1IWQA

Crystal structure of marcks calmodulin binding domain peptide complexed with ca2+/calmodulin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
139
Chain Sequence
b'LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Crystal structure of a MARCKS peptide containing the calmodulin-binding domain in complex with Ca(2+)-calmodulin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/protein binding
total genus 52
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iwqA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iwqA02
1KFXS 1QXPA 2JNFA 1W7IB 4M2QA 4MVFA 1WLMA 1KQMB 2M9GA 3CLNA 2OPOA 1OQPA 3VGOA 4TNCA 4OV2A 2KI4B 2FCEA 4DS7A 5CSIA 4QJ4B 2LVIA 1FW4A 4NQGA 5CPVA 1MXEA 4PCWA 1QLKA 2FCDA 1EG3A 2K8MB 2LLUA 1EJ3A 4XJKB 3SG6A 4BY4A 1NP8A 2Q4UA 3O6BA 4MLWA 1LA0A 4F0ZB 5HYDA 4M2OA 2H61A 2VRGA 1QVIY 1ZACA 3KO0A 1C7WA 1XFYO 2FOTA 1IKUA 2BCBA 1PSBA 1YX7A 1KK8C 1A2XA 1OSAA 2JOJA 3CR5X 2CT9A 1BMOA 1ODBA 4MBEA 3EK8A 3SG3A 1G8IA 2LNKA 2LVKA 1GJYA 4ETOA 2RGIA 2L4IA 3E3RA 1TNQA 3I5IB 1NX2A 1XK4A 1N2DA 1S6IA 4N1FA 1DJGA 2LCPA 1AK8A 1H8BA 1OMDA 3PLFB 1SNLA 1KFUS 3OB2B 1IG5A 2ZFDA 1IH0A 4PDZA 1SCVA 1NCYA 2BL0C 2LC5A 2V53A 5CSNA 5J3XA 3EK7A 1AP4A 5AXIA 1OZSA 1Y1XA 3WNXB 4AQJA 2CNPA 1JC2A 1R2UA 3QRXA 5IBWA 1KWOC 2OS8C 2H2KA 2JTZA 1TNXA 2JZIA 5BPJA 1G4YR 1CFCA 4GFTA 2AAOA 2KFGA 1GQMA 2BKHB 2M97A 2L51A 4PE4A 2H61C 2M8UA 2OTGB 3EKHA 4QJ3B 3GOFA 2I2RE 1PSRA 1SRAA 2I7AA 1WY9A 1XFXO 5HLOA 4YBHB 1E8AA 1CKKA 2KI6C 4HRGA 4NDDA 3SG7A 1CDLA 3OX6A 1YVHA 1RECA 3NXAA 3RLZA 2KGBC 2D8NA 1K96A 1B47A 1XFUO 4C0LA 2EC6B 2JTTA 4GBAA 5JJGA 1KK7Y 1XO5A 1NYAA 1B7TY 1TOPA 2LUXA 3JVTB 3I5HB 3RM1A 1IQ3A 2ZKMX 4DRWA 4PE1A 1IWQA 2L0PA 1SR6B 1CNPA 1MUXA 3NSLA 1KSMA 4YRUA 3ZNIA 5B8IB 1G33A 4HREE 1JFKA 1K2HA 5ER4X 3FIAA 2PSRA 3IQOA 4D1EA 4DUQA 3DVEA 1L7ZA 1Y0VH 1LKJA 1DVIA 1UHHA 3JTDC 1DTLA 2IS9A 2JNXA 4CPVA 1VRKA 2HETA 5AFPA 2JT0A 1Y1AA 2LHIA 3GK1A 3IQQA 1TCOB 1YRTB 2O5GA 1KSOA 2KAVA 4GUKA 1DJIA 1EG4A 3BUNB 3BUWB 4USLA 4YI8A 2M7NA 2NCPA 1R6PA 2Y1MA 2EHBA 3VRRA 2LMTA 1S5GZ 3FS7A 3PN7C 2ZNDA 3TDIA 1WRLA 1M46A 4YGEB 2ZRTA 1KCYA 1JF0A 1CMGA 1M45A 3SIAA 4JWQA 5D7FA 1K8UA 1K93D 1KK8B 1QJTA 3CWGA 3BUOB 3SG5A 3A4UB 3O4YA 5AANA 2P6BB 1ZOTB 2SCPA 2JC2A 3VROA 1M39A 2CTNA 1EH2A 1QX2A 1F70A 1RK9A 4ICBA 4ORAB 5TNCA 4AOMA 4PALA 1HT9A 1DF0B 1DJXA 4Q04A 2MHHA 1RROA 2BL0B 1L2OC 1XFWO 2KI6D 3CR2A 1BJFA 4YGDB 3KPXA 4OR9B 4ZCVA 1CTRA 2E30A 1CDPA 1XFVO 2JQ6A 2R2IA 4GAOA 2L4HA 2WCFA 4M2PA 1SKTA 1CB1A 1PULA 2LV7A 5DKNA 4NDBA 1NSHA 4FTGA 1KWOB 2GV5A 2OS8B 2HF5A 2K2FA 3CR4X 3KHEA 3OHMB 4MZKA 2I18A 2L5XB 4A4CA 2KSPA 2M29A 3TDZA 1UHNA 1WRKA 2COLB 1FBVA 1WDCC 3BUMB 3PSRA 1FPWA 3OX5A 1MHOA 5ER5A 2CBLA 1JWDA 1TNWA 2WC8A 4A4BA 4I5JA 1A4PA 1QIWA 2F8PA 3PALA 2K7OA 2LE9B 1Y1UA 1S36A 4DCKA 1B8CA 3EKJA 3EVUA 3WHUB 2K0JA 3KEVA 1SY9A 2O60A 2KHNA 1J7OA 1DJWA 1DGVA 4WQ2A 4HSZA 1CDMA 1SL7A 2JPTA 2QACA 5PALA 3IF7A 3PM8A 2KQYA 1ALVA 4E68A 1QVIZ 2BE6A 1C7VA 3D0YA 1OE9B 5DKQA 1BG1A 3SIBA 5G08A 1JFJA 1SCMB 1TN4A 2JXCA 1YVLA 4YI9A 1M31A 3TUYC 4OKHA 1WLZA 1Y6WA 4GGFC 4CLNA 2FJUB 3GK4X 1S6CA 1K95A 1MR8A 1K9KA 1Q80A 1CM4A 3BUXB 3M0WA 1J7QA 1NPQA 3JTDB 1ZMZA 2KFFA 4PE0A 5AERA 1YUSA 2MRDA 4CFQA 1YUUA 2EGDA 2NCOA 1RTP1 2Q91A 3LL8B 1RJVA 1CLBA 1TCFA 2MBXA 3WHTB 4WRIA 3CTNA 1XVJA 1YUTA 3TS5C 1LVCD 1UHKA 2BCAA 3TDUA 1B1GA 3H4SE 2LP3A 4HRHA 1J55A 1CFFA 1SPYA 2JXLA 1OOJA 4MZLA 2BCXA 3FWBA 4PHKA 4MRXA 2TN4A 2LP2A 3BYAA 1S26D 2G2BA 2K61A 4QJ5B 2KNEA 2LHLA 2NLNA 1GGWA 3EVVA 3PN7B 3SG4A 2LANA 4MN0A 5KU1A 1BT6A 4GNKB 1DJHA 5HKZA 5I2LA 3TZ1A 1AHRA 1S1EA 2F33A 1QV0A 4U8DA 3NSKA 2MLFC 1B8LA 2SASA 1PVAA 2I94A 1FI6A 1PVBA 2GGZA 3KF9A 1YRUB 2PASA 2QPTA 3WXAA 4P2YB 1S6JA 1XFZO 2CCMA 2ZNEA 1PK0D 1IGVA 4PHMA 1NIWA 2MJWB 1A29A 1X02A 1OMRA 4DIRA 1KK7Z 5CSJA 1MQ1A 5DKRA 4I5LB 3I5FC 1L2OB 2KAXA 2HQ8A 1QX7A 1B7TZ 2KOTA 3AKBA 4MRYA 1QTXA 3PFVA 4CFRA 1SYMA 1GGZA 1AUIB 1XYDA 1CMFA 1KFXL 1M63B 1F71A 1DMOA 1SBJA 1KQVA 2K7CA 3AKAA 3O78A 3F45A 2M7LA 1BF5A 5GQQC 2G9BA 1CLMA 4ORCB 2WOSA 1JBAA 1TIZA 1NUBA 5HKWA 2M49B 4FQOA 1WDCB 3BOWA 3I5GC 1A03A 2L2EA 3BQ3A 1LINA 2WNDA 1TNPA 1AJ5A 1DJZA 2L98A 4AQIA 4C0KA 1CM1A 1K90D 1TTXA 2BKIB 1RFJA 2JT8A 2JULA 1FI5A 3NSIA 3OP0A 3LK1A 2NZ0A 2PMYA 3LCPC 2KYCA 1PRWA 4GGFA 1FF1A 1RWYA 1SL9A 3O2PA 2F3YA 3DD4A 3BOWB 4P5OE 4WQ3A 5JOLA 1CFDA 1B9AA 1V1GA 1K9PA 2BBNA 2LAPA 1LXFC 2DOQA 2A4JA 1CDNA 1YR5A 2AUCA 3DVMA 5F6TA 4CIDA 1ALWA 4L9MA 3TUYB 2MAZA 5KSZA 2KBIA 1KFUL 1NWDA 3CGAA 2LLSA 1QATA 1HQVA 1F4OA 1NX0A 2ISDA 1ZFSA 3LK0A 4GGNA 1MXLC 2B1UA 2LLTA 2F2OA 2K7DA 3DVJA 3EVRA 1DJYA 1KQMC 1J7PA 3SJSA 4JPZB 4R1EA 1CFPA 2KI4C 1SL8A 3TS5B 1N65A 1UWOA 2NXQA 5HLVA 3AAJA 4UPGA 4YGBB 1OMVA 1SMGA 2Y1NA 3DF0A 2F3ZA 1DT7B 2Y5IA 4PHJA 2LVVA 1BU3A 1QX5B 4JQ0D 1B4CA 1F4QA 1IRJA 1MF8B 2JT3A 5K89A 1OZOA 1DGUA 3FWCA 5FYXA 1EXRA 2ZRSA 1SW8A 1U5IA 4IL1A 1JSAA 1WRZA 5D69A 1BR4B 3D0YB 2WCEA 5I8NA 1QLSA 2M1UA 2ZN8A 2Y4QA 3DF0B 1YX8A 1F54A 2AMIA 1UP5A 1UURA 2KGRA 1N0YA 2F2PA 2PALA 1C07A 1YTZC 2GGMA 2KFHA 3I5IC 1QS7A 1W7JB 1A75A 1LA3A 3MSEB 2HQWA 2MLEC 4XYNA 2M0RA 1D1OA 2BECA 1U5IB 3DVKA 1PALA 3I5FB 1JF2A 4PE7A 2BBMA 1YURA 1NCXA 2HPSA 4MZJA 2K2AA 1BODA 2JWWA 1NCZA 2ZN9A 2LMUA 1QV1A 3SG2A 4I5NB 1F8HA 2E6WA 2PVBA 5I2OA 5I2QA 3AAKA 2JU0A 5KTYA 3VRPA 1UHIA 1K94A 1V1FA 1B8RA 1QASA 1XK4C 1ZUZA 1S5GY 3ZWHA 1JUOA 3HX4A 1A75B 1J1DA 1AVSA 1SCMC 3GK2A 3I5GB 2KQ6A 1BR1B 2OTGC 2LVJA 4OVNF 2M3WA 2MA2A 3OB1B 4NDCA 3VRQA 4N1GA 3ICBA 2KBMA 2KDHA 3CZTX 2L50A 2JRFA 2LUCA 1H4BA 3EK4A 1IJ5A 1CLLA 4I5KA 4ZCUA 2WORA 4MEWA 4MSPA 5HKYA 3PATA 4OCIA 4YGAA 1F55A 2EC6C 3NSOA 3HCMA 1EL4A 1IQ5A 1K9UA 2CXJA 1J1EA 1UUSA 3K21A 1SK6D 3C1VA 3JVTC 1XA5A 1TRFA 3I5HC 1J7RA 4C0JA 1BLQA 1NX3A 5CSFA 1S3PA 1UHJA 2PRUA 1BOCA 2KYFA 1AJ4A 1SR6C 2K7BA 3D10A 2M1KB 4BY5A 2BE4A 4ORBB 3VRNA 5AEQA 1IJ6A 4PHNA 2LMVA 1MWNA 2KAYA 3CS1A 1NX1A 4XJKA 4N5XA 3BXKA 1DF0A 2WCBA 3LLEA 1QIVA 3A8RA 4GPLB 4YGCB 2LM5A
