 4WQ3A 5DKQA 3M0WA 1A4PA 1QXPA 3PALA 3QRXA 4PE7A 1F55A 2YGUA 1WRLA 3NSLA 4N1GA
chains in the Genus database with same CATH topology
4WRIA 1RROA 1TNWA 1DJGA 2LUCA 2QACA 1M45A 4PHKA 1A75B 2KHNA 3EKJA 5J3XA 1OSAA 2JWWA 2BE4A 2EC6C 1B4CA 1CFCA 2JOJA 1KSOA 2M1UA 2PMYA 5IBWA 1B7TY 1W7IB 4XYNA 2PALA 5HLOA 4A4CA 1XA5A 1K96A 3TDZA 2F33A 3DVKA 2M8UA 1F4OA 3CR5X 3E3RA 1JUOA 2COLB 1HT9A 4CFQA 1DF0B 4MVFA 3AAKA 1IRJA 5I2QA 1AK8A 1SMGA 2KOTA 1F4QA 2KFGA 1S3PA 1K9UA 1KFXS 3VRRA 1CM4A 1SL8A 2I18A 2MBXA 4HRGA 2LMUA 1KQVA 2B1UA 3VRNA 1SCMC 1HQVA 1QATA 2LVKA 2NLNA 1W7JB 1K2HA 4GPLB 1BR1B 2KAYA 1VRKA 1KK7Y 4L9MA 2SCPA 4M2PA 2BL0C 2LMTA 2L51A 3DVJA 1TOPA 1J1DA 1LKJA 2BCXA 2FCDA 1B7TZ 1RTP1 1TTXA 1QIVA 3O78A 2LLSA 2CTNA 1KFUS 1CDPA 1KFXL 2BKIB 1LA3A 1OMDA 1H4BA 1UHHA 1QX7A 2OTGC 4PHMA 2KQYA 3RLZA 1TNQA 3LK1A 4AQIA 2L4HA 1K95A 4JQ0D 3WHTB 4C0LA 4D1EA 4M2OA 1BMOA 2CT9A 3NSOA 1PALA 3KF9A 1K8UA 1M39A 3JTDB 3PFVA 1MUXA 1WRKA 5PALA 1F8HA 3WHUB 1KFUL 3TDUA 1B8RA 2VRGA 2M7LA 3TDIA 2PSRA 3TUYC 4OR9B 1KK7Z 1SW8A 2MHHA 3PATA 1BG1A 4ORCB 2JU0A 2LVIA 1MF8B 3I5FC 2AAOA 4GGFC 1CMFA 1J7QA 4N1FA 2M29A 1C7WA 2F8PA 2L4IA 3LK0A 1X02A 3DF0A 3PN7C 5CSNA 1NX3A 1AHRA 2M97A 1JFJA 1TCFA 1BR4B 5FYXA 1IQ5A 1PSRA 1C7VA 2M3WA 4NDDA 1EG4A 1SKTA 1B8LA 4MRXA 5CSIA 3I5FB 2EGDA 3SJSA 4GGFA 2LC5A 1ALVA 4OV2A 4YGBB 2E6WA 1JF2A 1SPYA 1WDCC 1EJ3A 3BOWB 3BXKA 2LHLA 3PLFB 1XFXO 2QPTA 1G8IA 3ICBA 3JVTB 5TNCA 2H2KA 4C0JA 1CNPA 2L0PA 1J7RA 2F2PA 3SG2A 1CLLA 1KCYA 2R2IA 5ER5A 2WCBA 1BU3A 1RECA 3I5IC 4R1EA 1N0YA 4PALA 2BCBA 2GGZA 2PRUA 1L2OC 3SG4A 1Y1XA 1JFKA 2HPSA 2L50A 1UHNA 3CR2A 3O6BA 3GK2A 4OKHA 4C0KA 5BPJA 1DJYA 1N2DA 4GUKA 3NSKA 4GFTA 3AKBA 4NQGA 5CSJA 2JT0A 3DVEA 1LXFC 3BUOB 3HX4A 1UHIA 2KAVA 4ETOA 4YBHB 4YI9A 3EVVA 1MXEA 1Q80A 1YURA 1CMGA 2M7NA 1F54A 2BE6A 1IGVA 5G08A 1JC2A 3WXAA 4BY5A 4GGNA 4MEWA 2LVJA 4HRHA 3IQOA 4MZJA 1PK0D 1CDLA 1SL9A 2LANA 2P6BB 2K2FA 2LAPA 3EK4A 1S6CA 3LL8B 1IQ3A 3ZWHA 1TNXA 3D0YB 1G33A 1LVCD 1MXLC 2LCPA 4ZCVA 1F71A 2DOQA 1FBVA 2KI6D 3HCMA 4N5XA 2JRFA 1TIZA 4I5LB 1M63B 3CTNA 2LLUA 1CLMA 4PDZA 5JOLA 4AQJA 1J55A 3CZTX 2L5XB 1L7ZA 5B8IB 1DJIA 5GQQC 4MN0A 1B8CA 1CM1A 3OB1B 2EC6B 1SBJA 1GGWA 1EXRA 2Y4QA 1S6JA 5JJGA 2TN4A 1Y1AA 1CDNA 4DS7A 4GNKB 1MQ1A 2MAZA 1N65A 1TRFA 3CLNA 3LLEA 4GBAA 1WRZA 2LM5A 1MHOA 4NDBA 1PRWA 1KWOC 1TN4A 2D8NA 2I94A 1SR6C 3VGOA 1ODBA 1K93D 2WCEA 1QVIY 3A8RA 3BUWB 3OHMB 4FQOA 2M49B 2G2BA 1SCMB 2EHBA 3DD4A 1UHJA 4P5OE 4MRYA 1YRUB 5AEQA 3I5HC 2ZFDA 1E8AA 1ALWA 1WLMA 2K0JA 4BY4A 1DJXA 1XFZO 1XO5A 2BL0B 1KQMC 1JSAA 3IQQA 2MRDA 1DGUA 3OB2B 5I8NA 1S1EA 4TNCA 3RM1A 2ZNDA 3DVMA 3FWBA 3EKHA 4PE4A 1XFWO 2BCAA 1B9AA 1CDMA 1GJYA 1U5IB 2KBMA 5CPVA 5HLVA 2FJUB 1QX5B 1ZMZA 2PASA 3C1VA 1IWQA 3EK8A 4JPZB 2OTGB 4CIDA 2F2OA 1C07A 2H61A 2K8MB 2M0RA 3LCPC 2Y5IA 1M31A 1SNLA 2KI4C 3TS5C 5DKRA 1DT7B 3WNXB 2KFFA 1QVIZ 5HKZA 4PHNA 3AAJA 2KSPA 4PE0A 4XJKB 1B47A 1CFDA 1OMVA 1PULA 2K7OA 1J7PA 1NX2A 5ER4X 1PVAA 2NZ0A 3OP0A 3TUYB 2CBLA 1MWNA 5HKWA 2FOTA 2F3ZA 1CLBA 3NSIA 2LUXA 4PE1A 3SG6A 1CKKA 4NDCA 4CLNA 1J1EA 1OMRA 1FW4A 2KAXA 1CTRA 1S5GY 3AKAA 3PN7B 2E30A 1KK8C 2KI6C 2LMVA 1AP4A 2JPTA 2JULA 2JT3A 1AVSA 4I5JA 2HQWA 1QLKA 3SG7A 1YRTB 1YVHA 2FCEA 3SIBA 2KYCA 1NUBA 1ZACA 4DIRA 3ZNIA 3H4SE 2WORA 2I2RE 1FF1A 1DVIA 4FTGA 4P2YB 1S36A 4AOMA 2G9BA 1IJ6A 1XYDA 1WDCB 1M46A 2K7CA 1UP5A 2SASA 2ZN9A 1LINA 5DKNA 1BT6A 1V1GA 3EK7A 3VRPA 1A2XA 1QTXA 4HREE 3PM8A 1IG5A 3BQ3A 1GQMA 3BOWA 2JNXA 2JC2A 2WNDA 4QJ4B 1NIWA 4Q04A 1YVLA 4CPVA 1SK6D 2KGBC 1K9PA 3GOFA 1NWDA 1XVJA 3I5IB 1S5GZ 2OS8C 3KPXA 4ICBA 1AJ4A 2JQ6A 1L2OB 5AXIA 5AFPA 3BUXB 1S26D 3FIAA 4QJ5B 2I7AA 2K7BA 1ZFSA 4GAOA 1XK4A 1R6PA 1Y1UA 5HYDA 1BLQA 4M2QA 1RFJA 1A03A 5D69A 3SG3A 2O60A 3FWCA 1CFPA 4ORAB 4F0ZB 5HKYA 3BUMB 2BBNA 3D10A 2MLEC 2O5GA 2LP2A 1NCYA 1CFFA 2LVVA 2K61A 1PVBA 1RK9A 4OCIA 4ZCUA 2Q91A 2ZNEA 1IH0A 1Y0VH 2K7DA 5AERA 3TZ1A 