1IWQA

Crystal structure of marcks calmodulin binding domain peptide complexed with ca2+/calmodulin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
139
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Crystal structure of a MARCKS peptide containing the calmodulin-binding domain in complex with Ca(2+)-calmodulin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/protein binding
total genus 52
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iwqA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iwqA02
1AUIB 1B7TZ 1K94A 1AHRA 1L7ZA 1KFXL 1TNXA 1FPWA 2L51A 5DKRA 3SIAA 1WRKA 1SCMB 1SL9A 2CCMA 1QLSA 4OCIA 3A4UB 4CPVA 1MXEA 1CMGA 2K2FA 1KFXS 2LLTA 1SYMA 5JOLA 4FQOA 5KU1A 3M0WA 4I5JA 1B4CA 2JT3A 3VRRA 1SY9A 1IKUA 1F55A 1JC2A 5HKYA 1QJTA 5HKZA 1MXLC 2SASA 1FW4A 1YUUA 3DVKA 1TIZA 1K8UA 2L4HA 1F71A 4TNCA 1K2HA 3PN7C 1WDCB 5CSIA 1SK6D 4YGDB 5IBWA 2KOTA 2Y5IA 1LKJA 2L2EA 5K89A 1DJHA 2FJUB 1ODBA 1XYDA 2BCBA 2ZN9A 3PFVA 3TUYB 4BY4A 1F54A 1MQ1A 3CTNA 5ER4X 1H4BA 2NZ0A 2E6WA 2KI6D 1YX7A 4PALA 4MLWA 1F70A 2F2PA 5GQQC 2CXJA 1B8CA 3GK1A 5TNCA 3BUNB 1JSAA 2I18A 5B8IB 3KO0A 1BMOA 1EJ3A 1G8IA 1AVSA 1SR6B 2K61A 2OTGC 1UWOA 2A4JA 4YI8A 1GQMA 1PK0D 3BUWB 4P5OE 2QPTA 5HYDA 2KFHA 2KYCA 2KQ6A 1DTLA 2JULA 4QJ5B 3LLEA 2R2IA 3D0YA 3CGAA 3WHUB 1KCYA 2WNDA 1QS7A 2LNKA 3GK4X 4N1GA 1KQMC 3VRPA 1J7QA 1QIWA 3CR2A 1TCFA 2M1UA 1CM4A 2EHBA 4HRHA 1DF0B 2AMIA 3EK4A 4NDCA 1J55A 2FCEA 1CDNA 3TS5C 1RWYA 1ZUZA 4HREE 3SG3A 3KF9A 1PVAA 1K93D 2H61A 3WHTB 3E3RA 1CMFA 2BCXA 1GGWA 3JTDC 3KPXA 1DJGA 2BE4A 3DVMA 1TCOB 2JXCA 1CDPA 1NSHA 3BUMB 2L5XB 4PHKA 2HQWA 1S5GZ 3VRNA 1C07A 1NCZA 1BG1A 3I5GB 5D69A 1LA0A 2CNPA 1WRLA 2G2BA 2LLSA 3CR4X 4GGNA 1SCMC 2LVVA 3SG6A 4AQIA 2VRGA 4GGFA 3IF7A 4FTGA 1ZOTB 3MSEB 1QVIZ 3EKHA 2KYFA 1YVLA 2M3WA 1A2XA 3BQ3A 3PSRA 2P6BB 2I2RE 4AQJA 2KHNA 4I5LB 4QJ4B 1WRZA 1F4OA 1MR8A 1IQ5A 2JNFA 1MHOA 1Y6WA 1XVJA 1K95A 2F8PA 3VRQA 1YR5A 1XK4C 1WDCC 3AKBA 1NYAA 1XFWO 4GFTA 4R1EA 3DF0A 4OV2A 3I5HB 4IL1A 4YGCB 2Y1MA 5KSZA 2KSPA 2MRDA 3WXAA 1QX2A 2KGBC 1A29A 3HX4A 1NUBA 3I5FB 4CIDA 3TUYC 3OB1B 3EVRA 1SMGA 1E8AA 1K9UA 1M63B 1A03A 4NDDA 1RTP1 1DJWA 1S6IA 2BL0B 2LE9B 2LHIA 1M31A 4MZLA 5AANA 2MBXA 4DIRA 5CSNA 1SCVA 4C0LA 2HF5A 2LANA 4GBAA 4YGAA 4DUQA 1UUSA 2K7BA 3TDIA 3EK7A 1IJ5A 1MUXA 1B9AA 1X02A 1ZACA 4F0ZB 2ZFDA 1J7RA 1SR6C 4E68A 2EGDA 4DCKA 1EH2A 1BODA 1FF1A 1K96A 1DJYA 1UHIA 1LVCD 3CR5X 1S6CA 4UPGA 4M2PA 3CWGA 3DVJA 3KEVA 4PDZA 1DJIA 5ER5A 2L50A 4I5NB 3OX5A 1GJYA 2WOSA 2CT9A 5J3XA 4A4BA 1V1GA 1BT6A 1XO5A 1CLLA 4QJ3B 1PSBA 2LUCA 1TNPA 1QTXA 1XFYO 5CSJA 2NLNA 3EVVA 4ETOA 2MHHA 1YX8A 1LINA 1OMRA 1WLZA 1AJ5A 1N65A 3IQOA 3OX6A 3TZ1A 2LC5A 1DJZA 1L2OB 1SKTA 1TTXA 3LK1A 3NSLA 4GUKA 2KGRA 2JRFA 2KBIA 1FI6A 1WLMA 1BLQA 1YRTB 2COLB 1WY9A 2PSRA 1NWDA 2BKIB 3JVTB 4D1EA 1B1GA 1MWNA 3EVUA 3D0YB 2IS9A 1PULA 2G9BA 1GGZA 2Q91A 3I5GC 4XJKA 1KK7Y 4MZJA 2JXLA 5HKWA 1F8HA 2LVJA 4MRYA 4YRUA 1W7IB 1QX7A 2F3YA 3BOWA 4YI9A 2BECA 1JF0A 1ALVA 1MF8B 2MAZA 3D10A 4JPZB 1CLMA 1YURA 1XFZO 1QIVA 5CSFA 2O5GA 2JZIA 2MLEC 2M7LA 1DVIA 3DD4A 4HSZA 3WNXB 2KI6C 2JC2A 1YVHA 1KFUS 2HETA 4PE0A 3QRXA 4OR9B 4ORCB 1DGVA 1PALA 1RK9A 3NSIA 2NXQA 3LCPC 1UHHA 2TN4A 1BOCA 1QLKA 1UURA 2JTTA 2K2AA 3PLFB 3I5HC 1C7VA 2KI4B 2LLUA 1OQPA 2JT8A 1R2UA 1S36A 1BJFA 1M39A 1AK8A 3FWCA 2M0RA 2JQ6A 3SG7A 2KFGA 2BL0C 1R6PA 1M45A 1IRJA 1NX1A 3VGOA 1C7WA 4N5XA 2EC6B 4PE1A 2K7OA 3I5IB 3CLNA 3SG4A 1JFJA 3OHMB 1DT7B 1M46A 1TRFA 2KFFA 4ZCUA 1NX3A 2LM5A 1S6JA 3TDZA 4JWQA 1ZFSA 2LMVA 3BUOB 4MBEA 1PRWA 4MRXA 4A4CA 2M49B 3BUXB 1IQ3A 1KSOA 2M8UA 1YUSA 1CTRA 3DF0B 1CFFA 4MEWA 4YGBB 2FOTA 1DJXA 1F4QA 3SJSA 1DMOA 2LVKA 1SW8A 2OS8B 4PCWA 4P2YB 1SNLA 2K0JA 1OSAA 3FS7A 2PVBA 3FIAA 1OMDA 2LMUA 4GAOA 1NX2A 2M7NA 1HT9A 1U5IA 4ICBA 3HCMA 3IQQA 2JU0A 3GOFA 1B7TY 1XFXO 4AOMA 1L2OC 2PRUA 1A75A 1ZMZA 2NCPA 1JWDA 1BF5A 3BYAA 4I5KA 4JQ0D 2GV5A 1OZSA 4WQ3A 4U8DA 5DKQA 5I2LA 2LAPA 5AEQA 3JVTC 3DVEA 3FWBA 5G08A 1NIWA 1UP5A 1B47A 1K90D 3O6BA 3AKAA 4M2QA 2B1UA 3SG5A 2CBLA 1SBJA 1VRKA 1NCYA 1RROA 5D7FA 5I8NA 4MSPA 1S1EA 4Q04A 2KNEA 1EXRA 1B8RA 1CNPA 2MA2A 2BCAA 2WC8A 1KWOB 2WCFA 5AFPA 1OZOA 2KQYA 2LP3A 2D8NA 3EKJA 4ORAB 1D1OA 2LCPA 2PASA 5HLOA 4C0KA 1Y0VH 1SL8A 3SG2A 1K9KA 1QATA 1V1FA 3PATA 2H61C 2WCEA 4WRIA 2MLFC 2KAYA 1BR1B 4PE4A 2BKHB 3OB2B 2M1KB 1JF2A 1A4PA 1IG5A 4GNKB 1UHJA 1Y1XA 1XA5A 2KBMA 1TNQA 1JUOA 4NQGA 4ZCVA 1KK8B 2SCPA 2RGIA 3H4SE 4HRGA 4XJKB 3K21A 2AUCA 1JBAA 2I7AA 1JFKA 2KI4C 2M29A 4YGEB 5DKNA 2LMTA 2L98A 4N1FA 2CTNA 2V53A 4GGFC 1KQVA 3BOWB 2KAXA 1BR4B 1QV0A 3C1VA 1IH0A 1RFJA 1PVBA 1J1EA 2H2KA 1IGVA 2BE6A 2FCDA 3RM1A 1CFPA 3AAKA 3VROA 4PE7A 1J1DA 2EC6C 1AJ4A 1NP8A 2K7CA 1PSRA 3I5IC 3LK0A 2Y4QA 4M2OA 2ZRTA 1N2DA 2ZRSA 1HQVA 4CFRA 3NSOA 5I2QA 2GGZA 4MN0A 1QX5B 3TDUA 1KSMA 3CZTX 1XK4A 2OPOA 1J7PA 1SL7A 2ZNDA 1KFUL 4OVNF 2K7DA 1XFUO 1S26D 2JOJA 2QACA 1G4YR 1SRAA 1CFCA 2JPTA 2L4IA 1H8BA 5F6TA 2OS8C 1FBVA 3ZWHA 1SPYA 1TOPA 2M97A 2L0PA 3AAJA 2LHLA 3NSKA 1CFDA 2LV7A 1NCXA 4PHMA 2BBMA 1S5GY 3GK2A 2LUXA 4NDBA 1OOJA 5HLVA 1IWQA 1KK7Z 3I5FC 2JNXA 5CPVA 4DS7A 2BBNA 1NPQA 2WORA 3NXAA 2JWWA 2M9GA 2NCOA 3PN7B 2ZKMX 4CLNA 1CKKA 2Q4UA 5FYXA 1QVIY 3ZNIA 1Y1UA 3KHEA 3ICBA 1TNWA 2ZN8A 2F33A 1YRUB 2K8MB 1FI5A 4L9MA 2O60A 1YUTA 5KTYA 4OKHA 2AAOA 2HQ8A 1ALWA 1RJVA 3RLZA 2WCBA 1CM1A 1EL4A 1KWOC 2JT0A 3OP0A 1BU3A 5I2OA 3LL8B 1J7OA 4C0JA 1DF0A 5AXIA 2ISDA 1U5IB 2E30A 3CS1A 5AERA 3O78A 1G33A 4MZKA 1A75B 1YTZC 1NX0A 1Q80A 1IJ6A 3BXKA 1K9PA 2KAVA 2OTGB 2PALA 1LA3A 1EG3A 4GPLB 1DGUA 4USLA 4BY5A 5JJGA 1CDMA 3O4YA 2MJWB 1UHKA 3PALA 4YBHB 1KK8C 1QV1A 1KQMB 1UHNA 5PALA 3PM8A 1CLBA 1RECA 2PMYA 1LXFC 4WQ2A 4ORBB 2LVIA 1W7JB 3O2PA 4PHJA 2GGMA 1Y1AA 3F45A 1CB1A 1CDLA 1QASA 4CFQA 1N0YA 2KDHA 2Y1NA 4XYNA 3TS5B 2I94A 2DOQA 2ZNEA 2F3ZA 1AP4A 1OMVA 2F2OA 2JTZA 4DRWA 4PHNA 3A8RA 3EK8A 3JTDB 1OE9B 1EG4A 2LP2A 3SIBA 1B8LA 1TN4A 5BPJA 1S3PA 4MVFA 1QXPA 2HPSA 1XFVO
