1IWQA

Crystal structure of marcks calmodulin binding domain peptide complexed with ca2+/calmodulin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
139
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Crystal structure of a MARCKS peptide containing the calmodulin-binding domain in complex with Ca(2+)-calmodulin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/protein binding
total genus 52
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iwqA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iwqA02
3SG5A 3CLNA 1KQMB 2JC2A 1UP5A 3O78A 4YGDB 1F8HA 1Q80A 1A29A 5CSJA 1DJZA 1FI6A 1CDPA 2LMUA 2K7BA 1J7QA 2L50A 3I5FC 1CMGA 1AUIB 1F4QA 1OMDA 4USLA 5I2QA 3NSOA 1J7RA 1BMOA 2M29A 1L7ZA 1SL8A 3D0YB 1J1DA 1KFXL 2I18A 4ORBB 2LVIA 1RROA 4PE0A 2JULA 1JC2A 1YUUA 3F45A 1KK7Z 4AQIA 4C0LA 2B1UA 1JWDA 2FOTA 2E30A 3BUXB 3CGAA 2L4IA 1AJ4A 3NSKA 2F2PA 1SR6C 1KQVA 1RJVA 5ER4X 1JBAA 1EL4A 4XYNA 1G8IA 4PALA 4YRUA 2Y4QA 1QVIY 5FYXA 1OMRA 5HKYA 4DRWA 2Q4UA 3SG6A 1DJIA 3WNXB 2I94A 2M7LA 1Y6WA 1CDLA 4C0JA 2WCBA 4ICBA 1QLSA 4DUQA 1S3PA 2BCBA 2F8PA 4ORCB 3EK8A 2KNEA 4OVNF 2WCFA 2K2FA 2LP3A 1KK8C 3NSLA 2CNPA 5KSZA 3I5GB 4PCWA 1EJ3A 1MXLC 2ZKMX 1NCZA 1TN4A 1F55A 2I7AA 1B8LA 2H61C 2MHHA 3JTDB 1QASA 1LVCD 3RLZA 1MUXA 1KFUL 1UHKA 1BJFA 3ICBA 1WRLA 1N2DA 2Y1MA 4AQJA 2PRUA 3DVMA 1NX1A 3TDUA 4PE4A 1CLBA 1BLQA 1M46A 2JQ6A 2H2KA 3HCMA 3I5FB 1SL7A 1U5IB 1SCVA 1C07A 2IS9A 1RFJA 1SW8A 1UWOA 3KEVA 3ZNIA 4A4CA 1SRAA 4CFRA 1HQVA 1CFPA 2K7CA 3LK1A 1NX0A 1S6JA 3TZ1A 3DVJA 2BCXA 4MVFA 1TNWA 2AMIA 2JT3A 1JF2A 1YR5A 2MAZA 3EVRA 1TIZA 1BR4B 2K2AA 2M8UA 2LAPA 2JNXA 2KQ6A 3I5HB 2BBMA 1CLLA 1NSHA 4HREE 3TS5C 3H4SE 2JTZA 1XFXO 4MEWA 1W7JB 4JPZB 1KFUS 2EGDA 1CMFA 4N5XA 2NCPA 1GGWA 4YGEB 1BG1A 1FBVA 1JSAA 3D0YA 1M31A 4M2PA 1IJ6A 4GAOA 3CR2A 3DVEA 2L5XB 1CM1A 1KWOC 4GNKB 2MBXA 3D10A 2OTGC 1YX8A 1WY9A 1W7IB 3A8RA 4E68A 1KCYA 1YRTB 2LP2A 2M0RA 1QX5B 2G2BA 4R1EA 1CNPA 1RTP1 1SY9A 3SG2A 4I5JA 4PHMA 2P6BB 3GK2A 2M9GA 1OOJA 1XFWO 1S1EA 1TRFA 2HQ8A 2BL0C 2KQYA 2M97A 3SG4A 4PHKA 4ZCVA 2HPSA 3PATA 2Y5IA 1OZSA 3O4YA 3CR4X 1N65A 2AUCA 3EVUA 2OS8B 2G9BA 2O60A 3IQOA 1V1GA 2ZN8A 3EK7A 2LVJA 4A4BA 4N1GA 1TNXA 3BUNB 3NSIA 1XVJA 1DJHA 5D69A 4C0KA 1QTXA 1BF5A 4CPVA 1LA0A 3KO0A 4WQ3A 1SCMB 4NDCA 2LLUA 1EXRA 2JU0A 2M7NA 2WNDA 3MSEB 3I5IC 3CWGA 3PALA 5AANA 3DF0B 4GGFA 4BY5A 4MRYA 2BECA 2O5GA 1QJTA 3KF9A 3OP0A 1IKUA 1ZMZA 1QVIZ 1A75B 2HF5A 2JXLA 5I8NA 2HETA 2KI6C 1NIWA 2BKIB 2JRFA 5ER5A 4M2OA 3TS5B 1B8RA 4JQ0D 1U5IA 2JZIA 1XFZO 2KHNA 2BE6A 2ZRSA 1C7WA 4IL1A 5D7FA 2K7OA 1F54A 1PSBA 4GUKA 1ZOTB 2D8NA 1KWOB 1WLMA 3FIAA 2OTGB 3OB1B 1NYAA 2CCMA 2Y1NA 1CTRA 1JFKA 2BCAA 2KOTA 2EC6C 5HLVA 3DD4A 2LHIA 1UHIA 1ZUZA 4OCIA 3VRPA 1K93D 1YVLA 3VROA 2KBIA 1DGUA 2ZNEA 1DJGA 4AOMA 2KSPA 1S5GY 5GQQC 3BQ3A 1MF8B 1QV0A 1LXFC 1QS7A 3EK4A 1CFCA 2CT9A 2K7DA 2JT0A 3K21A 3O2PA 1SYMA 2NXQA 1DTLA 1NWDA 5I2LA 1KSMA 1SBJA 2L98A 1S36A 1J1EA 2LV7A 3I5IB 2LE9B 1S26D 1K9PA 2LMVA 3E3RA 1BT6A 5HKZA 1K8UA 2LCPA 2QACA 2SCPA 1BOCA 2LMTA 2RGIA 4PDZA 3IF7A 1C7VA 4N1FA 1L2OC 1OE9B 1B4CA 1WRZA 4GGNA 1QATA 4M2QA 3PFVA 4U8DA 1RECA 1ZFSA 4QJ4B 1DF0B 3CTNA 1MQ1A 5CPVA 1A2XA 5DKNA 3C1VA 3AAKA 1JF0A 1FI5A 1LA3A 1NX2A 2DOQA 4HRHA 4WQ2A 3BXKA 3SG3A 1AK8A 1HT9A 1OMVA 1BR1B 3LK0A 1NCXA 5AEQA 1B7TZ 1SR6B 2QPTA 3JVTC 1NUBA 4MZJA 1TOPA 4PHNA 1UHJA 2M1UA 3PN7C 2JOJA 4MBEA 2CTNA 5CSFA 1TNPA 2I2RE 5CSIA 1A75A 1XK4C 4PE7A 2R2IA 2ZNDA 1QIWA 3WHTB 1JFJA 1RK9A 1PK0D 5KU1A 1DVIA 1J55A 3EKHA 3LL8B 1NPQA 1J7PA 2BKHB 4MRXA 1KK8B 4OR9B 5DKRA 4DCKA 1RWYA 1SK6D 4I5NB 1D1OA 1G4YR 1R2UA 4PHJA 3WHUB 4MSPA 4GFTA 5JOLA 1NCYA 1XFVO 5TNCA 2EHBA 1PRWA 2PASA 4HRGA 2WORA 1CFFA 2MJWB 1OZOA 3WXAA 1EG3A 2JWWA 2F33A 1LKJA 1IRJA 1QIVA 2KGBC 3GK4X 1DJWA 1K90D 3CS1A 1YX7A 3TUYC 2PALA 2MA2A 1QX2A 3BOWB 3PM8A 2SASA 1SPYA 4F0ZB 3PSRA 3CZTX 1L2OB 3EKJA 5I2OA 2KAYA 1S6IA 2JXCA 2KGRA 1H4BA 2MLEC 4PE1A 1GGZA 1A4PA 1J7OA 1GQMA 2FJUB 2M3WA 4P2YB 2KAXA 4ORAB 1IGVA 4MN0A 5HKWA 3OB2B 1DT7B 1F4OA 4MZKA 1KSOA 1XFYO 3PN7B 2F3ZA 4GGFC 1IJ5A 1Y1UA 3PLFB 1YURA 1XFUO 2COLB 3SIAA 2KI6D 1ODBA 5HLOA 1DF0A 2LM5A 4I5LB 4QJ5B 2K0JA 1WLZA 4YBHB 5F6TA 1OQPA 4JWQA 2LLSA 1MXEA 1MWNA 1DMOA 1SKTA 1JUOA 3AKAA 4CIDA 1FW4A 5G08A 4BY4A 1UHNA 4I5KA 4UPGA 2JNFA 1UHHA 2ZRTA 4P5OE 1EH2A 4HSZA 2NLNA 1YRUB 1F70A 2WOSA 5BPJA 2BL0B 2V53A 1K96A 2TN4A 1CM4A 1CB1A 1FPWA 3LCPC 2ISDA 1MR8A 2K61A 4NDDA 2M1KB 2LVKA 3BUMB 1CLMA 1X02A 1ALVA 2KFFA 3TUYB 5AERA 4FTGA 2FCEA 1B9AA 1YUTA 3KPXA 4XJKB 3I5HC 1AVSA 1Y1AA 2LUXA 2Q91A 3SIBA 1LINA 2KI4C 3O6BA 4YI8A 1G33A 2LHLA 3TDZA 2GV5A 1ALWA 1PVAA 1IWQA 1QLKA 2CBLA 1IH0A 3KHEA 4L9MA 3RM1A 1IQ3A 2BE4A 2KAVA 3VGOA 5HYDA 2H61A 2GGZA 1N0YA 2PSRA 3BYAA 3DVKA 4D1EA 1B1GA 4QJ3B 4CFQA 2NCOA 1KK7Y 1IG5A 2KFGA 1M39A 3FS7A 5KTYA 4GPLB 2KYFA 1TCFA 1SL9A 1VRKA 1PSRA 4WRIA 5AXIA 1WRKA 4ETOA 2L4HA 3BOWA 4MLWA 5K89A 1KFXS 5B8IB 3OX6A 4TNCA 1AHRA 1CDMA 3VRNA 5AFPA 1PVBA 4OV2A 4MZLA 3BUOB 2OS8C 5PALA 1WDCC 2JPTA 1DJXA 3GOFA 2F2OA 3DF0A 4DS7A 1Y1XA 1GJYA 4FQOA 1QX7A 1BODA 1NX3A 1SCMC 1UURA 3M0WA 4DIRA 1K95A 2AAOA 5CSNA 2EC6B 1CKKA 2KFHA 5JJGA 2MLFC 2LANA 3HX4A 1KQMC 2HQWA 3IQQA 2PVBA 4ZCUA 1XO5A 4YGBB 2PMYA 1F71A 5IBWA 1XK4A 5J3XA 2LLTA 1YVHA 1DJYA 1CFDA 1AJ5A 1K94A 1SMGA 1S6CA 1QV1A 1TNQA 2KI4B 1Y0VH 1IQ5A 1TTXA 1XA5A 4YGAA 2MRDA 3OX5A 1M63B 3BUWB 1V1FA 1BU3A 2F3YA 2E6WA 3OHMB 3A4UB 1EG4A 1B8CA 1PULA 3FWCA 2KYCA 4NQGA 4YGCB 1CDNA 1OSAA 1R6PA 2A4JA 2L0PA 3AAJA 4Q04A 1QXPA 3NXAA 2LNKA 3CR5X 1B47A 4NDBA 2NZ0A 2KBMA 2LUCA 2WCEA 2K8MB 1ZACA 2LC5A 1H8BA 1B7TY 2KDHA 3SG7A 3FWBA 1YTZC 1K9UA 1MHOA 2LVVA 3VRQA 1NP8A 1PALA 1M45A 2BBNA 4XJKA 3SJSA 4GBAA 1TCOB 4CLNA 3AKBA 2FCDA 2CXJA 3GK1A 2ZN9A 3LLEA 3EVVA 3ZWHA 1K2HA 1UUSA 1DGVA 1YUSA 2JT8A 2OPOA 4YI9A 4OKHA 1SNLA 3I5GC 1WDCB 5DKQA 2JTTA 3JVTB 3VRRA 3JTDC 1AP4A 2M49B 2WC8A 2L51A 1K9KA 3TDIA 2ZFDA 2GGMA 1FF1A 1E8AA 1XYDA 3QRXA 1A03A 2L2EA 2VRGA 1S5GZ