1A29A 1LA0A 3CWGA 5D7FA 2LP3A 4DRWA 1NYAA 2LLTA 2LNKA 1TCOB 1SCVA 4YRUA 1A75A 1NP8A 2JTTA 3PSRA 1NSHA 1SRAA 4E68A 2HQ8A 1AUIB 2WOSA 3KO0A 5KTYA 3NXAA 4MZKA 3D0YA 1D1OA 4UPGA 5I2OA 1MR8A 4YGCB 1IKUA 1KSMA 1YUSA 2MA2A 5I2LA 1JWDA 1EH2A 3CGAA 5AANA 2KFHA 3KEVA 2RGIA 2M9GA 1DF0A 2V53A 1QS7A 1OOJA 1PSBA 3O4YA 2CCMA 4HSZA 1QIWA 5KU1A 1ZUZA 1Y6WA 1DJZA 3CR4X 1G4YR 1XFVO 1KWOB 1K94A 2H61C 1SL7A 2AUCA 4USLA 1SR6B 2JZIA 2WCFA 4OVNF 2Y1NA 3KHEA 1YTZC 3GK4X 1YUTA 1DTLA 1BF5A 4WQ2A 1FI6A 2CXJA 2WC8A 1H8BA 4DUQA 1DMOA 3I5HB 3VROA 2ZKMX 1QX2A 3JTDC 4QJ3B 3K21A 2Q4UA 1KQMB 3GK1A 5F6TA 2JT8A 1RWYA 1QJTA 1UURA 3O2PA 4YGEB 2AMIA 1TNPA 2L2EA 1QV1A 2ZRSA 2LE9B 1IJ5A 2NCOA 1AJ5A 2KNEA 1YX8A 2BECA 3DF0B 4U8DA 1WLZA 1OQPA 2KBIA 4YI8A 3SIAA 1NCZA 2K2AA 1YUUA 4MBEA 4YGDB 3I5GC 1UUSA 1ZOTB 1DGVA 4CFRA 3EVUA 1U5IA 2IS9A 4A4BA 1UHKA 2BKHB 1B1GA 1QV0A 1FPWA 1YR5A 2NXQA 2KYFA 2KI4B 3TS5B 2GV5A 3FS7A 1QLSA 1OZOA 2JXCA 2MJWB 1BJFA 2ZN8A 1XFYO 1SYMA 1R2UA 1NCXA 2LHIA 2LV7A 2ZRTA 4PCWA 1F70A 2Y1MA 2HETA 3I5GB 3SG5A 3OX5A 2HF5A 2KDHA 3VRQA 4XJKA 2JNFA 4YGAA 1BODA 3CS1A 1QASA 1UWOA 2KQ6A 1SY9A 2JXLA 3JVTC 2GGMA 3IF7A 1NX1A 1DJHA 1KK8B 4MSPA 1JF0A 2A4JA 1XFUO 1YX7A 2PVBA 1WY9A 3MSEB 4IL1A 2NCPA 1XK4C 1JBAA 1OZSA 5K89A 3BYAA 1BOCA 3F45A 2CNPA 2F3YA 1S6IA 3BUNB 1V1FA 4PHJA 4MZLA 1K90D 3OX6A 2M1KB 4DCKA 2OPOA 2L98A 4ORBB 1DJWA 3EVRA 1EG3A 1CB1A 2KGRA 1FI5A 2MLFC 5CSFA 1EL4A 4MLWA 2ISDA 1OE9B 1NPQA 2BBMA 4I5NB 2OS8B 1NX0A 5KSZA 2JTZA 1J7OA 4JWQA 1K9KA 3A4UB 1RJVA 4I5KA 1GGZA 4WQ3A 5DKQA 3M0WA 1A4PA 1QXPA 3PALA 3QRXA 4PE7A 1F55A 1WRLA 3NSLA 4N1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRI A;  1RRO A;  1TNW A;  1DJG A;  2LUC A;  2QAC A;  1M45 A;  4PHK A;  1A75 B;  2KHN A;  3EKJ A;  5J3X A;  1OSA A;  2JWW A;  2BE4 A;  2EC6 C;  1B4C A;  1CFC A;  2JOJ A;  1KSO A;  2M1U A;  2PMY A;  5IBW A;  1B7T Y;  1W7I B;  4XYN A;  2PAL A;  5HLO A;  4A4C A;  1XA5 A;  1K96 A;  3TDZ A;  2F33 A;  3DVK A;  2M8U A;  1F4O A;  3CR5 X;  3E3R A;  1JUO A;  2COL B;  1HT9 A;  4CFQ A;  1DF0 B;  4MVF A;  3AAK A;  1IRJ A;  5I2Q A;  1AK8 A;  1SMG A;  2KOT A;  1F4Q A;  2KFG A;  1S3P A;  1K9U A;  1KFX S;  3VRR A;  1CM4 A;  1SL8 A;  2I18 A;  2MBX A;  4HRG A;  2LMU A;  1KQV A;  2B1U A;  3VRN A;  1SCM C;  1HQV A;  1QAT A;  2LVK A;  2NLN A;  1W7J B;  1K2H A;  4GPL B;  1BR1 B;  2KAY A;  1VRK A;  1KK7 Y;  4L9M A;  2SCP A;  4M2P A;  2BL0 C;  2LMT A;  2L51 A;  3DVJ A;  1TOP A;  1J1D A;  1LKJ A;  2BCX A;  2FCD A;  1B7T Z;  1RTP 1;  1TTX A;  1QIV A;  3O78 A;  2LLS A;  2CTN A;  1KFU S;  1CDP A;  1KFX L;  2BKI B;  1LA3 A;  1OMD A;  1H4B A;  1UHH A;  1QX7 A;  2OTG C;  4PHM A;  2KQY A;  3RLZ A;  1TNQ A;  3LK1 A;  4AQI A;  2L4H A;  1K95 A;  4JQ0 D;  3WHT B;  4C0L A;  4D1E A;  4M2O A;  1BMO A;  2CT9 A;  3NSO A;  1PAL A;  3KF9 A;  1K8U A;  1M39 A;  3JTD B;  3PFV A;  1MUX A;  1WRK A;  5PAL A;  1F8H A;  3WHU B;  1KFU L;  3TDU A;  1B8R A;  2VRG A;  2M7L A;  3TDI A;  2PSR A;  3TUY C;  4OR9 B;  1KK7 Z;  1SW8 A;  2MHH A;  3PAT A;  1BG1 A;  4ORC B;  2JU0 A;  2LVI A;  1MF8 B;  3I5F C;  2AAO A;  4GGF C;  1CMF A;  1J7Q A;  4N1F A;  2M29 A;  1C7W A;  2F8P A;  2L4I A;  3LK0 A;  1X02 A;  3DF0 A;  3PN7 C;  5CSN A;  1NX3 A;  1AHR A;  2M97 A;  1JFJ A;  1TCF A;  1BR4 B;  5FYX A;  1IQ5 A;  1PSR A;  1C7V A;  2M3W A;  4NDD A;  1EG4 A;  1SKT A;  1B8L A;  4MRX A;  5CSI A;  3I5F B;  2EGD A;  3SJS A;  4GGF A;  2LC5 A;  1ALV A;  4OV2 A;  4YGB B;  2E6W A;  1JF2 A;  1SPY A;  1WDC C;  1EJ3 A;  3BOW B;  3BXK A;  2LHL A;  3PLF B;  1XFX O;  2QPT A;  1G8I A;  3ICB A;  3JVT B;  5TNC A;  2H2K A;  4C0J A;  1CNP A;  2L0P A;  1J7R A;  2F2P A;  3SG2 A;  1CLL A;  1KCY A;  2R2I A;  5ER5 A;  2WCB A;  1BU3 A;  1REC A;  3I5I C;  4R1E A;  1N0Y A;  4PAL A;  2BCB A;  2GGZ A;  2PRU A;  1L2O C;  3SG4 A;  1Y1X A;  1JFK A;  2HPS A;  2L50 A;  1UHN A;  3CR2 A;  3O6B A;  