1IWQA

Crystal structure of marcks calmodulin binding domain peptide complexed with ca2+/calmodulin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
143
structure length
139
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a MARCKS peptide containing the calmodulin-binding domain in complex with Ca(2+)-calmodulin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/protein binding
molecule keywords CALMODULIN
total genus 52
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iwqA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iwqA02
1KQVA 1KK8B 2I94A 5GQQC 1PVAA 3FIAA 4ETOA 2BCXA 2BKHB 2E6WA 1DT7B 1CDNA 1YURA 4UPGA 5D7FA 1OSAA 1J1EA 5AANA 5HYDA 1ALVA 4PDZA 5CSNA 1XFZO 1GGZA 1DGUA 1OQPA 3TS5B 1BJFA 2OTGB 2F2PA 2KI6C 1DMOA 1NX1A 1JSAA 4NQGA 5PALA 1V1GA 2CCMA 2K7OA 1SRAA 4CIDA 2FOTA 4C0JA 2LLTA 3BQ3A 2OPOA 1OOJA 4NDDA 1XFUO 1OE9B 1PVBA 1RK9A 4MZJA 2BE4A 1B7TZ 4P5OE 4PE7A 2KSPA 1KCYA 3OHMB 1C7WA 3I5FC 2KFHA 1KFXS 2BKIB 4XJKA 2I18A 2CBLA 1AJ5A 3JVTC 1NUBA 3SG5A 1LXFC 1BR4B 4OCIA 2ZNDA 3LK0A 2AMIA 1WLMA 4WQ2A 1AHRA 1CLLA 1QX5B 2K8MB 2LE9B 5DKRA 1BT6A 2OS8C 1QLSA 5FYXA 1PSBA 1RJVA 2JULA 1TIZA 1DJXA 1S3PA 1DJWA 1YUUA 2F33A 4YGEB 2LMVA 1SCMC 1BF5A 3RM1A 1S6IA 2KFFA 2LVVA 1FI5A 1RWYA 1QATA 2M8UA 1MXEA 1K9KA 1SCVA 3I5HB 2KI4C 1FPWA 5G08A 4YGAA 2CTNA 3CR5X 4ORCB 1SMGA 2LM5A 3BOWB 3LCPC 4GGNA 4MBEA 4C0LA 1LA0A 3TZ1A 1VRKA 1QIVA 2KBMA 2L5XB 1K2HA 2JXCA 4A4BA 2JQ6A 3PATA 5B8IB 3IQOA 2K7BA 1XFVO 2LP3A 1GJYA 2K2AA 2KGRA 1Y6WA 1TCOB 2ZNEA 5KU1A 2BBNA 2KQ6A 1NP8A 4XYNA 3GK4X 2M1UA 1NYAA 2PASA 1QS7A 2LNKA 2KI6D 1BLQA 2E30A 2M1KB 1R6PA 1N65A 3IF7A 5AFPA 1Y1AA 2OTGC 1S5GY 1A03A 4OVNF 3FS7A 1K9PA 4OR9B 1UHHA 2GV5A 2LV7A 3DF0B 1F55A 1KK7Z 2B1UA 4HRHA 2JT8A 2M0RA 4MRYA 1GQMA 2IS9A 3TS5C 1ALWA 3EVVA 2PRUA 1S6CA 1SYMA 3I5HC 4OKHA 4ZCUA 4E68A 1J7PA 1XFXO 3BUOB 2F2OA 3I5GB 1EH2A 4C0KA 1M31A 2A4JA 1FF1A 2M9GA 5AEQA 1NCXA 3VRPA 2F3ZA 1S36A 3CGAA 1EG4A 1IQ3A 3OB2B 2CNPA 4GAOA 1OMDA 2JT3A 2MRDA 2SCPA 4WQ3A 2R2IA 4GGFC 4PE1A 2KDHA 5J3XA 4M2OA 1QVIZ 4MVFA 3DVMA 1FBVA 2KHNA 1IRJA 1RFJA 2F3YA 1MQ1A 1TN4A 4YI9A 4AQJA 1PALA 2MBXA 1A4PA 1CTRA 5TNCA 2VRGA 2WOSA 4PHKA 4CFQA 1F8HA 1KFUL 2F8PA 3AKAA 1CNPA 4DS7A 1CMGA 1F70A 1QX2A 1E8AA 1KSOA 1W7JB 2LC5A 1BU3A 3NXAA 1S26D 3D0YB 3PN7C 4M2PA 2MLEC 1FW4A 5KSZA 2M7LA 3D0YA 2LHLA 5I2LA 5KTYA 2LANA 3O4YA 3TDZA 2FCEA 2JC2A 2L50A 1J1DA 1UWOA 4P2YB 1J55A 1CFCA 2K7CA 1KWOC 1WDCB 1KK8C 3AAKA 3VGOA 4MRXA 3PALA 3D10A 4ICBA 3VRNA 1V1FA 4XJKB 4DCKA 4D1EA 1ZFSA 1WRZA 1NX3A 1CKKA 1SKTA 1K8UA 3OP0A 1K94A 1JBAA 2NCOA 3SG7A 3KO0A 1QX7A 1R2UA 1AUIB 5K89A 1IGVA 1UHIA 1B8CA 5DKQA 4PHJA 1XFWO 5BPJA 1H4BA 1RTP1 1B1GA 3VRRA 3EVUA 2M49B 2LHIA 3GK1A 3NSOA 1EXRA 2LVIA 1SY9A 1DVIA 1CDMA 1KQMB 1QV1A 3KPXA 3MSEB 5AXIA 2Y1NA 1JF0A 1RECA 1WRKA 1KFUS 1UHJA 3KF9A 1K95A 3JVTB 1WLZA 3SG6A 2KYCA 2KGBC 3OX6A 1YTZC 1C07A 3EKJA 1NIWA 2HQWA 1IWQA 2K0JA 1ZOTB 5HLVA 4BY4A 3WXAA 1KSMA 1NCYA 1S6JA 5I8NA 2COLB 1DJZA 4I5LB 1F4OA 2NZ0A 1YUTA 1LINA 1MR8A 2NCPA 1DF0A 1SPYA 3NSLA 2Y4QA 2JWWA 5CSIA 1M45A 2BCAA 3K21A 1UHNA 1L2OC 1TNPA 1OZSA 1SR6B 1ZUZA 1MUXA 2MAZA 4USLA 2L4IA 1ZACA 1JF2A 4YGBB 1U5IB 4MSPA 1M63B 2MLFC 3EK7A 1B8LA 3DVEA 2LMUA 4WRIA 4MZLA 4PE4A 2KFGA 4GFTA 1MHOA 2ZN9A 1PULA 2OS8B 4YI8A 1A29A 1KWOB 1WDCC 2M3WA 2KYFA 2WCEA 2Y5IA 3ZNIA 1PK0D 1CMFA 2L2EA 3TDIA 2KBIA 1S5GZ 1YRUB 2PALA 1PRWA 1B8RA 2FCDA 2BBMA 1DJHA 2LCPA 1XVJA 2ZRTA 4TNCA 5AERA 1CLBA 4QJ3B 1CFFA 1AJ4A 5I2OA 5JOLA 1A75B 1BR1B 3CR2A 3DD4A 2M97A 4AQIA 3H4SE 4PHMA 3BUMB 2ZFDA 2HPSA 1K96A 3JTDB 2JNXA 2V53A 2LLUA 5D69A 4MN0A 5CSJA 2K2FA 2G2BA 1QTXA 2CXJA 1G8IA 1TOPA 2JZIA 2KNEA 2KAYA 1QVIY 1HT9A 1QASA 2ZRSA 1ODBA 3BOWA 3PN7B 3SG2A 1H8BA 5IBWA 2CT9A 3BUWB 4I5JA 5HLOA 1LKJA 3TDUA 1LVCD 1B47A 4PHNA 4YGCB 1F4QA 3CS1A 3DF0A 3PM8A 2HQ8A 3O6BA 1K9UA 1CM4A 1G33A 1Y0VH 1WRLA 4N1GA 4YGDB 5JJGA 1DJGA 1SW8A 3QRXA 1NPQA 4HSZA 4NDBA 2ISDA 3SG4A 1IJ6A 1QJTA 3NSKA 2BL0B 1IJ5A 1BOCA 3LL8B 1A75A 2I7AA 3I5IC 2HF5A 1SCMB 4MEWA 1CLMA 2BL0C 1EJ3A 4JWQA 3KHEA 1OMVA 1MXLC 