chains in the Genus database with same CATH superfamily
3SG5A 3CLNA 1KQMB 2JC2A 1UP5A 3O78A 3QMEA 4YGDB 1F8HA 1Q80A 1A29A 5CSJA 1DJZA 1FI6A 1CDPA 2LMUA 2K7BA 1J7QA 2L50A 3I5FC 1CMGA 1AUIB 5EL2A 1F4QA 1OMDA 4USLA 5I2QA 3NSOA 1J7RA 1BMOA 2M29A 1L7ZA 1SL8A 3D0YB 1J1DA 1KFXL 2I18A 4ORBB 2LVIA 1RROA 4PE0A 2WCHA 2JULA 1JC2A 1YUUA 3F45A 1KK7Z 4AQIA 4C0LA 2B1UA 1JWDA 2FOTA 2E30A 3BUXB 3CGAA 2L4IA 1AJ4A 3NSKA 2F2PA 1SR6C 2KLEA 1KQVA 1RJVA 5ER4X 1JBAA 3V2LA 1EL4A 4XYNA 1G8IA 4PALA 4YRUA 2Y4QA 1QVIY 5FYXA 1OMRA 5HKYA 4DRWA 2Q4UA 3SG6A 1DJIA 3WNXB 2I94A 2M7LA 1Y6WA 1SSEB 3CYZA 1CDLA 4C0JA 2WCBA 4ICBA 1QLSA 4DUQA 1S3PA 2BCBA 2F8PA 4ORCB 2PQLA 3EK8A 2P71A 2KNEA 4OVNF 2WCFA 2K2FA 2LP3A 1KK8C 3NSLA 2CNPA 5KSZA 3I5GB 4PCWA 1EJ3A 1MXLC 2ZKMX 1NCZA 1TN4A 1F55A 2I7AA 2L2CA 1B8LA 2H61C 2MHHA 3JTDB 3R1OA 1QASA 2KPHA 1LVCD 2WCJA 3RLZA 1MUXA 1KFUL 1UHKA 1BJFA 3ICBA 1WRLA 1N2DA 2Y1MA 4AQJA 2PRUA 3DVMA 3PM2A 2WC5A 1NX1A 3L47A 3TDUA 4PE4A 1CLBA 1BLQA 1M46A 2JQ6A 2H2KA 3HCMA 3CZ1A 3I5FB 1SL7A 1U5IB 1SCVA 1C07A 2IS9A 1OOHA 1RFJA 1SW8A 1UWOA 1DC1A 3KEVA 3ZNIA 4A4CA 1SRAA 3D74A 1HQVA 4CFRA 3B7AA 1CFPA 3D77A 2K7CA 3LK1A 1NX0A 2L5YA 1OOGA 1S6JA 3TZ1A 2JPOA 3DVJA 2BCXA 4MVFA 1TNWA 2AMIA 2JT3A 1JF2A 1YR5A 2BNXA 2MAZA 3EVRA 1TIZA 1BR4B 2K2AA 2M8UA 2LAPA 4INXA 2JNXA 2KQ6A 3FE6A 3I5HB 2BBMA 1CLLA 1NSHA 4HREE 3TS5C 3H4SE 2JTZA 1XFXO 4MEWA 3S0FA 1W7JB 4JPZB 1KFUS 2EGDA 1CMFA 4N5XA 3BFAA 2NCPA 1GGWA 4YGEB 1BG1A 1FBVA 1JSAA 3D0YA 1M31A 4M2PA 1IJ6A 2KLDA 3CR2A 4GAOA 3DVEA 2L5XB 1CM1A 1KWOC 1W9ZA 4GNKB 2MBXA 3D10A 2OTGC 1YX8A 1WY9A 1W7IB 3A8RA 4E68A 1KCYA 1YRTB 2LP2A 2M0RA 3S0BA 1QX5B 2G2BA 4R1EA 2BAPA 1RTP1 1CNPA 1SY9A 3SG2A 4I5JA 2K60A 4PHMA 2P6BB 3GK2A 2M9GA 1OOJA 1XFWO 1S1EA 1TRFA 2HQ8A 2BL0C 2KQYA 2M97A 3SG4A 4PHKA 4KYNA 4ZCVA 2WCLA 2HPSA 3PATA 2Y5IA 3B88A 1OZSA 3O4YA 3CR4X 1N65A 2AUCA 2ERBA 3EVUA 2OS8B 1DEKA 2G9BA 2O60A 3IQOA 1V1GA 2ZN8A 3EK7A 2LVJA 4A4BA 4N1GA 1TNXA 3BUNB 3NSIA 1XVJA 1DJHA 5D69A 4C0KA 1QTXA 1BF5A 4CPVA 1LA0A 3KO0A 4WQ3A 1SCMB 4NDCA 2LLUA 1EXRA 2JU0A 2M7NA 2WNDA 3MSEB 3I5IC 3CWGA 3PALA 5AANA 1TWOA 3DF0B 4GGFA 3OGNA 4OZDA 4BY5A 4MRYA 2BECA 2O5GA 1QJTA 3KF9A 3OP0A 1IKUA 1ZMZA 1QVIZ 1A75B 1OW4A 2HF5A 2JXLA 2H8VA 5I8NA 2HETA 2KI6C 1NIWA 2BKIB 2JRFA 5ER5A 4M2OA 3TS5B 1OOFA 1B8RA 4JQ0D 1U5IA 2JZIA 1XFZO 2KHNA 2BE6A 2ZRSA 1C7WA 2GTEA 4IL1A 5D7FA 4F7FA 2K7OA 1F54A 1PSBA 4GUKA 1ZOTB 2D8NA 1KWOB 1WLMA 3FIAA 2OTGB 1C3ZA 3OB1B 5D3OA 1NYAA 2FJYA 5FI2A 2CCMA 2Y1NA 1CTRA 3SS3A 5I94A 1JFKA 2BCAA 2KOTA 2EC6C 5HLVA 3DD4A 2LHIA 1UHIA 1ZUZA 4OCIA 3VRPA 1K93D 1YVLA 3VROA 2KBIA 1DGUA 2ZNEA 1DJGA 4AOMA 2KSPA 1S5GY 3S0AA 5GQQC 3BQ3A 1MF8B 1QV0A 1Z4HA 1LXFC 1QS7A 3S0GA 3EK4A 1CFCA 2CT9A 2K7DA 2JT0A 3K21A 3O2PA 1SYMA 2NXQA 1DTLA 1NWDA 5I2LA 1KSMA 1SBJA 2L98A 1S36A 1J1EA 2LV7A 3I5IB 2LE9B 1S26D 1K9PA 2LMVA 3E3RA 1BT6A 5HKZA 1K8UA 2LCPA 2QACA 2SCPA 1BOCA 2LMTA 2RGIA 1T14A 4PDZA 3IF7A 1OOIX 1C7VA 4N1FA 1L2OC 2QEBA 1OE9B 1B4CA 3BFHA 1WRZA 4GGNA 1QATA 4M2QA 3PFVA 4U8DA 1RECA 1ZFSA 4QJ4B 1DF0B 3RZSA 3D75A 3CTNA 1MQ1A 5CPVA 1A2XA 3B86A 5DKNA 3D78A 3C1VA 3SS5A 3AAKA 1JF0A 1FI5A 1LA3A 3D73A 1NX2A 1LS8A 2DOQA 4HRHA 4WQ2A 3BXKA 3SG3A 1AK8A 1HT9A 1OMVA 1BR1B 3CZ0A 3LK0A 1NCXA 5AEQA 1B7TZ 1P28A 1SR6B 2QPTA 3JVTC 1NUBA 4MZJA 1TOPA 4PHNA 1UHJA 2M1UA 3PN7C 3R72A 2JOJA 4MBEA 2CTNA 5CSFA 1TNPA 2I2RE 5CSIA 1A75A 1XK4C 4PE7A 2R2IA 2ZNDA 1QIWA 3WHTB 1JFJA 1RK9A 1PK0D 1TUJA 5KU1A 1DVIA 1J55A 3EKHA 3LL8B 1NPQA 1Z2CB 1J7PA 1ORGA 2BKHB 4MRXA 1KK8B 4OR9B 5DKRA 4DCKA 1RWYA 1SK6D 1TUZA 4I5NB 3S0DA 1D1OA 1G4YR 1R2UA 4PHJA 3WHUB 4MSPA 4GFTA 2WC6A 5JOLA 1NCYA 1XFVO 5TNCA 2EHBA 1PRWA 2PASA 4HRGA 2WORA 1CFFA 2MJWB 1OZOA 3WXAA 1EG3A 2JWWA 2F33A 1LKJA 1IRJA 1QIVA 2KGBC 3GK4X 1DJWA 3S0EA 1K90D 3CS1A 1YX7A 3TUYC 2PALA 2MA2A 1GM0A 1QX2A 3BOWB 3PM8A 2SASA 1SPYA 4F0ZB 3PSRA 3CZTX 3NHTA 1L2OB 3EKJA 5I2OA 2KAYA 2PYQA 1S6IA 2JXCA 2KGRA 1H4BA 2MLEC 4INWA 4PE1A 1GGZA 1A4PA 1J7OA 1GQMA 2FJUB 2M3WA 4P2YB 2KAXA 4ORAB 1IGVA 4MN0A 5HL1A 3D76A 2WCMA 5HKWA 3OB2B 1DT7B 1F4OA 4MZKA 1KSOA 1XFYO 4JKTA 3FE9A 2F3ZA 3PN7B 4GGFC 1IJ5A 3BJHA 1Y1UA 3PLFB 1YURA 1XFUO 2COLB 2WCKA 3SIAA 3PJIA 2KI6D 1ODBA 5HLOA 3NHIA 1DF0A 2LM5A 4I5LB 4QJ5B 2K0JA 1WLZA 4YBHB 5F6TA 1OQPA 4JWQA 2LLSA 1MXEA 1MWNA 1DMOA 4FQTA 1SKTA 1JUOA 3AKAA 4CIDA 2QEHA 1FW4A 5G08A 4BY4A 1UHNA 4I5KA 4UPGA 2JNFA 2QDIA 1UHHA 2ZRTA 4P5OE 1EH2A 4HSZA 2NLNA 1YRUB 1F70A 2WOSA 3N7HA 5BPJA 2BL0B 2V53A 3EG5B 1K96A 2TN4A 1CM4A 1CB1A 1FPWA 3LCPC 2ISDA 1MR8A 2K61A 3DZTA 4NDDA 3BFBA 2M1KB 2LVKA 3BUMB 1CLMA 1X02A 3B87A 1ALVA 2KFFA 3TUYB 5AERA 4FTGA 2FCEA 1B9AA 1YUTA 3KPXA 4XJKB 5FI7A 3I5HC 1AVSA 1Y1AA 2LUXA 2Q91A 3SIBA 1LINA 2KI4C 3O6BA 3UNWA 4YI8A 1G33A 2LHLA 3TDZA 2GV5A 1ALWA 1PVAA 1IWQA 1QLKA 2CBLA 1IH0A 3KHEA 4L9MA 3RM1A 1IQ3A 2BE4A 2KAVA 3CZ2A 3OBVA 3VGOA 5HYDA 2H61A 2GGZA 1N0YA 2PSRA 3BYAA 3DVKA 4D1EA 1B1GA 4QJ3B 4CFQA 2NCOA 