3GK2 A;  4OKH A;  4C0K A;  5BPJ A;  1DJY A;  1N2D A;  4GUK A;  3NSK A;  4GFT A;  3AKB A;  4NQG A;  5CSJ A;  2JT0 A;  3DVE A;  1LXF C;  3BUO B;  3HX4 A;  1UHI A;  2KAV A;  4ETO A;  4YBH B;  4YI9 A;  3EVV A;  1MXE A;  1Q80 A;  1YUR A;  1CMG A;  2M7N A;  1F54 A;  2BE6 A;  1IGV A;  5G08 A;  1JC2 A;  3WXA A;  4BY5 A;  4GGN A;  4MEW A;  2LVJ A;  4HRH A;  3IQO A;  4MZJ A;  1PK0 D;  1CDL A;  1SL9 A;  2LAN A;  2P6B B;  2K2F A;  2LAP A;  3EK4 A;  1S6C A;  3LL8 B;  1IQ3 A;  3ZWH A;  1TNX A;  3D0Y B;  1G33 A;  1LVC D;  1MXL C;  2LCP A;  4ZCV A;  1F71 A;  2DOQ A;  1FBV A;  2KI6 D;  3HCM A;  4N5X A;  2JRF A;  1TIZ A;  4I5L B;  1M63 B;  3CTN A;  2LLU A;  1CLM A;  4PDZ A;  5JOL A;  4AQJ A;  1J55 A;  3CZT X;  2L5X B;  1L7Z A;  5B8I B;  1DJI A;  5GQQ C;  4MN0 A;  1B8C A;  1CM1 A;  3OB1 B;  2EC6 B;  1SBJ A;  1GGW A;  1EXR A;  2Y4Q A;  1S6J A;  5JJG A;  2TN4 A;  1Y1A A;  1CDN A;  4DS7 A;  4GNK B;  1MQ1 A;  2MAZ A;  1N65 A;  1TRF A;  3CLN A;  3LLE A;  4GBA A;  1WRZ A;  2LM5 A;  1MHO A;  4NDB A;  1PRW A;  1KWO C;  1TN4 A;  2D8N A;  2I94 A;  1SR6 C;  3VGO A;  1ODB A;  1K93 D;  2WCE A;  1QVI Y;  3A8R A;  3BUW B;  3OHM B;  4FQO A;  2M49 B;  2G2B A;  1SCM B;  2EHB A;  3DD4 A;  1UHJ A;  4P5O E;  4MRY A;  1YRU B;  5AEQ A;  3I5H C;  2ZFD A;  1E8A A;  1ALW A;  1WLM A;  2K0J A;  4BY4 A;  1DJX A;  1XFZ O;  1XO5 A;  2BL0 B;  1KQM C;  1JSA A;  3IQQ A;  2MRD A;  1DGU A;  3OB2 B;  5I8N A;  1S1E A;  4TNC A;  3RM1 A;  2ZND A;  3DVM A;  3FWB A;  3EKH A;  4PE4 A;  1XFW O;  2BCA A;  1B9A A;  1CDM A;  1GJY A;  1U5I B;  2KBM A;  5CPV A;  5HLV A;  2FJU B;  1QX5 B;  1ZMZ A;  2PAS A;  3C1V A;  1IWQ A;  3EK8 A;  4JPZ B;  2OTG B;  4CID A;  2F2O A;  1C07 A;  2H61 A;  2K8M B;  2M0R A;  3LCP C;  2Y5I A;  1M31 A;  1SNL A;  2KI4 C;  3TS5 C;  5DKR A;  1DT7 B;  3WNX B;  2KFF A;  1QVI Z;  5HKZ A;  4PHN A;  3AAJ A;  2KSP A;  4PE0 A;  4XJK B;  1B47 A;  1CFD A;  1OMV A;  1PUL A;  2K7O A;  1J7P A;  1NX2 A;  5ER4 X;  1PVA A;  2NZ0 A;  3OP0 A;  3TUY B;  2CBL A;  1MWN A;  5HKW A;  2FOT A;  2F3Z A;  1CLB A;  3NSI A;  2LUX A;  4PE1 A;  3SG6 A;  1CKK A;  4NDC A;  4CLN A;  1J1E A;  1OMR A;  1FW4 A;  2KAX A;  1CTR A;  1S5G Y;  3AKA A;  3PN7 B;  2E30 A;  1KK8 C;  2KI6 C;  2LMV A;  1AP4 A;  2JPT A;  2JUL A;  2JT3 A;  1AVS A;  4I5J A;  2HQW A;  1QLK A;  3SG7 A;  1YRT B;  1YVH A;  2FCE A;  3SIB A;  2KYC A;  1NUB A;  1ZAC A;  4DIR A;  3ZNI A;  3H4S E;  2WOR A;  2I2R E;  1FF1 A;  1DVI A;  4FTG A;  4P2Y B;  1S36 A;  4AOM A;  2G9B A;  1IJ6 A;  1XYD A;  1WDC B;  1M46 A;  2K7C A;  1UP5 A;  2SAS A;  2ZN9 A;  1LIN A;  5DKN A;  1BT6 A;  1V1G A;  3EK7 A;  3VRP A;  1A2X A;  1QTX A;  4HRE E;  3PM8 A;  1IG5 A;  3BQ3 A;  1GQM A;  3BOW A;  2JNX A;  2JC2 A;  2WND A;  4QJ4 B;  1NIW A;  4Q04 A;  1YVL A;  4CPV A;  1SK6 D;  2KGB C;  1K9P A;  3GOF A;  1NWD A;  1XVJ A;  3I5I B;  1S5G Z;  2OS8 C;  3KPX A;  4ICB A;  1AJ4 A;  2JQ6 A;  1L2O B;  5AXI A;  5AFP A;  3BUX B;  1S26 D;  3FIA A;  4QJ5 B;  2I7A A;  2K7B A;  1ZFS A;  4GAO A;  1XK4 A;  1R6P A;  1Y1U A;  5HYD A;  1BLQ A;  4M2Q A;  1RFJ A;  1A03 A;  5D69 A;  3SG3 A;  2O60 A;  3FWC A;  1CFP A;  4ORA B;  4F0Z B;  5HKY A;  3BUM B;  2BBN A;  3D10 A;  2MLE C;  2O5G A;  2LP2 A;  1NCY A;  1CFF A;  2LVV A;  2K61 A;  1PVB A;  1RK9 A;  4OCI A;  4ZCU A;  2Q91 A;  2ZNE A;  1IH0 A;  1Y0V H;  2K7D A;  5AER A;  3TZ1 A;  1A29 A;  1LA0 A;  3CWG A;  5D7F A;  2LP3 A;  4DRW A;  1NYA A;  2LLT A;  2LNK A;  1TCO B;  1SCV A;  4YRU A;  1A75 A;  1NP8 A;  2JTT A;  3PSR A;  1NSH A;  1SRA A;  4E68 A;  2HQ8 A;  1AUI B;  2WOS A;  3KO0 A;  5KTY A;  3NXA A;  4MZK A;  3D0Y A;  1D1O A;  4UPG A;  5I2O A;  1MR8 A;  4YGC B;  1IKU A;  1KSM A;  1YUS A;  2MA2 A;  5I2L A;  1JWD A;  1EH2 A;  3CGA A;  5AAN A;  2KFH A;  3KEV A;  2RGI A;  2M9G A;  1DF0 A;  2V53 A;  1QS7 A;  1OOJ A;  1PSB A;  3O4Y A;  2CCM A;  4HSZ A;  