chains in the Genus database with same CATH superfamily
1AUIB 1B7TZ 1K94A 1AHRA 1L7ZA 1KFXL 1TNXA 1FPWA 2L51A 5DKRA 3SIAA 1WRKA 1SCMB 1SL9A 3EG5B 2CCMA 1QLSA 4OCIA 3A4UB 4CPVA 1MXEA 1C3YA 2K2FA 1KFXS 2LLTA 1CMGA 1SYMA 3B86A 5JOLA 4AQIA 4FQOA 5KU1A 3M0WA 4I5JA 1B4CA 2JT3A 3VRRA 1SY9A 1IKUA 1F55A 1JC2A 5HKYA 1QJTA 5HKZA 1MXLC 2SASA 1FW4A 1YUUA 3D78A 1TIZA 1K8UA 2L4HA 3DVKA 1F71A 4TNCA 1K2HA 1TUZA 3PN7C 1WDCB 1W9ZA 3S0DA 5CSIA 1SK6D 4YGDB 3VB1A 1Z2CB 5IBWA 1Z4HA 1C3ZA 2KOTA 2Y5IA 1LKJA 2L2EA 5K89A 1DJHA 2FJUB 1ODBA 1XYDA 2BCBA 2ZN9A 3PFVA 3TUYB 4BY4A 1F54A 1MQ1A 3CTNA 5ER4X 1H4BA 2NZ0A 2E6WA 2KI6D 1GM0A 1YX7A 4PALA 3B6XA 3RZSA 4INXA 4MLWA 1F70A 2F2PA 3O4XA 5GQQC 2CXJA 1B8CA 3GK1A 5TNCA 3BUNB 2KPHA 1JSAA 2I18A 5B8IB 3KO0A 1BMOA 1EJ3A 1G8IA 1AVSA 1SR6B 2K61A 2OTGC 1UWOA 2A4JA 2KLDA 4YI8A 1GQMA 1PK0D 3BUWB 3D75A 4P5OE 2QPTA 5HYDA 2KFHA 2KYCA 2KQ6A 1DTLA 2JULA 4QJ5B 3LLEA 2R2IA 3D0YA 3CGAA 3WHUB 1KCYA 2WNDA 3CABA 1QS7A 2ERBA 2LNKA 3GK4X 4N1GA 1KQMC 3VRPA 1J7QA 1QIWA 3CR2A 1TCFA 2M1UA 1CM4A 2EHBA 4HRHA 1DF0B 2AMIA 3EK4A 4NDCA 2P71A 1J55A 2FCEA 1CDNA 3TS5C 1RWYA 1ZUZA 3CZ0A 4HREE 1DC1A 3BFBA 3SG3A 3KF9A 1PVAA 1K93D 2H61A 3WHTB 3E3RA 1CMFA 2BCXA 4F7FA 1GGWA 3JTDC 3KPXA 1DJGA 2BE4A 3DVMA 1TCOB 2JXCA 1CDPA 1NSHA 3BUMB 2L5XB 4FQTA 2HQWA 4PHKA 1S5GZ 3VRNA 1C07A 1NCZA 1BG1A 3I5GB 5D69A 1LA0A 2CNPA 1WRLA 2G2BA 2LLSA 3CR4X 3OBVA 1SCMC 2LVVA 3R1PA 4GGNA 2VRGA 3SG6A 4GGFA 5FI2A 3IF7A 4FTGA 2PQLA 1ZOTB 3MSEB 1QVIZ 3EKHA 2KYFA 1YVLA 2M3WA 1A2XA 3BQ3A 3PSRA 2P6BB 2I2RE 4AQJA 2KHNA 4I5LB 4QJ4B 1WRZA 1F4OA 1MR8A 2WCLA 1IQ5A 2JNFA 3FE6A 3R1OA 1MHOA 1TWOA 1Y6WA 1XVJA 1K95A 2F8PA 3UO9A 3VRQA 1YR5A 1XK4C 1WDCC 3AKBA 1NYAA 1XFWO 4GFTA 4R1EA 3S0FA 3DF0A 4OV2A 3I5HB 4IL1A 4YGCB 2Y1MA 3CZ2A 2KSPA 2MRDA 3WXAA 1QX2A 5KSZA 2KGBC 1A29A 3HX4A 1NUBA 3I5FB 4CIDA 3TUYC 3OB1B 3EVRA 1SMGA 1E8AA 3SS5A 1K9UA 1M63B 1A03A 4NDDA 1RTP1 1DJWA 1S6IA 2BL0B 2LE9B 2LHIA 3DXLA 1M31A 3OGNA 4MZLA 5AANA 2MBXA 4DIRA 5CSNA 1SCVA 4C0LA 2HF5A 2LANA 4GBAA 4YGAA 4DUQA 1UUSA 2K7BA 3TDIA 3EK7A 5EL2A 1IJ5A 1MUXA 1B9AA 1X02A 1ZACA 4F0ZB 2ZFDA 1J7RA 1SR6C 3DZTA 4E68A 2EGDA 4DCKA 2JPOA 1EH2A 1BODA 1FF1A 1K96A 1DJYA 1UHIA 1LVCD 3CR5X 1S6CA 4UPGA 4M2PA 3CWGA 3DVJA 3KEVA 4PDZA 1DJIA 5ER5A 2L50A 3SS3A 4I5NB 3OX5A 1GJYA 2WOSA 2CT9A 5J3XA 4A4BA 1V1GA 1BT6A 1XO5A 1CLLA 4QJ3B 1PSBA 2LUCA 1TNPA 1QTXA 1XFYO 5CSJA 2NLNA 3EVVA 3FE8A 4ETOA 2MHHA 1YX8A 2WCKA 1LINA 1OMRA 1WLZA 1AJ5A 1N65A 3IQOA 3OX6A 3TZ1A 2LC5A 1DJZA 1L2OB 1SKTA 1TTXA 3LK1A 3NSLA 4GUKA 2KGRA 3CYZA 2JRFA 2KBIA 1FI6A 1WLMA 5HL1A 1BLQA 1YRTB 2COLB 1WY9A 2PSRA 1NWDA 2BKIB 2WC5A 2WCMA 3JVTB 1MWNA 4D1EA 1B1GA 3EVUA 3D0YB 2IS9A 1PULA 2G9BA 1GGZA 2Q91A 3I5GC 4XJKA 3QMEA 3S0AA 1KK7Y 4MZJA 2JXLA 5HKWA 1F8HA 2LVJA 4MRYA 4YRUA 1W7IB 1QX7A 2F3YA 3BOWA 4YI9A 2BECA 1JF0A 1ALVA 1MF8B 2MAZA 2QDIA 3D10A 4JPZB 1CLMA 2YGUA 1YURA 1XFZO 1QIVA 5CSFA 1OOIX 2O5GA 2JZIA 2MLEC 2M7LA 1DVIA 3DD4A 4HSZA 3WNXB 2KI6C 2JC2A 1YVHA 3FE9A 1KFUS 2HETA 4PE0A 3QRXA 4OR9B 4ORCB 1DGVA 1PALA 1RK9A 3NSIA 5D3OA 2NXQA 3LCPC 1UHHA 2TN4A 1BOCA 1QLKA 1UURA 2JTTA 2K2AA 3PLFB 3I5HC 1C7VA 2KI4B 2LLUA 1OQPA 2JT8A 1R2UA 2QEBA 1S36A 1BJFA 1M39A 1AK8A 3FWCA 2KLEA 2M0RA 2JQ6A 4JKTA 3SG7A 2KFGA 2BL0C 1R6PA 3NHIA 1M45A 1IRJA 1NX1A 3VGOA 1C7WA 4N5XA 2EC6B 4PE1A 3NHTA 2K7OA 1SSEB 3I5IB 3CLNA 3SG4A 1JFJA 3OHMB 1DT7B 1M46A 2H8VA 1TRFA 3PJIA 2KFFA 4ZCUA 1NX3A 1TUJA 2LM5A 1S6JA 3TDZA 4JWQA 1ZFSA 2LMVA 3BUOB 3CDNA 4MBEA 1PRWA 4MRXA 4A4CA 2M49B 3BUXB 3Q8IA 1KSOA 2M8UA 1YUSA 1CTRA 3DF0B 3L47A 1IQ3A 1CFFA 4MEWA 4YGBB 2FOTA 1DJXA 1F4QA 3SJSA 1DMOA 2LVKA 1OOHA 3V2LA 1SW8A 4JD9A 2OS8B 4PCWA 4P2YB 1OW4A 1DQEA 1SNLA 2K0JA 1OSAA 3B88A 3FS7A 2PVBA 3FIAA 1OMDA 2LMUA 3B87A 1NX2A 4GAOA 2M7NA 1HT9A 1LS8A 1U5IA 4ICBA 4IJ7A 3HCMA 3IQQA 2JU0A 3GOFA 1B7TY 1XFXO 4AOMA 1L2OC 2PRUA 1A75A 1ZMZA 2NCPA 3SS4A 1JWDA 1BF5A 3BYAA 4KYNA 1ORGA 2BAPA 4I5KA 1JBAA 4JQ0D 2GV5A 1OZSA 4WQ3A 4U8DA 5DKQA 5I2LA 2LAPA 5AEQA 1DELA 3JVTC 3CZ1A 3DVEA 3FWBA 1NIWA 1UP5A 5G08A 1B47A 1K90D 2QEVA 3O6BA 3AKAA 4M2QA 2B1UA 1OOFA 3SG5A 2CBLA 1SBJA 1VRKA 1NCYA 1RROA 5D7FA 5I8NA 4MSPA 1S1EA 4Q04A 2KNEA 1EXRA 1B8RA 3UNWA 3PM2A 1CNPA 2MA2A 2BCAA 2WC8A 1KWOB 2WCFA 5AFPA 1OZOA 2KQYA 2LP3A 2D8NA 3EKJA 4ORAB 1D1OA 2LCPA 2PASA 5HLOA 4C0KA 1Y0VH 1SL8A 2L2CA 3B7AA 3D76A 3SG2A 1K9KA 1QATA 1V1FA 3PATA 2H61C 2WCEA 3NGVA 4WRIA 2MLFC 3IVTA 2KAYA 1BR1B 4PE4A 2BKHB 3OB2B 2M1KB 1JF2A 5FI6A 1A4PA 1IG5A 4GNKB 3L4AA 1UHJA 1Y1XA 1XA5A 2KBMA 1TNQA 1JUOA 4NQGA 4ZCVA 1KK8B 2SCPA 2RGIA 3H4SE 4HRGA 4XJKB 3K21A 2AUCA 3DYEA 2I7AA 1JFKA 2KI4C 2M29A 4YGEB 5DKNA 2LMTA 2L98A 4N1FA 2CTNA 2V53A 4GGFC 1KQVA 3BOWB 2KAXA 1BR4B 1QV0A 3C1VA 3D74A 1RFJA 1IH0A 1PVBA 2K60A 1J1EA 2H2KA 1IGVA 2BE6A 2FCDA 3RM1A 1CFPA 3AAKA 3S0BA 3VROA 4PE7A 1J1DA 2EC6C 1AJ4A 3S0GA 1NP8A 2K7CA 1PSRA 1QWVA 3I5IC 3LK0A 2Y4QA 4M2OA 5FI7A 2ZRTA 1N2DA 2ZRSA 1HQVA 4CFRA 