1KK7Y 1IG5A 2KFGA 1M39A 3FS7A 5KTYA 4GPLB 2KYFA 1TCFA 1SL9A 1VRKA 1PSRA 4WRIA 5AXIA 3Q8IA 1WRKA 4ETOA 2L4HA 3VB1A 1DQEA 3BOWA 4MLWA 4PT1A 1C3YA 5K89A 1KFXS 5B8IB 3OX6A 4TNCA 1AHRA 1CDMA 1DELA 2YGUA 3VRNA 5AFPA 5DICA 1PVBA 4OV2A 4MZLA 3BUOB 2OS8C 5PALA 1QWVA 1WDCC 2JPTA 1DJXA 3GOFA 2F2OA 3DF0A 4DS7A 3DXLA 4IJ7A 1Y1XA 1GJYA 4FQOA 1QX7A 1BODA 3UO9A 1NX3A 1SCMC 1UURA 3M0WA 4DIRA 1K95A 2AAOA 3R1PA 5CSNA 2EC6B 1CKKA 2KFHA 5JJGA 2MLFC 2LANA 3HX4A 2QEVA 3DYEA 1KQMC 2HQWA 3IQQA 2PVBA 4ZCUA 1XO5A 4YGBB 2PMYA 3IVTA 1F71A 5IBWA 1XK4A 5J3XA 2LLTA 1YVHA 1DJYA 1CFDA 1AJ5A 3L4AA 1K94A 1SMGA 1S6CA 1QV1A 1TNQA 2KI4B 1Y0VH 1IQ5A 1TTXA 1XA5A 4YGAA 2MRDA 3OX5A 1M63B 3BUWB 5FI6A 1V1FA 1BU3A 2F3YA 3FE8A 2E6WA 3OHMB 3A4UB 3K1EA 1EG4A 1B8CA 1PULA 3FWCA 2KYCA 4NQGA 4YGCB 1CDNA 1OSAA 1R6PA 2A4JA 2L0PA 3AAJA 4Q04A 1QXPA 3NXAA 2LNKA 3CDNA 1B47A 3CR5X 4NDBA 2NZ0A 2KBMA 2LUCA 2WCEA 4JD9A 2K8MB 1ZACA 1IIOA 2LC5A 1H8BA 1B7TY 2KDHA 3SG7A 3FWBA 1YTZC 1K9UA 1MHOA 2LVVA 3VRQA 1NP8A 1PALA 1M45A 2BBNA 3O4XA 4XJKA 3DY9A 3SJSA 4GBAA 1TCOB 4CLNA 3AKBA 2FCDA 2CXJA 3GK1A 2ZN9A 3LLEA 3EVVA 3ZWHA 1K2HA 1UUSA 1DGVA 1YUSA 2JT8A 2OPOA 3L4LA 4YI9A 4OKHA 3B6XA 1SNLA 3I5GC 1WDCB 5DKQA 2JTTA 3JVTB 3NGVA 3VRRA 3JTDC 1AP4A 2M49B 2P70A 2WC8A 3CABA 2L51A 2QEOA 1K9KA 3R1VA 2ZFDA 3TDIA 2GGMA 1FF1A 1E8AA 1XFRA 1XYDA 3QRXA 1A03A 2L2EA 2VRGA 1S5GZ 3SS4A
chains in the Genus database with same CATH topology
3SG5A 3CLNA 1KQMB 2JC2A 1UP5A 3O78A 4YGDB 1F8HA 1Q80A 1A29A 5CSJA 1DJZA 1FI6A 1CDPA 2LMUA 2K7BA 1J7QA 2L50A 3I5FC 1CMGA 1AUIB 1F4QA 1OMDA 4USLA 5I2QA 3NSOA 1J7RA 1BMOA 2M29A 1L7ZA 1SL8A 3D0YB 1J1DA 1KFXL 2I18A 4ORBB 2LVIA 1RROA 4PE0A 2JULA 1JC2A 1YUUA 3F45A 1KK7Z 4AQIA 4C0LA 2B1UA 1JWDA 2FOTA 2E30A 3BUXB 3CGAA 2L4IA 1AJ4A 3NSKA 2F2PA 1SR6C 1KQVA 1RJVA 5ER4X 1JBAA 1EL4A 4XYNA 1G8IA 4PALA 4YRUA 2Y4QA 1QVIY 5FYXA 1OMRA 5HKYA 4DRWA 2Q4UA 3SG6A 1DJIA 3WNXB 2I94A 2M7LA 1Y6WA 1CDLA 4C0JA 2WCBA 4ICBA 1QLSA 4DUQA 1S3PA 2BCBA 2F8PA 4ORCB 3EK8A 2KNEA 4OVNF 2WCFA 2K2FA 2LP3A 1KK8C 3NSLA 2CNPA 5KSZA 3I5GB 4PCWA 1EJ3A 1MXLC 2ZKMX 1NCZA 1TN4A 1F55A 2I7AA 1B8LA 2H61C 2MHHA 3JTDB 1QASA 1LVCD 3RLZA 1MUXA 1KFUL 1UHKA 1BJFA 3ICBA 1WRLA 1N2DA 2Y1MA 4AQJA 2PRUA 3DVMA 1NX1A 3TDUA 4PE4A 1CLBA 1BLQA 1M46A 2JQ6A 2H2KA 3HCMA 3I5FB 1SL7A 1U5IB 1SCVA 1C07A 2IS9A 1RFJA 1SW8A 1UWOA 3KEVA 3ZNIA 4A4CA 1SRAA 4CFRA 1HQVA 1CFPA 2K7CA 3LK1A 1NX0A 1S6JA 3TZ1A 3DVJA 2BCXA 4MVFA 1TNWA 2AMIA 2JT3A 1JF2A 1YR5A 2MAZA 3EVRA 1TIZA 1BR4B 2K2AA 2M8UA 2LAPA 2JNXA 2KQ6A 3I5HB 2BBMA 1CLLA 1NSHA 4HREE 3TS5C 3H4SE 2JTZA 1XFXO 4MEWA 1W7JB 4JPZB 1KFUS 2EGDA 1CMFA 4N5XA 2NCPA 1GGWA 4YGEB 1BG1A 1FBVA 1JSAA 3D0YA 1M31A 4M2PA 1IJ6A 4GAOA 3CR2A 3DVEA 2L5XB 1CM1A 1KWOC 4GNKB 2MBXA 3D10A 2OTGC 1YX8A 1WY9A 1W7IB 3A8RA 4E68A 1KCYA 1YRTB 2LP2A 2M0RA 1QX5B 2G2BA 4R1EA 1CNPA 1RTP1 1SY9A 3SG2A 4I5JA 4PHMA 2P6BB 3GK2A 2M9GA 1OOJA 1XFWO 1S1EA 1TRFA 2HQ8A 2BL0C 2KQYA 2M97A 3SG4A 4PHKA 4ZCVA 2HPSA 3PATA 2Y5IA 1OZSA 3O4YA 3CR4X 1N65A 2AUCA 3EVUA 2OS8B 2G9BA 2O60A 3IQOA 1V1GA 2ZN8A 3EK7A 2LVJA 4A4BA 4N1GA 1TNXA 3BUNB 3NSIA 1XVJA 1DJHA 5D69A 4C0KA 1QTXA 1BF5A 4CPVA 1LA0A 3KO0A 4WQ3A 1SCMB 4NDCA 2LLUA 1EXRA 2JU0A 2M7NA 2WNDA 3MSEB 3I5IC 3CWGA 3PALA 5AANA 3DF0B 4GGFA 4BY5A 4MRYA 2BECA 2O5GA 1QJTA 3KF9A 3OP0A 1IKUA 1ZMZA 1QVIZ 1A75B 2HF5A 2JXLA 5I8NA 2HETA 2KI6C 1NIWA 2BKIB 2JRFA 5ER5A 4M2OA 3TS5B 1B8RA 4JQ0D 1U5IA 2JZIA 1XFZO 2KHNA 2BE6A 2ZRSA 1C7WA 4IL1A 5D7FA 2K7OA 1F54A 1PSBA 4GUKA 1ZOTB 2D8NA 1KWOB 1WLMA 3FIAA 2OTGB 3OB1B 1NYAA 2CCMA 2Y1NA 1CTRA 1JFKA 2BCAA 2KOTA 2EC6C 5HLVA 3DD4A 2LHIA 1UHIA 1ZUZA 4OCIA 3VRPA 1K93D 1YVLA 3VROA 2KBIA 1DGUA 2ZNEA 1DJGA 4AOMA 2KSPA 1S5GY 5GQQC 3BQ3A 1MF8B 1QV0A 1LXFC 1QS7A 3EK4A 1CFCA 2CT9A 2K7DA 2JT0A 3K21A 3O2PA 1SYMA 2NXQA 1DTLA 1NWDA 5I2LA 1KSMA 1SBJA 2L98A 1S36A 1J1EA 2LV7A 3I5IB 2LE9B 1S26D 1K9PA 2LMVA 3E3RA 1BT6A 5HKZA 1K8UA 2LCPA 2QACA 2SCPA 1BOCA 2LMTA 2RGIA 4PDZA 3IF7A 1C7VA 4N1FA 1L2OC 1OE9B 1B4CA 1WRZA 4GGNA 1QATA 4M2QA 3PFVA 4U8DA 1RECA 1ZFSA 4QJ4B 1DF0B 3CTNA 1MQ1A 5CPVA 1A2XA 5DKNA 3C1VA 3AAKA 1JF0A 1FI5A 1LA3A 1NX2A 2DOQA 4HRHA 4WQ2A 3BXKA 3SG3A 1AK8A 1HT9A 1OMVA 1BR1B 3LK0A 1NCXA 5AEQA 1B7TZ 1SR6B 2QPTA 3JVTC 1NUBA 4MZJA 1TOPA 4PHNA 1UHJA 2M1UA 3PN7C 2JOJA 4MBEA 2CTNA 5CSFA 1TNPA 2I2RE 5CSIA 1A75A 1XK4C 4PE7A 2R2IA 2ZNDA 1QIWA 3WHTB 1JFJA 1RK9A 1PK0D 5KU1A 1DVIA 1J55A 3EKHA 3LL8B 1NPQA 1J7PA 2BKHB 4MRXA 1KK8B 4OR9B 5DKRA 4DCKA 1RWYA 1SK6D 4I5NB 1D1OA 1G4YR 1R2UA 4PHJA 3WHUB 4MSPA 4GFTA 5JOLA 1NCYA 1XFVO 5TNCA 2EHBA 1PRWA 2PASA 4HRGA 2WORA 1CFFA 2MJWB 1OZOA 3WXAA 1EG3A 2JWWA 2F33A 1LKJA 1IRJA 1QIVA 2KGBC 3GK4X 1DJWA 1K90D 3CS1A 1YX7A 3TUYC 2PALA 2MA2A 1QX2A 3BOWB 3PM8A 2SASA 1SPYA 4F0ZB 3PSRA 3CZTX 1L2OB 3EKJA 5I2OA 2KAYA 1S6IA 2JXCA 2KGRA 1H4BA 2MLEC 4PE1A 1GGZA 1A4PA 1J7OA 1GQMA 2FJUB 2M3WA 4P2YB 2KAXA 4ORAB 1IGVA 4MN0A 5HKWA 3OB2B 1DT7B 1F4OA 4MZKA 1KSOA 1XFYO 3PN7B 2F3ZA 4GGFC 1IJ5A 1Y1UA 3PLFB 1YURA 1XFUO 2COLB 3SIAA 2KI6D 1ODBA 5HLOA 1DF0A 2LM5A 4I5LB 4QJ5B 2K0JA 1WLZA 4YBHB 5F6TA 1OQPA 4JWQA 2LLSA 1MXEA 1MWNA 1DMOA 1SKTA 1JUOA 3AKAA 4CIDA 1FW4A 5G08A 4BY4A 1UHNA 4I5KA 4UPGA 2JNFA 1UHHA 2ZRTA 4P5OE 1EH2A 4HSZA 2NLNA 1YRUB 1F70A 2WOSA 5BPJA 2BL0B 2V53A 1K96A 2TN4A 1CM4A 1CB1A 1FPWA 3LCPC 2ISDA 1MR8A 2K61A 4NDDA 2M1KB 2LVKA 3BUMB 1CLMA 1X02A 1ALVA 2KFFA 3TUYB 5AERA 4FTGA 2FCEA 1B9AA 1YUTA 3KPXA 4XJKB 3I5HC 1AVSA 1Y1AA 