1QIW A;  5KU1 A;  1ZUZ A;  1Y6W A;  1DJZ A;  3CR4 X;  1G4Y R;  1XFV O;  1KWO B;  1K94 A;  2H61 C;  1SL7 A;  2AUC A;  4USL A;  1SR6 B;  2JZI A;  2WCF A;  4OVN F;  2Y1N A;  3KHE A;  1YTZ C;  3GK4 X;  1YUT A;  1DTL A;  1BF5 A;  4WQ2 A;  1FI6 A;  2CXJ A;  2WC8 A;  1H8B A;  4DUQ A;  1DMO A;  3I5H B;  3VRO A;  2ZKM X;  1QX2 A;  3JTD C;  4QJ3 B;  3K21 A;  2Q4U A;  1KQM B;  3GK1 A;  5F6T A;  2JT8 A;  1RWY A;  1QJT A;  1UUR A;  3O2P A;  4YGE B;  2AMI A;  1TNP A;  2L2E A;  1QV1 A;  2ZRS A;  2LE9 B;  1IJ5 A;  2NCO A;  1AJ5 A;  2KNE A;  1YX8 A;  2BEC A;  3DF0 B;  4U8D A;  1WLZ A;  1OQP A;  2KBI A;  4YI8 A;  3SIA A;  1NCZ A;  2K2A A;  1YUU A;  4MBE A;  4YGD B;  3I5G C;  1UUS A;  1ZOT B;  1DGV A;  4CFR A;  3EVU A;  1U5I A;  2IS9 A;  4A4B A;  1UHK A;  2BKH B;  1B1G A;  1QV0 A;  1FPW A;  1YR5 A;  2NXQ A;  2KYF A;  2KI4 B;  3TS5 B;  2GV5 A;  3FS7 A;  1QLS A;  1OZO A;  2JXC A;  2MJW B;  1BJF A;  2ZN8 A;  1XFY O;  1SYM A;  1R2U A;  1NCX A;  2LHI A;  2LV7 A;  2ZRT A;  4PCW A;  1F70 A;  2Y1M A;  2HET A;  3I5G B;  3SG5 A;  3OX5 A;  2HF5 A;  2KDH A;  3VRQ A;  4XJK A;  2JNF A;  4YGA A;  1BOD A;  3CS1 A;  1QAS A;  1UWO A;  2KQ6 A;  1SY9 A;  2JXL A;  3JVT C;  2GGM A;  3IF7 A;  1NX1 A;  1DJH A;  1KK8 B;  4MSP A;  1JF0 A;  2A4J A;  1XFU O;  1YX7 A;  2PVB A;  1WY9 A;  3MSE B;  4IL1 A;  2NCP A;  1XK4 C;  1JBA A;  1OZS A;  5K89 A;  3BYA A;  1BOC A;  3F45 A;  2CNP A;  2F3Y A;  1S6I A;  3BUN B;  1V1F A;  4PHJ A;  4MZL A;  1K90 D;  3OX6 A;  2M1K B;  4DCK A;  2OPO A;  2L98 A;  4ORB B;  1DJW A;  3EVR A;  1EG3 A;  1CB1 A;  2KGR A;  1FI5 A;  2MLF C;  5CSF A;  1EL4 A;  4MLW A;  2ISD A;  1OE9 B;  1NPQ A;  2BBM A;  4I5N B;  2OS8 B;  1NX0 A;  5KSZ A;  2JTZ A;  1J7O A;  4JWQ A;  1K9K A;  3A4U B;  1RJV A;  4I5K A;  1GGZ A;  4WQ3 A;  5DKQ A;  3M0W A;  1A4P A;  1QXP A;  3PAL A;  3QRX A;  4PE7 A;  1F55 A;  1WRL A;  3NSL A;  4N1G A; 
#chains in the Genus database with same CATH topology
 4WRI A;  1RRO A;  1TNW A;  1DJG A;  2LUC A;  2QAC A;  1M45 A;  4IJ7 A;  3D77 A;  4PHK A;  1A75 B;  2KHN A;  3EKJ A;  5J3X A;  3B87 A;  1OSA A;  2FJY A;  2BE4 A;  2JWW A;  2EC6 C;  1B4C A;  1CFC A;  2JOJ A;  1KSO A;  2M1U A;  2PMY A;  5IBW A;  1B7T Y;  1W7I B;  4XYN A;  2PAL A;  5HLO A;  4A4C A;  1XA5 A;  1K96 A;  3TDZ A;  2F33 A;  3DVK A;  2M8U A;  1F4O A;  3CR5 X;  3E3R A;  1JUO A;  2COL B;  1HT9 A;  4CFQ A;  1OOG A;  1DF0 B;  4MVF A;  3AAK A;  1IRJ A;  5I2Q A;  3NGV A;  1AK8 A;  1IIO A;  1SMG A;  2KOT A;  1F4Q A;  2KFG A;  2KLD A;  5FI2 A;  1S3P A;  1K9U A;  1KFX S;  2K60 A;  1CM4 A;  3VRR A;  1SL8 A;  2I18 A;  2H8V A;  2MBX A;  4HRG A;  2WCH A;  2LMU A;  1KQV A;  2B1U A;  3VRN A;  1SCM C;  1HQV A;  1OW4 A;  1QAT A;  2LVK A;  2NLN A;  1GM0 A;  1W7J B;  1K2H A;  4GPL B;  1BR1 B;  2KAY A;  1VRK A;  1KK7 Y;  4L9M A;  2SCP A;  4M2P A;  2BL0 C;  2LMT A;  2WC6 A;  2L51 A;  3B7A A;  3DVJ A;  1TOP A;  1J1D A;  1LKJ A;  2BCX A;  1OOH A;  2FCD A;  1B7T Z;  1RTP 1;  1TTX A;  1QIV A;  3O78 A;  2LLS A;  2CTN A;  1KFU S;  1CDP A;  1KFX L;  2BKI B;  1LA3 A;  1OMD A;  1H4B A;  1UHH A;  1QX7 A;  2OTG C;  4PHM A;  2KQY A;  3RLZ A;  1TNQ A;  3LK1 A;  4OZD A;  3SS3 A;  4AQI A;  2L4H A;  1K95 A;  4JQ0 D;  3WHT B;  4C0L A;  4D1E A;  4M2O A;  1BMO A;  2CT9 A;  3NSO A;  1PAL A;  2QEB A;  3KF9 A;  1K8U A;  1M39 A;  3JTD B;  3PFV A;  1MUX A;  1WRK A;  5PAL A;  1F8H A;  3WHU B;  1KFU L;  3TDU A;  1B8R A;  2VRG A;  2M7L A;  3TDI A;  2PSR A;  4INW A;  3TUY C;  2PYQ A;  4OR9 B;  1KK7 Z;  1SW8 A;  2MHH A;  3PAT A;  1BG1 A;  4ORC B;  2JU0 A;  2LVI A;  1MF8 B;  3I5F C;  2AAO A;  4GGF C;  1CMF A;  1J7Q A;  4N1F A;  2M29 A;  1C7W A;  2F8P A;  2L4I A;  3LK0 A;  1X02 A;  3DF0 A;  3PN7 C;  5CSN A;  1P28 A;  1TWO A;  3NHT A;  1NX3 A;  1AHR A;  2M97 A;  1JFJ A;  1TCF A;  1BR4 B;  5FYX A;  1IQ5 A;  1PSR A;  1C7V A;  2M3W A;  5DIC