3NSOA 5I2QA 4OZDA 2GGZA 4MN0A 1QX5B 3TDUA 1KSMA 2GTEA 3CZTX 3D73A 1XK4A 3L4LA 2OPOA 1J7PA 1SL7A 2ZNDA 1KFUL 3R72A 2K7DA 4OVNF 1XFUO 1S26D 2JOJA 2QACA 1G4YR 1SRAA 1CFCA 2JPTA 2L4IA 1H8BA 5F6TA 2OS8C 1FBVA 3ZWHA 1SPYA 2WCJA 1TOPA 2M97A 3BFAA 1IIOA 2L0PA 3AAJA 2LHLA 3NSKA 1CFDA 2LV7A 1NCXA 4PHMA 2BBMA 1S5GY 3GK2A 2LUXA 4NDBA 1OOJA 2WCHA 2FJYA 1IWQA 5HLVA 1KK7Z 2QEOA 3I5FC 2JNXA 5CPVA 4DS7A 2BBNA 2PYQA 1NPQA 2WORA 3NXAA 2JWWA 2M9GA 2NCOA 3D77A 3PN7B 2ZKMX 4CLNA 1CKKA 5DICA 2Q4UA 5FYXA 1QVIY 3ZNIA 1Y1UA 3KHEA 3ICBA 3K1EA 1TNWA 2ZN8A 2F33A 1YRUB 2K8MB 1FI5A 4L9MA 2O60A 1YUTA 5KTYA 4OKHA 2AAOA 2HQ8A 1ALWA 1RJVA 3RLZA 2WCBA 3BJHA 1CM1A 1EL4A 1KWOC 2JT0A 3OP0A 1BU3A 5I2OA 3LL8B 1J7OA 4C0JA 1DF0A 5AXIA 2ISDA 1U5IB 2E30A 4INWA 2BNXA 3CS1A 5AERA 3N7HA 1G33A 3O78A 4MZKA 2P70A 1A75B 1YTZC 1NX0A 1Q80A 1IJ6A 3BXKA 1K9PA 2KAVA 2OTGB 2PALA 1LA3A 1EG3A 4GPLB 1DGUA 3DY9A 4USLA 4BY5A 5JJGA 3R1VA 4PT1A 1CDMA 1XFRA 3O4YA 2MJWB 1UHKA 3S0EA 3PALA 4YBHB 1KK8C 1QV1A 1DEKA 1KQMB 1UHNA 5PALA 3PM8A 2QEHA 1CLBA 2L5YA 1RECA 2PMYA 1LXFC 1P28A 4WQ2A 4ORBB 2LVIA 3BFHA 1W7JB 3O2PA 5I94A 2WC6A 4PHJA 2GGMA 1Y1AA 3F45A 1CB1A 1CDLA 1QASA 4CFQA 1N0YA 2KDHA 2Y1NA 4XYNA 3TS5B 2I94A 2DOQA 2ZNEA 2F3ZA 1AP4A 1OOGA 1OMVA 2F2OA 2JTZA 4DRWA 4PHNA 3A8RA 3EK8A 3JTDB 1OE9B 1EG4A 2LP2A 3SIBA 1B8LA 1TN4A 5BPJA 1S3PA 1T14A 1QXPA 2HPSA 4MVFA 1XFVO
chains in the Genus database with same CATH topology
1AUIB 1B7TZ 1K94A 1AHRA 1L7ZA 1KFXL 1TNXA 1FPWA 2L51A 5DKRA 3SIAA 1WRKA 1SCMB 1SL9A 2CCMA 1QLSA 4OCIA 3A4UB 4CPVA 1MXEA 1CMGA 2K2FA 1KFXS 2LLTA 1SYMA 5JOLA 4FQOA 5KU1A 3M0WA 4I5JA 1B4CA 2JT3A 3VRRA 1SY9A 1IKUA 1F55A 1JC2A 5HKYA 1QJTA 5HKZA 1MXLC 2SASA 1FW4A 1YUUA 3DVKA 1TIZA 1K8UA 2L4HA 1F71A 4TNCA 1K2HA 3PN7C 1WDCB 5CSIA 1SK6D 4YGDB 5IBWA 2KOTA 2Y5IA 1LKJA 2L2EA 5K89A 1DJHA 2FJUB 1ODBA 1XYDA 2BCBA 2ZN9A 3PFVA 3TUYB 4BY4A 1F54A 1MQ1A 3CTNA 5ER4X 1H4BA 2NZ0A 2E6WA 2KI6D 1YX7A 4PALA 4MLWA 1F70A 2F2PA 5GQQC 2CXJA 1B8CA 3GK1A 5TNCA 3BUNB 1JSAA 2I18A 5B8IB 3KO0A 1BMOA 1EJ3A 1G8IA 1AVSA 1SR6B 2K61A 2OTGC 1UWOA 2A4JA 4YI8A 1GQMA 1PK0D 3BUWB 4P5OE 2QPTA 5HYDA 2KFHA 2KYCA 2KQ6A 1DTLA 2JULA 4QJ5B 3LLEA 2R2IA 3D0YA 3CGAA 3WHUB 1KCYA 2WNDA 1QS7A 2LNKA 3GK4X 4N1GA 1KQMC 3VRPA 1J7QA 1QIWA 3CR2A 1TCFA 2M1UA 1CM4A 2EHBA 4HRHA 1DF0B 2AMIA 3EK4A 4NDCA 1J55A 2FCEA 1CDNA 3TS5C 1RWYA 1ZUZA 4HREE 3SG3A 3KF9A 1PVAA 1K93D 2H61A 3WHTB 3E3RA 1CMFA 2BCXA 1GGWA 3JTDC 3KPXA 1DJGA 2BE4A 3DVMA 1TCOB 2JXCA 1CDPA 1NSHA 3BUMB 2L5XB 4PHKA 2HQWA 1S5GZ 3VRNA 1C07A 1NCZA 1BG1A 3I5GB 5D69A 1LA0A 2CNPA 1WRLA 2G2BA 2LLSA 3CR4X 4GGNA 1SCMC 2LVVA 3SG6A 4AQIA 2VRGA 4GGFA 3IF7A 4FTGA 1ZOTB 3MSEB 1QVIZ 3EKHA 2KYFA 1YVLA 2M3WA 1A2XA 3BQ3A 3PSRA 2P6BB 2I2RE 4AQJA 2KHNA 4I5LB 4QJ4B 1WRZA 1F4OA 1MR8A 1IQ5A 2JNFA 1MHOA 1Y6WA 1XVJA 1K95A 2F8PA 3VRQA 1YR5A 1XK4C 1WDCC 3AKBA 1NYAA 1XFWO 4GFTA 4R1EA 3DF0A 4OV2A 3I5HB 4IL1A 4YGCB 2Y1MA 5KSZA 2KSPA 2MRDA 3WXAA 1QX2A 2KGBC 1A29A 3HX4A 1NUBA 3I5FB 4CIDA 3TUYC 3OB1B 3EVRA 1SMGA 1E8AA 1K9UA 1M63B 1A03A 4NDDA 1RTP1 1DJWA 1S6IA 2BL0B 2LE9B 2LHIA 1M31A 4MZLA 5AANA 2MBXA 4DIRA 5CSNA 1SCVA 4C0LA 2HF5A 2LANA 4GBAA 4YGAA 4DUQA 1UUSA 2K7BA 3TDIA 3EK7A 1IJ5A 1MUXA 1B9AA 1X02A 1ZACA 4F0ZB 2ZFDA 1J7RA 1SR6C 4E68A 2EGDA 4DCKA 1EH2A 1BODA 1FF1A 1K96A 1DJYA 1UHIA 1LVCD 3CR5X 1S6CA 4UPGA 4M2PA 3CWGA 3DVJA 3KEVA 4PDZA 1DJIA 5ER5A 2L50A 4I5NB 3OX5A 1GJYA 2WOSA 2CT9A 5J3XA 4A4BA 1V1GA 1BT6A 1XO5A 1CLLA 4QJ3B 1PSBA 2LUCA 1TNPA 1QTXA 1XFYO 5CSJA 2NLNA 3EVVA 4ETOA 2MHHA 1YX8A 1LINA 1OMRA 1WLZA 1AJ5A 1N65A 3IQOA 3OX6A 3TZ1A 2LC5A 1DJZA 1L2OB 1SKTA 1TTXA 3LK1A 3NSLA 4GUKA 2KGRA 2JRFA 2KBIA 1FI6A 1WLMA 1BLQA 1YRTB 2COLB 1WY9A 2PSRA 1NWDA 2BKIB 3JVTB 4D1EA 1B1GA 1MWNA 3EVUA 3D0YB 2IS9A 1PULA 2G9BA 1GGZA 2Q91A 3I5GC 4XJKA 1KK7Y 4MZJA 2JXLA 5HKWA 1F8HA 2LVJA 4MRYA 4YRUA 1W7IB 1QX7A 2F3YA 3BOWA 4YI9A 2BECA 1JF0A 1ALVA 1MF8B 2MAZA 3D10A 4JPZB 1CLMA 1YURA 1XFZO 1QIVA 5CSFA 2O5GA 2JZIA 2MLEC 2M7LA 1DVIA 3DD4A 4HSZA 3WNXB 2KI6C 2JC2A 1YVHA 1KFUS 2HETA 4PE0A 3QRXA 4OR9B 4ORCB 1DGVA 1PALA 1RK9A 3NSIA 2NXQA 3LCPC 1UHHA 2TN4A 1BOCA 1QLKA 1UURA 2JTTA 2K2AA 3PLFB 3I5HC 1C7VA 2KI4B 2LLUA 1OQPA 2JT8A 1R2UA 1S36A 1BJFA 1M39A 1AK8A 3FWCA 2M0RA 2JQ6A 3SG7A 2KFGA 2BL0C 1R6PA 1M45A 1IRJA 1NX1A 3VGOA 1C7WA 4N5XA 2EC6B 4PE1A 2K7OA 3I5IB 3CLNA 3SG4A 1JFJA 3OHMB 1DT7B 1M46A 1TRFA 2KFFA 4ZCUA 1NX3A 2LM5A 1S6JA 3TDZA 4JWQA 1ZFSA 2LMVA 3BUOB 4MBEA 1PRWA 4MRXA 4A4CA 2M49B 3BUXB 1IQ3A 1KSOA 2M8UA 1YUSA 1CTRA 3DF0B 1CFFA 4MEWA 4YGBB 2FOTA 1DJXA 1F4QA 3SJSA 1DMOA 2LVKA 1SW8A 2OS8B 4PCWA 4P2YB 1SNLA 2K0JA 1OSAA 3FS7A 2PVBA 3FIAA 1OMDA 2LMUA 4GAOA 1NX2A 2M7NA 1HT9A 1U5IA 4ICBA 3HCMA 3IQQA 2JU0A 3GOFA 1B7TY 1XFXO 4AOMA 1L2OC 2PRUA 1A75A 1ZMZA 2NCPA 1JWDA 1BF5A 3BYAA 4I5KA 4JQ0D 2GV5A 1OZSA 4WQ3A 4U8DA 5DKQA 5I2LA 2LAPA 5AEQA 3JVTC 3DVEA 3FWBA 5G08A 1NIWA 1UP5A 1B47A 1K90D 3O6BA 3AKAA 4M2QA 2B1UA 3SG5A 2CBLA 1SBJA 1VRKA 1NCYA 1RROA 5D7FA 5I8NA 4MSPA 1S1EA 4Q04A 2KNEA 1EXRA 1B8RA 1CNPA 2MA2A 2BCAA 2WC8A 1KWOB 2WCFA 5AFPA 1OZOA 2KQYA 2LP3A 2D8NA 3EKJA 4ORAB 1D1OA 2LCPA 2PASA 5HLOA 4C0KA 1Y0VH 1SL8A 3SG2A 1K9KA 1QATA 1V1FA 3PATA 2H61C 2WCEA 4WRIA 2MLFC 2KAYA 1BR1B 4PE4A 2BKHB 3OB2B 2M1KB 1JF2A 1A4PA 1IG5A 4GNKB 1UHJA 1Y1XA 1XA5A 2KBMA 1TNQA 1JUOA 4NQGA 4ZCVA 1KK8B 2SCPA 2RGIA 3H4SE 4HRGA 4XJKB 3K21A 2AUCA 1JBAA 2I7AA 1JFKA 2KI4C 2M29A 4YGEB 5DKNA 2LMTA 2L98A 4N1FA 2CTNA 2V53A 