chains in the Genus database with same CATH superfamily
1KFXS 1QXPA 2JNFA 1W7IB 4M2QA 4MVFA 1WLMA 1KQMB 2M9GA 3CLNA 2OPOA 3DXLA 1OQPA 3VGOA 4TNCA 4OV2A 2KI4B 2FCEA 4DS7A 5CSIA 4QJ4B 2LVIA 1FW4A 4NQGA 5CPVA 1MXEA 4PCWA 1QLKA 2FCDA 1EG3A 2K8MB 2LLUA 1EJ3A 4XJKB 3SG6A 4BY4A 1NP8A 2Q4UA 3O6BA 4MLWA 1LA0A 4F0ZB 5HYDA 3D77A 4M2OA 2H61A 2VRGA 1QVIY 1ZACA 4JKTA 3KO0A 1C7WA 1XFYO 2FOTA 1OOFA 1IKUA 2BCBA 1PSBA 1YX7A 1KK8C 1A2XA 1OSAA 2JOJA 3CR5X 2CT9A 1BMOA 1ODBA 4MBEA 3EK8A 3SG3A 1G8IA 2LNKA 2LVKA 1GJYA 4ETOA 1B1GA 2RGIA 2L4IA 3E3RA 1TNQA 3I5IB 1NX2A 1XK4A 1N2DA 1S6IA 4N1FA 1DJGA 2LCPA 1AK8A 1H8BA 1OMDA 3PLFB 1SNLA 1KFUS 3OB2B 1IG5A 2ZFDA 1IH0A 4PDZA 1SCVA 1NCYA 2BL0C 2ERBA 2LC5A 2V53A 5CSNA 5J3XA 3EK7A 1AP4A 5AXIA 1OZSA 1Y1XA 3WNXB 4AQJA 2CNPA 5D3OA 3S0AA 3NHIA 1JC2A 3CDNA 1R2UA 3QRXA 5IBWA 1KWOC 2OS8C 2H2KA 2JTZA 1TNXA 2JZIA 5BPJA 1XFRA 1G4YR 1CFCA 3IVTA 4GFTA 2AAOA 2KFGA 1GQMA 2BKHB 2M97A 2WCJA 3BJHA 2L51A 2KLEA 4PE4A 2H61C 2M8UA 2QDIA 2OTGB 1T14A 3EKHA 3R1VA 4QJ3B 3GOFA 2I2RE 1PSRA 1SRAA 2I7AA 3CZ0A 1WY9A 1XFXO 5HLOA 4YBHB 1E8AA 1CKKA 2KI6C 4HRGA 4NDDA 2QEOA 3SG7A 1CDLA 3OX6A 1YVHA 1RECA 3NXAA 3RLZA 2KGBC 2D8NA 1K96A 1B47A 1XFUO 4C0LA 3R1OA 2EC6B 2JTTA 2YGUA 4GBAA 5JJGA 1KK7Y 5FI7A 1XO5A 1NYAA 1B7TY 1TOPA 2LUXA 3JVTB 3I5HB 3RM1A 1IQ3A 2ZKMX 4DRWA 4PE1A 1IWQA 2L0PA 1SR6B 1CNPA 1MUXA 3NSLA 1KSMA 4YRUA 3ZNIA 5B8IB 1G33A 1GGWA 4HREE 1JFKA 2WCLA 1K2HA 5ER4X 3FIAA 3S0BA 2PSRA 3IQOA 4D1EA 4DUQA 3DVEA 1L7ZA 1Y0VH 1LKJA 1OOGA 1DVIA 1UHHA 2GTEA 3JTDC 2L2CA 1DTLA 2IS9A 2JNXA 4CPVA 3B6XA 2KLDA 1VRKA 2HETA 5AFPA 2JT0A 1Y1AA 2LHIA 3GK1A 3RZSA 3IQQA 1TCOB 1YRTB 2O5GA 1KSOA 2KAVA 1DEKA 1DJIA 4GUKA 1EG4A 3BUNB 3CZ2A 3BUWB 4USLA 4YI8A 2M7NA 1DQEA 2NCPA 1R6PA 2QEHA 2Y1MA 2EHBA 3VRRA 2LMTA 1S5GZ 3FS7A 3PN7C 2ZNDA 3TDIA 1WRLA 1M46A 4YGEB 2ZRTA 1KCYA 1JF0A 1CMGA 3N7HA 2P71A 1Z2CB 1M45A 3V2LA 3K1EA 3SIAA 4JWQA 5D7FA 1K8UA 1K93D 1KK8B 1QJTA 3CWGA 3BUOB 3SG5A 3L47A 1DELA 2WCKA 3A4UB 3O4YA 5AANA 2P6BB 1ZOTB 5EL2A 2SCPA 5HL1A 2JC2A 3VROA 1M39A 2CTNA 1EH2A 3S0DA 1QX2A 3SS4A 1F70A 1RK9A 4ICBA 4ORAB 3DZTA 5TNCA 4AOMA 4PALA 1HT9A 1DF0B 1DJXA 4Q04A 2MHHA 1RROA 2BL0B 1L2OC 1XFWO 2KI6D 3CR2A 1BJFA 4YGDB 3KPXA 4OR9B 4ZCVA 1CTRA 2E30A 3DYEA 1CDPA 1XFVO 2JQ6A 2R2IA 4GAOA 2L4HA 2WCFA 4M2PA 1SKTA 1CB1A 1PULA 2LV7A 5DKNA 4NDBA 1NSHA 3PJIA 4FTGA 1KWOB 2GV5A 2OS8B 2HF5A 2K2FA 3CR4X 3D73A 3KHEA 3OHMB 2I18A 2L5XB 4MZKA 2KSPA 5FI6A 2M29A 3TDZA 1UHNA 4A4CA 3B88A 1WRKA 2COLB 1FBVA 1WDCC 2QEBA 3BUMB 3PSRA 3D78A 3OX5A 1MHOA 1FPWA 5ER5A 2CBLA 1W9ZA 1JWDA 1TNWA 2WC8A 3L4AA 4A4BA 4I5JA 1A4PA 1QIWA 2F8PA 3PALA 2K7OA 2LE9B 2KPHA 1Y1UA 1S36A 4DCKA 1B8CA 3EKJA 3EVUA 3WHUB 2K0JA 3KEVA 3NHTA 1SY9A 2O60A 2KHNA 1J7OA 1DJWA 1DGVA 4WQ2A 3L4LA 4HSZA 1CDMA 1SL7A 2JPTA 2QACA 5PALA 3IF7A 3PM8A 2KQYA 1ALVA 4E68A 1QVIZ 2BE6A 1C7VA 4QJ5B 3D0YA 1TUJA 1OE9B 5DKQA 1BG1A 3SIBA 5G08A 1OOIX 1JFJA 1SCMB 1TN4A 2JXCA 3OGNA 1YVLA 4YI9A 1M31A 3TUYC 1TUZA 4OKHA 1WLZA 1Y6WA 4GGFC 4CLNA 2FJUB 3GK4X 1S6CA 1K95A 1MR8A 1K9KA 1Q80A 1CM4A 3BUXB 3FE6A 1C3YA 3M0WA 1J7QA 1NPQA 3JTDB 1ZMZA 2KFFA 4PE0A 5AERA 1YUSA 2MRDA 2P70A 4CFQA 1YUUA 2EGDA 2NCOA 1RTP1 2Q91A 3LL8B 1RJVA 1CLBA 1TCFA 2MBXA 3WHTB 4WRIA 3CTNA 1XVJA 1YUTA 1LS8A 1LVCD 1UHKA 2BCAA 3TDUA 3TS5C 3VB1A 3H4SE 2LP3A 4HRHA 1J55A 1CFFA 1SPYA 2JXLA 1C3ZA 1OOJA 4MZLA 2BCXA 3FWBA 1ORGA 4PHKA 3D74A 4MRXA 2TN4A 2LP2A 3BYAA 3NGVA 3O4XA 1S26D 2G2BA 2K61A 3B87A 2KNEA 2LHLA 2NLNA 3D76A 3EVVA 3OBVA 3PN7B 2LANA 3SG4A 4MN0A 5KU1A 1BT6A 1QWVA 1DJHA 4FQTA 4GNKB 5HKZA 1AHRA 5I2LA 3TZ1A 3BFAA 1P28A 1S1EA 3SS3A 2F33A 3R1PA 1QV0A 4U8DA 3NSKA 2MLFC 1B8LA 2SASA 1PVAA 2I94A 1FI6A 1PVBA 2GGZA 3KF9A 1GM0A 1YRUB 2PASA 2QPTA 3WXAA 3S0FA 4P2YB 1S6JA 1XFZO 2CCMA 2PQLA 2ZNEA 1PK0D 1IGVA 4PHMA 1NIWA 4KYNA 2BAPA 2MJWB 1A29A 1X02A 3FE8A 1OMRA 3B86A 4DIRA 1KK7Z 5CSJA 1MQ1A 5DKRA 4I5LB 3I5FC 1L2OB 2KAXA 2HQ8A 3CYZA 3EG5B 1QX7A 1B7TZ 2KOTA 1SSEB 3AKBA 1QTXA 3PFVA 4MRYA 4CFRA 1SYMA 3S0GA 1GGZA 1AUIB 1XYDA 1CMFA 1KFXL 1M63B 1F71A 1DMOA 1SBJA 1KQVA 2K7CA 3AKAA 3O78A 3UNWA 3F45A 2M7LA 1BF5A 5GQQC 2G9BA 1CLMA 4ORCB 2WOSA 1JBAA 1TIZA 1NUBA 5HKWA 2M49B 4FQOA 1OW4A 1WDCB 3BOWA 2L5YA 3I5GC 1A03A 2L2EA 3BQ3A 1LINA 2WNDA 1TNPA 1AJ5A 1DJZA 2L98A 4AQIA 4C0KA 1CM1A 1K90D 2WC5A 1TTXA 2BKIB 1RFJA 2JT8A 2JULA 1FI5A 3NSIA 3OP0A 3LK1A 2NZ0A 3PM2A 2PMYA 3LCPC 2KYCA 1PRWA 4GGFA 1FF1A 1RWYA 1SL9A 3O2PA 2F3YA 2BNXA 3DD4A 1IIOA 3BOWB 4P5OE 4WQ3A 1TWOA 5JOLA 1CFDA 1B9AA 1V1GA 1K9PA 2BBNA 2LAPA 3QMEA 1LXFC 2DOQA 2A4JA 1CDNA 1YR5A 2AUCA 3R72A 2WC6A 3DVMA 5F6TA 4CIDA 1ALWA 4L9MA 3TUYB 2MAZA 4PT1A 5KSZA 2KBIA 1KFUL 1NWDA 3CGAA 2LLSA 1QATA 1HQVA 1F4OA 1NX0A 2ISDA 1ZFSA 3LK0A 4GGNA 1MXLC 2B1UA 2LLTA 2F2OA 2K7DA 3DVJA 3EVRA 1DJYA 1KQMC 1J7PA 3SJSA 4JPZB 3SS5A 4R1EA 1CFPA 2KI4C 1SL8A 3TS5B 5I94A 1N65A 1UWOA 2NXQA 5HLVA 3AAJA 4JD9A 4UPGA 4YGBB 1OMVA 1SMGA 2Y1NA 3BFHA 