A;  4NDD A;  1EG4 A;  3DXL A;  1SKT A;  3S0A A;  1B8L A;  2WCJ A;  4MRX A;  5CSI A;  3I5F B;  2EGD A;  2PQL A;  3SJS A;  3D75 A;  4GGF A;  2LC5 A;  1ALV A;  3DYE A;  4OV2 A;  2E6W A;  4YGB B;  1JF2 A;  1SPY A;  1WDC C;  1EJ3 A;  3BOW B;  3BXK A;  2LHL A;  3PLF B;  1XFX O;  2QPT A;  5D3O A;  1G8I A;  3ICB A;  3JVT B;  5TNC A;  2H2K A;  4C0J A;  1CNP A;  2L0P A;  1J7R A;  1OOF A;  2F2P A;  3D76 A;  1CLL A;  4PT1 A;  3SG2 A;  1KCY A;  2R2I A;  1OOI X;  5ER5 A;  2WCB A;  1BU3 A;  1REC A;  3I5I C;  4R1E A;  4KYN A;  1N0Y A;  3S0E A;  4PAL A;  2BCB A;  2GGZ A;  2PRU A;  1L2O C;  3SG4 A;  1Y1X A;  1JFK A;  2HPS A;  2L50 A;  1UHN A;  3CR2 A;  3O6B A;  2QDI A;  3GK2 A;  4OKH A;  5EL2 A;  4C0K A;  5BPJ A;  1DJY A;  1N2D A;  4GUK A;  3NSK A;  4GFT A;  3AKB A;  3EG5 B;  3CDN A;  2JT0 A;  3DVE A;  1LXF C;  3BUO B;  2KPH A;  1UHI A;  2KAV A;  3HX4 A;  4ETO A;  3S0F A;  4YBH B;  4YI9 A;  3EVV A;  1MXE A;  3UNW A;  1Q80 A;  1YUR A;  1CMG A;  2M7N A;  1F54 A;  2BE6 A;  1IGV A;  5G08 A;  1DEL A;  1JC2 A;  3RZS A;  3WXA A;  1C3Y A;  2L2C A;  4BY5 A;  1TUZ A;  4GGN A;  4MEW A;  2LVJ A;  4HRH A;  3IQO A;  4MZJ A;  1PK0 D;  1CDL A;  1SL9 A;  2LAN A;  2P6B B;  2K2F A;  2LAP A;  3EK4 A;  1Z4H A;  1S6C A;  3D78 A;  3LL8 B;  1IQ3 A;  3ZWH A;  1TNX A;  3D0Y B;  1G33 A;  1LVC D;  1MXL C;  2BAP A;  2LCP A;  4ZCV A;  4F7F A;  1F71 A;  2DOQ A;  1FBV A;  2KI6 D;  3HCM A;  4N5X A;  2JRF A;  1TIZ A;  3CZ1 A;  4I5L B;  1M63 B;  3CTN A;  2LLU A;  1CLM A;  3L4L A;  4PDZ A;  5JOL A;  4AQJ A;  1J55 A;  3CZT X;  2L5X B;  1LS8 A;  1L7Z A;  5B8I B;  1DJI A;  5GQQ C;  2BNX A;  1XFR A;  4MN0 A;  1B8C A;  1CM1 A;  3OB1 B;  2EC6 B;  3DY9 A;  3L4A A;  4INX A;  1SBJ A;  1GGW A;  1EXR A;  2Y4Q A;  1S6J A;  1TUJ A;  3PM2 A;  5JJG A;  2TN4 A;  1Y1A A;  1CDN A;  4DS7 A;  4GNK B;  1MQ1 A;  2MAZ A;  1N65 A;  1TRF A;  3CLN A;  3LLE A;  4GBA A;  1WRZ A;  2LM5 A;  1MHO A;  3B86 A;  1PRW A;  3FE9 A;  1KWO C;  4NDB A;  1Z2C B;  1TN4 A;  2D8N A;  2I94 A;  1SR6 C;  3VGO A;  1ODB A;  1K93 D;  2WCE A;  1QVI Y;  3A8R A;  3BUW B;  3OHM B;  3CZ0 A;  4FQO A;  2M49 B;  2G2B A;  1SCM B;  2EHB A;  3DD4 A;  1UHJ A;  4P5O E;  3BFB A;  1YRU B;  4MRY A;  3I5H C;  2ZFD A;  5AEQ A;  1WLM A;  1E8A A;  1ALW A;  2K0J A;  4BY4 A;  1DJX A;  1XFZ O;  1XO5 A;  2BL0 B;  1KQM C;  1JSA A;  3IQQ A;  2MRD A;  5HL1 A;  1DGU A;  3OB2 B;  5I8N A;  1S1E A;  4TNC A;  3RM1 A;  2ZND A;  3DVM A;  3FWB A;  3EKH A;  4PE4 A;  1XFW O;  2BCA A;  5I94 A;  1B9A A;  1CDM A;  1GJY A;  1U5I B;  2KBM A;  5CPV A;  5HLV A;  5CSJ A;  2FJU B;  1QX5 B;  1ZMZ A;  2PAS A;  3C1V A;  1IWQ A;  3EK8 A;  4JPZ B;  2OTG B;  4CID A;  2F2O A;  1C07 A;  2H61 A;  2K8M B;  2M0R A;  3LCP C;  2Y5I A;  1M31 A;  1SNL A;  2KI4 C;  3TS5 C;  5DKR A;  1DT7 B;  3WNX B;  2KFF A;  1QVI Z;  1DQE A;  2WC5 A;  5HKZ A;  4PHN A;  3AAJ A;  3NHI A;  2KSP A;  4PE0 A;  4XJK B;  1B47 A;  1CFD A;  1OMV A;  1PUL A;  2K7O A;  1J7P A;  1NX2 A;  5ER4 X;  1PVA A;  2NZ0 A;  3OP0 A;  3TUY B;  2CBL A;  1MWN A;  5HKW A;  2FOT A;  2F3Z A;  1CLB A;  3NSI A;  2LUX A;  4PE1 A;  3SG6 A;  1CKK A;  4NDC A;  4CLN A;  1J1E A;  3SS4 A;  1OMR A;  1FW4 A;  2KAX A;  1CTR A;  1S5G Y;  3AKA A;  3PN7 B;  2E30 A;  1KK8 C;  3B6X A;  2KI6 C;  2LMV A;  3D73 A;  2JPT A;  2JUL A;  3D74 A;  2JT3 A;  1AP4 A;  1AVS A;  2WCL A;  4I5J A;  2HQW A;  1QLK A;  3CYZ A;  1YRT B;  1YVH A;  2FCE A;  3SIB A;  3SG7 A;  2KLE A;  2KYC A;  1NUB A;  2JPO A;  1ZAC A;  4DIR A;  3ZNI A;  3H4S E;  2WOR A;  2I2R E;  1FF1 A;  1DVI A;  4FTG A;  4P2Y B;  3Q8I A;  1S36 A;  4AOM A;  2G9B A;  1IJ6 A;  1XYD A;  3VB1 A;  1WDC B;  1M46 A;  2K7C A;  1UP5 A;  1DEK A;  2SAS A;  2ZN9 A;  1LIN A;  3S0B A;  5DKN A;  1BT6 A;  1W9Z A;  1V1G A;  3EK7 A;  3VRP A;  1A2X A;  1QTX A;  4HRE E;  3CZ2 A;  3PM8 A;  1IG5 A;  3L47 A;  3BQ3 A;  1GQM A;  3BOW