2LUXA 2Q91A 3SIBA 1LINA 2KI4C 3O6BA 4YI8A 1G33A 2LHLA 3TDZA 2GV5A 1ALWA 1PVAA 1IWQA 1QLKA 2CBLA 1IH0A 3KHEA 4L9MA 3RM1A 1IQ3A 2BE4A 2KAVA 3VGOA 5HYDA 2H61A 2GGZA 1N0YA 2PSRA 3BYAA 3DVKA 4D1EA 1B1GA 4QJ3B 4CFQA 2NCOA 1KK7Y 1IG5A 2KFGA 1M39A 3FS7A 5KTYA 4GPLB 2KYFA 1TCFA 1SL9A 1VRKA 1PSRA 4WRIA 5AXIA 1WRKA 4ETOA 2L4HA 3BOWA 4MLWA 5K89A 1KFXS 5B8IB 3OX6A 4TNCA 1AHRA 1CDMA 3VRNA 5AFPA 1PVBA 4OV2A 4MZLA 3BUOB 2OS8C 5PALA 1WDCC 2JPTA 1DJXA 3GOFA 2F2OA 3DF0A 4DS7A 1Y1XA 1GJYA 4FQOA 1QX7A 1BODA 1NX3A 1SCMC 1UURA 3M0WA 4DIRA 1K95A 2AAOA 5CSNA 2EC6B 1CKKA 2KFHA 5JJGA 2MLFC 2LANA 3HX4A 1KQMC 2HQWA 3IQQA 2PVBA 4ZCUA 1XO5A 4YGBB 2PMYA 1F71A 5IBWA 1XK4A 5J3XA 2LLTA 1YVHA 1DJYA 1CFDA 1AJ5A 1K94A 1SMGA 1S6CA 1QV1A 1TNQA 2KI4B 1Y0VH 1IQ5A 1TTXA 1XA5A 4YGAA 2MRDA 3OX5A 1M63B 3BUWB 1V1FA 1BU3A 2F3YA 2E6WA 3OHMB 3A4UB 1EG4A 1B8CA 1PULA 3FWCA 2KYCA 4NQGA 4YGCB 1CDNA 1OSAA 1R6PA 2A4JA 2L0PA 3AAJA 4Q04A 1QXPA 3NXAA 2LNKA 3CR5X 1B47A 4NDBA 2NZ0A 2KBMA 2LUCA 2WCEA 2K8MB 1ZACA 2LC5A 1H8BA 1B7TY 2KDHA 3SG7A 3FWBA 1YTZC 1K9UA 1MHOA 2LVVA 3VRQA 1NP8A 1PALA 1M45A 2BBNA 4XJKA 3SJSA 4GBAA 1TCOB 4CLNA 3AKBA 2FCDA 2CXJA 3GK1A 2ZN9A 3LLEA 3EVVA 3ZWHA 1K2HA 1UUSA 1DGVA 1YUSA 2JT8A 2OPOA 4YI9A 4OKHA 1SNLA 3I5GC 1WDCB 5DKQA 2JTTA 3JVTB 3VRRA 3JTDC 1AP4A 2M49B 2WC8A 2L51A 1K9KA 3TDIA 2ZFDA 2GGMA 1FF1A 1E8AA 1XYDA 3QRXA 1A03A 2L2EA 2VRGA 1S5GZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG5 A;  3CLN A;  1KQM B;  2JC2 A;  1UP5 A;  3O78 A;  4YGD B;  1F8H A;  1Q80 A;  1A29 A;  5CSJ A;  1DJZ A;  1FI6 A;  1CDP A;  2LMU A;  2K7B A;  1J7Q A;  2L50 A;  3I5F C;  1CMG A;  1AUI B;  1F4Q A;  1OMD A;  4USL A;  5I2Q A;  3NSO A;  1J7R A;  1BMO A;  2M29 A;  1L7Z A;  1SL8 A;  3D0Y B;  1J1D A;  1KFX L;  2I18 A;  4ORB B;  2LVI A;  1RRO A;  4PE0 A;  2JUL A;  1JC2 A;  1YUU A;  3F45 A;  1KK7 Z;  4AQI A;  4C0L A;  2B1U A;  1JWD A;  2FOT A;  2E30 A;  3BUX B;  3CGA A;  2L4I A;  1AJ4 A;  3NSK A;  2F2P A;  1SR6 C;  1KQV A;  1RJV A;  5ER4 X;  1JBA A;  1EL4 A;  4XYN A;  1G8I A;  4PAL A;  4YRU A;  2Y4Q A;  1QVI Y;  5FYX A;  1OMR A;  5HKY A;  4DRW A;  2Q4U A;  3SG6 A;  1DJI A;  3WNX B;  2I94 A;  2M7L A;  1Y6W A;  1CDL A;  4C0J A;  2WCB A;  4ICB A;  1QLS A;  4DUQ A;  1S3P A;  2BCB A;  2F8P A;  4ORC B;  3EK8 A;  2KNE A;  4OVN F;  2WCF A;  2K2F A;  2LP3 A;  1KK8 C;  3NSL A;  2CNP A;  5KSZ A;  3I5G B;  4PCW A;  1EJ3 A;  1MXL C;  2ZKM X;  1NCZ A;  1TN4 A;  1F55 A;  2I7A A;  1B8L A;  2H61 C;  2MHH A;  3JTD B;  1QAS A;  1LVC D;  3RLZ A;  1MUX A;  1KFU L;  1UHK A;  1BJF A;  3ICB A;  1WRL A;  1N2D A;  2Y1M A;  4AQJ A;  2PRU A;  3DVM A;  1NX1 A;  3TDU A;  4PE4 A;  1CLB A;  1BLQ A;  1M46 A;  2JQ6 A;  2H2K A;  3HCM A;  3I5F B;  1SL7 A;  1U5I B;  1SCV A;  1C07 A;  2IS9 A;  1RFJ A;  1SW8 A;  1UWO A;  3KEV A;  3ZNI A;  4A4C A;  1SRA A;  4CFR A;  1HQV A;  1CFP A;  2K7C A;  3LK1 A;  1NX0 A;  1S6J A;  3TZ1 A;  3DVJ A;  2BCX A;  4MVF A;  1TNW A;  2AMI A;  2JT3 A;  1JF2 A;  1YR5 A;  2MAZ A;  3EVR A;  1TIZ A;  1BR4 B;  2K2A A;  2M8U A;  2LAP A;  2JNX A;  2KQ6 A;  3I5H B;  2BBM A;  1CLL A;  1NSH A;  4HRE E;  3TS5 C;  3H4S E;  2JTZ A;  1XFX O;  4MEW A;  1W7J B;  4JPZ B;  1KFU S;  2EGD A;  1CMF A;  4N5X A;  2NCP A;  1GGW A;  4YGE B;  1BG1 A;  1FBV A;  1JSA A;  3D0Y A;  1M31 A;  4M2P A;  1IJ6 A;  4GAO A;  3CR2 A;  3DVE A;  2L5X B;  1CM1 A;  1KWO C;  4GNK B;  2MBX A;  3D10 A;  2OTG C;  1YX8 A;  1WY9 A;  1W7I B;  3A8R A;  4E68 A;  1KCY A;  1YRT B;  2LP2 A;  2M0R A;  1QX5 B;  2G2B A;  4R1E A;  1CNP A;  1RTP 1;  1SY9 A;  3SG2 A;  4I5J A;  4PHM A;  2P6B B;  3GK2 A;  2M9G A;  1OOJ A;  1XFW O;  1S1E A;  1TRF A;  2HQ8 A;  2BL0 C;  2KQY A;  2M97 A;  3SG4 A;  4PHK A;  4ZCV A;  2HPS A;  3PAT A;  2Y5I A;  1OZS A;  3O4Y A;  3CR4 X;  1N65 A;  2AUC A;  3EVU A;  2OS8 B;  2G9B A;  2O60 A;  3IQO A;  1V1G A;  2ZN8 A;  3EK7 A;  2LVJ A;  4A4B A;  4N1G A;  1TNX A;  3BUN B;  3NSI A;  1XVJ A;  1DJH A;  5D69 A;  4C0K A;  1QTX A;  1BF5 A;  4CPV A;  1LA0 A;  3KO0 A;  4WQ3 A;  1SCM B;  4NDC A;  2LLU A;  1EXR A;  2JU0 A;  2M7N A;  2WND A;  3MSE B;  3I5I C;  3CWG A;  3PAL A;  5AAN A;  3DF0 B;  4GGF A;  4BY5 A;  4MRY A;  2BEC A;  2O5G A;  1QJT A;  3KF9 A;  3OP0 A;  1IKU A;  1ZMZ A;  1QVI Z;  1A75 B;  2HF5 A;  2JXL A;  5I8N A;  2HET A;  2KI6 C;  1NIW A;  2BKI B;  2JRF A;  5ER5 A;  4M2O A;  3TS5 B;  1B8R A;  4JQ0 D;  1U5I A;  2JZI A;  1XFZ O;  2KHN A;  2BE6 A;  2ZRS A;  1C7W A;  4IL1 A;  5D7F A;  2K7O A;  1F54 A;  1PSB A;  4GUK A;  1ZOT B;  2D8N A;  1KWO B;  1WLM A;  3FIA A;  2OTG B;  3OB1 B;  1NYA A;  2CCM A;  2Y1N A;  1CTR A;  1JFK A;  2BCA A;  2KOT A;  2EC6 C;  5HLV A;  3DD4 A;  2LHI A;  1UHI A;  1ZUZ A;  4OCI A;  3VRP A;  1K93 D;  1YVL A;  3VRO A;  2KBI A;  1DGU A;  2ZNE A;  1DJG A;  4AOM A;  2KSP A;  1S5G Y;  5GQQ C;  3BQ3 A;  1MF8 B;  1QV0 A;  1LXF C;  1QS7 A;  3EK4 A;  1CFC A;  2CT9 A;  2K7D A;  2JT0 A;  3K21 A;  3O2P A;  1SYM A;  2NXQ A;  1DTL A;  1NWD A;  5I2L A;  1KSM A;  1SBJ A;  2L98 A;  1S36 A;  1J1E A;  2LV7 A;  3I5I B;  2LE9 B;  1S26 D;  1K9P A;  2LMV A;  3E3R A;  1BT6 A;  5HKZ A;  1K8U A;  2LCP A;  2QAC A;  2SCP A;  1BOC A;  2LMT A;  2RGI A;  4PDZ A;  3IF7 A;  1C7V A;  4N1F A;  1L2O C;  1OE9 B;  1B4C A;  1WRZ A;  4GGN A;  1QAT A;  4M2Q A;  3PFV A;  4U8D A;  1REC A;  1ZFS A;  4QJ4 B;  1DF0 B;  3CTN A;  1MQ1 A;  5CPV A;  1A2X A;  5DKN A;  3C1V A;  3AAK