3DF0A 2F3ZA 1DT7B 2Y5IA 2QEVA 4PHJA 5DICA 2LVVA 1BU3A 1QX5B 4JQ0D 2JPOA 3DY9A 1B4CA 1F4QA 1IRJA 1MF8B 2JT3A 5K89A 1OZOA 1DGUA 3FWCA 3D75A 5FYXA 1EXRA 2ZRSA 2PYQA 1SW8A 1U5IA 1OOHA 4IL1A 1JSAA 1WRZA 5D69A 1BR4B 3D0YB 2WCEA 5I8NA 1QLSA 2M1UA 3S0EA 2ZN8A 2Y4QA 3DF0B 1YX8A 1F54A 2AMIA 1UP5A 1UURA 2FJYA 2KGRA 1N0YA 2F2PA 2PALA 3CZ1A 1C07A 2H8VA 1YTZC 2GGMA 2KFHA 3FE9A 3I5IC 3UO9A 4OZDA 1QS7A 1W7JB 3BFBA 1A75A 1LA3A 3MSEB 2HQWA 2MLEC 3CABA 4INXA 4XYNA 2M0RA 1D1OA 2BECA 1U5IB 3DVKA 1PALA 3I5FB 1JF2A 4PE7A 2BBMA 1YURA 1NCXA 2HPSA 4MZJA 2K2AA 1BODA 2JWWA 1NCZA 2ZN9A 2LMUA 1QV1A 3SG2A 4I5NB 1F8HA 1Z4HA 2E6WA 2PVBA 5I2OA 5I2QA 3AAKA 2JU0A 5KTYA 3VRPA 1UHIA 1K94A 1V1FA 1B8RA 1QASA 1XK4C 1ZUZA 1S5GY 3ZWHA 1JUOA 3HX4A 1A75B 1J1DA 1AVSA 1SCMC 3B7AA 3GK2A 3I5GB 4IJ7A 2KQ6A 1BR1B 2OTGC 2LVJA 4OVNF 2M3WA 2MA2A 3OB1B 4NDCA 3VRQA 4N1GA 3ICBA 2K60A 2KBMA 2KDHA 3CZTX 2L50A 2JRFA 2LUCA 4INWA 1H4BA 3EK4A 1IJ5A 1CLLA 4I5KA 4ZCUA 2WORA 4MEWA 4MSPA 5HKYA 3PATA 4F7FA 4OCIA 4YGAA 1F55A 2EC6C 3NSOA 2WCHA 3HCMA 1EL4A 1IQ5A 1K9UA 2CXJA 1J1EA 1UUSA 3K21A 1SK6D 3Q8IA 3C1VA 3JVTC 1XA5A 1TRFA 3I5HC 1J7RA 4C0JA 1BLQA 2WCMA 1NX3A 5CSFA 1S3PA 1UHJA 2PRUA 5FI2A 1BOCA 2KYFA 1AJ4A 1SR6C 2K7BA 3D10A 2M1KB 4BY5A 2BE4A 4ORBB 3VRNA 5AEQA 1IJ6A 4PHNA 2LMVA 1DC1A 1MWNA 2KAYA 3CS1A 1NX1A 4XJKA 4N5XA 3BXKA 1DF0A 2WCBA 3LLEA 1QIVA 3A8RA 4GPLB 4YGCB 2LM5A
chains in the Genus database with same CATH topology
1KFXS 1QXPA 2JNFA 1W7IB 4M2QA 4MVFA 1WLMA 1KQMB 2M9GA 3CLNA 2OPOA 1OQPA 3VGOA 4TNCA 4OV2A 2KI4B 2FCEA 4DS7A 5CSIA 4QJ4B 2LVIA 1FW4A 4NQGA 5CPVA 1MXEA 4PCWA 1QLKA 2FCDA 1EG3A 2K8MB 2LLUA 1EJ3A 4XJKB 3SG6A 4BY4A 1NP8A 2Q4UA 3O6BA 4MLWA 1LA0A 4F0ZB 5HYDA 4M2OA 2H61A 2VRGA 1QVIY 1ZACA 3KO0A 1C7WA 1XFYO 2FOTA 1IKUA 2BCBA 1PSBA 1YX7A 1KK8C 1A2XA 1OSAA 2JOJA 3CR5X 2CT9A 1BMOA 1ODBA 4MBEA 3EK8A 3SG3A 1G8IA 2LNKA 2LVKA 1GJYA 4ETOA 2RGIA 2L4IA 3E3RA 1TNQA 3I5IB 1NX2A 1XK4A 1N2DA 1S6IA 4N1FA 1DJGA 2LCPA 1AK8A 1H8BA 1OMDA 3PLFB 1SNLA 1KFUS 3OB2B 1IG5A 2ZFDA 1IH0A 4PDZA 1SCVA 1NCYA 2BL0C 2LC5A 2V53A 5CSNA 5J3XA 3EK7A 1AP4A 5AXIA 1OZSA 1Y1XA 3WNXB 4AQJA 2CNPA 1JC2A 1R2UA 3QRXA 5IBWA 1KWOC 2OS8C 2H2KA 2JTZA 1TNXA 2JZIA 5BPJA 1G4YR 1CFCA 4GFTA 2AAOA 2KFGA 1GQMA 2BKHB 2M97A 2L51A 4PE4A 2H61C 2M8UA 2OTGB 3EKHA 4QJ3B 3GOFA 2I2RE 1PSRA 1SRAA 2I7AA 1WY9A 1XFXO 5HLOA 4YBHB 1E8AA 1CKKA 2KI6C 4HRGA 4NDDA 3SG7A 1CDLA 3OX6A 1YVHA 1RECA 3NXAA 3RLZA 2KGBC 2D8NA 1K96A 1B47A 1XFUO 4C0LA 2EC6B 2JTTA 4GBAA 5JJGA 1KK7Y 1XO5A 1NYAA 1B7TY 1TOPA 2LUXA 3JVTB 3I5HB 3RM1A 1IQ3A 2ZKMX 4DRWA 4PE1A 1IWQA 2L0PA 1SR6B 1CNPA 1MUXA 3NSLA 1KSMA 4YRUA 3ZNIA 5B8IB 1G33A 4HREE 1JFKA 1K2HA 5ER4X 3FIAA 2PSRA 3IQOA 4D1EA 4DUQA 3DVEA 1L7ZA 1Y0VH 1LKJA 1DVIA 1UHHA 3JTDC 1DTLA 2IS9A 2JNXA 4CPVA 1VRKA 2HETA 5AFPA 2JT0A 1Y1AA 2LHIA 3GK1A 3IQQA 1TCOB 1YRTB 2O5GA 1KSOA 2KAVA 4GUKA 1DJIA 1EG4A 3BUNB 3BUWB 4USLA 4YI8A 2M7NA 2NCPA 1R6PA 2Y1MA 2EHBA 3VRRA 2LMTA 1S5GZ 3FS7A 3PN7C 2ZNDA 3TDIA 1WRLA 1M46A 4YGEB 2ZRTA 1KCYA 1JF0A 1CMGA 1M45A 3SIAA 4JWQA 5D7FA 1K8UA 1K93D 1KK8B 1QJTA 3CWGA 3BUOB 3SG5A 3A4UB 3O4YA 5AANA 2P6BB 1ZOTB 2SCPA 2JC2A 3VROA 1M39A 2CTNA 1EH2A 1QX2A 1F70A 1RK9A 4ICBA 4ORAB 5TNCA 4AOMA 4PALA 1HT9A 1DF0B 1DJXA 4Q04A 2MHHA 1RROA 2BL0B 1L2OC 1XFWO 2KI6D 3CR2A 1BJFA 4YGDB 3KPXA 4OR9B 4ZCVA 1CTRA 2E30A 1CDPA 1XFVO 2JQ6A 2R2IA 4GAOA 2L4HA 2WCFA 4M2PA 1SKTA 1CB1A 1PULA 2LV7A 5DKNA 4NDBA 1NSHA 4FTGA 1KWOB 2GV5A 2OS8B 2HF5A 2K2FA 3CR4X 3KHEA 3OHMB 4MZKA 2I18A 2L5XB 4A4CA 2KSPA 2M29A 3TDZA 1UHNA 1WRKA 2COLB 1FBVA 1WDCC 3BUMB 3PSRA 1FPWA 3OX5A 1MHOA 5ER5A 2CBLA 1JWDA 1TNWA 2WC8A 4A4BA 4I5JA 1A4PA 1QIWA 2F8PA 3PALA 2K7OA 2LE9B 1Y1UA 1S36A 4DCKA 1B8CA 3EKJA 3EVUA 3WHUB 2K0JA 3KEVA 1SY9A 2O60A 2KHNA 1J7OA 1DJWA 1DGVA 4WQ2A 4HSZA 1CDMA 1SL7A 2JPTA 2QACA 5PALA 3IF7A 3PM8A 2KQYA 1ALVA 4E68A 1QVIZ 2BE6A 1C7VA 3D0YA 1OE9B 5DKQA 1BG1A 3SIBA 5G08A 1JFJA 1SCMB 1TN4A 2JXCA 1YVLA 4YI9A 1M31A 3TUYC 4OKHA 1WLZA 1Y6WA 4GGFC 4CLNA 2FJUB 3GK4X 1S6CA 1K95A 1MR8A 1K9KA 1Q80A 1CM4A 3BUXB 3M0WA 1J7QA 1NPQA 3JTDB 1ZMZA 2KFFA 4PE0A 5AERA 1YUSA 2MRDA 4CFQA 1YUUA 2EGDA 2NCOA 1RTP1 2Q91A 3LL8B 1RJVA 1CLBA 1TCFA 2MBXA 3WHTB 4WRIA 3CTNA 1XVJA 1YUTA 3TS5C 1LVCD 1UHKA 2BCAA 3TDUA 1B1GA 3H4SE 2LP3A 4HRHA 1J55A 1CFFA 1SPYA 2JXLA 1OOJA 4MZLA 2BCXA 3FWBA 4PHKA 4MRXA 2TN4A 2LP2A 3BYAA 1S26D 2G2BA 2K61A 4QJ5B 2KNEA 2LHLA 2NLNA 1GGWA 3EVVA 3PN7B 3SG4A 2LANA 4MN0A 5KU1A 1BT6A 4GNKB 1DJHA 5HKZA 5I2LA 3TZ1A 1AHRA 1S1EA 2F33A 1QV0A 4U8DA 3NSKA 2MLFC 1B8LA 2SASA 1PVAA 2I94A 1FI6A 1PVBA 2GGZA 3KF9A 1YRUB 2PASA 2QPTA 3WXAA 4P2YB 1S6JA 1XFZO 2CCMA 2ZNEA 1PK0D 1IGVA 4PHMA 1NIWA 2MJWB 1A29A 1X02A 1OMRA 4DIRA 1KK7Z 5CSJA 1MQ1A 5DKRA 4I5LB 3I5FC 1L2OB 2KAXA 2HQ8A 1QX7A 1B7TZ 2KOTA 3AKBA 4MRYA 1QTXA 3PFVA 4CFRA 1SYMA 1GGZA 1AUIB 1XYDA 1CMFA 1KFXL 1M63B 1F71A 1DMOA 1SBJA 1KQVA 2K7CA 3AKAA 3O78A 3F45A 2M7LA 1BF5A 5GQQC 2G9BA 1CLMA 4ORCB 2WOSA 1JBAA 1TIZA 1NUBA 5HKWA 2M49B 4FQOA 1WDCB 3BOWA 3I5GC 1A03A 2L2EA 3BQ3A 1LINA 2WNDA 1TNPA 1AJ5A 1DJZA 2L98A 4AQIA 4C0KA 1CM1A 1K90D 1TTXA 2BKIB 1RFJA 2JT8A 2JULA 1FI5A 3NSIA 3OP0A 3LK1A 2NZ0A 2PMYA 3LCPC 2KYCA 1PRWA 4GGFA 1FF1A 1RWYA 1SL9A 3O2PA 2F3YA 3DD4A 3BOWB 4P5OE 4WQ3A 5JOLA 1CFDA 1B9AA 1V1GA 1K9PA 2BBNA 2LAPA 1LXFC 2DOQA 2A4JA 1CDNA 1YR5A 2AUCA 3DVMA 5F6TA 4CIDA 1ALWA 4L9MA 3TUYB 2MAZA 5KSZA 2KBIA 1KFUL 1NWDA 3CGAA 2LLSA 1QATA 1HQVA 1F4OA 1NX0A 2ISDA 