A;  2JNX A;  2JC2 A;  2WND A;  3S0D A;  1NIW A;  4QJ4 B;  4Q04 A;  1YVL A;  3O4X A;  4CPV A;  1SK6 D;  2KGB C;  1K9P A;  3GOF A;  1NWD A;  1XVJ A;  3I5I B;  1S5G Z;  2OS8 C;  3KPX A;  3OBV A;  3PJI A;  4ICB A;  1AJ4 A;  2JQ6 A;  1L2O B;  5AXI A;  5AFP A;  3BUX B;  3V2L A;  1S26 D;  3FIA A;  4QJ5 B;  2I7A A;  2K7B A;  1ZFS A;  4GAO A;  1XK4 A;  1R6P A;  1Y1U A;  4JD9 A;  5HYD A;  1BLQ A;  4M2Q A;  1RFJ A;  1A03 A;  4FQT A;  5D69 A;  3SG3 A;  2O60 A;  3FWC A;  1CFP A;  3QME A;  4ORA B;  4F0Z B;  5HKY A;  2QEV A;  3BUM B;  2BBN A;  3D10 A;  1ORG A;  2MLE C;  2O5G A;  2LP2 A;  1NCY A;  3DZT A;  1CFF A;  2LVV A;  2QEO A;  2K61 A;  1PVB A;  1RK9 A;  4OCI A;  4ZCU A;  2Q91 A;  2ZNE A;  1IH0 A;  1Y0V H;  2K7D A;  3BFH A;  5AER A;  3TZ1 A;  1A29 A;  1LA0 A;  3CWG A;  5D7F A;  2LP3 A;  4DRW A;  1NYA A;  2LLT A;  2LNK A;  1TCO B;  1SCV A;  4YRU A;  1A75 A;  1NP8 A;  2JTT A;  3PSR A;  1NSH A;  1SRA A;  4E68 A;  2HQ8 A;  1AUI B;  2WOS A;  3KO0 A;  2P70 A;  5KTY A;  3NXA A;  4MZK A;  3D0Y A;  1D1O A;  4UPG A;  5I2O A;  1MR8 A;  4YGC B;  1IKU A;  1KSM A;  1YUS A;  2MA2 A;  5I2L A;  1JWD A;  1EH2 A;  3CGA A;  5AAN A;  5FI7 A;  2KFH A;  3KEV A;  2RGI A;  2M9G A;  3BFA A;  1DF0 A;  2V53 A;  2WCK A;  3B88 A;  3S0G A;  1QS7 A;  1OOJ A;  1PSB A;  3O4Y A;  2CCM A;  4HSZ A;  1QIW A;  3K1E A;  5KU1 A;  1ZUZ A;  1Y6W A;  1DJZ A;  3CR4 X;  4NQG A;  1G4Y R;  1XFV O;  2QEH A;  1KWO B;  1K94 A;  2H61 C;  1SL7 A;  2AUC A;  4USL A;  1SR6 B;  2JZI A;  2WCF A;  4OVN F;  2Y1N A;  3KHE A;  1YTZ C;  3GK4 X;  1YUT A;  1DTL A;  3R1P A;  1BF5 A;  4WQ2 A;  1FI6 A;  2CXJ A;  2WC8 A;  1H8B A;  4DUQ A;  1DMO A;  3I5H B;  3VRO A;  2ZKM X;  1QX2 A;  3JTD C;  4QJ3 B;  1DC1 A;  3K21 A;  2Q4U A;  1KQM B;  3GK1 A;  5F6T A;  2JT8 A;  1RWY A;  1QJT A;  1UUR A;  3O2P A;  4YGE B;  2AMI A;  1TNP A;  2L2E A;  1QV1 A;  2ZRS A;  2LE9 B;  2ERB A;  1C3Z A;  1IJ5 A;  2NCO A;  1AJ5 A;  2KNE A;  1YX8 A;  2BEC A;  3DF0 B;  4U8D A;  1WLZ A;  1OQP A;  2KBI A;  4YI8 A;  3SIA A;  1NCZ A;  2K2A A;  3BJH A;  3CAB A;  1YUU A;  4MBE A;  4YGD B;  3I5G C;  1UUS A;  1ZOT B;  1DGV A;  4CFR A;  3EVU A;  1U5I A;  2IS9 A;  5FI6 A;  1UHK A;  2BKH B;  4A4B A;  1QV0 A;  1B1G A;  1FPW A;  1YR5 A;  2NXQ A;  2KYF A;  2KI4 B;  3TS5 B;  2GV5 A;  3FS7 A;  1QLS A;  1OZO A;  2JXC A;  3FE6 A;  2MJW B;  1BJF A;  2ZN8 A;  1SSE B;  1XFY O;  2L5Y A;  1SYM A;  1R2U A;  1NCX A;  2LHI A;  2LV7 A;  2ZRT A;  4PCW A;  1F70 A;  2Y1M A;  2HET A;  3I5G B;  3SG5 A;  2P71 A;  3OX5 A;  2HF5 A;  2KDH A;  3VRQ A;  2GTE A;  4XJK A;  2JNF A;  4YGA A;  1BOD A;  1T14 A;  1QAS A;  1UWO A;  2KQ6 A;  1SY9 A;  2JXL A;  2WCM A;  3CS1 A;  3JVT C;  3R1O A;  2GGM A;  3IF7 A;  3FE8 A;  1NX1 A;  4JKT A;  1DJH A;  1KK8 B;  4MSP A;  1JF0 A;  2A4J A;  1XFU O;  1YX7 A;  2PVB A;  3OGN A;  1WY9 A;  3MSE B;  3R72 A;  4IL1 A;  2NCP A;  3IVT A;  1XK4 C;  1JBA A;  1OZS A;  5K89 A;  3BYA A;  1BOC A;  3F45 A;  2CNP A;  2F3Y A;  1S6I A;  3BUN B;  1V1F A;  4PHJ A;  4MZL A;  1K90 D;  3OX6 A;  2M1K B;  3N7H A;  4DCK A;  2OPO A;  3R1V A;  2L98 A;  4ORB B;  1DJW A;  3EVR A;  3UO9 A;  1EG3 A;  1CB1 A;  2KGR A;  1FI5 A;  2MLF C;  3SS5 A;  5CSF A;  1EL4 A;  4MLW A;  2ISD A;  1OE9 B;  1NPQ A;  2BBM A;  4I5N B;  2OS8 B;  1NX0 A;  1QWV A;  2JTZ A;  5KSZ A;  1J7O A;  4JWQ A;  1K9K A;  3A4U B;  1RJV A;  4I5K A;  1GGZ A;  4WQ3 A;  5DKQ A;  3M0W A;  1A4P A;  1QXP A;  3PAL A;  3QRX A;  4PE7 A;  1F55 A;  2YGU A;  1WRL A;  3NSL A;  4N1G A; 
#chains in the Genus database with same CATH homology