A;  1JF0 A;  1FI5 A;  1LA3 A;  1NX2 A;  2DOQ A;  4HRH A;  4WQ2 A;  3BXK A;  3SG3 A;  1AK8 A;  1HT9 A;  1OMV A;  1BR1 B;  3LK0 A;  1NCX A;  5AEQ A;  1B7T Z;  1SR6 B;  2QPT A;  3JVT C;  1NUB A;  4MZJ A;  1TOP A;  4PHN A;  1UHJ A;  2M1U A;  3PN7 C;  2JOJ A;  4MBE A;  2CTN A;  5CSF A;  1TNP A;  2I2R E;  5CSI A;  1A75 A;  1XK4 C;  4PE7 A;  2R2I A;  2ZND A;  1QIW A;  3WHT B;  1JFJ A;  1RK9 A;  1PK0 D;  5KU1 A;  1DVI A;  1J55 A;  3EKH A;  3LL8 B;  1NPQ A;  1J7P A;  2BKH B;  4MRX A;  1KK8 B;  4OR9 B;  5DKR A;  4DCK A;  1RWY A;  1SK6 D;  4I5N B;  1D1O A;  1G4Y R;  1R2U A;  4PHJ A;  3WHU B;  4MSP A;  4GFT A;  5JOL A;  1NCY A;  1XFV O;  5TNC A;  2EHB A;  1PRW A;  2PAS A;  4HRG A;  2WOR A;  1CFF A;  2MJW B;  1OZO A;  3WXA A;  1EG3 A;  2JWW A;  2F33 A;  1LKJ A;  1IRJ A;  1QIV A;  2KGB C;  3GK4 X;  1DJW A;  1K90 D;  3CS1 A;  1YX7 A;  3TUY C;  2PAL A;  2MA2 A;  1QX2 A;  3BOW B;  3PM8 A;  2SAS A;  1SPY A;  4F0Z B;  3PSR A;  3CZT X;  1L2O B;  3EKJ A;  5I2O A;  2KAY A;  1S6I A;  2JXC A;  2KGR A;  1H4B A;  2MLE C;  4PE1 A;  1GGZ A;  1A4P A;  1J7O A;  1GQM A;  2FJU B;  2M3W A;  4P2Y B;  2KAX A;  4ORA B;  1IGV A;  4MN0 A;  5HKW A;  3OB2 B;  1DT7 B;  1F4O A;  4MZK A;  1KSO A;  1XFY O;  3PN7 B;  2F3Z A;  4GGF C;  1IJ5 A;  1Y1U A;  3PLF B;  1YUR A;  1XFU O;  2COL B;  3SIA A;  2KI6 D;  1ODB A;  5HLO A;  1DF0 A;  2LM5 A;  4I5L B;  4QJ5 B;  2K0J A;  1WLZ A;  4YBH B;  5F6T A;  1OQP A;  4JWQ A;  2LLS A;  1MXE A;  1MWN A;  1DMO A;  1SKT A;  1JUO A;  3AKA A;  4CID A;  1FW4 A;  5G08 A;  4BY4 A;  1UHN A;  4I5K A;  4UPG A;  2JNF A;  1UHH A;  2ZRT A;  4P5O E;  1EH2 A;  4HSZ A;  2NLN A;  1YRU B;  1F70 A;  2WOS A;  5BPJ A;  2BL0 B;  2V53 A;  1K96 A;  2TN4 A;  1CM4 A;  1CB1 A;  1FPW A;  3LCP C;  2ISD A;  1MR8 A;  2K61 A;  4NDD A;  2M1K B;  2LVK A;  3BUM B;  1CLM A;  1X02 A;  1ALV A;  2KFF A;  3TUY B;  5AER A;  4FTG A;  2FCE A;  1B9A A;  1YUT A;  3KPX A;  4XJK B;  3I5H C;  1AVS A;  1Y1A A;  2LUX A;  2Q91 A;  3SIB A;  1LIN A;  2KI4 C;  3O6B A;  4YI8 A;  1G33 A;  2LHL A;  3TDZ A;  2GV5 A;  1ALW A;  1PVA A;  1IWQ A;  1QLK A;  2CBL A;  1IH0 A;  3KHE A;  4L9M A;  3RM1 A;  1IQ3 A;  2BE4 A;  2KAV A;  3VGO A;  5HYD A;  2H61 A;  2GGZ A;  1N0Y A;  2PSR A;  3BYA A;  3DVK A;  4D1E A;  1B1G A;  4QJ3 B;  4CFQ A;  2NCO A;  1KK7 Y;  1IG5 A;  2KFG A;  1M39 A;  3FS7 A;  5KTY A;  4GPL B;  2KYF A;  1TCF A;  1SL9 A;  1VRK A;  1PSR A;  4WRI A;  5AXI A;  1WRK A;  4ETO A;  2L4H A;  3BOW A;  4MLW A;  5K89 A;  1KFX S;  5B8I B;  3OX6 A;  4TNC A;  1AHR A;  1CDM A;  3VRN A;  5AFP A;  1PVB A;  4OV2 A;  4MZL A;  3BUO B;  2OS8 C;  5PAL A;  1WDC C;  2JPT A;  1DJX A;  3GOF A;  2F2O A;  3DF0 A;  4DS7 A;  1Y1X A;  1GJY A;  4FQO A;  1QX7 A;  1BOD A;  1NX3 A;  1SCM C;  1UUR A;  3M0W A;  4DIR A;  1K95 A;  2AAO A;  5CSN A;  2EC6 B;  1CKK A;  2KFH A;  5JJG A;  2MLF C;  2LAN A;  3HX4 A;  1KQM C;  2HQW A;  3IQQ A;  2PVB A;  4ZCU A;  1XO5 A;  4YGB B;  2PMY A;  1F71 A;  5IBW A;  1XK4 A;  5J3X A;  2LLT A;  1YVH A;  1DJY A;  1CFD A;  1AJ5 A;  1K94 A;  1SMG A;  1S6C A;  1QV1 A;  1TNQ A;  2KI4 B;  1Y0V H;  1IQ5 A;  1TTX A;  1XA5 A;  4YGA A;  2MRD A;  3OX5 A;  1M63 B;  3BUW B;  1V1F A;  1BU3 A;  2F3Y A;  2E6W A;  3OHM B;  3A4U B;  1EG4 A;  1B8C A;  1PUL A;  3FWC A;  2KYC A;  4NQG A;  4YGC B;  1CDN A;  1OSA A;  1R6P A;  2A4J A;  2L0P A;  3AAJ A;  4Q04 A;  1QXP A;  3NXA A;  2LNK A;  3CR5 X;  1B47 A;  4NDB A;  2NZ0 A;  2KBM A;  2LUC A;  2WCE A;  2K8M B;  1ZAC A;  2LC5 A;  1H8B A;  1B7T Y;  2KDH A;  3SG7 A;  3FWB A;  1YTZ C;  1K9U A;  1MHO A;  2LVV A;  3VRQ A;  1NP8 A;  1PAL A;  1M45 A;  2BBN A;  4XJK A;  3SJS A;  4GBA A;  1TCO B;  4CLN A;  3AKB A;  2FCD A;  2CXJ A;  3GK1 A;  2ZN9 A;  3LLE A;  3EVV A;  3ZWH A;  1K2H A;  1UUS A;  1DGV A;  1YUS A;  2JT8 A;  2OPO A;  4YI9 A;  4OKH A;  1SNL A;  3I5G C;  1WDC B;  5DKQ A;  2JTT A;  3JVT B;  3VRR A;  3JTD C;  1AP4 A;  2M49 B;  2WC8 A;  2L51 A;  1K9K A;  3TDI A;  2ZFD A;  2GGM A;  1FF1 A;  1E8A A;  1XYD A;  3QRX A;  1A03 A;  2L2E A;  2VRG A;  1S5G Z; 
#chains in the Genus database with same CATH topology
 3SG5 A;  3CLN A;  1KQM B;  2JC2 A;  1UP5 A;  3O78 A;  3QME A;  4YGD B;  1F8H A;  1Q80 A;  1A29 A;  5CSJ A;  1DJZ A;  1FI6 A;  1CDP A;  2LMU A;  2K7B A;  1J7Q A;  2L50 A;  3I5F C;  1CMG A;  1AUI B;  5EL2 A;  1F4Q A;  1OMD A;  4USL A;  5I2Q A;  3NSO A;  1J7R A;  1BMO A;  2M29 A;  1L7Z A;  1SL8 A;  3D0Y B;  1J1D A;  1KFX L;  2I18 A;  4ORB B;  2LVI A;  1RRO A;  4PE0 A;  2WCH A;  2JUL A;  1JC2 A;  1YUU A;  3F45 A;  1KK7 Z;  4AQI A;  4C0L A;  2B1U A;  1JWD A;  2FOT A;  2E30 A;  3BUX B;  3CGA A;  2L4I A;  1AJ4 A;  3NSK A;  2F2P A;  1SR6 C;  2KLE A;  1KQV A;  1RJV A;  5ER4 X;  1JBA A;  3V2L A;  1EL4 A;  4XYN A;  1G8I A;  4PAL A;  4YRU A;  2Y4Q A;  1QVI Y;  5FYX A;  1OMR A;  5HKY A;  4DRW A;  2Q4U A;  3SG6 A;  1DJI A;  3WNX B;  2I94 A;  2M7L A;  1Y6W A;  1SSE B;  3CYZ A;  1CDL A;  4C0J A;  2WCB A;  4ICB A;  1QLS A;  4DUQ A;  1S3P A;  2BCB A;  2F8P A;  4ORC B;  2PQL A;  3EK8 A;  2P71 A;  2KNE A;  4OVN F;  2WCF A;  2K2F A;  2LP3 A;  1KK8 C;  3NSL A;  2CNP A;  5KSZ A;  3I5G B;  4PCW A;  1EJ3 A;  1MXL C;  2ZKM X;  1NCZ A;  1TN4 A;  1F55 A;  2I7A A;  2L2C A;  1B8L A;  2H61 C;  2MHH A;  3JTD B;  3R1O A;  1QAS A;  2KPH A;  1LVC D;  2WCJ A;  3RLZ A;  1MUX A;  1KFU L;  1UHK A;  1BJF A;  3ICB A;  1WRL A;  