1ZFSA 3LK0A 4GGNA 1MXLC 2B1UA 2LLTA 2F2OA 2K7DA 3DVJA 3EVRA 1DJYA 1KQMC 1J7PA 3SJSA 4JPZB 4R1EA 1CFPA 2KI4C 1SL8A 3TS5B 1N65A 1UWOA 2NXQA 5HLVA 3AAJA 4UPGA 4YGBB 1OMVA 1SMGA 2Y1NA 3DF0A 2F3ZA 1DT7B 2Y5IA 4PHJA 2LVVA 1BU3A 1QX5B 4JQ0D 1B4CA 1F4QA 1IRJA 1MF8B 2JT3A 5K89A 1OZOA 1DGUA 3FWCA 5FYXA 1EXRA 2ZRSA 1SW8A 1U5IA 4IL1A 1JSAA 1WRZA 5D69A 1BR4B 3D0YB 2WCEA 5I8NA 1QLSA 2M1UA 2ZN8A 2Y4QA 3DF0B 1YX8A 1F54A 2AMIA 1UP5A 1UURA 2KGRA 1N0YA 2F2PA 2PALA 1C07A 1YTZC 2GGMA 2KFHA 3I5IC 1QS7A 1W7JB 1A75A 1LA3A 3MSEB 2HQWA 2MLEC 4XYNA 2M0RA 1D1OA 2BECA 1U5IB 3DVKA 1PALA 3I5FB 1JF2A 4PE7A 2BBMA 1YURA 1NCXA 2HPSA 4MZJA 2K2AA 1BODA 2JWWA 1NCZA 2ZN9A 2LMUA 1QV1A 3SG2A 4I5NB 1F8HA 2E6WA 2PVBA 5I2OA 5I2QA 3AAKA 2JU0A 5KTYA 3VRPA 1UHIA 1K94A 1V1FA 1B8RA 1QASA 1XK4C 1ZUZA 1S5GY 3ZWHA 1JUOA 3HX4A 1A75B 1J1DA 1AVSA 1SCMC 3GK2A 3I5GB 2KQ6A 1BR1B 2OTGC 2LVJA 4OVNF 2M3WA 2MA2A 3OB1B 4NDCA 3VRQA 4N1GA 3ICBA 2KBMA 2KDHA 3CZTX 2L50A 2JRFA 2LUCA 1H4BA 3EK4A 1IJ5A 1CLLA 4I5KA 4ZCUA 2WORA 4MEWA 4MSPA 5HKYA 3PATA 4OCIA 4YGAA 1F55A 2EC6C 3NSOA 3HCMA 1EL4A 1IQ5A 1K9UA 2CXJA 1J1EA 1UUSA 3K21A 1SK6D 3C1VA 3JVTC 1XA5A 1TRFA 3I5HC 1J7RA 4C0JA 1BLQA 1NX3A 5CSFA 1S3PA 1UHJA 2PRUA 1BOCA 2KYFA 1AJ4A 1SR6C 2K7BA 3D10A 2M1KB 4BY5A 2BE4A 4ORBB 3VRNA 5AEQA 1IJ6A 4PHNA 2LMVA 1MWNA 2KAYA 3CS1A 1NX1A 4XJKA 4N5XA 3BXKA 1DF0A 2WCBA 3LLEA 1QIVA 3A8RA 4GPLB 4YGCB 2LM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX S;  1QXP A;  2JNF A;  1W7I B;  4M2Q A;  4MVF A;  1WLM A;  1KQM B;  2M9G A;  3CLN A;  2OPO A;  1OQP A;  3VGO A;  4TNC A;  4OV2 A;  2KI4 B;  2FCE A;  4DS7 A;  5CSI A;  4QJ4 B;  2LVI A;  1FW4 A;  4NQG A;  5CPV A;  1MXE A;  4PCW A;  1QLK A;  2FCD A;  1EG3 A;  2K8M B;  2LLU A;  1EJ3 A;  4XJK B;  3SG6 A;  4BY4 A;  1NP8 A;  2Q4U A;  3O6B A;  4MLW A;  1LA0 A;  4F0Z B;  5HYD A;  4M2O A;  2H61 A;  2VRG A;  1QVI Y;  1ZAC A;  3KO0 A;  1C7W A;  1XFY O;  2FOT A;  1IKU A;  2BCB A;  1PSB A;  1YX7 A;  1KK8 C;  1A2X A;  1OSA A;  2JOJ A;  3CR5 X;  2CT9 A;  1BMO A;  1ODB A;  4MBE A;  3EK8 A;  3SG3 A;  1G8I A;  2LNK A;  2LVK A;  1GJY A;  4ETO A;  2RGI A;  2L4I A;  3E3R A;  1TNQ A;  3I5I B;  1NX2 A;  1XK4 A;  1N2D A;  1S6I A;  4N1F A;  1DJG A;  2LCP A;  1AK8 A;  1H8B A;  1OMD A;  3PLF B;  1SNL A;  1KFU S;  3OB2 B;  1IG5 A;  2ZFD A;  1IH0 A;  4PDZ A;  1SCV A;  1NCY A;  2BL0 C;  2LC5 A;  2V53 A;  5CSN A;  5J3X A;  3EK7 A;  1AP4 A;  5AXI A;  1OZS A;  1Y1X A;  3WNX B;  4AQJ A;  2CNP A;  1JC2 A;  1R2U A;  3QRX A;  5IBW A;  1KWO C;  2OS8 C;  2H2K A;  2JTZ A;  1TNX A;  2JZI A;  5BPJ A;  1G4Y R;  1CFC A;  4GFT A;  2AAO A;  2KFG A;  1GQM A;  2BKH B;  2M97 A;  2L51 A;  4PE4 A;  2H61 C;  2M8U A;  2OTG B;  3EKH A;  4QJ3 B;  3GOF A;  2I2R E;  1PSR A;  1SRA A;  2I7A A;  1WY9 A;  1XFX O;  5HLO A;  4YBH B;  1E8A A;  1CKK A;  2KI6 C;  4HRG A;  4NDD A;  3SG7 A;  1CDL A;  3OX6 A;  1YVH A;  1REC A;  3NXA A;  3RLZ A;  2KGB C;  2D8N A;  1K96 A;  1B47 A;  1XFU O;  4C0L A;  2EC6 B;  2JTT A;  4GBA A;  5JJG A;  1KK7 Y;  1XO5 A;  1NYA A;  1B7T Y;  1TOP A;  2LUX A;  3JVT B;  3I5H B;  3RM1 A;  1IQ3 A;  2ZKM X;  4DRW A;  4PE1 A;  1IWQ A;  2L0P A;  1SR6 B;  1CNP A;  1MUX A;  3NSL A;  1KSM A;  4YRU A;  3ZNI A;  5B8I B;  1G33 A;  4HRE E;  1JFK A;  1K2H A;  5ER4 X;  3FIA A;  2PSR A;  3IQO A;  4D1E A;  4DUQ A;  3DVE A;  1L7Z A;  1Y0V H;  1LKJ A;  1DVI A;  1UHH A;  3JTD C;  1DTL A;  2IS9 A;  2JNX A;  4CPV A;  1VRK A;  2HET A;  5AFP A;  2JT0 A;  1Y1A A;  2LHI A;  3GK1 A;  3IQQ A;  1TCO B;  1YRT B;  2O5G A;  1KSO A;  2KAV A;  4GUK A;  1DJI A;  1EG4 A;  3BUN B;  3BUW B;  4USL A;  4YI8 A;  2M7N A;  2NCP A;  1R6P A;  2Y1M A;  2EHB A;  3VRR A;  2LMT A;  1S5G Z;  3FS7 A;  3PN7 C;  2ZND A;  3TDI A;  1WRL A;  1M46 A;  4YGE B;  2ZRT A;  1KCY A;  1JF0 A;  1CMG A;  1M45 A;  3SIA A;  4JWQ A;  5D7F A;  1K8U A;  1K93 D;  1KK8 B;  1QJT A;  3CWG A;  3BUO B;  3SG5 A;  3A4U B;  3O4Y A;  5AAN A;  2P6B B;  1ZOT B;  2SCP A;  2JC2 A;  3VRO A;  1M39 A;  2CTN A;  1EH2 A;  1QX2 A;  1F70 A;  1RK9 A;  4ICB A;  4ORA B;  5TNC A;  4AOM A;  4PAL A;  1HT9 A;  1DF0 B;  1DJX A;  4Q04 A;  2MHH A;  1RRO A;  2BL0 B;  1L2O C;  1XFW O;  2KI6 D;  3CR2 A;  1BJF A;  4YGD B;  3KPX A;  4OR9 B;  4ZCV A;  1CTR A;  2E30 A;  1CDP A;  1XFV O;  2JQ6 A;  2R2I A;  4GAO A;  2L4H A;  2WCF A;  4M2P A;  1SKT A;  1CB1 A;  1PUL A;  2LV7 A;  5DKN A;  4NDB A;  1NSH A;  4FTG A;  1KWO B;  2GV5 A;  2OS8 B;  2HF5 A;  2K2F A;  3CR4 X;  3KHE A;  3OHM B;  4MZK A;  2I18 A;  2L5X B;  4A4C A;  2KSP A;  2M29 A;  3TDZ A;  1UHN A;  1WRK A;  2COL B;  1FBV A;  1WDC C;  3BUM B;  3PSR A;  1FPW A;  3OX5 A;  1MHO A;  5ER5 A;  2CBL A;  1JWD A;  1TNW A;  2WC8 A;  4A4B A;  4I5J A;  1A4P A;  1QIW A;  2F8P A;  3PAL A;  2K7O A;  2LE9 B;  1Y1U A;  1S36 A;  4DCK A;  1B8C A;  3EKJ A;  3EVU A;  3WHU B;  2K0J A;  3KEV A;  1SY9 A;  2O60 A;  2KHN A;  1J7O A;  1DJW A;  1DGV A;  4WQ2 A;  4HSZ A;  1CDM A;  1SL7 A;  2JPT A;  2QAC A;  5PAL A;  3IF7 A;  3PM8 A;  2KQY A;  1ALV A;  4E68 A;  1QVI Z;  2BE6 A;  1C7V A;  3D0Y A;  1OE9 B;  5DKQ A;  1BG1 A;  3SIB A;  5G08 A;  1JFJ A;  1SCM B;  1TN4 A;  2JXC A;  1YVL A;  4YI9 A;  1M31 A;  3TUY C;  4OKH A;  1WLZ A;  1Y6W A;  4GGF C;  4CLN A;  2FJU B;  3GK4 X;  1S6C A;  1K95 A;  1MR8 A;  1K9K A;  1Q80 A;  1CM4 A;  3BUX B;  3M0W A;  1J7Q A;  1NPQ A;  3JTD B;  1ZMZ A;  2KFF A;  4PE0 A;  5AER A;  1YUS