4GGFC 1KQVA 3BOWB 2KAXA 1BR4B 1QV0A 3C1VA 1IH0A 1RFJA 1PVBA 1J1EA 2H2KA 1IGVA 2BE6A 2FCDA 3RM1A 1CFPA 3AAKA 3VROA 4PE7A 1J1DA 2EC6C 1AJ4A 1NP8A 2K7CA 1PSRA 3I5IC 3LK0A 2Y4QA 4M2OA 2ZRTA 1N2DA 2ZRSA 1HQVA 4CFRA 3NSOA 5I2QA 2GGZA 4MN0A 1QX5B 3TDUA 1KSMA 3CZTX 1XK4A 2OPOA 1J7PA 1SL7A 2ZNDA 1KFUL 4OVNF 2K7DA 1XFUO 1S26D 2JOJA 2QACA 1G4YR 1SRAA 1CFCA 2JPTA 2L4IA 1H8BA 5F6TA 2OS8C 1FBVA 3ZWHA 1SPYA 1TOPA 2M97A 2L0PA 3AAJA 2LHLA 3NSKA 1CFDA 2LV7A 1NCXA 4PHMA 2BBMA 1S5GY 3GK2A 2LUXA 4NDBA 1OOJA 5HLVA 1IWQA 1KK7Z 3I5FC 2JNXA 5CPVA 4DS7A 2BBNA 1NPQA 2WORA 3NXAA 2JWWA 2M9GA 2NCOA 3PN7B 2ZKMX 4CLNA 1CKKA 2Q4UA 5FYXA 1QVIY 3ZNIA 1Y1UA 3KHEA 3ICBA 1TNWA 2ZN8A 2F33A 1YRUB 2K8MB 1FI5A 4L9MA 2O60A 1YUTA 5KTYA 4OKHA 2AAOA 2HQ8A 1ALWA 1RJVA 3RLZA 2WCBA 1CM1A 1EL4A 1KWOC 2JT0A 3OP0A 1BU3A 5I2OA 3LL8B 1J7OA 4C0JA 1DF0A 5AXIA 2ISDA 1U5IB 2E30A 3CS1A 5AERA 3O78A 1G33A 4MZKA 1A75B 1YTZC 1NX0A 1Q80A 1IJ6A 3BXKA 1K9PA 2KAVA 2OTGB 2PALA 1LA3A 1EG3A 4GPLB 1DGUA 4USLA 4BY5A 5JJGA 1CDMA 3O4YA 2MJWB 1UHKA 3PALA 4YBHB 1KK8C 1QV1A 1KQMB 1UHNA 5PALA 3PM8A 1CLBA 1RECA 2PMYA 1LXFC 4WQ2A 4ORBB 2LVIA 1W7JB 3O2PA 4PHJA 2GGMA 1Y1AA 3F45A 1CB1A 1CDLA 1QASA 4CFQA 1N0YA 2KDHA 2Y1NA 4XYNA 3TS5B 2I94A 2DOQA 2ZNEA 2F3ZA 1AP4A 1OMVA 2F2OA 2JTZA 4DRWA 4PHNA 3A8RA 3EK8A 3JTDB 1OE9B 1EG4A 2LP2A 3SIBA 1B8LA 1TN4A 5BPJA 1S3PA 4MVFA 1QXPA 2HPSA 1XFVO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUI B;  1B7T Z;  1K94 A;  1AHR A;  1L7Z A;  1KFX L;  1TNX A;  1FPW A;  2L51 A;  5DKR A;  3SIA A;  1WRK A;  1SCM B;  1SL9 A;  2CCM A;  1QLS A;  4OCI A;  3A4U B;  4CPV A;  1MXE A;  1CMG A;  2K2F A;  1KFX S;  2LLT A;  1SYM A;  5JOL A;  4FQO A;  5KU1 A;  3M0W A;  4I5J A;  1B4C A;  2JT3 A;  3VRR A;  1SY9 A;  1IKU A;  1F55 A;  1JC2 A;  5HKY A;  1QJT A;  5HKZ A;  1MXL C;  2SAS A;  1FW4 A;  1YUU A;  3DVK A;  1TIZ A;  1K8U A;  2L4H A;  1F71 A;  4TNC A;  1K2H A;  3PN7 C;  1WDC B;  5CSI A;  1SK6 D;  4YGD B;  5IBW A;  2KOT A;  2Y5I A;  1LKJ A;  2L2E A;  5K89 A;  1DJH A;  2FJU B;  1ODB A;  1XYD A;  2BCB A;  2ZN9 A;  3PFV A;  3TUY B;  4BY4 A;  1F54 A;  1MQ1 A;  3CTN A;  5ER4 X;  1H4B A;  2NZ0 A;  2E6W A;  2KI6 D;  1YX7 A;  4PAL A;  4MLW A;  1F70 A;  2F2P A;  5GQQ C;  2CXJ A;  1B8C A;  3GK1 A;  5TNC A;  3BUN B;  1JSA A;  2I18 A;  5B8I B;  3KO0 A;  1BMO A;  1EJ3 A;  1G8I A;  1AVS A;  1SR6 B;  2K61 A;  2OTG C;  1UWO A;  2A4J A;  4YI8 A;  1GQM A;  1PK0 D;  3BUW B;  4P5O E;  2QPT A;  5HYD A;  2KFH A;  2KYC A;  2KQ6 A;  1DTL A;  2JUL A;  4QJ5 B;  3LLE A;  2R2I A;  3D0Y A;  3CGA A;  3WHU B;  1KCY A;  2WND A;  1QS7 A;  2LNK A;  3GK4 X;  4N1G A;  1KQM C;  3VRP A;  1J7Q A;  1QIW A;  3CR2 A;  1TCF A;  2M1U A;  1CM4 A;  2EHB A;  4HRH A;  1DF0 B;  2AMI A;  3EK4 A;  4NDC A;  1J55 A;  2FCE A;  1CDN A;  3TS5 C;  1RWY A;  1ZUZ A;  4HRE E;  3SG3 A;  3KF9 A;  1PVA A;  1K93 D;  2H61 A;  3WHT B;  3E3R A;  1CMF A;  2BCX A;  1GGW A;  3JTD C;  3KPX A;  1DJG A;  2BE4 A;  3DVM A;  1TCO B;  2JXC A;  1CDP A;  1NSH A;  3BUM B;  2L5X B;  4PHK A;  2HQW A;  1S5G Z;  3VRN A;  1C07 A;  1NCZ A;  1BG1 A;  3I5G B;  5D69 A;  1LA0 A;  2CNP A;  1WRL A;  2G2B A;  2LLS A;  3CR4 X;  4GGN A;  1SCM C;  2LVV A;  3SG6 A;  4AQI A;  2VRG A;  4GGF A;  3IF7 A;  4FTG A;  1ZOT B;  3MSE B;  1QVI Z;  3EKH A;  2KYF A;  1YVL A;  2M3W A;  1A2X A;  3BQ3 A;  3PSR A;  2P6B B;  2I2R E;  4AQJ A;  2KHN A;  4I5L B;  4QJ4 B;  1WRZ A;  1F4O A;  1MR8 A;  1IQ5 A;  2JNF A;  1MHO A;  1Y6W A;  1XVJ A;  1K95 A;  2F8P A;  3VRQ A;  1YR5 A;  1XK4 C;  1WDC C;  3AKB A;  1NYA A;  1XFW O;  4GFT A;  4R1E A;  3DF0 A;  4OV2 A;  3I5H B;  4IL1 A;  4YGC B;  2Y1M A;  5KSZ A;  2KSP A;  2MRD A;  3WXA A;  1QX2 A;  2KGB C;  1A29 A;  3HX4 A;  1NUB A;  3I5F B;  4CID A;  3TUY C;  3OB1 B;  3EVR A;  1SMG A;  1E8A A;  1K9U A;  1M63 B;  1A03 A;  4NDD A;  1RTP 1;  1DJW A;  1S6I A;  2BL0 B;  2LE9 B;  2LHI A;  1M31 A;  4MZL A;  5AAN A;  2MBX A;  4DIR A;  5CSN A;  1SCV A;  4C0L A;  2HF5 A;  2LAN A;  4GBA A;  4YGA A;  4DUQ A;  1UUS A;  2K7B A;  3TDI A;  3EK7 A;  1IJ5 A;  1MUX A;  1B9A A;  1X02 A;  1ZAC A;  4F0Z B;  2ZFD A;  1J7R A;  1SR6 C;  4E68 A;  2EGD A;  4DCK A;  1EH2 A;  1BOD A;  1FF1 A;  1K96 A;  1DJY A;  1UHI A;  1LVC D;  3CR5 X;  1S6C A;  4UPG A;  4M2P A;  3CWG A;  3DVJ A;  3KEV A;  4PDZ A;  1DJI A;  5ER5 A;  2L50 A;  4I5N B;  3OX5 A;  1GJY A;  2WOS A;  2CT9 A;  5J3X A;  4A4B A;  1V1G A;  1BT6 A;  1XO5 A;  1CLL A;  4QJ3 B;  1PSB A;  2LUC A;  1TNP A;  1QTX A;  1XFY O;  5CSJ A;  2NLN A;  3EVV A;  4ETO A;  2MHH A;  1YX8 A;  1LIN A;  1OMR A;  1WLZ A;  1AJ5 A;  1N65 A;  3IQO A;  3OX6 A;  3TZ1 A;  2LC5 A;  1DJZ A;  1L2O B;  1SKT A;  1TTX A;  3LK1 A;  3NSL A;  4GUK A;  2KGR A;  2JRF A;  2KBI A;  1FI6 A;  1WLM A;  1BLQ A;  1YRT B;  2COL B;  1WY9 A;  2PSR A;  1NWD A;  2BKI B;  3JVT B;  4D1E A;  1B1G A;  1MWN A;  3EVU A;  3D0Y B;  2IS9 A;  1PUL A;  2G9B A;  1GGZ A;  2Q91 A;  3I5G C;  4XJK A;  1KK7 Y;  4MZJ A;  2JXL A;  5HKW A;  1F8H A;  2LVJ A;  4MRY A;  4YRU A;  1W7I B;  1QX7 A;  2F3Y A;  3BOW A;  4YI9 A;  2BEC A;  1JF0 A;  1ALV A;  1MF8 B;  2MAZ A;  3D10 A;  4JPZ B;  1CLM A;  1YUR A;  1XFZ O;  1QIV A;  5CSF A;  2O5G A;  2JZI A;  2MLE C;  2M7L A;  1DVI A;  3DD4 A;  4HSZ A;  3WNX B;  2KI6 C;  2JC2 A;  1YVH A;  1KFU S;  2HET A;  4PE0 A;  3QRX A;  4OR9 B;  4ORC B;  1DGV A;  1PAL A;  1RK9 A;  3NSI A;  2NXQ A;  3LCP