1SL7A 3HX4A 2P6BB 2JNFA 1CDPA 1IKUA 4JQ0D 1UUSA 1EL4A 2H61A 1BG1A 1TRFA 1WY9A 1L2OB 2AUCA 1AK8A 3BYAA 4MLWA 1JWDA 1Q80A 2LUCA 1NCZA 1N2DA 4F0ZB 2WORA 3O78A 1S1EA 3BXKA 2L0PA 1SR6C 3EVRA 1EG3A 1W7IB 2ZKMX 2DOQA 4YBHB 2NLNA 3WHUB 1G4YR 4QJ4B 1SL9A 4R1EA 1J7QA 1JFJA 4M2QA 1IH0A 1YR5A 2MHHA 4ORBB 4DIRA 1SBJA 1CM1A 1DJIA 2Q4UA 3PFVA 3JTDC 2WC8A 4MZKA 4JPZB 1JC2A 2JRFA 1SK6D 2JTZA 5HKZA 1OMRA 5ER5A 1QXPA 3VRQA 1NX2A 4DRWA 2I2RE 4FTGA 1MF8B 2L98A 1L7ZA 1K90D 2MA2A 2BCBA 4A4CA 1TNWA 2GGMA 3TUYC 1TCFA 3GK2A 3BUXB 2JU0A 4DUQA 2PSRA 2BE6A 4CLNA 1ZMZA 3WNXB 2BECA 3GOFA 2KAXA 2SASA 3ICBA 1PSRA 3CLNA 2LAPA 3OX5A 2EGDA 1C7VA 2K61A 3AKBA 1TTXA 1XA5A 1U5IA 1Y1XA 2JT0A 1K93D 3IQQA 1A2XA 1QLKA 4I5KA 1N0YA 2FJUB 2L51A 3LK1A 3PSRA 2LVJA 2K7DA 3CZTX 1QIWA 1UHKA 3KEVA 1DF0B 1GGWA 1FI6A 1TNXA 1YUSA 1AVSA 1F54A 2M29A 4HRGA 4PALA 1YX7A 2WCBA 2EC6C 5I2QA 4OV2A 2JOJA 1MWNA 3I5FB 1BODA 1XK4A 5CSFA 2HETA 4CFRA 3HCMA 3EKHA 2PVBA 1KFXL 2WNDA 1CFDA 1NX0A 3LLEA 4GPLB 2Y1MA 4GGFA 2TN4A 3A8RA 3PLFB 4U8DA 3RLZA 1CB1A 3FWCA 1J7OA 1KQMC 3C1VA 1B7TY 3EK8A 2PMYA 3DVJA 4AOMA 1YRTB 1XYDA 3SIAA 1Y1UA 4ORAB 5HKYA 1UP5A 1UURA 3I5IB 2G9BA 3EK4A 5HKWA 2Q91A 1SL8A 4FQOA 1TNQA 1HQVA 1F71A 4QJ5B 2O5GA 4GNKB 2RGIA 4N1FA 2LVKA 1XO5A 3CTNA 1YX8A 2MJWB 4BY5A 4Q04A 3I5GC 2NXQA 2KAVA 3OB1B 1BMOA 1CDLA 1M39A 1KK7Y 2EHBA 1RROA 1OZOA 1DTLA 3CWGA 2H61C 1NWDA 1YVLA 3TUYB 1IG5A 2LP2A 1JFKA 1LA3A 4GBAA 4PCWA 3NSIA 1CFPA 2WCFA 3A4UB 5ER4X 3DVKA 3F45A 4HREE 4IL1A 3SG3A 3ZWHA 1JUOA 1D1OA 1M46A 4YRUA 2JPTA 5F6TA 1B4CA 2AAOA 1J7RA 1XFYO 2QPTA 4L9MA 2M7NA 5CPVA 2EC6B 2KQYA 2L4HA 4ZCVA 3SIBA 3WHTB 1DGVA 4N5XA 2ZN8A 1AP4A 2JTTA 2KOTA 1IQ5A 2LUXA 1DJYA 2LLSA 2GGZA 3AAJA 4I5NB 4PE0A 4GUKA 1YVHA 4NDCA 1SNLA 2KI4B 2LMTA 3CR4X 2JXLA 3M0WA 1B9AA 1NSHA 2QACA 1XK4C 5DKNA 3BUNB 3SJSA 2D8NA 3FWBA 4CPVA 3VROA 2O60A 2H2KA 3O2PA 1QV0A 3E3RA 1X02A
chains in the Genus database with same CATH superfamily
1KQVA 1KK8B 4JD9A 2I94A 5GQQC 1PVAA 3FIAA 4ETOA 2BCXA 2BKHB 2E6WA 1DT7B 1CDNA 1YURA 4UPGA 3L47A 5D7FA 1OSAA 1J1EA 5AANA 5HYDA 1ALVA 4PDZA 5CSNA 1XFZO 1GGZA 1DGUA 1OQPA 3TS5B 1BJFA 2OTGB 2F2PA 2KI6C 1DMOA 1NX1A 1JSAA 4NQGA 5PALA 1V1GA 2CCMA 2K7OA 1SRAA 2P71A 4CIDA 2FOTA 3D77A 4C0JA 3CZ0A 2LLTA 2L5YA 3BQ3A 5FI6A 2OPOA 1DC1A 2WCKA 1OOJA 4NDDA 1XFUO 1W9ZA 1OE9B 1PVBA 1RK9A 1SSEB 2BE4A 4MZJA 2QDIA 1B7TZ 3NHTA 4P5OE 4PE7A 2KSPA 1KCYA 3OHMB 1C7WA 3I5FC 2KFHA 1KFXS 2BKIB 4XJKA 2I18A 2CBLA 1AJ5A 3JVTC 1NUBA 2QEVA 3SG5A 1LXFC 1BR4B 4OCIA 2ZNDA 3LK0A 2AMIA 1WLMA 2K60A 4WQ2A 1AHRA 1CLLA 1QX5B 2K8MB 2LE9B 5DKRA 1BT6A 2OS8C 1QLSA 5FYXA 1PSBA 3RZSA 1RJVA 2JULA 1TIZA 1DJXA 1S3PA 1DJWA 1YUUA 2F33A 4YGEB 3UO9A 2LMVA 3D74A 1SCMC 1BF5A 3RM1A 1S6IA 2KFFA 2LVVA 2GTEA 1FI5A 1RWYA 1QATA 2M8UA 1MXEA 1K9KA 1SCVA 3BFHA 3I5HB 2KI4C 1FPWA 1C3ZA 5G08A 4YGAA 5I94A 2CTNA 3CR5X 4FQTA 4ORCB 1SMGA 2LM5A 3BOWB 3LCPC 4GGNA 5FI2A 4MBEA 2JPOA 1LA0A 4C0LA 3TZ1A 1VRKA 1QIVA 2KBMA 2L5XB 1K2HA 2JXCA 4A4BA 2JQ6A 1OW4A 3PATA 5B8IB 3IQOA 2BNXA 2K7BA 1XFVO 2LP3A 1GJYA 2K2AA 2KGRA 1Y6WA 1TCOB 1P28A 2ZNEA 5KU1A 2BBNA 2KQ6A 1NP8A 4XYNA 3GK4X 2M1UA 1NYAA 2PASA 1QS7A 2LNKA 2KI6D 1BLQA 4JKTA 2E30A 2KLEA 2M1KB 1R6PA 1N65A 3IF7A 5AFPA 1Y1AA 2OTGC 1S5GY 1A03A 4OVNF 3FS7A 1K9PA 4OR9B 1UHHA 2GV5A 3B86A 2LV7A 3DF0B 3S0GA 1F55A 1KK7Z 2B1UA 4HRHA 2JT8A 2M0RA 4MRYA 1GQMA 2IS9A 3NHIA 3TS5C 1ALWA 3BFAA 3EVVA 2PRUA 3CABA 1S6CA 1SYMA 3I5HC 4OKHA 4ZCUA 4E68A 1J7PA 1XFXO 3BUOB 2F2OA 3I5GB 1EH2A 4C0KA 1M31A 2A4JA 1FF1A 2M9GA 5AEQA 1NCXA 3VRPA 2F3ZA 1S36A 3CGAA 1EG4A 1IQ3A 3OB2B 2CNPA 4GAOA 1OMDA 2JT3A 2MRDA 2SCPA 4WQ3A 2R2IA 4GGFC 4PE1A 2KDHA 5J3XA 3B87A 4M2OA 1QVIZ 3DXLA 3DVMA 4MVFA 1FBVA 2KHNA 1IRJA 1RFJA 2F3YA 1MQ1A 1TN4A 4YI9A 4AQJA 1PALA 2MBXA 1A4PA 1CTRA 5TNCA 2VRGA 2WOSA 4PHKA 4CFQA 1OOGA 1F8HA 1KFUL 2F8PA 3AKAA 1CNPA 4DS7A 1CMGA 1F70A 1QX2A 1E8AA 1KSOA 1W7JB 2LC5A 1BU3A 3NXAA 1S26D 5HL1A 3D0YB 3PN7C 4M2PA 2MLEC 1FW4A 3SS3A 1GM0A 5KSZA 2M7LA 1OOIX 3D0YA 2LHLA 5I2LA 2PYQA 3S0DA 5KTYA 2LANA 3O4YA 3TDZA 2FCEA 2JC2A 2L50A 1DQEA 