 4WRI A;  1RRO A;  1TNW A;  1DJG A;  2LUC A;  2QAC A;  1M45 A;  4PHK A;  1A75 B;  2KHN A;  3EKJ A;  5J3X A;  1OSA A;  2JWW A;  2BE4 A;  2EC6 C;  1B4C A;  1CFC A;  2JOJ A;  1KSO A;  2M1U A;  2PMY A;  5IBW A;  1B7T Y;  1W7I B;  4XYN A;  2PAL A;  5HLO A;  4A4C A;  1XA5 A;  1K96 A;  3TDZ A;  2F33 A;  3DVK A;  2M8U A;  1F4O A;  3CR5 X;  3E3R A;  1JUO A;  2COL B;  1HT9 A;  4CFQ A;  1DF0 B;  4MVF A;  3AAK A;  1IRJ A;  5I2Q A;  1AK8 A;  1SMG A;  2KOT A;  1F4Q A;  2KFG A;  1S3P A;  1K9U A;  1KFX S;  3VRR A;  1CM4 A;  1SL8 A;  2I18 A;  2MBX A;  4HRG A;  2LMU A;  1KQV A;  2B1U A;  3VRN A;  1SCM C;  1HQV A;  1QAT A;  2LVK A;  2NLN A;  1W7J B;  1K2H A;  4GPL B;  1BR1 B;  2KAY A;  1VRK A;  1KK7 Y;  4L9M A;  2SCP A;  4M2P A;  2BL0 C;  2LMT A;  2L51 A;  3DVJ A;  1TOP A;  1J1D A;  1LKJ A;  2BCX A;  2FCD A;  1B7T Z;  1RTP 1;  1TTX A;  1QIV A;  3O78 A;  2LLS A;  2CTN A;  1KFU S;  1CDP A;  1KFX L;  2BKI B;  1LA3 A;  1OMD A;  1H4B A;  1UHH A;  1QX7 A;  2OTG C;  4PHM A;  2KQY A;  3RLZ A;  1TNQ A;  3LK1 A;  4AQI A;  2L4H A;  1K95 A;  4JQ0 D;  3WHT B;  4C0L A;  4D1E A;  4M2O A;  1BMO A;  2CT9 A;  3NSO A;  1PAL A;  3KF9 A;  1K8U A;  1M39 A;  3JTD B;  3PFV A;  1MUX A;  1WRK A;  5PAL A;  1F8H A;  3WHU B;  1KFU L;  3TDU A;  1B8R A;  2VRG A;  2M7L A;  3TDI A;  2PSR A;  3TUY C;  4OR9 B;  1KK7 Z;  1SW8 A;  2MHH A;  3PAT A;  1BG1 A;  4ORC B;  2JU0 A;  2LVI A;  1MF8 B;  3I5F C;  2AAO A;  4GGF C;  1CMF A;  1J7Q A;  4N1F A;  2M29 A;  1C7W A;  2F8P A;  2L4I A;  3LK0 A;  1X02 A;  3DF0 A;  3PN7 C;  5CSN A;  1NX3 A;  1AHR A;  2M97 A;  1JFJ A;  1TCF A;  1BR4 B;  5FYX A;  1IQ5 A;  1PSR A;  1C7V A;  2M3W A;  4NDD A;  1EG4 A;  1SKT A;  1B8L A;  4MRX A;  5CSI A;  3I5F B;  2EGD A;  3SJS A;  4GGF A;  2LC5 A;  1ALV A;  4OV2 A;  4YGB B;  2E6W A;  1JF2 A;  1SPY A;  1WDC C;  1EJ3 A;  3BOW B;  3BXK A;  2LHL A;  3PLF B;  1XFX O;  2QPT A;  1G8I A;  3ICB A;  3JVT B;  5TNC A;  2H2K A;  4C0J A;  1CNP A;  2L0P A;  1J7R A;  2F2P A;  3SG2 A;  1CLL A;  1KCY A;  2R2I A;  5ER5 A;  2WCB A;  1BU3 A;  1REC A;  3I5I C;  4R1E A;  1N0Y A;  4PAL A;  2BCB A;  2GGZ A;  2PRU A;  1L2O C;  3SG4 A;  1Y1X A;  1JFK A;  2HPS A;  2L50 A;  1UHN A;  3CR2 A;  3O6B A;  3GK2 A;  4OKH A;  4C0K A;  5BPJ A;  1DJY A;  1N2D A;  4GUK A;  3NSK A;  4GFT A;  3AKB A;  4NQG A;  5CSJ A;  2JT0 A;  3DVE A;  1LXF C;  3BUO B;  3HX4 A;  1UHI A;  2KAV A;  4ETO A;  4YBH B;  4YI9 A;  3EVV A;  1MXE A;  1Q80 A;  1YUR A;  1CMG A;  2M7N A;  1F54 A;  2BE6 A;  1IGV A;  5G08 A;  1JC2 A;  3WXA A;  4BY5 A;  4GGN A;  4MEW A;  2LVJ A;  4HRH A;  3IQO A;  4MZJ A;  1PK0 D;  1CDL A;  1SL9 A;  2LAN A;  2P6B B;  2K2F A;  2LAP A;  3EK4 A;  1S6C A;  3LL8 B;  1IQ3 A;  3ZWH A;  1TNX A;  3D0Y B;  1G33 A;  1LVC D;  1MXL C;  2LCP A;  4ZCV A;  1F71 A;  2DOQ A;  1FBV A;  2KI6 D;  3HCM A;  4N5X A;  2JRF A;  1TIZ A;  4I5L B;  1M63 B;  3CTN A;  2LLU A;  1CLM A;  4PDZ A;  5JOL A;  4AQJ A;  1J55 A;  3CZT X;  2L5X B;  1L7Z A;  5B8I B;  1DJI A;  5GQQ C;  4MN0 A;  1B8C A;  1CM1 A;  3OB1 B;  2EC6 B;  1SBJ A;  1GGW A;  1EXR A;  2Y4Q A;  1S6J A;  5JJG A;  2TN4 A;  1Y1A A;  1CDN A;  4DS7 A;  4GNK B;  1MQ1 A;  2MAZ A;  1N65 A;  1TRF A;  3CLN A;  3LLE A;  4GBA A;  1WRZ A;  2LM5 A;  1MHO A;  4NDB A;  1PRW A;  1KWO C;  1TN4 A;  2D8N A;  2I94 A;  1SR6 C;  3VGO A;  1ODB A;  1K93 D;  2WCE A;  1QVI Y;  3A8R A;  3BUW B;  3OHM B;  4FQO A;  2M49 B;  2G2B A;  1SCM B;  2EHB A;  3DD4 A;  1UHJ A;  4P5O E;  4MRY A;  1YRU B;  5AEQ A;  3I5H C;  2ZFD A;  1E8A A;  1ALW A;  1WLM A;  2K0J A;  4BY4 A;  1DJX A;  1XFZ O;  1XO5 A;  2BL0 B;  1KQM C;  1JSA A;  3IQQ A;  2MRD A;  1DGU A;  3OB2 B;  5I8N A;  1S1E A;  4TNC A;  3RM1 A;  2ZND A;  3DVM A;  3FWB A;  3EKH A;  4PE4 A;  1XFW O;  2BCA A;  1B9A A;  1CDM A;  1GJY A;  1U5I B;  2KBM A;  5CPV A;  5HLV A;  2FJU B;  1QX5 B;  1ZMZ A;  2PAS A;  3C1V A;  1IWQ A;  3EK8 A;  4JPZ B;  2OTG B;  4CID A;  2F2O A;  1C07 A;  2H61 A;  2K8M B;  2M0R A;  3LCP C;  2Y5I A;  1M31 A;  1SNL A;  2KI4 C;  3TS5 C;  5DKR A;  1DT7 B;  3WNX B;  2KFF A;  1QVI Z;  5HKZ A;  4PHN A;  3AAJ A;  2KSP A;  4PE0 A;  4XJK B;  1B47 A;  1CFD A;  1OMV A;  1PUL A;  2K7O A;  1J7P