A;  2MRD A;  4CFQ A;  1YUU A;  2EGD A;  2NCO A;  1RTP 1;  2Q91 A;  3LL8 B;  1RJV A;  1CLB A;  1TCF A;  2MBX A;  3WHT B;  4WRI A;  3CTN A;  1XVJ A;  1YUT A;  3TS5 C;  1LVC D;  1UHK A;  2BCA A;  3TDU A;  1B1G A;  3H4S E;  2LP3 A;  4HRH A;  1J55 A;  1CFF A;  1SPY A;  2JXL A;  1OOJ A;  4MZL A;  2BCX A;  3FWB A;  4PHK A;  4MRX A;  2TN4 A;  2LP2 A;  3BYA A;  1S26 D;  2G2B A;  2K61 A;  4QJ5 B;  2KNE A;  2LHL A;  2NLN A;  1GGW A;  3EVV A;  3PN7 B;  3SG4 A;  2LAN A;  4MN0 A;  5KU1 A;  1BT6 A;  4GNK B;  1DJH A;  5HKZ A;  5I2L A;  3TZ1 A;  1AHR A;  1S1E A;  2F33 A;  1QV0 A;  4U8D A;  3NSK A;  2MLF C;  1B8L A;  2SAS A;  1PVA A;  2I94 A;  1FI6 A;  1PVB A;  2GGZ A;  3KF9 A;  1YRU B;  2PAS A;  2QPT A;  3WXA A;  4P2Y B;  1S6J A;  1XFZ O;  2CCM A;  2ZNE A;  1PK0 D;  1IGV A;  4PHM A;  1NIW A;  2MJW B;  1A29 A;  1X02 A;  1OMR A;  4DIR A;  1KK7 Z;  5CSJ A;  1MQ1 A;  5DKR A;  4I5L B;  3I5F C;  1L2O B;  2KAX A;  2HQ8 A;  1QX7 A;  1B7T Z;  2KOT A;  3AKB A;  4MRY A;  1QTX A;  3PFV A;  4CFR A;  1SYM A;  1GGZ A;  1AUI B;  1XYD A;  1CMF A;  1KFX L;  1M63 B;  1F71 A;  1DMO A;  1SBJ A;  1KQV A;  2K7C A;  3AKA A;  3O78 A;  3F45 A;  2M7L A;  1BF5 A;  5GQQ C;  2G9B A;  1CLM A;  4ORC B;  2WOS A;  1JBA A;  1TIZ A;  1NUB A;  5HKW A;  2M49 B;  4FQO A;  1WDC B;  3BOW A;  3I5G C;  1A03 A;  2L2E A;  3BQ3 A;  1LIN A;  2WND A;  1TNP A;  1AJ5 A;  1DJZ A;  2L98 A;  4AQI A;  4C0K A;  1CM1 A;  1K90 D;  1TTX A;  2BKI B;  1RFJ A;  2JT8 A;  2JUL A;  1FI5 A;  3NSI A;  3OP0 A;  3LK1 A;  2NZ0 A;  2PMY A;  3LCP C;  2KYC A;  1PRW A;  4GGF A;  1FF1 A;  1RWY A;  1SL9 A;  3O2P A;  2F3Y A;  3DD4 A;  3BOW B;  4P5O E;  4WQ3 A;  5JOL A;  1CFD A;  1B9A A;  1V1G A;  1K9P A;  2BBN A;  2LAP A;  1LXF C;  2DOQ A;  2A4J A;  1CDN A;  1YR5 A;  2AUC A;  3DVM A;  5F6T A;  4CID A;  1ALW A;  4L9M A;  3TUY B;  2MAZ A;  5KSZ A;  2KBI A;  1KFU L;  1NWD A;  3CGA A;  2LLS A;  1QAT A;  1HQV A;  1F4O A;  1NX0 A;  2ISD A;  1ZFS A;  3LK0 A;  4GGN A;  1MXL C;  2B1U A;  2LLT A;  2F2O A;  2K7D A;  3DVJ A;  3EVR A;  1DJY A;  1KQM C;  1J7P A;  3SJS A;  4JPZ B;  4R1E A;  1CFP A;  2KI4 C;  1SL8 A;  3TS5 B;  1N65 A;  1UWO A;  2NXQ A;  5HLV A;  3AAJ A;  4UPG A;  4YGB B;  1OMV A;  1SMG A;  2Y1N A;  3DF0 A;  2F3Z A;  1DT7 B;  2Y5I A;  4PHJ A;  2LVV A;  1BU3 A;  1QX5 B;  4JQ0 D;  1B4C A;  1F4Q A;  1IRJ A;  1MF8 B;  2JT3 A;  5K89 A;  1OZO A;  1DGU A;  3FWC A;  5FYX A;  1EXR A;  2ZRS A;  1SW8 A;  1U5I A;  4IL1 A;  1JSA A;  1WRZ A;  5D69 A;  1BR4 B;  3D0Y B;  2WCE A;  5I8N A;  1QLS A;  2M1U A;  2ZN8 A;  2Y4Q A;  3DF0 B;  1YX8 A;  1F54 A;  2AMI A;  1UP5 A;  1UUR A;  2KGR A;  1N0Y A;  2F2P A;  2PAL A;  1C07 A;  1YTZ C;  2GGM A;  2KFH A;  3I5I C;  1QS7 A;  1W7J B;  1A75 A;  1LA3 A;  3MSE B;  2HQW A;  2MLE C;  4XYN A;  2M0R A;  1D1O A;  2BEC A;  1U5I B;  3DVK A;  1PAL A;  3I5F B;  1JF2 A;  4PE7 A;  2BBM A;  1YUR A;  1NCX A;  2HPS A;  4MZJ A;  2K2A A;  1BOD A;  2JWW A;  1NCZ A;  2ZN9 A;  2LMU A;  1QV1 A;  3SG2 A;  4I5N B;  1F8H A;  2E6W A;  2PVB A;  5I2O A;  5I2Q A;  3AAK A;  2JU0 A;  5KTY A;  3VRP A;  1UHI A;  1K94 A;  1V1F A;  1B8R A;  1QAS A;  1XK4 C;  1ZUZ A;  1S5G Y;  3ZWH A;  1JUO A;  3HX4 A;  1A75 B;  1J1D A;  1AVS A;  1SCM C;  3GK2 A;  3I5G B;  2KQ6 A;  1BR1 B;  2OTG C;  2LVJ A;  4OVN F;  2M3W A;  2MA2 A;  3OB1 B;  4NDC A;  3VRQ A;  4N1G A;  3ICB A;  2KBM A;  2KDH A;  3CZT X;  2L50 A;  2JRF A;  2LUC A;  1H4B A;  3EK4 A;  1IJ5 A;  1CLL A;  4I5K A;  4ZCU A;  2WOR A;  4MEW A;  4MSP A;  5HKY A;  3PAT A;  4OCI A;  4YGA A;  1F55 A;  2EC6 C;  3NSO A;  3HCM A;  1EL4 A;  1IQ5 A;  1K9U A;  2CXJ A;  1J1E A;  1UUS A;  3K21 A;  1SK6 D;  3C1V A;  3JVT C;  1XA5 A;  1TRF A;  3I5H C;  1J7R A;  4C0J A;  1BLQ A;  1NX3 A;  5CSF A;  1S3P A;  1UHJ A;  2PRU A;  1BOC A;  2KYF A;  1AJ4 A;  1SR6 C;  2K7B A;  3D10 A;  2M1K B;  4BY5 A;  2BE4 A;  4ORB B;  3VRN A;  5AEQ A;  1IJ6 A;  4PHN A;  2LMV A;  1MWN A;  2KAY A;  3CS1 A;  1NX1 A;  4XJK A;  4N5X A;  3BXK A;  1DF0 A;  2WCB A;  3LLE A;  1QIV A;  3A8R A;  4GPL B;  4YGC B;  2LM5 A; 
#chains in the Genus database with same CATH topology
 1KFX S;  1QXP A;  2JNF A;  1W7I B;  4M2Q A;  4MVF A;  1WLM A;  1KQM B;  2M9G A;  3CLN A;  2OPO A;  3DXL A;  1OQP A;  3VGO A;  4TNC A;  4OV2 A;  2KI4 B;  2FCE A;  4DS7 A;  5CSI A;  4QJ4 B;  2LVI A;  1FW4 A;  4NQG A;  5CPV A;  1MXE A;  4PCW A;  1QLK A;  2FCD A;  1EG3 A;  2K8M B;  2LLU A;  1EJ3 A;  4XJK B;  3SG6 A;  4BY4 A;  1NP8 A;  2Q4U A;  3O6B A;  4MLW A;  1LA0 A;  4F0Z B;  5HYD A;  3D77 A;  4M2O A;  2H61 A;  2VRG A;  1QVI Y;  1ZAC A;  4JKT A;  3KO0 A;  1C7W A;  1XFY O;  2FOT A;  1OOF A;  1IKU A;  2BCB A;  1PSB A;  1YX7 A;  1KK8 C;  1A2X A;  1OSA A;  2JOJ A;  3CR5 X;  2CT9 A;  1BMO A;  1ODB A;  4MBE A;  3EK8 A;  3SG3 A;  1G8I A;  2LNK A;  2LVK A;  1GJY A;  4ETO A;  1B1G A;  2RGI A;  2L4I A;  3E3R A;  1TNQ A;  3I5I B;  1NX2 A;  1XK4 A;  1N2D A;  1S6I A;  4N1F A;  1DJG A;  2LCP A;  1AK8 A;  1H8B A;  1OMD A;  3PLF B;  1SNL A;  1KFU S;  3OB2 B;  1IG5 A;  2ZFD A;  1IH0 A;  4PDZ A;  1SCV A;  1NCY A;  2BL0 C;  2ERB A;  2LC5 A;  2V53 A;  5CSN A;  5J3X A;  3EK7 A;  1AP4 A;  5AXI A;  1OZS A;  1Y1X A;  3WNX B;  4AQJ A;  2CNP A;  5D3O A;  3S0A A;  3NHI A;  1JC2 A;  3CDN A;  1R2U A;  3QRX A;  5IBW A;  1KWO C;  2OS8 C;  2H2K A;  2JTZ A;  1TNX A;  2JZI A;  5BPJ A;  1XFR A;  1G4Y R;  1CFC A;  3IVT