C;  1UHH A;  2TN4 A;  1BOC A;  1QLK A;  1UUR A;  2JTT A;  2K2A A;  3PLF B;  3I5H C;  1C7V A;  2KI4 B;  2LLU A;  1OQP A;  2JT8 A;  1R2U A;  1S36 A;  1BJF A;  1M39 A;  1AK8 A;  3FWC A;  2M0R A;  2JQ6 A;  3SG7 A;  2KFG A;  2BL0 C;  1R6P A;  1M45 A;  1IRJ A;  1NX1 A;  3VGO A;  1C7W A;  4N5X A;  2EC6 B;  4PE1 A;  2K7O A;  3I5I B;  3CLN A;  3SG4 A;  1JFJ A;  3OHM B;  1DT7 B;  1M46 A;  1TRF A;  2KFF A;  4ZCU A;  1NX3 A;  2LM5 A;  1S6J A;  3TDZ A;  4JWQ A;  1ZFS A;  2LMV A;  3BUO B;  4MBE A;  1PRW A;  4MRX A;  4A4C A;  2M49 B;  3BUX B;  1IQ3 A;  1KSO A;  2M8U A;  1YUS A;  1CTR A;  3DF0 B;  1CFF A;  4MEW A;  4YGB B;  2FOT A;  1DJX A;  1F4Q A;  3SJS A;  1DMO A;  2LVK A;  1SW8 A;  2OS8 B;  4PCW A;  4P2Y B;  1SNL A;  2K0J A;  1OSA A;  3FS7 A;  2PVB A;  3FIA A;  1OMD A;  2LMU A;  4GAO A;  1NX2 A;  2M7N A;  1HT9 A;  1U5I A;  4ICB A;  3HCM A;  3IQQ A;  2JU0 A;  3GOF A;  1B7T Y;  1XFX O;  4AOM A;  1L2O C;  2PRU A;  1A75 A;  1ZMZ A;  2NCP A;  1JWD A;  1BF5 A;  3BYA A;  4I5K A;  4JQ0 D;  2GV5 A;  1OZS A;  4WQ3 A;  4U8D A;  5DKQ A;  5I2L A;  2LAP A;  5AEQ A;  3JVT C;  3DVE A;  3FWB A;  5G08 A;  1NIW A;  1UP5 A;  1B47 A;  1K90 D;  3O6B A;  3AKA A;  4M2Q A;  2B1U A;  3SG5 A;  2CBL A;  1SBJ A;  1VRK A;  1NCY A;  1RRO A;  5D7F A;  5I8N A;  4MSP A;  1S1E A;  4Q04 A;  2KNE A;  1EXR A;  1B8R A;  1CNP A;  2MA2 A;  2BCA A;  2WC8 A;  1KWO B;  2WCF A;  5AFP A;  1OZO A;  2KQY A;  2LP3 A;  2D8N A;  3EKJ A;  4ORA B;  1D1O A;  2LCP A;  2PAS A;  5HLO A;  4C0K A;  1Y0V H;  1SL8 A;  3SG2 A;  1K9K A;  1QAT A;  1V1F A;  3PAT A;  2H61 C;  2WCE A;  4WRI A;  2MLF C;  2KAY A;  1BR1 B;  4PE4 A;  2BKH B;  3OB2 B;  2M1K B;  1JF2 A;  1A4P A;  1IG5 A;  4GNK B;  1UHJ A;  1Y1X A;  1XA5 A;  2KBM A;  1TNQ A;  1JUO A;  4NQG A;  4ZCV A;  1KK8 B;  2SCP A;  2RGI A;  3H4S E;  4HRG A;  4XJK B;  3K21 A;  2AUC A;  1JBA A;  2I7A A;  1JFK A;  2KI4 C;  2M29 A;  4YGE B;  5DKN A;  2LMT A;  2L98 A;  4N1F A;  2CTN A;  2V53 A;  4GGF C;  1KQV A;  3BOW B;  2KAX A;  1BR4 B;  1QV0 A;  3C1V A;  1IH0 A;  1RFJ A;  1PVB A;  1J1E A;  2H2K A;  1IGV A;  2BE6 A;  2FCD A;  3RM1 A;  1CFP A;  3AAK A;  3VRO A;  4PE7 A;  1J1D A;  2EC6 C;  1AJ4 A;  1NP8 A;  2K7C A;  1PSR A;  3I5I C;  3LK0 A;  2Y4Q A;  4M2O A;  2ZRT A;  1N2D A;  2ZRS A;  1HQV A;  4CFR A;  3NSO A;  5I2Q A;  2GGZ A;  4MN0 A;  1QX5 B;  3TDU A;  1KSM A;  3CZT X;  1XK4 A;  2OPO A;  1J7P A;  1SL7 A;  2ZND A;  1KFU L;  4OVN F;  2K7D A;  1XFU O;  1S26 D;  2JOJ A;  2QAC A;  1G4Y R;  1SRA A;  1CFC A;  2JPT A;  2L4I A;  1H8B A;  5F6T A;  2OS8 C;  1FBV A;  3ZWH A;  1SPY A;  1TOP A;  2M97 A;  2L0P A;  3AAJ A;  2LHL A;  3NSK A;  1CFD A;  2LV7 A;  1NCX A;  4PHM A;  2BBM A;  1S5G Y;  3GK2 A;  2LUX A;  4NDB A;  1OOJ A;  5HLV A;  1IWQ A;  1KK7 Z;  3I5F C;  2JNX A;  5CPV A;  4DS7 A;  2BBN A;  1NPQ A;  2WOR A;  3NXA A;  2JWW A;  2M9G A;  2NCO A;  3PN7 B;  2ZKM X;  4CLN A;  1CKK A;  2Q4U A;  5FYX A;  1QVI Y;  3ZNI A;  1Y1U A;  3KHE A;  3ICB A;  1TNW A;  2ZN8 A;  2F33 A;  1YRU B;  2K8M B;  1FI5 A;  4L9M A;  2O60 A;  1YUT A;  5KTY A;  4OKH A;  2AAO A;  2HQ8 A;  1ALW A;  1RJV A;  3RLZ A;  2WCB A;  1CM1 A;  1EL4 A;  1KWO C;  2JT0 A;  3OP0 A;  1BU3 A;  5I2O A;  3LL8 B;  1J7O A;  4C0J A;  1DF0 A;  5AXI A;  2ISD A;  1U5I B;  2E30 A;  3CS1 A;  5AER A;  3O78 A;  1G33 A;  4MZK A;  1A75 B;  1YTZ C;  1NX0 A;  1Q80 A;  1IJ6 A;  3BXK A;  1K9P A;  2KAV A;  2OTG B;  2PAL A;  1LA3 A;  1EG3 A;  4GPL B;  1DGU A;  4USL A;  4BY5 A;  5JJG A;  1CDM A;  3O4Y A;  2MJW B;  1UHK A;  3PAL A;  4YBH B;  1KK8 C;  1QV1 A;  1KQM B;  1UHN A;  5PAL A;  3PM8 A;  1CLB A;  1REC A;  2PMY A;  1LXF C;  4WQ2 A;  4ORB B;  2LVI A;  1W7J B;  3O2P A;  4PHJ A;  2GGM A;  1Y1A A;  3F45 A;  1CB1 A;  1CDL A;  1QAS A;  4CFQ A;  1N0Y A;  2KDH A;  2Y1N A;  4XYN A;  3TS5 B;  2I94 A;  2DOQ A;  2ZNE A;  2F3Z A;  1AP4 A;  1OMV A;  2F2O A;  2JTZ A;  4DRW A;  4PHN A;  3A8R A;  3EK8 A;  3JTD B;  1OE9 B;  1EG4 A;  2LP2 A;  3SIB A;  1B8L A;  1TN4 A;  5BPJ A;  1S3P A;  4MVF A;  1QXP A;  2HPS A;  1XFV O; 
#chains in the Genus database with same CATH topology
 1AUI B;  1B7T Z;  1K94 A;  1AHR A;  1L7Z A;  1KFX L;  1TNX A;  1FPW A;  2L51 A;  5DKR A;  3SIA A;  1WRK A;  1SCM B;  1SL9 A;  3EG5 B;  2CCM A;  1QLS A;  4OCI A;  3A4U B;  4CPV A;  1MXE A;  1C3Y A;  2K2F A;  1KFX S;  2LLT A;  1CMG A;  1SYM A;  3B86 A;  5JOL A;  4AQI A;  4FQO A;  5KU1 A;  3M0W A;  4I5J A;  1B4C A;  2JT3 A;  3VRR A;  1SY9 A;  1IKU A;  1F55 A;  1JC2 A;  5HKY A;  1QJT A;  5HKZ A;  1MXL C;  2SAS A;  1FW4 A;  1YUU A;  3D78 A;  1TIZ A;  1K8U A;  2L4H A;  3DVK A;  1F71 A;  4TNC A;  1K2H A;  1TUZ A;  3PN7 C;  1WDC B;  1W9Z A;  3S0D A;  5CSI A;  1SK6 D;  4YGD B;  3VB1 A;  1Z2C B;  5IBW A;  1Z4H A;  1C3Z A;  2KOT A;  2Y5I A;  1LKJ A;  2L2E A;  5K89 A;  1DJH A;  2FJU B;  1ODB A;  1XYD A;  2BCB A;  2ZN9 A;  3PFV A;  3TUY B;  4BY4 A;  1F54 A;  1MQ1 A;  3CTN A;  5ER4 X;  1H4B A;  2NZ0 A;  2E6W A;  2KI6 D;  1GM0 A;  1YX7 A;  4PAL A;  3B6X A;  3RZS A;  4INX A;  4MLW A;  1F70 A;  2F2P A;  3O4X A;  5GQQ C;  2CXJ A;  1B8C A;  3GK1 A;  5TNC A;  3BUN B;  2KPH A;  1JSA A;  2I18 A;  5B8I B;  3KO0 A;  1BMO A;  1EJ3 A;  1G8I A;  1AVS A;  1SR6 B;  2K61 A;  2OTG C;  1UWO A;  2A4J A;  2KLD A;  4YI8 A;  1GQM A;  1PK0 D;  3BUW B;  3D75 A;  4P5O E;  2QPT A;  5HYD A;  2KFH A;  2KYC A;  2KQ6 A;  1DTL A;  