1N2D A;  2Y1M A;  4AQJ A;  2PRU A;  3DVM A;  3PM2 A;  2WC5 A;  1NX1 A;  3L47 A;  3TDU A;  4PE4 A;  1CLB A;  1BLQ A;  1M46 A;  2JQ6 A;  2H2K A;  3HCM A;  3CZ1 A;  3I5F B;  1SL7 A;  1U5I B;  1SCV A;  1C07 A;  2IS9 A;  1OOH A;  1RFJ A;  1SW8 A;  1UWO A;  1DC1 A;  3KEV A;  3ZNI A;  4A4C A;  1SRA A;  3D74 A;  1HQV A;  4CFR A;  3B7A A;  1CFP A;  3D77 A;  2K7C A;  3LK1 A;  1NX0 A;  2L5Y A;  1OOG A;  1S6J A;  3TZ1 A;  2JPO A;  3DVJ A;  2BCX A;  4MVF A;  1TNW A;  2AMI A;  2JT3 A;  1JF2 A;  1YR5 A;  2BNX A;  2MAZ A;  3EVR A;  1TIZ A;  1BR4 B;  2K2A A;  2M8U A;  2LAP A;  4INX A;  2JNX A;  2KQ6 A;  3FE6 A;  3I5H B;  2BBM A;  1CLL A;  1NSH A;  4HRE E;  3TS5 C;  3H4S E;  2JTZ A;  1XFX O;  4MEW A;  3S0F A;  1W7J B;  4JPZ B;  1KFU S;  2EGD A;  1CMF A;  4N5X A;  3BFA A;  2NCP A;  1GGW A;  4YGE B;  1BG1 A;  1FBV A;  1JSA A;  3D0Y A;  1M31 A;  4M2P A;  1IJ6 A;  2KLD A;  3CR2 A;  4GAO A;  3DVE A;  2L5X B;  1CM1 A;  1KWO C;  1W9Z A;  4GNK B;  2MBX A;  3D10 A;  2OTG C;  1YX8 A;  1WY9 A;  1W7I B;  3A8R A;  4E68 A;  1KCY A;  1YRT B;  2LP2 A;  2M0R A;  3S0B A;  1QX5 B;  2G2B A;  4R1E A;  2BAP A;  1RTP 1;  1CNP A;  1SY9 A;  3SG2 A;  4I5J A;  2K60 A;  4PHM A;  2P6B B;  3GK2 A;  2M9G A;  1OOJ A;  1XFW O;  1S1E A;  1TRF A;  2HQ8 A;  2BL0 C;  2KQY A;  2M97 A;  3SG4 A;  4PHK A;  4KYN A;  4ZCV A;  2WCL A;  2HPS A;  3PAT A;  2Y5I A;  3B88 A;  1OZS A;  3O4Y A;  3CR4 X;  1N65 A;  2AUC A;  2ERB A;  3EVU A;  2OS8 B;  1DEK A;  2G9B A;  2O60 A;  3IQO A;  1V1G A;  2ZN8 A;  3EK7 A;  2LVJ A;  4A4B A;  4N1G A;  1TNX A;  3BUN B;  3NSI A;  1XVJ A;  1DJH A;  5D69 A;  4C0K A;  1QTX A;  1BF5 A;  4CPV A;  1LA0 A;  3KO0 A;  4WQ3 A;  1SCM B;  4NDC A;  2LLU A;  1EXR A;  2JU0 A;  2M7N A;  2WND A;  3MSE B;  3I5I C;  3CWG A;  3PAL A;  5AAN A;  1TWO A;  3DF0 B;  4GGF A;  3OGN A;  4OZD A;  4BY5 A;  4MRY A;  2BEC A;  2O5G A;  1QJT A;  3KF9 A;  3OP0 A;  1IKU A;  1ZMZ A;  1QVI Z;  1A75 B;  1OW4 A;  2HF5 A;  2JXL A;  2H8V A;  5I8N A;  2HET A;  2KI6 C;  1NIW A;  2BKI B;  2JRF A;  5ER5 A;  4M2O A;  3TS5 B;  1OOF A;  1B8R A;  4JQ0 D;  1U5I A;  2JZI A;  1XFZ O;  2KHN A;  2BE6 A;  2ZRS A;  1C7W A;  2GTE A;  4IL1 A;  5D7F A;  4F7F A;  2K7O A;  1F54 A;  1PSB A;  4GUK A;  1ZOT B;  2D8N A;  1KWO B;  1WLM A;  3FIA A;  2OTG B;  1C3Z A;  3OB1 B;  5D3O A;  1NYA A;  2FJY A;  5FI2 A;  2CCM A;  2Y1N A;  1CTR A;  3SS3 A;  5I94 A;  1JFK A;  2BCA A;  2KOT A;  2EC6 C;  5HLV A;  3DD4 A;  2LHI A;  1UHI A;  1ZUZ A;  4OCI A;  3VRP A;  1K93 D;  1YVL A;  3VRO A;  2KBI A;  1DGU A;  2ZNE A;  1DJG A;  4AOM A;  2KSP A;  1S5G Y;  3S0A A;  5GQQ C;  3BQ3 A;  1MF8 B;  1QV0 A;  1Z4H A;  1LXF C;  1QS7 A;  3S0G A;  3EK4 A;  1CFC A;  2CT9 A;  2K7D A;  2JT0 A;  3K21 A;  3O2P A;  1SYM A;  2NXQ A;  1DTL A;  1NWD A;  5I2L A;  1KSM A;  1SBJ A;  2L98 A;  1S36 A;  1J1E A;  2LV7 A;  3I5I B;  2LE9 B;  1S26 D;  1K9P A;  2LMV A;  3E3R A;  1BT6 A;  5HKZ A;  1K8U A;  2LCP A;  2QAC A;  2SCP A;  1BOC A;  2LMT A;  2RGI A;  1T14 A;  4PDZ A;  3IF7 A;  1OOI X;  1C7V A;  4N1F A;  1L2O C;  2QEB A;  1OE9 B;  1B4C A;  3BFH A;  1WRZ A;  4GGN A;  1QAT A;  4M2Q A;  3PFV A;  4U8D A;  1REC A;  1ZFS A;  4QJ4 B;  1DF0 B;  3RZS A;  3D75 A;  3CTN A;  1MQ1 A;  5CPV A;  1A2X A;  3B86 A;  5DKN A;  3D78 A;  3C1V A;  3SS5 A;  3AAK A;  1JF0 A;  1FI5 A;  1LA3 A;  3D73 A;  1NX2 A;  1LS8 A;  2DOQ A;  4HRH A;  4WQ2 A;  3BXK A;  3SG3 A;  1AK8 A;  1HT9 A;  1OMV A;  1BR1 B;  3CZ0 A;  3LK0 A;  1NCX A;  5AEQ A;  1B7T Z;  1P28 A;  1SR6 B;  2QPT A;  3JVT C;  1NUB A;  4MZJ A;  1TOP A;  4PHN A;  1UHJ A;  2M1U A;  3PN7 C;  3R72 A;  2JOJ A;  4MBE A;  2CTN A;  5CSF A;  1TNP A;  2I2R E;  5CSI A;  1A75 A;  1XK4 C;  4PE7 A;  2R2I A;  2ZND A;  1QIW A;  3WHT B;  1JFJ A;  1RK9 A;  1PK0 D;  1TUJ A;  5KU1 A;  1DVI A;  1J55 A;  3EKH A;  3LL8 B;  1NPQ A;  1Z2C B;  1J7P A;  1ORG A;  2BKH B;  4MRX A;  1KK8 B;  4OR9 B;  5DKR A;  4DCK A;  1RWY A;  1SK6 D;  1TUZ A;  4I5N B;  3S0D A;  1D1O A;  1G4Y R;  1R2U A;  4PHJ A;  3WHU B;  4MSP A;  4GFT A;  2WC6 A;  5JOL A;  1NCY A;  1XFV O;  5TNC A;  2EHB A;  1PRW A;  2PAS A;  4HRG A;  2WOR A;  1CFF A;  2MJW B;  1OZO A;  3WXA A;  1EG3 A;  2JWW A;  2F33 A;  1LKJ A;  1IRJ A;  1QIV A;  2KGB C;  3GK4 X;  1DJW A;  3S0E A;  1K90 D;  3CS1 A;  1YX7 A;  3TUY C;  2PAL A;  2MA2 A;  1GM0 A;  1QX2 A;  3BOW B;  3PM8 A;  2SAS A;  1SPY A;  4F0Z B;  3PSR A;  3CZT X;  3NHT A;  1L2O B;  3EKJ A;  5I2O A;  2KAY A;  2PYQ A;  1S6I A;  2JXC A;  2KGR A;  1H4B A;  2MLE C;  4INW A;  4PE1 A;  1GGZ A;  1A4P A;  1J7O A;  1GQM A;  2FJU B;  2M3W A;  4P2Y B;  2KAX A;  4ORA B;  1IGV A;  4MN0 A;  5HL1 A;  3D76 A;  2WCM A;  5HKW A;  3OB2 B;  1DT7 B;  1F4O A;  4MZK A;  1KSO A;  1XFY O;  4JKT A;  3FE9 A;  2F3Z A;  3PN7 B;  4GGF C;  1IJ5 A;  3BJH A;  1Y1U A;  3PLF B;  1YUR A;  1XFU O;  2COL B;  2WCK A;  3SIA A;  3PJI A;  2KI6 D;  1ODB A;  5HLO A;  3NHI A;  1DF0 A;  2LM5 A;  4I5L B;  4QJ5 B;  2K0J A;  1WLZ A;  4YBH B;  5F6T A;  1OQP A;  4JWQ A;  2LLS A;  1MXE A;  1MWN A;  1DMO A;  4FQT A;  1SKT A;  1JUO A;  3AKA A;  4CID A;  2QEH A;  1FW4 A;  5G08 A;  4BY4 A;  1UHN A;  4I5K A;  4UPG A;  2JNF A;  2QDI A;  1UHH A;  2ZRT A;  4P5O E;  1EH2 A;  4HSZ A;  2NLN A;  1YRU B;  1F70 A;  2WOS A;  3N7H A;  5BPJ A;  2BL0 B;  2V53 A;  3EG5 B;  1K96 A;  2TN4 A;  1CM4 A;  1CB1 A;  1FPW A;  3LCP C;  2ISD A;  1MR8 A;  2K61 A;  