1J1DA 1UWOA 4P2YB 1J55A 3B6XA 1CFCA 2K7CA 1KWOC 1WDCB 1KK8C 3AAKA 3VGOA 4MRXA 3PALA 3D10A 4ICBA 3VRNA 1V1FA 4XJKB 4DCKA 4D1EA 1ZFSA 1WRZA 1NX3A 1Z2CB 1CKKA 1SKTA 1K8UA 3OP0A 1K94A 1JBAA 2NCOA 3SG7A 3KO0A 3L4AA 1QX7A 1R2UA 1AUIB 5K89A 1IGVA 1UHIA 1B8CA 5DKQA 2KPHA 1XFWO 4PHJA 5BPJA 1C3YA 1H4BA 1RTP1 1DELA 1B1GA 3R1OA 3VRRA 3EVUA 2M49B 2LHIA 3GK1A 3NSOA 1EXRA 2LVIA 1SY9A 1DVIA 1CDMA 1KQMB 1QV1A 3KPXA 3MSEB 5AXIA 2Y1NA 3SS5A 1JF0A 1RECA 1WRKA 1KFUS 1UHJA 3KF9A 1LS8A 1K95A 3JVTB 1WLZA 3SG6A 2KYCA 2KGBC 3OX6A 1YTZC 2FJYA 1OOHA 1C07A 3EKJA 1NIWA 2HQWA 3CYZA 1IWQA 2K0JA 1ZOTB 5HLVA 4BY4A 3WXAA 1KSMA 1NCYA 1S6JA 5I8NA 2COLB 1DJZA 3R72A 1XFRA 4I5LB 1F4OA 2NZ0A 1YUTA 4INXA 1LINA 1MR8A 2NCPA 1DF0A 1SPYA 3NSLA 2Y4QA 2JWWA 5CSIA 1M45A 2BCAA 3K21A 1UHNA 1L2OC 1TNPA 1OZSA 1SR6B 1ZUZA 1MUXA 2MAZA 4USLA 2L4IA 1ZACA 1JF2A 4YGBB 1U5IB 4MSPA 1M63B 2MLFC 3EK7A 1B8LA 3DVEA 2LMUA 4WRIA 4MZLA 4PE4A 2KFGA 4GFTA 1MHOA 2ZN9A 1IIOA 1PULA 1OOFA 2OS8B 4YI8A 1A29A 1KWOB 1WDCC 2M3WA 2KYFA 2WCEA 2Y5IA 3ZNIA 1PK0D 2L2CA 2L2EA 3TDIA 2KBIA 1CMFA 3DZTA 1S5GZ 3OGNA 1YRUB 3UNWA 2PALA 1PRWA 1B8RA 2FCDA 2BBMA 1DJHA 2LCPA 1XVJA 2ZRTA 4TNCA 5AERA 3B88A 1CLBA 4QJ3B 1CFFA 1AJ4A 1Z4HA 5I2OA 5JOLA 1A75B 1BR1B 3CR2A 3DD4A 4INWA 2M97A 4AQIA 3H4SE 2WCJA 4PHMA 3BUMB 2ZFDA 2HPSA 1K96A 3JTDB 2JNXA 2V53A 2LLUA 5D69A 4MN0A 5CSJA 2K2FA 2G2BA 1QTXA 2CXJA 1G8IA 4OZDA 1TOPA 2JZIA 2KNEA 2KAYA 1QVIY 1HT9A 1QASA 2ZRSA 1ODBA 3BOWA 3PN7B 3S0BA 3SG2A 1H8BA 5IBWA 2CT9A 3BUWB 4I5JA 5HLOA 1LKJA 3TDUA 1LVCD 1B47A 4PHNA 4YGCB 1F4QA 3EG5B 3CS1A 3DF0A 3PM8A 2HQ8A 3BFBA 1K9UA 1CM4A 1G33A 3O6BA 1DEKA 1TUZA 1WRLA 1Y0VH 4N1GA 4YGDB 5JJGA 1DJGA 1SW8A 3QRXA 1NPQA 4HSZA 4NDBA 2ISDA 3SG4A 1IJ6A 1QJTA 3NSKA 2BL0B 1IJ5A 2PQLA 1BOCA 3LL8B 1A75A 2I7AA 3I5IC 2HF5A 1SCMB 4MEWA 1CLMA 1EJ3A 2BL0C 4JWQA 3KHEA 1OMVA 1MXLC 1SL7A 3HX4A 2P6BB 3OBVA 5EL2A 3O4XA 2JNFA 1CDPA 1IKUA 3CDNA 4JQ0D 1UUSA 1EL4A 2H61A 3CZ1A 2WCMA 1TRFA 1WY9A 1L2OB 2AUCA 1BG1A 1AK8A 3BYAA 4MLWA 1JWDA 1Q80A 2LUCA 1NCZA 5FI7A 1N2DA 4F0ZB 2WORA 3BJHA 3O78A 3NGVA 1S1EA 3BXKA 2L0PA 1SR6C 3EVRA 1EG3A 1W7IB 2ZKMX 2DOQA 4YBHB 2NLNA 3WHUB 1G4YR 4QJ4B 1SL9A 4KYNA 4R1EA 2WCHA 1J7QA 3D76A 1JFJA 2WCLA 4M2QA 1IH0A 1YR5A 2MHHA 4ORBB 4DIRA 1SBJA 3DY9A 1CM1A 1DJIA 2Q4UA 3PFVA 3JTDC 3V2LA 2WC8A 4MZKA 4JPZB 1JC2A 2JRFA 1SK6D 2JTZA 3D75A 5HKZA 1OMRA 5ER5A 1QXPA 2WC6A 1NX2A 3VRQA 4DRWA 2I2RE 4FTGA 1MF8B 2L98A 1L7ZA 1K90D 2MA2A 2BCBA 4A4CA 1TNWA 2GGMA 3TUYC 1TCFA 3GK2A 3BUXB 2JU0A 3D78A 3S0FA 4DUQA 2PSRA 4IJ7A 3PJIA 2BE6A 3CZ2A 1ZMZA 4CLNA 3FE6A 3WNXB 2BECA 3GOFA 2KAXA 2SASA 3ICBA 1PSRA 3CLNA 2LAPA 3OX5A 2EGDA 1C7VA 2K61A 3K1EA 3AKBA 1TTXA 1XA5A 3FE8A 1U5IA 1Y1XA 2JT0A 1K93D 3IQQA 1A2XA 1QLKA 4I5KA 1TWOA 1N0YA 2FJUB 2ERBA 2L51A 3LK1A 3PSRA 2LVJA 2K7DA 4F7FA 3CZTX 1QIWA 1UHKA 3KEVA 1DF0B 2QEHA 1GGWA 1FI6A 1TNXA 1YUSA 1AVSA 1F54A 2M29A 4HRGA 4PALA 1YX7A 2WCBA 2EC6C 5DICA 5I2QA 4OV2A 2JOJA 1MWNA 3I5FB 1BODA 1XK4A 5CSFA 2HETA 3VB1A 4CFRA 3HCMA 3EKHA 3L4LA 3N7HA 2PVBA 1KFXL 2WNDA 4PT1A 1CFDA 1NX0A 3LLEA 3FE9A 3R1VA 2Y1MA 4GPLB 4GGFA 3DYEA 2TN4A 1QWVA 2WC5A 3A8RA 3PLFB 4U8DA 3RLZA 1CB1A 3FWCA 1J7OA 1KQMC 2BAPA 3C1VA 1B7TY 3EK8A 3R1PA 2PMYA 3DVJA 4AOMA 1YRTB 1XYDA 3SIAA 1Y1UA 4ORAB 5HKYA 3S0AA 1UP5A 1UURA 3QMEA 3I5IB 2G9BA 3EK4A 5HKWA 2Q91A 1SL8A 4FQOA 1TNQA 3PM2A 1HQVA 1F71A 4QJ5B 3IVTA 2O5GA 4GNKB 2RGIA 4N1FA 2LVKA 1XO5A 3CTNA 2QEOA 1ORGA 1YX8A 2MJWB 3SS4A 4Q04A 3I5GC 4BY5A 2NXQA 2KAVA 3OB1B 1BMOA 1CDLA 1M39A 1KK7Y 2EHBA 1RROA 1OZOA 1DTLA 3CWGA 2H61C 1NWDA 2P70A 2H8VA 1YVLA 3TUYB 1IG5A 2LP2A 1JFKA 1LA3A 1T14A 4GBAA 4PCWA 3NSIA 1CFPA 2WCFA 3A4UB 5D3OA 5ER4X 3DVKA 3F45A 4HREE 4IL1A 3B7AA 3SG3A 3ZWHA 1JUOA 1D1OA 1M46A 2YGUA 4YRUA 2JPTA 5F6TA 1B4CA 1TUJA 2AAOA 1J7RA 1XFYO 2QPTA 4L9MA 2KLDA 2M7NA 5CPVA 2EC6B 2KQYA 2L4HA 4ZCVA 3SIBA 3WHTB 1DGVA 4N5XA 2ZN8A 1AP4A 2JTTA 3S0EA 2KOTA 1IQ5A 2LUXA 1DJYA 3Q8IA 2LLSA 2GGZA 3AAJA 3D73A 4I5NB 4PE0A 4GUKA 1YVHA 4NDCA 1SNLA 2KI4B 2LMTA 3CR4X 2JXLA 3M0WA 1B9AA 1NSHA 2QACA 1XK4C 5DKNA 3BUNB 3SJSA 2D8NA 3FWBA 4CPVA 2QEBA 3VROA 2O60A 2H2KA 3O2PA 1QV0A 3E3RA 1X02A