A;  1NX2 A;  5ER4 X;  1PVA A;  2NZ0 A;  3OP0 A;  3TUY B;  2CBL A;  1MWN A;  5HKW A;  2FOT A;  2F3Z A;  1CLB A;  3NSI A;  2LUX A;  4PE1 A;  3SG6 A;  1CKK A;  4NDC A;  4CLN A;  1J1E A;  1OMR A;  1FW4 A;  2KAX A;  1CTR A;  1S5G Y;  3AKA A;  3PN7 B;  2E30 A;  1KK8 C;  2KI6 C;  2LMV A;  1AP4 A;  2JPT A;  2JUL A;  2JT3 A;  1AVS A;  4I5J A;  2HQW A;  1QLK A;  3SG7 A;  1YRT B;  1YVH A;  2FCE A;  3SIB A;  2KYC A;  1NUB A;  1ZAC A;  4DIR A;  3ZNI A;  3H4S E;  2WOR A;  2I2R E;  1FF1 A;  1DVI A;  4FTG A;  4P2Y B;  1S36 A;  4AOM A;  2G9B A;  1IJ6 A;  1XYD A;  1WDC B;  1M46 A;  2K7C A;  1UP5 A;  2SAS A;  2ZN9 A;  1LIN A;  5DKN A;  1BT6 A;  1V1G A;  3EK7 A;  3VRP A;  1A2X A;  1QTX A;  4HRE E;  3PM8 A;  1IG5 A;  3BQ3 A;  1GQM A;  3BOW A;  2JNX A;  2JC2 A;  2WND A;  4QJ4 B;  1NIW A;  4Q04 A;  1YVL A;  4CPV A;  1SK6 D;  2KGB C;  1K9P A;  3GOF A;  1NWD A;  1XVJ A;  3I5I B;  1S5G Z;  2OS8 C;  3KPX A;  4ICB A;  1AJ4 A;  2JQ6 A;  1L2O B;  5AXI A;  5AFP A;  3BUX B;  1S26 D;  3FIA A;  4QJ5 B;  2I7A A;  2K7B A;  1ZFS A;  4GAO A;  1XK4 A;  1R6P A;  1Y1U A;  5HYD A;  1BLQ A;  4M2Q A;  1RFJ A;  1A03 A;  5D69 A;  3SG3 A;  2O60 A;  3FWC A;  1CFP A;  4ORA B;  4F0Z B;  5HKY A;  3BUM B;  2BBN A;  3D10 A;  2MLE C;  2O5G A;  2LP2 A;  1NCY A;  1CFF A;  2LVV A;  2K61 A;  1PVB A;  1RK9 A;  4OCI A;  4ZCU A;  2Q91 A;  2ZNE A;  1IH0 A;  1Y0V H;  2K7D A;  5AER A;  3TZ1 A;  1A29 A;  1LA0 A;  3CWG A;  5D7F A;  2LP3 A;  4DRW A;  1NYA A;  2LLT A;  2LNK A;  1TCO B;  1SCV A;  4YRU A;  1A75 A;  1NP8 A;  2JTT A;  3PSR A;  1NSH A;  1SRA A;  4E68 A;  2HQ8 A;  1AUI B;  2WOS A;  3KO0 A;  5KTY A;  3NXA A;  4MZK A;  3D0Y A;  1D1O A;  4UPG A;  5I2O A;  1MR8 A;  4YGC B;  1IKU A;  1KSM A;  1YUS A;  2MA2 A;  5I2L A;  1JWD A;  1EH2 A;  3CGA A;  5AAN A;  2KFH A;  3KEV A;  2RGI A;  2M9G A;  1DF0 A;  2V53 A;  1QS7 A;  1OOJ A;  1PSB A;  3O4Y A;  2CCM A;  4HSZ A;  1QIW A;  5KU1 A;  1ZUZ A;  1Y6W A;  1DJZ A;  3CR4 X;  1G4Y R;  1XFV O;  1KWO B;  1K94 A;  2H61 C;  1SL7 A;  2AUC A;  4USL A;  1SR6 B;  2JZI A;  2WCF A;  4OVN F;  2Y1N A;  3KHE A;  1YTZ C;  3GK4 X;  1YUT A;  1DTL A;  1BF5 A;  4WQ2 A;  1FI6 A;  2CXJ A;  2WC8 A;  1H8B A;  4DUQ A;  1DMO A;  3I5H B;  3VRO A;  2ZKM X;  1QX2 A;  3JTD C;  4QJ3 B;  3K21 A;  2Q4U A;  1KQM B;  3GK1 A;  5F6T A;  2JT8 A;  1RWY A;  1QJT A;  1UUR A;  3O2P A;  4YGE B;  2AMI A;  1TNP A;  2L2E A;  1QV1 A;  2ZRS A;  2LE9 B;  1IJ5 A;  2NCO A;  1AJ5 A;  2KNE A;  1YX8 A;  2BEC A;  3DF0 B;  4U8D A;  1WLZ A;  1OQP A;  2KBI A;  4YI8 A;  3SIA A;  1NCZ A;  2K2A A;  1YUU A;  4MBE A;  4YGD B;  3I5G C;  1UUS A;  1ZOT B;  1DGV A;  4CFR A;  3EVU A;  1U5I A;  2IS9 A;  4A4B A;  1UHK A;  2BKH B;  1B1G A;  1QV0 A;  1FPW A;  1YR5 A;  2NXQ A;  2KYF A;  2KI4 B;  3TS5 B;  2GV5 A;  3FS7 A;  1QLS A;  1OZO A;  2JXC A;  2MJW B;  1BJF A;  2ZN8 A;  1XFY O;  1SYM A;  1R2U A;  1NCX A;  2LHI A;  2LV7 A;  2ZRT A;  4PCW A;  1F70 A;  2Y1M A;  2HET A;  3I5G B;  3SG5 A;  3OX5 A;  2HF5 A;  2KDH A;  3VRQ A;  4XJK A;  2JNF A;  4YGA A;  1BOD A;  3CS1 A;  1QAS A;  1UWO A;  2KQ6 A;  1SY9 A;  2JXL A;  3JVT C;  2GGM A;  3IF7 A;  1NX1 A;  1DJH A;  1KK8 B;  4MSP A;  1JF0 A;  2A4J A;  1XFU O;  1YX7 A;  2PVB A;  1WY9 A;  3MSE B;  4IL1 A;  2NCP A;  1XK4 C;  1JBA A;  1OZS A;  5K89 A;  3BYA A;  1BOC A;  3F45 A;  2CNP A;  2F3Y A;  1S6I A;  3BUN B;  1V1F A;  4PHJ A;  4MZL A;  1K90 D;  3OX6 A;  2M1K B;  4DCK A;  2OPO A;  2L98 A;  4ORB B;  1DJW A;  3EVR A;  1EG3 A;  1CB1 A;  2KGR A;  1FI5 A;  2MLF C;  5CSF A;  1EL4 A;  4MLW A;  2ISD A;  1OE9 B;  1NPQ A;  2BBM A;  4I5N B;  2OS8 B;  1NX0 A;  5KSZ A;  2JTZ A;  1J7O A;  4JWQ A;  1K9K A;  3A4U B;  1RJV A;  4I5K A;  1GGZ A;  4WQ3 A;  5DKQ A;  3M0W A;  1A4P A;  1QXP A;  3PAL A;  3QRX A;  4PE7 A;  1F55 A;  1WRL A;  3NSL A;  4N1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...