3DZT A;  4NDD A;  3BFB A;  2M1K B;  2LVK A;  3BUM B;  1CLM A;  1X02 A;  3B87 A;  1ALV A;  2KFF A;  3TUY B;  5AER A;  4FTG A;  2FCE A;  1B9A A;  1YUT A;  3KPX A;  4XJK B;  5FI7 A;  3I5H C;  1AVS A;  1Y1A A;  2LUX A;  2Q91 A;  3SIB A;  1LIN A;  2KI4 C;  3O6B A;  3UNW A;  4YI8 A;  1G33 A;  2LHL A;  3TDZ A;  2GV5 A;  1ALW A;  1PVA A;  1IWQ A;  1QLK A;  2CBL A;  1IH0 A;  3KHE A;  4L9M A;  3RM1 A;  1IQ3 A;  2BE4 A;  2KAV A;  3CZ2 A;  3OBV A;  3VGO A;  5HYD A;  2H61 A;  2GGZ A;  1N0Y A;  2PSR A;  3BYA A;  3DVK A;  4D1E A;  1B1G A;  4QJ3 B;  4CFQ A;  2NCO A;  1KK7 Y;  1IG5 A;  2KFG A;  1M39 A;  3FS7 A;  5KTY A;  4GPL B;  2KYF A;  1TCF A;  1SL9 A;  1VRK A;  1PSR A;  4WRI A;  5AXI A;  3Q8I A;  1WRK A;  4ETO A;  2L4H A;  3VB1 A;  1DQE A;  3BOW A;  4MLW A;  4PT1 A;  1C3Y A;  5K89 A;  1KFX S;  5B8I B;  3OX6 A;  4TNC A;  1AHR A;  1CDM A;  1DEL A;  2YGU A;  3VRN A;  5AFP A;  5DIC A;  1PVB A;  4OV2 A;  4MZL A;  3BUO B;  2OS8 C;  5PAL A;  1QWV A;  1WDC C;  2JPT A;  1DJX A;  3GOF A;  2F2O A;  3DF0 A;  4DS7 A;  3DXL A;  4IJ7 A;  1Y1X A;  1GJY A;  4FQO A;  1QX7 A;  1BOD A;  3UO9 A;  1NX3 A;  1SCM C;  1UUR A;  3M0W A;  4DIR A;  1K95 A;  2AAO A;  3R1P A;  5CSN A;  2EC6 B;  1CKK A;  2KFH A;  5JJG A;  2MLF C;  2LAN A;  3HX4 A;  2QEV A;  3DYE A;  1KQM C;  2HQW A;  3IQQ A;  2PVB A;  4ZCU A;  1XO5 A;  4YGB B;  2PMY A;  3IVT A;  1F71 A;  5IBW A;  1XK4 A;  5J3X A;  2LLT A;  1YVH A;  1DJY A;  1CFD A;  1AJ5 A;  3L4A A;  1K94 A;  1SMG A;  1S6C A;  1QV1 A;  1TNQ A;  2KI4 B;  1Y0V H;  1IQ5 A;  1TTX A;  1XA5 A;  4YGA A;  2MRD A;  3OX5 A;  1M63 B;  3BUW B;  5FI6 A;  1V1F A;  1BU3 A;  2F3Y A;  3FE8 A;  2E6W A;  3OHM B;  3A4U B;  3K1E A;  1EG4 A;  1B8C A;  1PUL A;  3FWC A;  2KYC A;  4NQG A;  4YGC B;  1CDN A;  1OSA A;  1R6P A;  2A4J A;  2L0P A;  3AAJ A;  4Q04 A;  1QXP A;  3NXA A;  2LNK A;  3CDN A;  1B47 A;  3CR5 X;  4NDB A;  2NZ0 A;  2KBM A;  2LUC A;  2WCE A;  4JD9 A;  2K8M B;  1ZAC A;  1IIO A;  2LC5 A;  1H8B A;  1B7T Y;  2KDH A;  3SG7 A;  3FWB A;  1YTZ C;  1K9U A;  1MHO A;  2LVV A;  3VRQ A;  1NP8 A;  1PAL A;  1M45 A;  2BBN A;  3O4X A;  4XJK A;  3DY9 A;  3SJS A;  4GBA A;  1TCO B;  4CLN A;  3AKB A;  2FCD A;  2CXJ A;  3GK1 A;  2ZN9 A;  3LLE A;  3EVV A;  3ZWH A;  1K2H A;  1UUS A;  1DGV A;  1YUS A;  2JT8 A;  2OPO A;  3L4L A;  4YI9 A;  4OKH A;  3B6X A;  1SNL A;  3I5G C;  1WDC B;  5DKQ A;  2JTT A;  3JVT B;  3NGV A;  3VRR A;  3JTD C;  1AP4 A;  2M49 B;  2P70 A;  2WC8 A;  3CAB A;  2L51 A;  2QEO A;  1K9K A;  3R1V A;  2ZFD A;  3TDI A;  2GGM A;  1FF1 A;  1E8A A;  1XFR A;  1XYD A;  3QRX A;  1A03 A;  2L2E A;  2VRG A;  1S5G Z;  3SS4 A; 
#chains in the Genus database with same CATH homology
 3SG5 A;  3CLN A;  1KQM B;  2JC2 A;  1UP5 A;  3O78 A;  4YGD B;  1F8H A;  1Q80 A;  1A29 A;  5CSJ A;  1DJZ A;  1FI6 A;  1CDP A;  2LMU A;  2K7B A;  1J7Q A;  2L50 A;  3I5F C;  1CMG A;  1AUI B;  1F4Q A;  1OMD A;  4USL A;  5I2Q A;  3NSO A;  1J7R A;  1BMO A;  2M29 A;  1L7Z A;  1SL8 A;  3D0Y B;  1J1D A;  1KFX L;  2I18 A;  4ORB B;  2LVI A;  1RRO A;  4PE0 A;  2JUL A;  1JC2 A;  1YUU A;  3F45 A;  1KK7 Z;  4AQI A;  4C0L A;  2B1U A;  1JWD A;  2FOT A;  2E30 A;  3BUX B;  3CGA A;  2L4I A;  1AJ4 A;  3NSK A;  2F2P A;  1SR6 C;  1KQV A;  1RJV A;  5ER4 X;  1JBA A;  1EL4 A;  4XYN A;  1G8I A;  4PAL A;  4YRU A;  2Y4Q A;  1QVI Y;  5FYX A;  1OMR A;  5HKY A;  4DRW A;  2Q4U A;  3SG6 A;  1DJI A;  3WNX B;  2I94 A;  2M7L A;  1Y6W A;  1CDL A;  4C0J A;  2WCB A;  4ICB A;  1QLS A;  4DUQ A;  1S3P A;  2BCB A;  2F8P A;  4ORC B;  3EK8 A;  2KNE A;  4OVN F;  2WCF A;  2K2F A;  2LP3 A;  1KK8 C;  3NSL A;  2CNP A;  5KSZ A;  3I5G B;  4PCW A;  1EJ3 A;  1MXL C;  2ZKM X;  1NCZ A;  1TN4 A;  1F55 A;  2I7A A;  1B8L A;  2H61 C;  2MHH A;  3JTD B;  1QAS A;  1LVC D;  3RLZ A;  1MUX A;  1KFU L;  1UHK A;  1BJF A;  3ICB A;  1WRL A;  1N2D A;  2Y1M A;  4AQJ A;  2PRU A;  3DVM A;  1NX1 A;  3TDU A;  4PE4 A;  1CLB A;  1BLQ A;  1M46 A;  2JQ6 A;  2H2K A;  3HCM A;  3I5F B;  1SL7 A;  1U5I B;  1SCV A;  1C07 A;  2IS9 A;  1RFJ A;  1SW8 A;  1UWO A;  3KEV A;  3ZNI A;  4A4C A;  1SRA A;  4CFR A;  1HQV A;  1CFP A;  2K7C A;  3LK1 A;  1NX0 A;  1S6J A;  3TZ1 A;  3DVJ A;  2BCX A;  4MVF A;  1TNW A;  2AMI A;  2JT3 A;  1JF2 A;  1YR5 A;  2MAZ A;  3EVR A;  1TIZ A;  1BR4 B;  2K2A A;  2M8U A;  2LAP A;  2JNX A;  2KQ6 A;  3I5H B;  2BBM A;  1CLL A;  1NSH A;  4HRE E;  3TS5 C;  3H4S E;  2JTZ A;  1XFX O;  4MEW A;  1W7J B;  4JPZ B;  1KFU S;  2EGD A;  1CMF A;  4N5X A;  2NCP A;  1GGW A;  4YGE B;  1BG1 A;  1FBV A;  1JSA A;  3D0Y A;  1M31 A;  4M2P A;  1IJ6 A;  4GAO A;  3CR2 A;  3DVE A;  2L5X B;  1CM1 A;  1KWO C;  4GNK B;  2MBX A;  3D10 A;  2OTG C;  1YX8 A;  1WY9 A;  1W7I B;  3A8R A;  4E68 A;  1KCY A;  1YRT B;  2LP2 A;  2M0R A;  1QX5 B;  2G2B A;  4R1E A;  1CNP A;  1RTP 1;  1SY9 A;  3SG2 A;  4I5J A;  4PHM A;  2P6B B;  3GK2 A;  2M9G A;  1OOJ A;  1XFW O;  1S1E A;  1TRF A;  2HQ8 A;  2BL0 C;  2KQY A;  2M97 A;  3SG4 A;  4PHK A;  4ZCV A;  2HPS A;  3PAT A;  2Y5I A;  1OZS A;  3O4Y A;  3CR4 X;  1N65 A;  2AUC A;  3EVU A;  2OS8 B;  2G9B A;  2O60 A;  3IQO A;  1V1G A;  2ZN8 A;  3EK7 A;  2LVJ A;  4A4B A;  4N1G A;  1TNX A;  3BUN B;  3NSI A;  1XVJ A;  1DJH A;  5D69 A;  4C0K A;  1QTX A;  1BF5 A;  4CPV A;  1LA0 A;  3KO0 A;  4WQ3 A;  1SCM B;  4NDC A;  2LLU A;  1EXR A;  2JU0 A;  2M7N A;  2WND A;  3MSE B;  3I5I C;  3CWG A;  3PAL