A;  4GFT A;  2AAO A;  2KFG A;  1GQM A;  2BKH B;  2M97 A;  2WCJ A;  3BJH A;  2L51 A;  2KLE A;  4PE4 A;  2H61 C;  2M8U A;  2QDI A;  2OTG B;  1T14 A;  3EKH A;  3R1V A;  4QJ3 B;  3GOF A;  2I2R E;  1PSR A;  1SRA A;  2I7A A;  3CZ0 A;  1WY9 A;  1XFX O;  5HLO A;  4YBH B;  1E8A A;  1CKK A;  2KI6 C;  4HRG A;  4NDD A;  2QEO A;  3SG7 A;  1CDL A;  3OX6 A;  1YVH A;  1REC A;  3NXA A;  3RLZ A;  2KGB C;  2D8N A;  1K96 A;  1B47 A;  1XFU O;  4C0L A;  3R1O A;  2EC6 B;  2JTT A;  2YGU A;  4GBA A;  5JJG A;  1KK7 Y;  5FI7 A;  1XO5 A;  1NYA A;  1B7T Y;  1TOP A;  2LUX A;  3JVT B;  3I5H B;  3RM1 A;  1IQ3 A;  2ZKM X;  4DRW A;  4PE1 A;  1IWQ A;  2L0P A;  1SR6 B;  1CNP A;  1MUX A;  3NSL A;  1KSM A;  4YRU A;  3ZNI A;  5B8I B;  1G33 A;  1GGW A;  4HRE E;  1JFK A;  2WCL A;  1K2H A;  5ER4 X;  3FIA A;  3S0B A;  2PSR A;  3IQO A;  4D1E A;  4DUQ A;  3DVE A;  1L7Z A;  1Y0V H;  1LKJ A;  1OOG A;  1DVI A;  1UHH A;  2GTE A;  3JTD C;  2L2C A;  1DTL A;  2IS9 A;  2JNX A;  4CPV A;  3B6X A;  2KLD A;  1VRK A;  2HET A;  5AFP A;  2JT0 A;  1Y1A A;  2LHI A;  3GK1 A;  3RZS A;  3IQQ A;  1TCO B;  1YRT B;  2O5G A;  1KSO A;  2KAV A;  1DEK A;  1DJI A;  4GUK A;  1EG4 A;  3BUN B;  3CZ2 A;  3BUW B;  4USL A;  4YI8 A;  2M7N A;  1DQE A;  2NCP A;  1R6P A;  2QEH A;  2Y1M A;  2EHB A;  3VRR A;  2LMT A;  1S5G Z;  3FS7 A;  3PN7 C;  2ZND A;  3TDI A;  1WRL A;  1M46 A;  4YGE B;  2ZRT A;  1KCY A;  1JF0 A;  1CMG A;  3N7H A;  2P71 A;  1Z2C B;  1M45 A;  3V2L A;  3K1E A;  3SIA A;  4JWQ A;  5D7F A;  1K8U A;  1K93 D;  1KK8 B;  1QJT A;  3CWG A;  3BUO B;  3SG5 A;  3L47 A;  1DEL A;  2WCK A;  3A4U B;  3O4Y A;  5AAN A;  2P6B B;  1ZOT B;  5EL2 A;  2SCP A;  5HL1 A;  2JC2 A;  3VRO A;  1M39 A;  2CTN A;  1EH2 A;  3S0D A;  1QX2 A;  3SS4 A;  1F70 A;  1RK9 A;  4ICB A;  4ORA B;  3DZT A;  5TNC A;  4AOM A;  4PAL A;  1HT9 A;  1DF0 B;  1DJX A;  4Q04 A;  2MHH A;  1RRO A;  2BL0 B;  1L2O C;  1XFW O;  2KI6 D;  3CR2 A;  1BJF A;  4YGD B;  3KPX A;  4OR9 B;  4ZCV A;  1CTR A;  2E30 A;  3DYE A;  1CDP A;  1XFV O;  2JQ6 A;  2R2I A;  4GAO A;  2L4H A;  2WCF A;  4M2P A;  1SKT A;  1CB1 A;  1PUL A;  2LV7 A;  5DKN A;  4NDB A;  1NSH A;  3PJI A;  4FTG A;  1KWO B;  2GV5 A;  2OS8 B;  2HF5 A;  2K2F A;  3CR4 X;  3D73 A;  3KHE A;  3OHM B;  2I18 A;  2L5X B;  4MZK A;  2KSP A;  5FI6 A;  2M29 A;  3TDZ A;  1UHN A;  4A4C A;  3B88 A;  1WRK A;  2COL B;  1FBV A;  1WDC C;  2QEB A;  3BUM B;  3PSR A;  3D78 A;  3OX5 A;  1MHO A;  1FPW A;  5ER5 A;  2CBL A;  1W9Z A;  1JWD A;  1TNW A;  2WC8 A;  3L4A A;  4A4B A;  4I5J A;  1A4P A;  1QIW A;  2F8P A;  3PAL A;  2K7O A;  2LE9 B;  2KPH A;  1Y1U A;  1S36 A;  4DCK A;  1B8C A;  3EKJ A;  3EVU A;  3WHU B;  2K0J A;  3KEV A;  3NHT A;  1SY9 A;  2O60 A;  2KHN A;  1J7O A;  1DJW A;  1DGV A;  4WQ2 A;  3L4L A;  4HSZ A;  1CDM A;  1SL7 A;  2JPT A;  2QAC A;  5PAL A;  3IF7 A;  3PM8 A;  2KQY A;  1ALV A;  4E68 A;  1QVI Z;  2BE6 A;  1C7V A;  4QJ5 B;  3D0Y A;  1TUJ A;  1OE9 B;  5DKQ A;  1BG1 A;  3SIB A;  5G08 A;  1OOI X;  1JFJ A;  1SCM B;  1TN4 A;  2JXC A;  3OGN A;  1YVL A;  4YI9 A;  1M31 A;  3TUY C;  1TUZ A;  4OKH A;  1WLZ A;  1Y6W A;  4GGF C;  4CLN A;  2FJU B;  3GK4 X;  1S6C A;  1K95 A;  1MR8 A;  1K9K A;  1Q80 A;  1CM4 A;  3BUX B;  3FE6 A;  1C3Y A;  3M0W A;  1J7Q A;  1NPQ A;  3JTD B;  1ZMZ A;  2KFF A;  4PE0 A;  5AER A;  1YUS A;  2MRD A;  2P70 A;  4CFQ A;  1YUU A;  2EGD A;  2NCO A;  1RTP 1;  2Q91 A;  3LL8 B;  1RJV A;  1CLB A;  1TCF A;  2MBX A;  3WHT B;  4WRI A;  3CTN A;  1XVJ A;  1YUT A;  1LS8 A;  1LVC D;  1UHK A;  2BCA A;  3TDU A;  3TS5 C;  3VB1 A;  3H4S E;  2LP3 A;  4HRH A;  1J55 A;  1CFF A;  1SPY A;  2JXL A;  1C3Z A;  1OOJ A;  4MZL A;  2BCX A;  3FWB A;  1ORG A;  4PHK A;  3D74 A;  4MRX A;  2TN4 A;  2LP2 A;  3BYA A;  3NGV A;  3O4X A;  1S26 D;  2G2B A;  2K61 A;  3B87 A;  2KNE A;  2LHL A;  2NLN A;  3D76 A;  3EVV A;  3OBV A;  3PN7 B;  2LAN A;  3SG4 A;  4MN0 A;  5KU1 A;  1BT6 A;  1QWV A;  1DJH A;  4FQT A;  4GNK B;  5HKZ A;  1AHR A;  5I2L A;  3TZ1 A;  3BFA A;  1P28 A;  1S1E A;  3SS3 A;  2F33 A;  3R1P A;  1QV0 A;  4U8D A;  3NSK A;  2MLF C;  1B8L A;  2SAS A;  1PVA A;  2I94 A;  1FI6 A;  1PVB A;  2GGZ A;  3KF9 A;  1GM0 A;  1YRU B;  2PAS A;  2QPT A;  3WXA A;  3S0F A;  4P2Y B;  1S6J A;  1XFZ O;  2CCM A;  2PQL A;  2ZNE A;  1PK0 D;  1IGV A;  4PHM A;  1NIW A;  4KYN A;  2BAP A;  2MJW B;  1A29 A;  1X02 A;  3FE8 A;  1OMR A;  3B86 A;  4DIR A;  1KK7 Z;  5CSJ A;  1MQ1 A;  5DKR A;  4I5L B;  3I5F C;  1L2O B;  2KAX A;  2HQ8 A;  3CYZ A;  3EG5 B;  1QX7 A;  1B7T Z;  2KOT A;  1SSE B;  3AKB A;  1QTX A;  3PFV A;  4MRY A;  4CFR A;  1SYM A;  3S0G A;  1GGZ A;  1AUI B;  1XYD A;  1CMF A;  1KFX L;  1M63 B;  1F71 A;  1DMO A;  1SBJ A;  1KQV A;  2K7C A;  3AKA A;  3O78 A;  3UNW A;  3F45 A;  2M7L A;  1BF5 A;  5GQQ C;  2G9B A;  1CLM A;  4ORC B;  2WOS A;  1JBA A;  1TIZ A;  1NUB A;  5HKW A;  2M49 B;  4FQO A;  1OW4 A;  1WDC B;  3BOW A;  2L5Y A;  3I5G C;  1A03 A;  2L2E A;  3BQ3 A;  1LIN A;  2WND A;  1TNP A;  1AJ5 A;  1DJZ A;  2L98 A;  4AQI A;  4C0K A;  1CM1 A;  1K90 D;  2WC5 A;  1TTX A;  2BKI B;  1RFJ A;  2JT8 A;  2JUL A;  1FI5 A;  3NSI A;  3OP0 A;  3LK1 A;  2NZ0 A;  3PM2 A;  2PMY A;  3LCP C;  2KYC A;  1PRW A;  4GGF A;  1FF1 A;  1RWY A;  1SL9 A;  3O2P A;  2F3Y A;  2BNX A;  3DD4 A;  1IIO A;  3BOW B;  4P5O E;  4WQ3 A;  1TWO A;  5JOL A;  1CFD A;  1B9A A;  1V1G A;  1K9P A;  2BBN A;  2LAP A;  3QME A;  1LXF