chains in the Genus database with same CATH topology
1KQVA 1KK8B 2I94A 5GQQC 1PVAA 3FIAA 4ETOA 2BCXA 2BKHB 2E6WA 1DT7B 1CDNA 1YURA 4UPGA 5D7FA 1OSAA 1J1EA 5AANA 5HYDA 1ALVA 4PDZA 5CSNA 1XFZO 1GGZA 1DGUA 1OQPA 3TS5B 1BJFA 2OTGB 2F2PA 2KI6C 1DMOA 1NX1A 1JSAA 4NQGA 5PALA 1V1GA 2CCMA 2K7OA 1SRAA 4CIDA 2FOTA 4C0JA 2LLTA 3BQ3A 2OPOA 1OOJA 4NDDA 1XFUO 1OE9B 1PVBA 1RK9A 4MZJA 2BE4A 1B7TZ 4P5OE 4PE7A 2KSPA 1KCYA 3OHMB 1C7WA 3I5FC 2KFHA 1KFXS 2BKIB 4XJKA 2I18A 2CBLA 1AJ5A 3JVTC 1NUBA 3SG5A 1LXFC 1BR4B 4OCIA 2ZNDA 3LK0A 2AMIA 1WLMA 4WQ2A 1AHRA 1CLLA 1QX5B 2K8MB 2LE9B 5DKRA 1BT6A 2OS8C 1QLSA 5FYXA 1PSBA 1RJVA 2JULA 1TIZA 1DJXA 1S3PA 1DJWA 1YUUA 2F33A 4YGEB 2LMVA 1SCMC 1BF5A 3RM1A 1S6IA 2KFFA 2LVVA 1FI5A 1RWYA 1QATA 2M8UA 1MXEA 1K9KA 1SCVA 3I5HB 2KI4C 1FPWA 5G08A 4YGAA 2CTNA 3CR5X 4ORCB 1SMGA 2LM5A 3BOWB 3LCPC 4GGNA 4MBEA 4C0LA 1LA0A 3TZ1A 1VRKA 1QIVA 2KBMA 2L5XB 1K2HA 2JXCA 4A4BA 2JQ6A 3PATA 5B8IB 3IQOA 2K7BA 1XFVO 2LP3A 1GJYA 2K2AA 2KGRA 1Y6WA 1TCOB 2ZNEA 5KU1A 2BBNA 2KQ6A 1NP8A 4XYNA 3GK4X 2M1UA 1NYAA 2PASA 1QS7A 2LNKA 2KI6D 1BLQA 2E30A 2M1KB 1R6PA 1N65A 3IF7A 5AFPA 1Y1AA 2OTGC 1S5GY 1A03A 4OVNF 3FS7A 1K9PA 4OR9B 1UHHA 2GV5A 2LV7A 3DF0B 1F55A 1KK7Z 2B1UA 4HRHA 2JT8A 2M0RA 4MRYA 1GQMA 2IS9A 3TS5C 1ALWA 3EVVA 2PRUA 1S6CA 1SYMA 3I5HC 4OKHA 4ZCUA 4E68A 1J7PA 1XFXO 3BUOB 2F2OA 3I5GB 1EH2A 4C0KA 1M31A 2A4JA 1FF1A 2M9GA 5AEQA 1NCXA 3VRPA 2F3ZA 1S36A 3CGAA 1EG4A 1IQ3A 3OB2B 2CNPA 4GAOA 1OMDA 2JT3A 2MRDA 2SCPA 4WQ3A 2R2IA 4GGFC 4PE1A 2KDHA 5J3XA 4M2OA 1QVIZ 4MVFA 3DVMA 1FBVA 2KHNA 1IRJA 1RFJA 2F3YA 1MQ1A 1TN4A 4YI9A 4AQJA 1PALA 2MBXA 1A4PA 1CTRA 5TNCA 2VRGA 2WOSA 4PHKA 4CFQA 1F8HA 1KFUL 2F8PA 3AKAA 1CNPA 4DS7A 1CMGA 1F70A 1QX2A 1E8AA 1KSOA 1W7JB 2LC5A 1BU3A 3NXAA 1S26D 3D0YB 3PN7C 4M2PA 2MLEC 1FW4A 5KSZA 2M7LA 3D0YA 2LHLA 5I2LA 5KTYA 2LANA 3O4YA 3TDZA 2FCEA 2JC2A 2L50A 1J1DA 1UWOA 4P2YB 1J55A 1CFCA 2K7CA 1KWOC 1WDCB 1KK8C 3AAKA 3VGOA 4MRXA 3PALA 3D10A 4ICBA 3VRNA 1V1FA 4XJKB 4DCKA 4D1EA 1ZFSA 1WRZA 1NX3A 1CKKA 1SKTA 1K8UA 3OP0A 1K94A 1JBAA 2NCOA 3SG7A 3KO0A 1QX7A 1R2UA 1AUIB 5K89A 1IGVA 1UHIA 1B8CA 5DKQA 4PHJA 1XFWO 5BPJA 1H4BA 1RTP1 1B1GA 3VRRA 3EVUA 2M49B 2LHIA 3GK1A 3NSOA 1EXRA 2LVIA 1SY9A 1DVIA 1CDMA 1KQMB 1QV1A 3KPXA 3MSEB 5AXIA 2Y1NA 1JF0A 1RECA 1WRKA 1KFUS 1UHJA 3KF9A 1K95A 3JVTB 1WLZA 3SG6A 2KYCA 2KGBC 3OX6A 1YTZC 1C07A 3EKJA 1NIWA 2HQWA 1IWQA 2K0JA 1ZOTB 5HLVA 4BY4A 3WXAA 1KSMA 1NCYA 1S6JA 5I8NA 2COLB 1DJZA 4I5LB 1F4OA 2NZ0A 1YUTA 1LINA 1MR8A 2NCPA 1DF0A 1SPYA 3NSLA 2Y4QA 2JWWA 5CSIA 1M45A 2BCAA 3K21A 1UHNA 1L2OC 1TNPA 1OZSA 1SR6B 1ZUZA 1MUXA 2MAZA 4USLA 2L4IA 1ZACA 1JF2A 4YGBB 1U5IB 4MSPA 1M63B 2MLFC 3EK7A 1B8LA 3DVEA 2LMUA 4WRIA 4MZLA 4PE4A 2KFGA 4GFTA 1MHOA 2ZN9A 1PULA 2OS8B 4YI8A 1A29A 1KWOB 1WDCC 2M3WA 2KYFA 2WCEA 2Y5IA 3ZNIA 1PK0D 1CMFA 2L2EA 3TDIA 2KBIA 1S5GZ 1YRUB 2PALA 1PRWA 1B8RA 2FCDA 2BBMA 1DJHA 2LCPA 1XVJA 2ZRTA 4TNCA 5AERA 1CLBA 4QJ3B 1CFFA 1AJ4A 5I2OA 5JOLA 1A75B 1BR1B 3CR2A 3DD4A 2M97A 4AQIA 3H4SE 4PHMA 3BUMB 2ZFDA 2HPSA 1K96A 3JTDB 2JNXA 2V53A 2LLUA 5D69A 4MN0A 5CSJA 2K2FA 2G2BA 1QTXA 2CXJA 1G8IA 1TOPA 2JZIA 2KNEA 2KAYA 1QVIY 1HT9A 1QASA 2ZRSA 1ODBA 3BOWA 3PN7B 3SG2A 1H8BA 5IBWA 2CT9A 3BUWB 4I5JA 5HLOA 1LKJA 3TDUA 1LVCD 1B47A 4PHNA 4YGCB 1F4QA 3CS1A 3DF0A 3PM8A 2HQ8A 3O6BA 1K9UA 1CM4A 1G33A 1Y0VH 1WRLA 4N1GA 4YGDB 5JJGA 1DJGA 1SW8A 3QRXA 1NPQA 4HSZA 4NDBA 2ISDA 3SG4A 1IJ6A 1QJTA 3NSKA 2BL0B 1IJ5A 1BOCA 3LL8B 1A75A 2I7AA 3I5IC 2HF5A 1SCMB 4MEWA 1CLMA 2BL0C 1EJ3A 4JWQA 3KHEA 1OMVA 1MXLC 1SL7A 3HX4A 2P6BB 2JNFA 1CDPA 1IKUA 4JQ0D 1UUSA 1EL4A 2H61A 1BG1A 1TRFA 1WY9A 1L2OB 2AUCA 1AK8A 3BYAA 4MLWA 1JWDA 1Q80A 2LUCA 1NCZA 1N2DA 4F0ZB 2WORA 3O78A 1S1EA 3BXKA 2L0PA 1SR6C 3EVRA 1EG3A 1W7IB 2ZKMX 2DOQA 4YBHB 2NLNA 3WHUB 1G4YR 4QJ4B 1SL9A 4R1EA 1J7QA 1JFJA 4M2QA 1IH0A 1YR5A 2MHHA 4ORBB 4DIRA 1SBJA 1CM1A 1DJIA 2Q4UA 3PFVA 3JTDC 2WC8A 4MZKA 4JPZB 1JC2A 2JRFA 1SK6D 2JTZA 5HKZA 1OMRA 5ER5A 1QXPA 3VRQA 1NX2A 4DRWA 2I2RE 4FTGA 