A;  5AAN A;  3DF0 B;  4GGF A;  4BY5 A;  4MRY A;  2BEC A;  2O5G A;  1QJT A;  3KF9 A;  3OP0 A;  1IKU A;  1ZMZ A;  1QVI Z;  1A75 B;  2HF5 A;  2JXL A;  5I8N A;  2HET A;  2KI6 C;  1NIW A;  2BKI B;  2JRF A;  5ER5 A;  4M2O A;  3TS5 B;  1B8R A;  4JQ0 D;  1U5I A;  2JZI A;  1XFZ O;  2KHN A;  2BE6 A;  2ZRS A;  1C7W A;  4IL1 A;  5D7F A;  2K7O A;  1F54 A;  1PSB A;  4GUK A;  1ZOT B;  2D8N A;  1KWO B;  1WLM A;  3FIA A;  2OTG B;  3OB1 B;  1NYA A;  2CCM A;  2Y1N A;  1CTR A;  1JFK A;  2BCA A;  2KOT A;  2EC6 C;  5HLV A;  3DD4 A;  2LHI A;  1UHI A;  1ZUZ A;  4OCI A;  3VRP A;  1K93 D;  1YVL A;  3VRO A;  2KBI A;  1DGU A;  2ZNE A;  1DJG A;  4AOM A;  2KSP A;  1S5G Y;  5GQQ C;  3BQ3 A;  1MF8 B;  1QV0 A;  1LXF C;  1QS7 A;  3EK4 A;  1CFC A;  2CT9 A;  2K7D A;  2JT0 A;  3K21 A;  3O2P A;  1SYM A;  2NXQ A;  1DTL A;  1NWD A;  5I2L A;  1KSM A;  1SBJ A;  2L98 A;  1S36 A;  1J1E A;  2LV7 A;  3I5I B;  2LE9 B;  1S26 D;  1K9P A;  2LMV A;  3E3R A;  1BT6 A;  5HKZ A;  1K8U A;  2LCP A;  2QAC A;  2SCP A;  1BOC A;  2LMT A;  2RGI A;  4PDZ A;  3IF7 A;  1C7V A;  4N1F A;  1L2O C;  1OE9 B;  1B4C A;  1WRZ A;  4GGN A;  1QAT A;  4M2Q A;  3PFV A;  4U8D A;  1REC A;  1ZFS A;  4QJ4 B;  1DF0 B;  3CTN A;  1MQ1 A;  5CPV A;  1A2X A;  5DKN A;  3C1V A;  3AAK A;  1JF0 A;  1FI5 A;  1LA3 A;  1NX2 A;  2DOQ A;  4HRH A;  4WQ2 A;  3BXK A;  3SG3 A;  1AK8 A;  1HT9 A;  1OMV A;  1BR1 B;  3LK0 A;  1NCX A;  5AEQ A;  1B7T Z;  1SR6 B;  2QPT A;  3JVT C;  1NUB A;  4MZJ A;  1TOP A;  4PHN A;  1UHJ A;  2M1U A;  3PN7 C;  2JOJ A;  4MBE A;  2CTN A;  5CSF A;  1TNP A;  2I2R E;  5CSI A;  1A75 A;  1XK4 C;  4PE7 A;  2R2I A;  2ZND A;  1QIW A;  3WHT B;  1JFJ A;  1RK9 A;  1PK0 D;  5KU1 A;  1DVI A;  1J55 A;  3EKH A;  3LL8 B;  1NPQ A;  1J7P A;  2BKH B;  4MRX A;  1KK8 B;  4OR9 B;  5DKR A;  4DCK A;  1RWY A;  1SK6 D;  4I5N B;  1D1O A;  1G4Y R;  1R2U A;  4PHJ A;  3WHU B;  4MSP A;  4GFT A;  5JOL A;  1NCY A;  1XFV O;  5TNC A;  2EHB A;  1PRW A;  2PAS A;  4HRG A;  2WOR A;  1CFF A;  2MJW B;  1OZO A;  3WXA A;  1EG3 A;  2JWW A;  2F33 A;  1LKJ A;  1IRJ A;  1QIV A;  2KGB C;  3GK4 X;  1DJW A;  1K90 D;  3CS1 A;  1YX7 A;  3TUY C;  2PAL A;  2MA2 A;  1QX2 A;  3BOW B;  3PM8 A;  2SAS A;  1SPY A;  4F0Z B;  3PSR A;  3CZT X;  1L2O B;  3EKJ A;  5I2O A;  2KAY A;  1S6I A;  2JXC A;  2KGR A;  1H4B A;  2MLE C;  4PE1 A;  1GGZ A;  1A4P A;  1J7O A;  1GQM A;  2FJU B;  2M3W A;  4P2Y B;  2KAX A;  4ORA B;  1IGV A;  4MN0 A;  5HKW A;  3OB2 B;  1DT7 B;  1F4O A;  4MZK A;  1KSO A;  1XFY O;  3PN7 B;  2F3Z A;  4GGF C;  1IJ5 A;  1Y1U A;  3PLF B;  1YUR A;  1XFU O;  2COL B;  3SIA A;  2KI6 D;  1ODB A;  5HLO A;  1DF0 A;  2LM5 A;  4I5L B;  4QJ5 B;  2K0J A;  1WLZ A;  4YBH B;  5F6T A;  1OQP A;  4JWQ A;  2LLS A;  1MXE A;  1MWN A;  1DMO A;  1SKT A;  1JUO A;  3AKA A;  4CID A;  1FW4 A;  5G08 A;  4BY4 A;  1UHN A;  4I5K A;  4UPG A;  2JNF A;  1UHH A;  2ZRT A;  4P5O E;  1EH2 A;  4HSZ A;  2NLN A;  1YRU B;  1F70 A;  2WOS A;  5BPJ A;  2BL0 B;  2V53 A;  1K96 A;  2TN4 A;  1CM4 A;  1CB1 A;  1FPW A;  3LCP C;  2ISD A;  1MR8 A;  2K61 A;  4NDD A;  2M1K B;  2LVK A;  3BUM B;  1CLM A;  1X02 A;  1ALV A;  2KFF A;  3TUY B;  5AER A;  4FTG A;  2FCE A;  1B9A A;  1YUT A;  3KPX A;  4XJK B;  3I5H C;  1AVS A;  1Y1A A;  2LUX A;  2Q91 A;  3SIB A;  1LIN A;  2KI4 C;  3O6B A;  4YI8 A;  1G33 A;  2LHL A;  3TDZ A;  2GV5 A;  1ALW A;  1PVA A;  1IWQ A;  1QLK A;  2CBL A;  1IH0 A;  3KHE A;  4L9M A;  3RM1 A;  1IQ3 A;  2BE4 A;  2KAV A;  3VGO A;  5HYD A;  2H61 A;  2GGZ A;  1N0Y A;  2PSR A;  3BYA A;  3DVK A;  4D1E A;  1B1G A;  4QJ3 B;  4CFQ A;  2NCO A;  1KK7 Y;  1IG5 A;  2KFG A;  1M39 A;  3FS7 A;  5KTY A;  4GPL B;  2KYF A;  1TCF A;  1SL9 A;  1VRK A;  1PSR A;  4WRI A;  5AXI A;  1WRK A;  4ETO A;  2L4H A;  3BOW A;  4MLW A;  5K89 A;  1KFX S;  5B8I B;  3OX6 A;  4TNC A;  1AHR A;  1CDM A;  3VRN A;  5AFP A;  1PVB A;  4OV2 A;  4MZL A;  3BUO B;  2OS8 C;  5PAL A;  1WDC C;  2JPT A;  1DJX A;  3GOF A;  2F2O A;  3DF0 A;  4DS7 A;  1Y1X A;  1GJY A;  4FQO A;  1QX7 A;  1BOD A;  1NX3 A;  1SCM C;  1UUR A;  3M0W A;  4DIR A;  1K95 A;  2AAO A;  5CSN A;  2EC6 B;  1CKK A;  2KFH A;  5JJG A;  2MLF C;  2LAN A;  3HX4 A;  1KQM C;  2HQW A;  3IQQ A;  2PVB A;  4ZCU A;  1XO5 A;  4YGB B;  2PMY A;  1F71 A;  5IBW A;  1XK4 A;  5J3X A;  2LLT A;  1YVH A;  1DJY A;  1CFD A;  1AJ5 A;  1K94 A;  1SMG A;  1S6C A;  1QV1 A;  1TNQ A;  2KI4 B;  1Y0V H;  1IQ5 A;  1TTX A;  1XA5 A;  4YGA A;  2MRD A;  3OX5 A;  1M63 B;  3BUW B;  1V1F A;  1BU3 A;  2F3Y A;  2E6W A;  3OHM B;  3A4U B;  1EG4 A;  1B8C A;  1PUL A;  3FWC A;  2KYC A;  4NQG A;  4YGC B;  1CDN A;  1OSA A;  1R6P A;  2A4J A;  2L0P A;  3AAJ A;  4Q04 A;  1QXP A;  3NXA A;  2LNK A;  3CR5 X;  1B47 A;  4NDB A;  2NZ0 A;  2KBM A;  2LUC A;  2WCE A;  2K8M B;  1ZAC A;  2LC5 A;  1H8B A;  1B7T Y;  2KDH A;  3SG7 A;  3FWB A;  1YTZ C;  1K9U A;  1MHO A;  2LVV A;  3VRQ A;  1NP8 A;  1PAL A;  1M45 A;  2BBN A;  4XJK A;  3SJS A;  4GBA A;  1TCO B;  4CLN A;  3AKB A;  2FCD A;  2CXJ A;  3GK1 A;  2ZN9 A;  3LLE A;  3EVV A;  3ZWH A;  1K2H A;  1UUS A;  1DGV A;  1YUS A;  2JT8 A;  2OPO A;  4YI9 A;  4OKH A;  1SNL A;  3I5G C;  1WDC B;  5DKQ A;  2JTT A;  3JVT B;  3VRR A;  3JTD C;  1AP4 A;  2M49 B;  2WC8 A;  2L51 A;  1K9K A;  3TDI A;  2ZFD A;  2GGM A;  1FF1 A;  1E8A A;  1XYD A;  3QRX A;  1A03 A;  2L2E A;  2VRG A;  1S5G Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...