2JUL A;  4QJ5 B;  3LLE A;  2R2I A;  3D0Y A;  3CGA A;  3WHU B;  1KCY A;  2WND A;  3CAB A;  1QS7 A;  2ERB A;  2LNK A;  3GK4 X;  4N1G A;  1KQM C;  3VRP A;  1J7Q A;  1QIW A;  3CR2 A;  1TCF A;  2M1U A;  1CM4 A;  2EHB A;  4HRH A;  1DF0 B;  2AMI A;  3EK4 A;  4NDC A;  2P71 A;  1J55 A;  2FCE A;  1CDN A;  3TS5 C;  1RWY A;  1ZUZ A;  3CZ0 A;  4HRE E;  1DC1 A;  3BFB A;  3SG3 A;  3KF9 A;  1PVA A;  1K93 D;  2H61 A;  3WHT B;  3E3R A;  1CMF A;  2BCX A;  4F7F A;  1GGW A;  3JTD C;  3KPX A;  1DJG A;  2BE4 A;  3DVM A;  1TCO B;  2JXC A;  1CDP A;  1NSH A;  3BUM B;  2L5X B;  4FQT A;  2HQW A;  4PHK A;  1S5G Z;  3VRN A;  1C07 A;  1NCZ A;  1BG1 A;  3I5G B;  5D69 A;  1LA0 A;  2CNP A;  1WRL A;  2G2B A;  2LLS A;  3CR4 X;  3OBV A;  1SCM C;  2LVV A;  3R1P A;  4GGN A;  2VRG A;  3SG6 A;  4GGF A;  5FI2 A;  3IF7 A;  4FTG A;  2PQL A;  1ZOT B;  3MSE B;  1QVI Z;  3EKH A;  2KYF A;  1YVL A;  2M3W A;  1A2X A;  3BQ3 A;  3PSR A;  2P6B B;  2I2R E;  4AQJ A;  2KHN A;  4I5L B;  4QJ4 B;  1WRZ A;  1F4O A;  1MR8 A;  2WCL A;  1IQ5 A;  2JNF A;  3FE6 A;  3R1O A;  1MHO A;  1TWO A;  1Y6W A;  1XVJ A;  1K95 A;  2F8P A;  3UO9 A;  3VRQ A;  1YR5 A;  1XK4 C;  1WDC C;  3AKB A;  1NYA A;  1XFW O;  4GFT A;  4R1E A;  3S0F A;  3DF0 A;  4OV2 A;  3I5H B;  4IL1 A;  4YGC B;  2Y1M A;  3CZ2 A;  2KSP A;  2MRD A;  3WXA A;  1QX2 A;  5KSZ A;  2KGB C;  1A29 A;  3HX4 A;  1NUB A;  3I5F B;  4CID A;  3TUY C;  3OB1 B;  3EVR A;  1SMG A;  1E8A A;  3SS5 A;  1K9U A;  1M63 B;  1A03 A;  4NDD A;  1RTP 1;  1DJW A;  1S6I A;  2BL0 B;  2LE9 B;  2LHI A;  3DXL A;  1M31 A;  3OGN A;  4MZL A;  5AAN A;  2MBX A;  4DIR A;  5CSN A;  1SCV A;  4C0L A;  2HF5 A;  2LAN A;  4GBA A;  4YGA A;  4DUQ A;  1UUS A;  2K7B A;  3TDI A;  3EK7 A;  5EL2 A;  1IJ5 A;  1MUX A;  1B9A A;  1X02 A;  1ZAC A;  4F0Z B;  2ZFD A;  1J7R A;  1SR6 C;  3DZT A;  4E68 A;  2EGD A;  4DCK A;  2JPO A;  1EH2 A;  1BOD A;  1FF1 A;  1K96 A;  1DJY A;  1UHI A;  1LVC D;  3CR5 X;  1S6C A;  4UPG A;  4M2P A;  3CWG A;  3DVJ A;  3KEV A;  4PDZ A;  1DJI A;  5ER5 A;  2L50 A;  3SS3 A;  4I5N B;  3OX5 A;  1GJY A;  2WOS A;  2CT9 A;  5J3X A;  4A4B A;  1V1G A;  1BT6 A;  1XO5 A;  1CLL A;  4QJ3 B;  1PSB A;  2LUC A;  1TNP A;  1QTX A;  1XFY O;  5CSJ A;  2NLN A;  3EVV A;  3FE8 A;  4ETO A;  2MHH A;  1YX8 A;  2WCK A;  1LIN A;  1OMR A;  1WLZ A;  1AJ5 A;  1N65 A;  3IQO A;  3OX6 A;  3TZ1 A;  2LC5 A;  1DJZ A;  1L2O B;  1SKT A;  1TTX A;  3LK1 A;  3NSL A;  4GUK A;  2KGR A;  3CYZ A;  2JRF A;  2KBI A;  1FI6 A;  1WLM A;  5HL1 A;  1BLQ A;  1YRT B;  2COL B;  1WY9 A;  2PSR A;  1NWD A;  2BKI B;  2WC5 A;  2WCM A;  3JVT B;  1MWN A;  4D1E A;  1B1G A;  3EVU A;  3D0Y B;  2IS9 A;  1PUL A;  2G9B A;  1GGZ A;  2Q91 A;  3I5G C;  4XJK A;  3QME A;  3S0A A;  1KK7 Y;  4MZJ A;  2JXL A;  5HKW A;  1F8H A;  2LVJ A;  4MRY A;  4YRU A;  1W7I B;  1QX7 A;  2F3Y A;  3BOW A;  4YI9 A;  2BEC A;  1JF0 A;  1ALV A;  1MF8 B;  2MAZ A;  2QDI A;  3D10 A;  4JPZ B;  1CLM A;  2YGU A;  1YUR A;  1XFZ O;  1QIV A;  5CSF A;  1OOI X;  2O5G A;  2JZI A;  2MLE C;  2M7L A;  1DVI A;  3DD4 A;  4HSZ A;  3WNX B;  2KI6 C;  2JC2 A;  1YVH A;  3FE9 A;  1KFU S;  2HET A;  4PE0 A;  3QRX A;  4OR9 B;  4ORC B;  1DGV A;  1PAL A;  1RK9 A;  3NSI A;  5D3O A;  2NXQ A;  3LCP C;  1UHH A;  2TN4 A;  1BOC A;  1QLK A;  1UUR A;  2JTT A;  2K2A A;  3PLF B;  3I5H C;  1C7V A;  2KI4 B;  2LLU A;  1OQP A;  2JT8 A;  1R2U A;  2QEB A;  1S36 A;  1BJF A;  1M39 A;  1AK8 A;  3FWC A;  2KLE A;  2M0R A;  2JQ6 A;  4JKT A;  3SG7 A;  2KFG A;  2BL0 C;  1R6P A;  3NHI A;  1M45 A;  1IRJ A;  1NX1 A;  3VGO A;  1C7W A;  4N5X A;  2EC6 B;  4PE1 A;  3NHT A;  2K7O A;  1SSE B;  3I5I B;  3CLN A;  3SG4 A;  1JFJ A;  3OHM B;  1DT7 B;  1M46 A;  2H8V A;  1TRF A;  3PJI A;  2KFF A;  4ZCU A;  1NX3 A;  1TUJ A;  2LM5 A;  1S6J A;  3TDZ A;  4JWQ A;  1ZFS A;  2LMV A;  3BUO B;  3CDN A;  4MBE A;  1PRW A;  4MRX A;  4A4C A;  2M49 B;  3BUX B;  3Q8I A;  1KSO A;  2M8U A;  1YUS A;  1CTR A;  3DF0 B;  3L47 A;  1IQ3 A;  1CFF A;  4MEW A;  4YGB B;  2FOT A;  1DJX A;  1F4Q A;  3SJS A;  1DMO A;  2LVK A;  1OOH A;  3V2L A;  1SW8 A;  4JD9 A;  2OS8 B;  4PCW A;  4P2Y B;  1OW4 A;  1DQE A;  1SNL A;  2K0J A;  1OSA A;  3B88 A;  3FS7 A;  2PVB A;  3FIA A;  1OMD A;  2LMU A;  3B87 A;  1NX2 A;  4GAO A;  2M7N A;  1HT9 A;  1LS8 A;  1U5I A;  4ICB A;  4IJ7 A;  3HCM A;  3IQQ A;  2JU0 A;  3GOF A;  1B7T Y;  1XFX O;  4AOM A;  1L2O C;  2PRU A;  1A75 A;  1ZMZ A;  2NCP A;  3SS4 A;  1JWD A;  1BF5 A;  3BYA A;  4KYN A;  1ORG A;  2BAP A;  4I5K A;  1JBA A;  4JQ0 D;  2GV5 A;  1OZS A;  4WQ3 A;  4U8D A;  5DKQ A;  5I2L A;  2LAP A;  5AEQ A;  1DEL A;  3JVT C;  3CZ1 A;  3DVE A;  3FWB A;  1NIW A;  1UP5 A;  5G08 A;  1B47 A;  1K90 D;  2QEV A;  3O6B A;  3AKA A;  4M2Q A;  2B1U A;  1OOF A;  3SG5 A;  2CBL A;  1SBJ A;  1VRK A;  1NCY A;  1RRO A;  5D7F A;  5I8N A;  4MSP A;  1S1E A;  4Q04 A;  2KNE A;  1EXR A;  1B8R A;  3UNW A;  3PM2 A;  1CNP A;  2MA2 A;  2BCA A;  2WC8 A;  1KWO B;  2WCF A;  5AFP A;  1OZO A;  2KQY A;  2LP3 A;  2D8N A;  3EKJ A;  4ORA B;  1D1O A;  2LCP A;  2PAS A;  5HLO A;  4C0K A;  1Y0V H;  1SL8 A;  2L2C A;  3B7A A;  3D76 A;  3SG2 A;  1K9K A;  1QAT A;  1V1F A;  3PAT A;  2H61 C;  2WCE A;  3NGV A;  4WRI A;  2MLF C;  3IVT A;  2KAY A;  1BR1 B;  4PE4 A;  2BKH B;  3OB2 B;  2M1K B;  1JF2 A;  5FI6 A;  1A4P A;  1IG5 A;  4GNK B;  3L4A A;  1UHJ A;  1Y1X A;  1XA5 A;  2KBM A;  1TNQ A;  1JUO A;  4NQG A;  