1MF8B 2L98A 1L7ZA 1K90D 2MA2A 2BCBA 4A4CA 1TNWA 2GGMA 3TUYC 1TCFA 3GK2A 3BUXB 2JU0A 4DUQA 2PSRA 2BE6A 4CLNA 1ZMZA 3WNXB 2BECA 3GOFA 2KAXA 2SASA 3ICBA 1PSRA 3CLNA 2LAPA 3OX5A 2EGDA 1C7VA 2K61A 3AKBA 1TTXA 1XA5A 1U5IA 1Y1XA 2JT0A 1K93D 3IQQA 1A2XA 1QLKA 4I5KA 1N0YA 2FJUB 2L51A 3LK1A 3PSRA 2LVJA 2K7DA 3CZTX 1QIWA 1UHKA 3KEVA 1DF0B 1GGWA 1FI6A 1TNXA 1YUSA 1AVSA 1F54A 2M29A 4HRGA 4PALA 1YX7A 2WCBA 2EC6C 5I2QA 4OV2A 2JOJA 1MWNA 3I5FB 1BODA 1XK4A 5CSFA 2HETA 4CFRA 3HCMA 3EKHA 2PVBA 1KFXL 2WNDA 1CFDA 1NX0A 3LLEA 4GPLB 2Y1MA 4GGFA 2TN4A 3A8RA 3PLFB 4U8DA 3RLZA 1CB1A 3FWCA 1J7OA 1KQMC 3C1VA 1B7TY 3EK8A 2PMYA 3DVJA 4AOMA 1YRTB 1XYDA 3SIAA 1Y1UA 4ORAB 5HKYA 1UP5A 1UURA 3I5IB 2G9BA 3EK4A 5HKWA 2Q91A 1SL8A 4FQOA 1TNQA 1HQVA 1F71A 4QJ5B 2O5GA 4GNKB 2RGIA 4N1FA 2LVKA 1XO5A 3CTNA 1YX8A 2MJWB 4BY5A 4Q04A 3I5GC 2NXQA 2KAVA 3OB1B 1BMOA 1CDLA 1M39A 1KK7Y 2EHBA 1RROA 1OZOA 1DTLA 3CWGA 2H61C 1NWDA 1YVLA 3TUYB 1IG5A 2LP2A 1JFKA 1LA3A 4GBAA 4PCWA 3NSIA 1CFPA 2WCFA 3A4UB 5ER4X 3DVKA 3F45A 4HREE 4IL1A 3SG3A 3ZWHA 1JUOA 1D1OA 1M46A 4YRUA 2JPTA 5F6TA 1B4CA 2AAOA 1J7RA 1XFYO 2QPTA 4L9MA 2M7NA 5CPVA 2EC6B 2KQYA 2L4HA 4ZCVA 3SIBA 3WHTB 1DGVA 4N5XA 2ZN8A 1AP4A 2JTTA 2KOTA 1IQ5A 2LUXA 1DJYA 2LLSA 2GGZA 3AAJA 4I5NB 4PE0A 4GUKA 1YVHA 4NDCA 1SNLA 2KI4B 2LMTA 3CR4X 2JXLA 3M0WA 1B9AA 1NSHA 2QACA 1XK4C 5DKNA 3BUNB 3SJSA 2D8NA 3FWBA 4CPVA 3VROA 2O60A 2H2KA 3O2PA 1QV0A 3E3RA 1X02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQV A;  1KK8 B;  2I94 A;  5GQQ C;  1PVA A;  3FIA A;  4ETO A;  2BCX A;  2BKH B;  2E6W A;  1DT7 B;  1CDN A;  1YUR A;  4UPG A;  5D7F A;  1OSA A;  1J1E A;  5AAN A;  5HYD A;  1ALV A;  4PDZ A;  5CSN A;  1XFZ O;  1GGZ A;  1DGU A;  1OQP A;  3TS5 B;  1BJF A;  2OTG B;  2F2P A;  2KI6 C;  1DMO A;  1NX1 A;  1JSA A;  4NQG A;  5PAL A;  1V1G A;  2CCM A;  2K7O A;  1SRA A;  4CID A;  2FOT A;  4C0J A;  2LLT A;  3BQ3 A;  2OPO A;  1OOJ A;  4NDD A;  1XFU O;  1OE9 B;  1PVB A;  1RK9 A;  4MZJ A;  2BE4 A;  1B7T Z;  4P5O E;  4PE7 A;  2KSP A;  1KCY A;  3OHM B;  1C7W A;  3I5F C;  2KFH A;  1KFX S;  2BKI B;  4XJK A;  2I18 A;  2CBL A;  1AJ5 A;  3JVT C;  1NUB A;  3SG5 A;  1LXF C;  1BR4 B;  4OCI A;  2ZND A;  3LK0 A;  2AMI A;  1WLM A;  4WQ2 A;  1AHR A;  1CLL A;  1QX5 B;  2K8M B;  2LE9 B;  5DKR A;  1BT6 A;  2OS8 C;  1QLS A;  5FYX A;  1PSB A;  1RJV A;  2JUL A;  1TIZ A;  1DJX A;  1S3P A;  1DJW A;  1YUU A;  2F33 A;  4YGE B;  2LMV A;  1SCM C;  1BF5 A;  3RM1 A;  1S6I A;  2KFF A;  2LVV A;  1FI5 A;  1RWY A;  1QAT A;  2M8U A;  1MXE A;  1K9K A;  1SCV A;  3I5H B;  2KI4 C;  1FPW A;  5G08 A;  4YGA A;  2CTN A;  3CR5 X;  4ORC B;  1SMG A;  2LM5 A;  3BOW B;  3LCP C;  4GGN A;  4MBE A;  4C0L A;  1LA0 A;  3TZ1 A;  1VRK A;  1QIV A;  2KBM A;  2L5X B;  1K2H A;  2JXC A;  4A4B A;  2JQ6 A;  3PAT A;  5B8I B;  3IQO A;  2K7B A;  1XFV O;  2LP3 A;  1GJY A;  2K2A A;  2KGR A;  1Y6W A;  1TCO B;  2ZNE A;  5KU1 A;  2BBN A;  2KQ6 A;  1NP8 A;  4XYN A;  3GK4 X;  2M1U A;  1NYA A;  2PAS A;  1QS7 A;  2LNK A;  2KI6 D;  1BLQ A;  2E30 A;  2M1K B;  1R6P A;  1N65 A;  3IF7 A;  5AFP A;  1Y1A A;  2OTG C;  1S5G Y;  1A03 A;  4OVN F;  3FS7 A;  1K9P A;  4OR9 B;  1UHH A;  2GV5 A;  2LV7 A;  3DF0 B;  1F55 A;  1KK7 Z;  2B1U A;  4HRH A;  2JT8 A;  2M0R A;  4MRY A;  1GQM A;  2IS9 A;  3TS5 C;  1ALW A;  3EVV A;  2PRU A;  1S6C A;  1SYM A;  3I5H C;  4OKH A;  4ZCU A;  4E68 A;  1J7P A;  1XFX O;  3BUO B;  2F2O A;  3I5G B;  1EH2 A;  4C0K A;  1M31 A;  2A4J A;  1FF1 A;  2M9G A;  5AEQ A;  1NCX A;  3VRP A;  2F3Z A;  1S36 A;  3CGA A;  1EG4 A;  1IQ3 A;  3OB2 B;  2CNP A;  4GAO A;  1OMD A;  2JT3 A;  2MRD A;  2SCP A;  4WQ3 A;  2R2I A;  4GGF C;  4PE1 A;  2KDH A;  5J3X A;  4M2O A;  1QVI Z;  4MVF A;  3DVM A;  1FBV A;  2KHN A;  1IRJ A;  1RFJ A;  2F3Y A;  1MQ1 A;  1TN4 A;  4YI9 A;  4AQJ A;  1PAL A;  2MBX A;  1A4P A;  1CTR A;  5TNC A;  2VRG A;  2WOS A;  4PHK A;  4CFQ A;  1F8H A;  1KFU L;  2F8P A;  3AKA A;  1CNP A;  4DS7 A;  1CMG A;  1F70 A;  1QX2 A;  1E8A A;  1KSO A;  1W7J B;  2LC5 A;  1BU3 A;  3NXA A;  1S26 D;  