C;  2DOQ A;  2A4J A;  1CDN A;  1YR5 A;  2AUC A;  3R72 A;  2WC6 A;  3DVM A;  5F6T A;  4CID A;  1ALW A;  4L9M A;  3TUY B;  2MAZ A;  4PT1 A;  5KSZ A;  2KBI A;  1KFU L;  1NWD A;  3CGA A;  2LLS A;  1QAT A;  1HQV A;  1F4O A;  1NX0 A;  2ISD A;  1ZFS A;  3LK0 A;  4GGN A;  1MXL C;  2B1U A;  2LLT A;  2F2O A;  2K7D A;  3DVJ A;  3EVR A;  1DJY A;  1KQM C;  1J7P A;  3SJS A;  4JPZ B;  3SS5 A;  4R1E A;  1CFP A;  2KI4 C;  1SL8 A;  3TS5 B;  5I94 A;  1N65 A;  1UWO A;  2NXQ A;  5HLV A;  3AAJ A;  4JD9 A;  4UPG A;  4YGB B;  1OMV A;  1SMG A;  2Y1N A;  3BFH A;  3DF0 A;  2F3Z A;  1DT7 B;  2Y5I A;  2QEV A;  4PHJ A;  5DIC A;  2LVV A;  1BU3 A;  1QX5 B;  4JQ0 D;  2JPO A;  3DY9 A;  1B4C A;  1F4Q A;  1IRJ A;  1MF8 B;  2JT3 A;  5K89 A;  1OZO A;  1DGU A;  3FWC A;  3D75 A;  5FYX A;  1EXR A;  2ZRS A;  2PYQ A;  1SW8 A;  1U5I A;  1OOH A;  4IL1 A;  1JSA A;  1WRZ A;  5D69 A;  1BR4 B;  3D0Y B;  2WCE A;  5I8N A;  1QLS A;  2M1U A;  3S0E A;  2ZN8 A;  2Y4Q A;  3DF0 B;  1YX8 A;  1F54 A;  2AMI A;  1UP5 A;  1UUR A;  2FJY A;  2KGR A;  1N0Y A;  2F2P A;  2PAL A;  3CZ1 A;  1C07 A;  2H8V A;  1YTZ C;  2GGM A;  2KFH A;  3FE9 A;  3I5I C;  3UO9 A;  4OZD A;  1QS7 A;  1W7J B;  3BFB A;  1A75 A;  1LA3 A;  3MSE B;  2HQW A;  2MLE C;  3CAB A;  4INX A;  4XYN A;  2M0R A;  1D1O A;  2BEC A;  1U5I B;  3DVK A;  1PAL A;  3I5F B;  1JF2 A;  4PE7 A;  2BBM A;  1YUR A;  1NCX A;  2HPS A;  4MZJ A;  2K2A A;  1BOD A;  2JWW A;  1NCZ A;  2ZN9 A;  2LMU A;  1QV1 A;  3SG2 A;  4I5N B;  1F8H A;  1Z4H A;  2E6W A;  2PVB A;  5I2O A;  5I2Q A;  3AAK A;  2JU0 A;  5KTY A;  3VRP A;  1UHI A;  1K94 A;  1V1F A;  1B8R A;  1QAS A;  1XK4 C;  1ZUZ A;  1S5G Y;  3ZWH A;  1JUO A;  3HX4 A;  1A75 B;  1J1D A;  1AVS A;  1SCM C;  3B7A A;  3GK2 A;  3I5G B;  4IJ7 A;  2KQ6 A;  1BR1 B;  2OTG C;  2LVJ A;  4OVN F;  2M3W A;  2MA2 A;  3OB1 B;  4NDC A;  3VRQ A;  4N1G A;  3ICB A;  2K60 A;  2KBM A;  2KDH A;  3CZT X;  2L50 A;  2JRF A;  2LUC A;  4INW A;  1H4B A;  3EK4 A;  1IJ5 A;  1CLL A;  4I5K A;  4ZCU A;  2WOR A;  4MEW A;  4MSP A;  5HKY A;  3PAT A;  4F7F A;  4OCI A;  4YGA A;  1F55 A;  2EC6 C;  3NSO A;  2WCH A;  3HCM A;  1EL4 A;  1IQ5 A;  1K9U A;  2CXJ A;  1J1E A;  1UUS A;  3K21 A;  1SK6 D;  3Q8I A;  3C1V A;  3JVT C;  1XA5 A;  1TRF A;  3I5H C;  1J7R A;  4C0J A;  1BLQ A;  2WCM A;  1NX3 A;  5CSF A;  1S3P A;  1UHJ A;  2PRU A;  5FI2 A;  1BOC A;  2KYF A;  1AJ4 A;  1SR6 C;  2K7B A;  3D10 A;  2M1K B;  4BY5 A;  2BE4 A;  4ORB B;  3VRN A;  5AEQ A;  1IJ6 A;  4PHN A;  2LMV A;  1DC1 A;  1MWN A;  2KAY A;  3CS1 A;  1NX1 A;  4XJK A;  4N5X A;  3BXK A;  1DF0 A;  2WCB A;  3LLE A;  1QIV A;  3A8R A;  4GPL B;  4YGC B;  2LM5 A; 
#chains in the Genus database with same CATH homology
 1KFX S;  1QXP A;  2JNF A;  1W7I B;  4M2Q A;  4MVF A;  1WLM A;  1KQM B;  2M9G A;  3CLN A;  2OPO A;  1OQP A;  3VGO A;  4TNC A;  4OV2 A;  2KI4 B;  2FCE A;  4DS7 A;  5CSI A;  4QJ4 B;  2LVI A;  1FW4 A;  4NQG A;  5CPV A;  1MXE A;  4PCW A;  1QLK A;  2FCD A;  1EG3 A;  2K8M B;  2LLU A;  1EJ3 A;  4XJK B;  3SG6 A;  4BY4 A;  1NP8 A;  2Q4U A;  3O6B A;  4MLW A;  1LA0 A;  4F0Z B;  5HYD A;  4M2O A;  2H61 A;  2VRG A;  1QVI Y;  1ZAC A;  3KO0 A;  1C7W A;  1XFY O;  2FOT A;  1IKU A;  2BCB A;  1PSB A;  1YX7 A;  1KK8 C;  1A2X A;  1OSA A;  2JOJ A;  3CR5 X;  2CT9 A;  1BMO A;  1ODB A;  4MBE A;  3EK8 A;  3SG3 A;  1G8I A;  2LNK A;  2LVK A;  1GJY A;  4ETO A;  2RGI A;  2L4I A;  3E3R A;  1TNQ A;  3I5I B;  1NX2 A;  1XK4 A;  1N2D A;  1S6I A;  4N1F A;  1DJG A;  2LCP A;  1AK8 A;  1H8B A;  1OMD A;  3PLF B;  1SNL A;  1KFU S;  3OB2 B;  1IG5 A;  2ZFD A;  1IH0 A;  4PDZ A;  1SCV A;  1NCY A;  2BL0 C;  2LC5 A;  2V53 A;  5CSN A;  5J3X A;  3EK7 A;  1AP4 A;  5AXI A;  1OZS A;  1Y1X A;  3WNX B;  4AQJ A;  2CNP A;  1JC2 A;  1R2U A;  3QRX A;  5IBW A;  1KWO C;  2OS8 C;  2H2K A;  2JTZ A;  1TNX A;  2JZI A;  5BPJ A;  1G4Y R;  1CFC A;  4GFT A;  2AAO A;  2KFG A;  1GQM A;  2BKH B;  2M97 A;  2L51 A;  4PE4 A;  2H61 C;  2M8U A;  2OTG B;  3EKH A;  4QJ3 B;  3GOF A;  2I2R E;  1PSR A;  1SRA A;  2I7A A;  1WY9 A;  1XFX O;  5HLO A;  4YBH B;  1E8A A;  1CKK A;  2KI6 C;  4HRG A;  4NDD A;  3SG7 A;  1CDL A;  3OX6 A;  1YVH A;  1REC A;  3NXA A;  3RLZ A;  2KGB C;  2D8N A;  1K96 A;  1B47 A;  1XFU O;  4C0L A;  2EC6 B;  2JTT A;  4GBA A;  5JJG A;  1KK7 Y;  1XO5 A;  1NYA A;  1B7T Y;  1TOP A;  2LUX A;  3JVT B;  3I5H B;  3RM1 A;  1IQ3 A;  2ZKM X;  4DRW A;  4PE1 A;  1IWQ A;  2L0P A;  1SR6 B;  1CNP A;  1MUX A;  3NSL A;  1KSM A;  4YRU A;  3ZNI A;  5B8I B;  1G33 A;  4HRE E;  1JFK A;  1K2H A;  5ER4 X;  3FIA A;  2PSR A;  3IQO A;  4D1E A;  4DUQ A;  3DVE A;  1L7Z A;  1Y0V H;  1LKJ A;  1DVI A;  1UHH A;  3JTD C;  1DTL A;  2IS9 A;  2JNX A;  4CPV A;  1VRK A;  2HET A;  5AFP A;  2JT0 A;  1Y1A A;  2LHI A;  3GK1 A;  3IQQ A;  1TCO B;  1YRT B;  2O5G A;  1KSO A;  2KAV A;  4GUK A;  1DJI A;  1EG4 A;  3BUN B;  3BUW B;  4USL A;  4YI8 A;  2M7N A;  2NCP A;  1R6P A;  2Y1M A;  2EHB A;  3VRR A;  2LMT A;  1S5G Z;  3FS7 A;  3PN7 C;  2ZND A;  3TDI A;  1WRL A;  1M46 A;  4YGE B;  2ZRT A;  1KCY A;  1JF0 A;  1CMG A;  1M45 A;  3SIA A;  4JWQ A;  5D7F A;  1K8U A;  1K93 D;  1KK8 B;  1QJT A;  3CWG A;  3BUO B;  3SG5 A;  3A4U B;  3O4Y A;  5AAN A;  2P6B B;  1ZOT B;  2SCP A;  2JC2 A;  3VRO A;  1M39 A;  2CTN A;  1EH2 A;  1QX2 A;  1F70 A;  1RK9 A;  4ICB A;  4ORA B;  5TNC A;  4AOM A;  4PAL A;  1HT9 A;  1DF0 B;  1DJX A;  4Q04 A;  2MHH