4ZCV A;  1KK8 B;  2SCP A;  2RGI A;  3H4S E;  4HRG A;  4XJK B;  3K21 A;  2AUC A;  3DYE A;  2I7A A;  1JFK A;  2KI4 C;  2M29 A;  4YGE B;  5DKN A;  2LMT A;  2L98 A;  4N1F A;  2CTN A;  2V53 A;  4GGF C;  1KQV A;  3BOW B;  2KAX A;  1BR4 B;  1QV0 A;  3C1V A;  3D74 A;  1RFJ A;  1IH0 A;  1PVB A;  2K60 A;  1J1E A;  2H2K A;  1IGV A;  2BE6 A;  2FCD A;  3RM1 A;  1CFP A;  3AAK A;  3S0B A;  3VRO A;  4PE7 A;  1J1D A;  2EC6 C;  1AJ4 A;  3S0G A;  1NP8 A;  2K7C A;  1PSR A;  1QWV A;  3I5I C;  3LK0 A;  2Y4Q A;  4M2O A;  5FI7 A;  2ZRT A;  1N2D A;  2ZRS A;  1HQV A;  4CFR A;  3NSO A;  5I2Q A;  4OZD A;  2GGZ A;  4MN0 A;  1QX5 B;  3TDU A;  1KSM A;  2GTE A;  3CZT X;  3D73 A;  1XK4 A;  3L4L A;  2OPO A;  1J7P A;  1SL7 A;  2ZND A;  1KFU L;  3R72 A;  2K7D A;  4OVN F;  1XFU O;  1S26 D;  2JOJ A;  2QAC A;  1G4Y R;  1SRA A;  1CFC A;  2JPT A;  2L4I A;  1H8B A;  5F6T A;  2OS8 C;  1FBV A;  3ZWH A;  1SPY A;  2WCJ A;  1TOP A;  2M97 A;  3BFA A;  1IIO A;  2L0P A;  3AAJ A;  2LHL A;  3NSK A;  1CFD A;  2LV7 A;  1NCX A;  4PHM A;  2BBM A;  1S5G Y;  3GK2 A;  2LUX A;  4NDB A;  1OOJ A;  2WCH A;  2FJY A;  1IWQ A;  5HLV A;  1KK7 Z;  2QEO A;  3I5F C;  2JNX A;  5CPV A;  4DS7 A;  2BBN A;  2PYQ A;  1NPQ A;  2WOR A;  3NXA A;  2JWW A;  2M9G A;  2NCO A;  3D77 A;  3PN7 B;  2ZKM X;  4CLN A;  1CKK A;  5DIC A;  2Q4U A;  5FYX A;  1QVI Y;  3ZNI A;  1Y1U A;  3KHE A;  3ICB A;  3K1E A;  1TNW A;  2ZN8 A;  2F33 A;  1YRU B;  2K8M B;  1FI5 A;  4L9M A;  2O60 A;  1YUT A;  5KTY A;  4OKH A;  2AAO A;  2HQ8 A;  1ALW A;  1RJV A;  3RLZ A;  2WCB A;  3BJH A;  1CM1 A;  1EL4 A;  1KWO C;  2JT0 A;  3OP0 A;  1BU3 A;  5I2O A;  3LL8 B;  1J7O A;  4C0J A;  1DF0 A;  5AXI A;  2ISD A;  1U5I B;  2E30 A;  4INW A;  2BNX A;  3CS1 A;  5AER A;  3N7H A;  1G33 A;  3O78 A;  4MZK A;  2P70 A;  1A75 B;  1YTZ C;  1NX0 A;  1Q80 A;  1IJ6 A;  3BXK A;  1K9P A;  2KAV A;  2OTG B;  2PAL A;  1LA3 A;  1EG3 A;  4GPL B;  1DGU A;  3DY9 A;  4USL A;  4BY5 A;  5JJG A;  3R1V A;  4PT1 A;  1CDM A;  1XFR A;  3O4Y A;  2MJW B;  1UHK A;  3S0E A;  3PAL A;  4YBH B;  1KK8 C;  1QV1 A;  1DEK A;  1KQM B;  1UHN A;  5PAL A;  3PM8 A;  2QEH A;  1CLB A;  2L5Y A;  1REC A;  2PMY A;  1LXF C;  1P28 A;  4WQ2 A;  4ORB B;  2LVI A;  3BFH A;  1W7J B;  3O2P A;  5I94 A;  2WC6 A;  4PHJ A;  2GGM A;  1Y1A A;  3F45 A;  1CB1 A;  1CDL A;  1QAS A;  4CFQ A;  1N0Y A;  2KDH A;  2Y1N A;  4XYN A;  3TS5 B;  2I94 A;  2DOQ A;  2ZNE A;  2F3Z A;  1AP4 A;  1OOG A;  1OMV A;  2F2O A;  2JTZ A;  4DRW A;  4PHN A;  3A8R A;  3EK8 A;  3JTD B;  1OE9 B;  1EG4 A;  2LP2 A;  3SIB A;  1B8L A;  1TN4 A;  5BPJ A;  1S3P A;  1T14 A;  1QXP A;  2HPS A;  4MVF A;  1XFV O; 
#chains in the Genus database with same CATH homology
 1AUI B;  1B7T Z;  1K94 A;  1AHR A;  1L7Z A;  1KFX L;  1TNX A;  1FPW A;  2L51 A;  5DKR A;  3SIA A;  1WRK A;  1SCM B;  1SL9 A;  2CCM A;  1QLS A;  4OCI A;  3A4U B;  4CPV A;  1MXE A;  1CMG A;  2K2F A;  1KFX S;  2LLT A;  1SYM A;  5JOL A;  4FQO A;  5KU1 A;  3M0W A;  4I5J A;  1B4C A;  2JT3 A;  3VRR A;  1SY9 A;  1IKU A;  1F55 A;  1JC2 A;  5HKY A;  1QJT A;  5HKZ A;  1MXL C;  2SAS A;  1FW4 A;  1YUU A;  3DVK A;  1TIZ A;  1K8U A;  2L4H A;  1F71 A;  4TNC A;  1K2H A;  3PN7 C;  1WDC B;  5CSI A;  1SK6 D;  4YGD B;  5IBW A;  2KOT A;  2Y5I A;  1LKJ A;  2L2E A;  5K89 A;  1DJH A;  2FJU B;  1ODB A;  1XYD A;  2BCB A;  2ZN9 A;  3PFV A;  3TUY B;  4BY4 A;  1F54 A;  1MQ1 A;  3CTN A;  5ER4 X;  1H4B A;  2NZ0 A;  2E6W A;  2KI6 D;  1YX7 A;  4PAL A;  4MLW A;  1F70 A;  2F2P A;  5GQQ C;  2CXJ A;  1B8C A;  3GK1 A;  5TNC A;  3BUN B;  1JSA A;  2I18 A;  5B8I B;  3KO0 A;  1BMO A;  1EJ3 A;  1G8I A;  1AVS A;  1SR6 B;  2K61 A;  2OTG C;  1UWO A;  2A4J A;  4YI8 A;  1GQM A;  1PK0 D;  3BUW B;  4P5O E;  2QPT A;  5HYD A;  2KFH A;  2KYC A;  2KQ6 A;  1DTL A;  2JUL A;  4QJ5 B;  3LLE A;  2R2I A;  3D0Y A;  3CGA A;  3WHU B;  1KCY A;  2WND A;  1QS7 A;  2LNK A;  3GK4 X;  4N1G A;  1KQM C;  3VRP A;  1J7Q A;  1QIW A;  3CR2 A;  1TCF A;  2M1U A;  1CM4 A;  2EHB A;  4HRH A;  1DF0 B;  2AMI A;  3EK4 A;  4NDC A;  1J55 A;  2FCE A;  1CDN A;  3TS5 C;  1RWY A;  1ZUZ A;  4HRE E;  3SG3 A;  3KF9 A;  1PVA A;  1K93 D;  2H61 A;  3WHT B;  3E3R A;  1CMF A;  2BCX A;  1GGW A;  3JTD C;  3KPX A;  1DJG A;  2BE4 A;  3DVM A;  1TCO B;  2JXC A;  1CDP A;  1NSH A;  3BUM B;  2L5X B;  4PHK A;  2HQW A;  1S5G Z;  3VRN A;  1C07 A;  1NCZ A;  1BG1 A;  3I5G B;  5D69 A;  1LA0 A;  2CNP A;  1WRL A;  2G2B A;  2LLS A;  3CR4 X;  4GGN A;  1SCM C;  2LVV A;  3SG6 A;  4AQI A;  2VRG A;  4GGF A;  3IF7 A;  4FTG A;  1ZOT B;  3MSE B;  1QVI Z;  3EKH A;  2KYF A;  1YVL A;  2M3W A;  1A2X A;  3BQ3 A;  3PSR A;  2P6B B;  2I2R E;  4AQJ A;  2KHN A;  4I5L B;  4QJ4 B;  1WRZ A;  1F4O A;  1MR8 A;  1IQ5 A;  2JNF A;  1MHO A;  1Y6W A;  1XVJ A;  1K95 A;  2F8P A;  3VRQ A;  1YR5 A;  1XK4 C;  1WDC C;  3AKB A;  1NYA A;  1XFW O;  4GFT A;  4R1E A;  3DF0 A;  4OV2 A;  3I5H B;  4IL1 A;  4YGC B;  2Y1M A;  5KSZ A;  2KSP A;  2MRD A;  3WXA A;  1QX2 A;  2KGB C;  1A29 A;  3HX4 A;  1NUB A;  3I5F B;  4CID A;  3TUY C;  3OB1 B;  3EVR A;  1SMG A;  1E8A A;  1K9U A;  1M63 B;  1A03 A;  4NDD A;  1RTP 1;  1DJW A;  1S6I A;  2BL0 B;  2LE9 B;  2LHI A;  1M31 A;  4MZL A;  5AAN A;  2MBX A;  4DIR A;  5CSN A;  1SCV A;  4C0L A;  2HF5 A;  2LAN A;  4GBA A;  4YGA A;  4DUQ A;  1UUS A;  2K7B A;  3TDI A;  3EK7 A;  1IJ5 A;  1MUX A;  1B9A A;  1X02 A;  1ZAC A;  4F0Z B;  2ZFD A;  