3D0Y B;  3PN7 C;  4M2P A;  2MLE C;  1FW4 A;  5KSZ A;  2M7L A;  3D0Y A;  2LHL A;  5I2L A;  5KTY A;  2LAN A;  3O4Y A;  3TDZ A;  2FCE A;  2JC2 A;  2L50 A;  1J1D A;  1UWO A;  4P2Y B;  1J55 A;  1CFC A;  2K7C A;  1KWO C;  1WDC B;  1KK8 C;  3AAK A;  3VGO A;  4MRX A;  3PAL A;  3D10 A;  4ICB A;  3VRN A;  1V1F A;  4XJK B;  4DCK A;  4D1E A;  1ZFS A;  1WRZ A;  1NX3 A;  1CKK A;  1SKT A;  1K8U A;  3OP0 A;  1K94 A;  1JBA A;  2NCO A;  3SG7 A;  3KO0 A;  1QX7 A;  1R2U A;  1AUI B;  5K89 A;  1IGV A;  1UHI A;  1B8C A;  5DKQ A;  4PHJ A;  1XFW O;  5BPJ A;  1H4B A;  1RTP 1;  1B1G A;  3VRR A;  3EVU A;  2M49 B;  2LHI A;  3GK1 A;  3NSO A;  1EXR A;  2LVI A;  1SY9 A;  1DVI A;  1CDM A;  1KQM B;  1QV1 A;  3KPX A;  3MSE B;  5AXI A;  2Y1N A;  1JF0 A;  1REC A;  1WRK A;  1KFU S;  1UHJ A;  3KF9 A;  1K95 A;  3JVT B;  1WLZ A;  3SG6 A;  2KYC A;  2KGB C;  3OX6 A;  1YTZ C;  1C07 A;  3EKJ A;  1NIW A;  2HQW A;  1IWQ A;  2K0J A;  1ZOT B;  5HLV A;  4BY4 A;  3WXA A;  1KSM A;  1NCY A;  1S6J A;  5I8N A;  2COL B;  1DJZ A;  4I5L B;  1F4O A;  2NZ0 A;  1YUT A;  1LIN A;  1MR8 A;  2NCP A;  1DF0 A;  1SPY A;  3NSL A;  2Y4Q A;  2JWW A;  5CSI A;  1M45 A;  2BCA A;  3K21 A;  1UHN A;  1L2O C;  1TNP A;  1OZS A;  1SR6 B;  1ZUZ A;  1MUX A;  2MAZ A;  4USL A;  2L4I A;  1ZAC A;  1JF2 A;  4YGB B;  1U5I B;  4MSP A;  1M63 B;  2MLF C;  3EK7 A;  1B8L A;  3DVE A;  2LMU A;  4WRI A;  4MZL A;  4PE4 A;  2KFG A;  4GFT A;  1MHO A;  2ZN9 A;  1PUL A;  2OS8 B;  4YI8 A;  1A29 A;  1KWO B;  1WDC C;  2M3W A;  2KYF A;  2WCE A;  2Y5I A;  3ZNI A;  1PK0 D;  1CMF A;  2L2E A;  3TDI A;  2KBI A;  1S5G Z;  1YRU B;  2PAL A;  1PRW A;  1B8R A;  2FCD A;  2BBM A;  1DJH A;  2LCP A;  1XVJ A;  2ZRT A;  4TNC A;  5AER A;  1CLB A;  4QJ3 B;  1CFF A;  1AJ4 A;  5I2O A;  5JOL A;  1A75 B;  1BR1 B;  3CR2 A;  3DD4 A;  2M97 A;  4AQI A;  3H4S E;  4PHM A;  3BUM B;  2ZFD A;  2HPS A;  1K96 A;  3JTD B;  2JNX A;  2V53 A;  2LLU A;  5D69 A;  4MN0 A;  5CSJ A;  2K2F A;  2G2B A;  1QTX A;  2CXJ A;  1G8I A;  1TOP A;  2JZI A;  2KNE A;  2KAY A;  1QVI Y;  1HT9 A;  1QAS A;  2ZRS A;  1ODB A;  3BOW A;  3PN7 B;  3SG2 A;  1H8B A;  5IBW A;  2CT9 A;  3BUW B;  4I5J A;  5HLO A;  1LKJ A;  3TDU A;  1LVC D;  1B47 A;  4PHN A;  4YGC B;  1F4Q A;  3CS1 A;  3DF0 A;  3PM8 A;  2HQ8 A;  3O6B A;  1K9U A;  1CM4 A;  1G33 A;  1Y0V H;  1WRL A;  4N1G A;  4YGD B;  5JJG A;  1DJG A;  1SW8 A;  3QRX A;  1NPQ A;  4HSZ A;  4NDB A;  2ISD A;  3SG4 A;  1IJ6 A;  1QJT A;  3NSK A;  2BL0 B;  1IJ5 A;  1BOC A;  3LL8 B;  1A75 A;  2I7A A;  3I5I C;  2HF5 A;  1SCM B;  4MEW A;  1CLM A;  2BL0 C;  1EJ3 A;  4JWQ A;  3KHE A;  1OMV A;  1MXL C;  1SL7 A;  3HX4 A;  2P6B B;  2JNF A;  1CDP A;  1IKU A;  4JQ0 D;  1UUS A;  1EL4 A;  2H61 A;  1BG1 A;  1TRF A;  1WY9 A;  1L2O B;  2AUC A;  1AK8 A;  3BYA A;  4MLW A;  1JWD A;  1Q80 A;  2LUC A;  1NCZ A;  1N2D A;  4F0Z B;  2WOR A;  3O78 A;  1S1E A;  3BXK A;  2L0P A;  1SR6 C;  3EVR A;  1EG3 A;  1W7I B;  2ZKM X;  2DOQ A;  4YBH B;  2NLN A;  3WHU B;  1G4Y R;  4QJ4 B;  1SL9 A;  4R1E A;  1J7Q A;  1JFJ A;  4M2Q A;  1IH0 A;  1YR5 A;  2MHH A;  4ORB B;  4DIR A;  1SBJ A;  1CM1 A;  1DJI A;  2Q4U A;  3PFV A;  3JTD C;  2WC8 A;  4MZK A;  4JPZ B;  1JC2 A;  2JRF A;  1SK6 D;  2JTZ A;  5HKZ A;  1OMR A;  5ER5 A;  1QXP A;  3VRQ A;  1NX2 A;  4DRW A;  2I2R E;  4FTG A;  1MF8 B;  2L98 A;  1L7Z A;  1K90 D;  2MA2 A;  2BCB A;  4A4C A;  1TNW A;  2GGM A;  3TUY C;  1TCF A;  3GK2 A;  3BUX B;  2JU0 A;  4DUQ A;  2PSR A;  2BE6 A;  4CLN A;  1ZMZ A;  3WNX B;  2BEC A;  3GOF A;  2KAX A;  2SAS A;  3ICB A;  1PSR A;  3CLN A;  2LAP A;  3OX5 A;  2EGD A;  1C7V A;  2K61 A;  3AKB A;  1TTX A;  1XA5 A;  1U5I A;  1Y1X A;  2JT0 A;  1K93 D;  3IQQ A;  1A2X A;  1QLK A;  4I5K A;  1N0Y A;  2FJU B;  2L51 A;  3LK1 A;  3PSR A;  2LVJ A;  2K7D A;  3CZT X;  1QIW A;  1UHK A;  3KEV A;  1DF0 B;  1GGW A;  1FI6 A;  1TNX A;  1YUS A;  1AVS A;  1F54 A;  2M29 A;  4HRG A;  4PAL A;  1YX7 A;  2WCB A;  2EC6 C;  5I2Q A;  4OV2 A;  2JOJ A;  1MWN A;  3I5F B;  1BOD A;  1XK4 A;  5CSF A;  2HET A;  4CFR A;  