A;  1RRO A;  2BL0 B;  1L2O C;  1XFW O;  2KI6 D;  3CR2 A;  1BJF A;  4YGD B;  3KPX A;  4OR9 B;  4ZCV A;  1CTR A;  2E30 A;  1CDP A;  1XFV O;  2JQ6 A;  2R2I A;  4GAO A;  2L4H A;  2WCF A;  4M2P A;  1SKT A;  1CB1 A;  1PUL A;  2LV7 A;  5DKN A;  4NDB A;  1NSH A;  4FTG A;  1KWO B;  2GV5 A;  2OS8 B;  2HF5 A;  2K2F A;  3CR4 X;  3KHE A;  3OHM B;  4MZK A;  2I18 A;  2L5X B;  4A4C A;  2KSP A;  2M29 A;  3TDZ A;  1UHN A;  1WRK A;  2COL B;  1FBV A;  1WDC C;  3BUM B;  3PSR A;  1FPW A;  3OX5 A;  1MHO A;  5ER5 A;  2CBL A;  1JWD A;  1TNW A;  2WC8 A;  4A4B A;  4I5J A;  1A4P A;  1QIW A;  2F8P A;  3PAL A;  2K7O A;  2LE9 B;  1Y1U A;  1S36 A;  4DCK A;  1B8C A;  3EKJ A;  3EVU A;  3WHU B;  2K0J A;  3KEV A;  1SY9 A;  2O60 A;  2KHN A;  1J7O A;  1DJW A;  1DGV A;  4WQ2 A;  4HSZ A;  1CDM A;  1SL7 A;  2JPT A;  2QAC A;  5PAL A;  3IF7 A;  3PM8 A;  2KQY A;  1ALV A;  4E68 A;  1QVI Z;  2BE6 A;  1C7V A;  3D0Y A;  1OE9 B;  5DKQ A;  1BG1 A;  3SIB A;  5G08 A;  1JFJ A;  1SCM B;  1TN4 A;  2JXC A;  1YVL A;  4YI9 A;  1M31 A;  3TUY C;  4OKH A;  1WLZ A;  1Y6W A;  4GGF C;  4CLN A;  2FJU B;  3GK4 X;  1S6C A;  1K95 A;  1MR8 A;  1K9K A;  1Q80 A;  1CM4 A;  3BUX B;  3M0W A;  1J7Q A;  1NPQ A;  3JTD B;  1ZMZ A;  2KFF A;  4PE0 A;  5AER A;  1YUS A;  2MRD A;  4CFQ A;  1YUU A;  2EGD A;  2NCO A;  1RTP 1;  2Q91 A;  3LL8 B;  1RJV A;  1CLB A;  1TCF A;  2MBX A;  3WHT B;  4WRI A;  3CTN A;  1XVJ A;  1YUT A;  3TS5 C;  1LVC D;  1UHK A;  2BCA A;  3TDU A;  1B1G A;  3H4S E;  2LP3 A;  4HRH A;  1J55 A;  1CFF A;  1SPY A;  2JXL A;  1OOJ A;  4MZL A;  2BCX A;  3FWB A;  4PHK A;  4MRX A;  2TN4 A;  2LP2 A;  3BYA A;  1S26 D;  2G2B A;  2K61 A;  4QJ5 B;  2KNE A;  2LHL A;  2NLN A;  1GGW A;  3EVV A;  3PN7 B;  3SG4 A;  2LAN A;  4MN0 A;  5KU1 A;  1BT6 A;  4GNK B;  1DJH A;  5HKZ A;  5I2L A;  3TZ1 A;  1AHR A;  1S1E A;  2F33 A;  1QV0 A;  4U8D A;  3NSK A;  2MLF C;  1B8L A;  2SAS A;  1PVA A;  2I94 A;  1FI6 A;  1PVB A;  2GGZ A;  3KF9 A;  1YRU B;  2PAS A;  2QPT A;  3WXA A;  4P2Y B;  1S6J A;  1XFZ O;  2CCM A;  2ZNE A;  1PK0 D;  1IGV A;  4PHM A;  1NIW A;  2MJW B;  1A29 A;  1X02 A;  1OMR A;  4DIR A;  1KK7 Z;  5CSJ A;  1MQ1 A;  5DKR A;  4I5L B;  3I5F C;  1L2O B;  2KAX A;  2HQ8 A;  1QX7 A;  1B7T Z;  2KOT A;  3AKB A;  4MRY A;  1QTX A;  3PFV A;  4CFR A;  1SYM A;  1GGZ A;  1AUI B;  1XYD A;  1CMF A;  1KFX L;  1M63 B;  1F71 A;  1DMO A;  1SBJ A;  1KQV A;  2K7C A;  3AKA A;  3O78 A;  3F45 A;  2M7L A;  1BF5 A;  5GQQ C;  2G9B A;  1CLM A;  4ORC B;  2WOS A;  1JBA A;  1TIZ A;  1NUB A;  5HKW A;  2M49 B;  4FQO A;  1WDC B;  3BOW A;  3I5G C;  1A03 A;  2L2E A;  3BQ3 A;  1LIN A;  2WND A;  1TNP A;  1AJ5 A;  1DJZ A;  2L98 A;  4AQI A;  4C0K A;  1CM1 A;  1K90 D;  1TTX A;  2BKI B;  1RFJ A;  2JT8 A;  2JUL A;  1FI5 A;  3NSI A;  3OP0 A;  3LK1 A;  2NZ0 A;  2PMY A;  3LCP C;  2KYC A;  1PRW A;  4GGF A;  1FF1 A;  1RWY A;  1SL9 A;  3O2P A;  2F3Y A;  3DD4 A;  3BOW B;  4P5O E;  4WQ3 A;  5JOL A;  1CFD A;  1B9A A;  1V1G A;  1K9P A;  2BBN A;  2LAP A;  1LXF C;  2DOQ A;  2A4J A;  1CDN A;  1YR5 A;  2AUC A;  3DVM A;  5F6T A;  4CID A;  1ALW A;  4L9M A;  3TUY B;  2MAZ A;  5KSZ A;  2KBI A;  1KFU L;  1NWD A;  3CGA A;  2LLS A;  1QAT A;  1HQV A;  1F4O A;  1NX0 A;  2ISD A;  1ZFS A;  3LK0 A;  4GGN A;  1MXL C;  2B1U A;  2LLT A;  2F2O A;  2K7D A;  3DVJ A;  3EVR A;  1DJY A;  1KQM C;  1J7P A;  3SJS A;  4JPZ B;  4R1E A;  1CFP A;  2KI4 C;  1SL8 A;  3TS5 B;  1N65 A;  1UWO A;  2NXQ A;  5HLV A;  3AAJ A;  4UPG A;  4YGB B;  1OMV A;  1SMG A;  2Y1N A;  3DF0 A;  2F3Z A;  1DT7 B;  2Y5I A;  4PHJ A;  2LVV A;  1BU3 A;  1QX5 B;  4JQ0 D;  1B4C A;  1F4Q A;  1IRJ A;  1MF8 B;  2JT3 A;  5K89 A;  1OZO A;  1DGU A;  3FWC A;  5FYX A;  1EXR A;  2ZRS A;  1SW8 A;  1U5I A;  4IL1 A;  1JSA A;  1WRZ A;  5D69 A;  1BR4 B;  3D0Y B;  2WCE A;  5I8N A;  1QLS A;  2M1U A;  2ZN8 A;  2Y4Q A;  3DF0 B;  1YX8 A;  1F54 A;  2AMI A;  1UP5 A;  1UUR A;  2KGR A;  1N0Y A;  2F2P A;  2PAL A;  1C07 A;  1YTZ C;  2GGM A;  2KFH A;  3I5I C;  1QS7 A;  1W7J B;  1A75 A;  1LA3 A;  3MSE B;  2HQW A;  2MLE C;  4XYN A;  2M0R A;  1D1O A;  2BEC A;  1U5I B;  3DVK A;  1PAL A;  3I5F B;  1JF2 A;  4PE7 A;  2BBM A;  1YUR A;  1NCX A;  2HPS A;  4MZJ A;  2K2A A;  1BOD A;  2JWW A;  1NCZ A;  2ZN9 A;  2LMU A;  1QV1 A;  3SG2 A;  4I5N B;  1F8H A;  2E6W A;  2PVB A;  5I2O A;  5I2Q A;  3AAK A;  2JU0 A;  5KTY A;  3VRP A;  1UHI A;  1K94 A;  1V1F A;  1B8R A;  1QAS A;  1XK4 C;  1ZUZ A;  1S5G Y;  3ZWH A;  1JUO A;  3HX4 A;  1A75 B;  1J1D A;  1AVS A;  1SCM C;  3GK2 A;  3I5G B;  2KQ6 A;  1BR1 B;  2OTG C;  2LVJ A;  4OVN F;  2M3W A;  2MA2 A;  3OB1 B;  4NDC A;  3VRQ A;  4N1G A;  3ICB A;  2KBM A;  2KDH A;  3CZT X;  2L50 A;  2JRF A;  2LUC A;  1H4B A;  3EK4 A;  1IJ5 A;  1CLL A;  4I5K A;  4ZCU A;  2WOR A;  4MEW A;  4MSP A;  5HKY A;  3PAT A;  4OCI A;  4YGA A;  1F55 A;  2EC6 C;  3NSO A;  3HCM A;  1EL4 A;  1IQ5 A;  1K9U A;  2CXJ A;  1J1E A;  1UUS A;  3K21 A;  1SK6 D;  3C1V A;  3JVT C;  1XA5 A;  1TRF A;  3I5H C;  1J7R A;  4C0J A;  1BLQ A;  1NX3 A;  5CSF A;  1S3P A;  1UHJ A;  2PRU A;  1BOC A;  2KYF A;  1AJ4 A;  1SR6 C;  2K7B A;  3D10 A;  2M1K B;  4BY5 A;  2BE4 A;  4ORB B;  3VRN A;  5AEQ A;  1IJ6 A;  4PHN A;  2LMV A;  1MWN A;  2KAY A;  3CS1 A;  1NX1 A;  4XJK A;  4N5X A;  3BXK A;  1DF0 A;  2WCB A;  3LLE A;  1QIV A;  3A8R A;  4GPL B;  4YGC B;  2LM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...