1J7R A;  1SR6 C;  4E68 A;  2EGD A;  4DCK A;  1EH2 A;  1BOD A;  1FF1 A;  1K96 A;  1DJY A;  1UHI A;  1LVC D;  3CR5 X;  1S6C A;  4UPG A;  4M2P A;  3CWG A;  3DVJ A;  3KEV A;  4PDZ A;  1DJI A;  5ER5 A;  2L50 A;  4I5N B;  3OX5 A;  1GJY A;  2WOS A;  2CT9 A;  5J3X A;  4A4B A;  1V1G A;  1BT6 A;  1XO5 A;  1CLL A;  4QJ3 B;  1PSB A;  2LUC A;  1TNP A;  1QTX A;  1XFY O;  5CSJ A;  2NLN A;  3EVV A;  4ETO A;  2MHH A;  1YX8 A;  1LIN A;  1OMR A;  1WLZ A;  1AJ5 A;  1N65 A;  3IQO A;  3OX6 A;  3TZ1 A;  2LC5 A;  1DJZ A;  1L2O B;  1SKT A;  1TTX A;  3LK1 A;  3NSL A;  4GUK A;  2KGR A;  2JRF A;  2KBI A;  1FI6 A;  1WLM A;  1BLQ A;  1YRT B;  2COL B;  1WY9 A;  2PSR A;  1NWD A;  2BKI B;  3JVT B;  4D1E A;  1B1G A;  1MWN A;  3EVU A;  3D0Y B;  2IS9 A;  1PUL A;  2G9B A;  1GGZ A;  2Q91 A;  3I5G C;  4XJK A;  1KK7 Y;  4MZJ A;  2JXL A;  5HKW A;  1F8H A;  2LVJ A;  4MRY A;  4YRU A;  1W7I B;  1QX7 A;  2F3Y A;  3BOW A;  4YI9 A;  2BEC A;  1JF0 A;  1ALV A;  1MF8 B;  2MAZ A;  3D10 A;  4JPZ B;  1CLM A;  1YUR A;  1XFZ O;  1QIV A;  5CSF A;  2O5G A;  2JZI A;  2MLE C;  2M7L A;  1DVI A;  3DD4 A;  4HSZ A;  3WNX B;  2KI6 C;  2JC2 A;  1YVH A;  1KFU S;  2HET A;  4PE0 A;  3QRX A;  4OR9 B;  4ORC B;  1DGV A;  1PAL A;  1RK9 A;  3NSI A;  2NXQ A;  3LCP C;  1UHH A;  2TN4 A;  1BOC A;  1QLK A;  1UUR A;  2JTT A;  2K2A A;  3PLF B;  3I5H C;  1C7V A;  2KI4 B;  2LLU A;  1OQP A;  2JT8 A;  1R2U A;  1S36 A;  1BJF A;  1M39 A;  1AK8 A;  3FWC A;  2M0R A;  2JQ6 A;  3SG7 A;  2KFG A;  2BL0 C;  1R6P A;  1M45 A;  1IRJ A;  1NX1 A;  3VGO A;  1C7W A;  4N5X A;  2EC6 B;  4PE1 A;  2K7O A;  3I5I B;  3CLN A;  3SG4 A;  1JFJ A;  3OHM B;  1DT7 B;  1M46 A;  1TRF A;  2KFF A;  4ZCU A;  1NX3 A;  2LM5 A;  1S6J A;  3TDZ A;  4JWQ A;  1ZFS A;  2LMV A;  3BUO B;  4MBE A;  1PRW A;  4MRX A;  4A4C A;  2M49 B;  3BUX B;  1IQ3 A;  1KSO A;  2M8U A;  1YUS A;  1CTR A;  3DF0 B;  1CFF A;  4MEW A;  4YGB B;  2FOT A;  1DJX A;  1F4Q A;  3SJS A;  1DMO A;  2LVK A;  1SW8 A;  2OS8 B;  4PCW A;  4P2Y B;  1SNL A;  2K0J A;  1OSA A;  3FS7 A;  2PVB A;  3FIA A;  1OMD A;  2LMU A;  4GAO A;  1NX2 A;  2M7N A;  1HT9 A;  1U5I A;  4ICB A;  3HCM A;  3IQQ A;  2JU0 A;  3GOF A;  1B7T Y;  1XFX O;  4AOM A;  1L2O C;  2PRU A;  1A75 A;  1ZMZ A;  2NCP A;  1JWD A;  1BF5 A;  3BYA A;  4I5K A;  4JQ0 D;  2GV5 A;  1OZS A;  4WQ3 A;  4U8D A;  5DKQ A;  5I2L A;  2LAP A;  5AEQ A;  3JVT C;  3DVE A;  3FWB A;  5G08 A;  1NIW A;  1UP5 A;  1B47 A;  1K90 D;  3O6B A;  3AKA A;  4M2Q A;  2B1U A;  3SG5 A;  2CBL A;  1SBJ A;  1VRK A;  1NCY A;  1RRO A;  5D7F A;  5I8N A;  4MSP A;  1S1E A;  4Q04 A;  2KNE A;  1EXR A;  1B8R A;  1CNP A;  2MA2 A;  2BCA A;  2WC8 A;  1KWO B;  2WCF A;  5AFP A;  1OZO A;  2KQY A;  2LP3 A;  2D8N A;  3EKJ A;  4ORA B;  1D1O A;  2LCP A;  2PAS A;  5HLO A;  4C0K A;  1Y0V H;  1SL8 A;  3SG2 A;  1K9K A;  1QAT A;  1V1F A;  3PAT A;  2H61 C;  2WCE A;  4WRI A;  2MLF C;  2KAY A;  1BR1 B;  4PE4 A;  2BKH B;  3OB2 B;  2M1K B;  1JF2 A;  1A4P A;  1IG5 A;  4GNK B;  1UHJ A;  1Y1X A;  1XA5 A;  2KBM A;  1TNQ A;  1JUO A;  4NQG A;  4ZCV A;  1KK8 B;  2SCP A;  2RGI A;  3H4S E;  4HRG A;  4XJK B;  3K21 A;  2AUC A;  1JBA A;  2I7A A;  1JFK A;  2KI4 C;  2M29 A;  4YGE B;  5DKN A;  2LMT A;  2L98 A;  4N1F A;  2CTN A;  2V53 A;  4GGF C;  1KQV A;  3BOW B;  2KAX A;  1BR4 B;  1QV0 A;  3C1V A;  1IH0 A;  1RFJ A;  1PVB A;  1J1E A;  2H2K A;  1IGV A;  2BE6 A;  2FCD A;  3RM1 A;  1CFP A;  3AAK A;  3VRO A;  4PE7 A;  1J1D A;  2EC6 C;  1AJ4 A;  1NP8 A;  2K7C A;  1PSR A;  3I5I C;  3LK0 A;  2Y4Q A;  4M2O A;  2ZRT A;  1N2D A;  2ZRS A;  1HQV A;  4CFR A;  3NSO A;  5I2Q A;  2GGZ A;  4MN0 A;  1QX5 B;  3TDU A;  1KSM A;  3CZT X;  1XK4 A;  2OPO A;  1J7P A;  1SL7 A;  2ZND A;  1KFU L;  4OVN F;  2K7D A;  1XFU O;  1S26 D;  2JOJ A;  2QAC A;  1G4Y R;  1SRA A;  1CFC A;  2JPT A;  2L4I A;  1H8B A;  5F6T A;  2OS8 C;  1FBV A;  3ZWH A;  1SPY A;  1TOP A;  2M97 A;  2L0P A;  3AAJ A;  2LHL A;  3NSK A;  1CFD A;  2LV7 A;  1NCX A;  4PHM A;  2BBM A;  1S5G Y;  3GK2 A;  2LUX A;  4NDB A;  1OOJ A;  5HLV A;  1IWQ A;  1KK7 Z;  3I5F C;  2JNX A;  5CPV A;  4DS7 A;  2BBN A;  1NPQ A;  2WOR A;  3NXA A;  2JWW A;  2M9G A;  2NCO A;  3PN7 B;  2ZKM X;  4CLN A;  1CKK A;  2Q4U A;  5FYX A;  1QVI Y;  3ZNI A;  1Y1U A;  3KHE A;  3ICB A;  1TNW A;  2ZN8 A;  2F33 A;  1YRU B;  2K8M B;  1FI5 A;  4L9M A;  2O60 A;  1YUT A;  5KTY A;  4OKH A;  2AAO A;  2HQ8 A;  1ALW A;  1RJV A;  3RLZ A;  2WCB A;  1CM1 A;  1EL4 A;  1KWO C;  2JT0 A;  3OP0 A;  1BU3 A;  5I2O A;  3LL8 B;  1J7O A;  4C0J A;  1DF0 A;  5AXI A;  2ISD A;  1U5I B;  2E30 A;  3CS1 A;  5AER A;  3O78 A;  1G33 A;  4MZK A;  1A75 B;  1YTZ C;  1NX0 A;  1Q80 A;  1IJ6 A;  3BXK A;  1K9P A;  2KAV A;  2OTG B;  2PAL A;  1LA3 A;  1EG3 A;  4GPL B;  1DGU A;  4USL A;  4BY5 A;  5JJG A;  1CDM A;  3O4Y A;  2MJW B;  1UHK A;  3PAL A;  4YBH B;  1KK8 C;  1QV1 A;  1KQM B;  1UHN A;  5PAL A;  3PM8 A;  1CLB A;  1REC A;  2PMY A;  1LXF C;  4WQ2 A;  4ORB B;  2LVI A;  1W7J B;  3O2P A;  4PHJ A;  2GGM A;  1Y1A A;  3F45 A;  1CB1 A;  1CDL A;  1QAS A;  4CFQ A;  1N0Y A;  2KDH A;  2Y1N A;  4XYN A;  3TS5 B;  2I94 A;  2DOQ A;  2ZNE A;  2F3Z A;  1AP4 A;  1OMV A;  2F2O A;  2JTZ A;  4DRW A;  4PHN A;  3A8R A;  3EK8 A;  3JTD B;  1OE9 B;  1EG4 A;  2LP2 A;  3SIB A;  1B8L A;  1TN4 A;  5BPJ A;  1S3P A;  4MVF A;  1QXP A;  2HPS A;  1XFV O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...