3HCM A;  3EKH A;  2PVB A;  1KFX L;  2WND A;  1CFD A;  1NX0 A;  3LLE A;  4GPL B;  2Y1M A;  4GGF A;  2TN4 A;  3A8R A;  3PLF B;  4U8D A;  3RLZ A;  1CB1 A;  3FWC A;  1J7O A;  1KQM C;  3C1V A;  1B7T Y;  3EK8 A;  2PMY A;  3DVJ A;  4AOM A;  1YRT B;  1XYD A;  3SIA A;  1Y1U A;  4ORA B;  5HKY A;  1UP5 A;  1UUR A;  3I5I B;  2G9B A;  3EK4 A;  5HKW A;  2Q91 A;  1SL8 A;  4FQO A;  1TNQ A;  1HQV A;  1F71 A;  4QJ5 B;  2O5G A;  4GNK B;  2RGI A;  4N1F A;  2LVK A;  1XO5 A;  3CTN A;  1YX8 A;  2MJW B;  4BY5 A;  4Q04 A;  3I5G C;  2NXQ A;  2KAV A;  3OB1 B;  1BMO A;  1CDL A;  1M39 A;  1KK7 Y;  2EHB A;  1RRO A;  1OZO A;  1DTL A;  3CWG A;  2H61 C;  1NWD A;  1YVL A;  3TUY B;  1IG5 A;  2LP2 A;  1JFK A;  1LA3 A;  4GBA A;  4PCW A;  3NSI A;  1CFP A;  2WCF A;  3A4U B;  5ER4 X;  3DVK A;  3F45 A;  4HRE E;  4IL1 A;  3SG3 A;  3ZWH A;  1JUO A;  1D1O A;  1M46 A;  4YRU A;  2JPT A;  5F6T A;  1B4C A;  2AAO A;  1J7R A;  1XFY O;  2QPT A;  4L9M A;  2M7N A;  5CPV A;  2EC6 B;  2KQY A;  2L4H A;  4ZCV A;  3SIB A;  3WHT B;  1DGV A;  4N5X A;  2ZN8 A;  1AP4 A;  2JTT A;  2KOT A;  1IQ5 A;  2LUX A;  1DJY A;  2LLS A;  2GGZ A;  3AAJ A;  4I5N B;  4PE0 A;  4GUK A;  1YVH A;  4NDC A;  1SNL A;  2KI4 B;  2LMT A;  3CR4 X;  2JXL A;  3M0W A;  1B9A A;  1NSH A;  2QAC A;  1XK4 C;  5DKN A;  3BUN B;  3SJS A;  2D8N A;  3FWB A;  4CPV A;  3VRO A;  2O60 A;  2H2K A;  3O2P A;  1QV0 A;  3E3R A;  1X02 A; 
#chains in the Genus database with same CATH topology
 1KQV A;  1KK8 B;  4JD9 A;  2I94 A;  5GQQ C;  1PVA A;  3FIA A;  4ETO A;  2BCX A;  2BKH B;  2E6W A;  1DT7 B;  1CDN A;  1YUR A;  4UPG A;  3L47 A;  5D7F A;  1OSA A;  1J1E A;  5AAN A;  5HYD A;  1ALV A;  4PDZ A;  5CSN A;  1XFZ O;  1GGZ A;  1DGU A;  1OQP A;  3TS5 B;  1BJF A;  2OTG B;  2F2P A;  2KI6 C;  1DMO A;  1NX1 A;  1JSA A;  4NQG A;  5PAL A;  1V1G A;  2CCM A;  2K7O A;  1SRA A;  2P71 A;  4CID A;  2FOT A;  3D77 A;  4C0J A;  3CZ0 A;  2LLT A;  2L5Y A;  3BQ3 A;  5FI6 A;  2OPO A;  1DC1 A;  2WCK A;  1OOJ A;  4NDD A;  1XFU O;  1W9Z A;  1OE9 B;  1PVB A;  1RK9 A;  1SSE B;  2BE4 A;  4MZJ A;  2QDI A;  1B7T Z;  3NHT A;  4P5O E;  4PE7 A;  2KSP A;  1KCY A;  3OHM B;  1C7W A;  3I5F C;  2KFH A;  1KFX S;  2BKI B;  4XJK A;  2I18 A;  2CBL A;  1AJ5 A;  3JVT C;  1NUB A;  2QEV A;  3SG5 A;  1LXF C;  1BR4 B;  4OCI A;  2ZND A;  3LK0 A;  2AMI A;  1WLM A;  2K60 A;  4WQ2 A;  1AHR A;  1CLL A;  1QX5 B;  2K8M B;  2LE9 B;  5DKR A;  1BT6 A;  2OS8 C;  1QLS A;  5FYX A;  1PSB A;  3RZS A;  1RJV A;  2JUL A;  1TIZ A;  1DJX A;  1S3P A;  1DJW A;  1YUU A;  2F33 A;  4YGE B;  3UO9 A;  2LMV A;  3D74 A;  1SCM C;  1BF5 A;  3RM1 A;  1S6I A;  2KFF A;  2LVV A;  2GTE A;  1FI5 A;  1RWY A;  1QAT A;  2M8U A;  1MXE A;  1K9K A;  1SCV A;  3BFH A;  3I5H B;  2KI4 C;  1FPW A;  1C3Z A;  5G08 A;  4YGA A;  5I94 A;  2CTN A;  3CR5 X;  4FQT A;  4ORC B;  1SMG A;  2LM5 A;  3BOW B;  3LCP C;  4GGN A;  5FI2 A;  4MBE A;  2JPO A;  1LA0 A;  4C0L A;  3TZ1 A;  1VRK A;  1QIV A;  2KBM A;  2L5X B;  1K2H A;  2JXC A;  4A4B A;  2JQ6 A;  1OW4 A;  3PAT A;  5B8I B;  3IQO A;  2BNX A;  2K7B A;  1XFV O;  2LP3 A;  1GJY A;  2K2A A;  2KGR A;  1Y6W A;  1TCO B;  1P28 A;  2ZNE A;  5KU1 A;  2BBN A;  2KQ6 A;  1NP8 A;  4XYN A;  3GK4 X;  2M1U A;  1NYA A;  2PAS A;  1QS7 A;  2LNK A;  2KI6 D;  1BLQ A;  4JKT A;  2E30 A;  2KLE A;  2M1K B;  1R6P A;  1N65 A;  3IF7 A;  5AFP A;  1Y1A A;  2OTG C;  1S5G Y;  1A03 A;  4OVN F;  3FS7 A;  1K9P A;  4OR9 B;  1UHH A;  2GV5 A;  3B86 A;  2LV7 A;  3DF0 B;  3S0G A;  1F55 A;  1KK7 Z;  2B1U A;  4HRH A;  2JT8 A;  2M0R A;  4MRY A;  1GQM A;  2IS9 A;  3NHI A;  3TS5 C;  1ALW A;  3BFA A;  3EVV A;  2PRU A;  3CAB A;  1S6C A;  1SYM A;  3I5H C;  4OKH A;  4ZCU A;  4E68 A;  1J7P A;  1XFX O;  3BUO B;  2F2O A;  3I5G B;  1EH2 A;  4C0K A;  1M31 A;  2A4J A;  1FF1 A;  2M9G A;  5AEQ A;  1NCX A;  3VRP A;  2F3Z A;  1S36 A;  3CGA A;  1EG4 A;  1IQ3 A;  3OB2 B;  2CNP A;  4GAO A;  1OMD A;  2JT3 A;  2MRD A;  2SCP A;  4WQ3 A;  2R2I A;  4GGF C;  4PE1 A;  2KDH A;  5J3X A;  3B87 A;  4M2O A;  1QVI Z;  3DXL A;  3DVM A;  4MVF A;  1FBV A;  2KHN A;  1IRJ A;  1RFJ A;  2F3Y A;  1MQ1 A;  1TN4 A;  4YI9 A;  4AQJ A;  1PAL A;  2MBX A;  1A4P A;  1CTR A;  5TNC A;  2VRG A;  2WOS A;  4PHK A;  4CFQ A;  1OOG A;  1F8H A;  1KFU L;  2F8P A;  3AKA A;  1CNP A;  4DS7 A;  1CMG A;  1F70 A;  1QX2 A;  1E8A A;  1KSO A;  1W7J B;  2LC5 A;  1BU3 A;  3NXA A;  1S26 D;  5HL1 A;  3D0Y B;  3PN7 C;  4M2P A;  2MLE C;  1FW4 A;  3SS3 A;  1GM0 A;  5KSZ A;  2M7L A;  1OOI X;  3D0Y A;  2LHL A;  5I2L A;  2PYQ A;  3S0D A;  5KTY A;  2LAN A;  3O4Y A;  3TDZ A;  2FCE A;  2JC2 A;  2L50 A;  1DQE A;  1J1D A;  1UWO A;  4P2Y B;  1J55 A;  3B6X A;  1CFC A;  2K7C A;  1KWO C;  1WDC B;  1KK8 C;  3AAK A;  3VGO A;  4MRX A;  3PAL A;  3D10 A;  4ICB A;  3VRN A;  1V1F A;  4XJK B;  4DCK A;  4D1E A;  1ZFS A;  1WRZ A;  1NX3 A;  1Z2C B;  1CKK A;  1SKT A;  1K8U A;  3OP0 A;  1K94 A;  1JBA A;  2NCO A;  3SG7 A;  3KO0 A;  3L4A A;  1QX7 A;  1R2U A;  1AUI B;  5K89 A;  1IGV A;  1UHI A;  1B8C A;  5DKQ A;  2KPH A;  1XFW O;  4PHJ A;  5BPJ A;  1C3Y A;  1H4B A;  1RTP 1;  1DEL A;  1B1G A;  3R1O A;  3VRR A;  3EVU A;  2M49 B;  2LHI A;  3GK1 A;  3NSO A;  1EXR A;  2LVI A;  1SY9 A;  1DVI A;  1CDM A;  1KQM B;  1QV1 A;  3KPX A;  3MSE B;  5AXI A;  2Y1N A;  3SS5 A;  1JF0 A;  1REC A;  1WRK A;  1KFU S;  1UHJ A;  3KF9 A;  1LS8 A;  1K95 A;  3JVT B;  1WLZ A;  3SG6 A;  2KYC A;  2KGB C;  3OX6 A;  1YTZ C;  2FJY A;  1OOH A;  1C07 A;  3EKJ A;  1NIW A;  2HQW A;  3CYZ A;  1IWQ A;  2K0J A;  1ZOT B;  5HLV A;  4BY4 A;  3WXA A;  1KSM A;  1NCY A;  1S6J A;  5I8N A;  2COL B;  1DJZ A;  3R72 A;  1XFR A;  4I5L B;  1F4O A;  2NZ0 A;  1YUT A;  4INX A;  1LIN A;  1MR8 A;  2NCP A;  1DF0 A;  1SPY A;  3NSL A;  2Y4Q A;  2JWW A;  5CSI A;  1M45 A;  2BCA A;  3K21 A;  1UHN A;  1L2O C;  1TNP A;  1OZS A;  1SR6 B;  1ZUZ A;  1MUX A;  2MAZ A;  4USL A;  2L4I A;  1ZAC A;  1JF2 A;  4YGB B;  1U5I B;  4MSP A;  1M63 B;  2MLF C;  3EK7 A;  1B8L A;  3DVE A;  2LMU A;  4WRI A;  4MZL A;  4PE4 A;  2KFG A;  4GFT A;  1MHO A;  2ZN9 A;  1IIO A;  1PUL A;  1OOF A;  2OS8 B;  4YI8 A;  1A29 A;  1KWO B;  1WDC C;  2M3W A;  2KYF A;  2WCE A;  2Y5I A;  3ZNI A;  1PK0 D;  2L2C A;  2L2E A;  3TDI A;  2KBI A;  1CMF A;  3DZT A;  1S5G Z;  3OGN A;  1YRU B;  3UNW A;  2PAL A;  1PRW A;  1B8R A;  2FCD A;  2BBM A;  1DJH A;  2LCP A;  1XVJ A;  2ZRT A;  4TNC A;  5AER A;  3B88 A;  1CLB A;  4QJ3 B;  1CFF A;  1AJ4 A;  1Z4H A;  5I2O A;  5JOL A;  1A75 B;  1BR1 B;  3CR2 A;  3DD4 A;  4INW A;  2M97 A;  4AQI A;  3H4S E;  2WCJ A;  4PHM A;  3BUM B;  2ZFD A;  2HPS A;  1K96 A;  3JTD B;  2JNX A;  2V53 A;  2LLU A;  5D69 A;  4MN0 A;  5CSJ A;  2K2F A;  2G2B A;  1QTX A;  2CXJ A;  1G8I A;  4OZD A;  1TOP A;  2JZI A;  2KNE A;  2KAY A;  1QVI Y;  1HT9 A;  1QAS A;  2ZRS A;  1ODB A;  3BOW A;  3PN7 B;  3S0B A;  3SG2 A;  1H8B A;  5IBW A;  2CT9 A;  3BUW B;  4I5J A;  5HLO A;  1LKJ A;  3TDU A;  1LVC D;  1B47 A;  4PHN A;  4YGC B;  1F4Q A;  3EG5 B;  3CS1 A;  3DF0 A;  3PM8 A;  2HQ8 A;  3BFB A;  1K9U A;  1CM4 A;  1G33 A;  3O6B A;  1DEK A;  1TUZ A;  1WRL A;  1Y0V H;  4N1G A;  4YGD B;  5JJG A;  1DJG A;  1SW8 A;  3QRX A;  1NPQ A;  4HSZ A;  4NDB A;  2ISD A;  3SG4 A;  1IJ6 A;  1QJT A;  3NSK A;  2BL0 B;  1IJ5 A;  2PQL A;  1BOC A;  3LL8 B;  1A75 A;  2I7A A;  3I5I C;  2HF5 A;  1SCM B;  4MEW A;  1CLM A;  1EJ3 A;  2BL0 C;  4JWQ A;  3KHE A;  1OMV A;  1MXL C;  1SL7 A;  3HX4 A;  2P6B B;  3OBV A;  5EL2 A;  3O4X A;  2JNF A;  1CDP A;  1IKU A;  3CDN A;  4JQ0 D;  1UUS A;  1EL4 A;  2H61 A;  3CZ1 A;  2WCM A;  1TRF A;  1WY9 A;  1L2O B;  2AUC A;  1BG1 A;  1AK8 A;  3BYA A;  4MLW A;  1JWD A;  1Q80 A;  2LUC A;  1NCZ A;  5FI7 A;  1N2D A;  4F0Z B;  2WOR A;  3BJH A;  3O78 A;  3NGV A;  1S1E A;  3BXK A;  2L0P A;  1SR6 C;  3EVR A;  1EG3 A;  1W7I B;  2ZKM X;  2DOQ A;  4YBH B;  2NLN A;  3WHU B;  1G4Y R;  4QJ4 B;  1SL9 A;  4KYN A;  4R1E A;  2WCH A;  1J7Q A;  3D76 A;  1JFJ A;  2WCL A;  4M2Q A;  1IH0 A;  1YR5 A;  2MHH A;  4ORB B;  4DIR A;  1SBJ A;  3DY9 A;  1CM1 A;  1DJI A;  2Q4U A;  3PFV A;  3JTD C;  3V2L A;  2WC8 A;  4MZK A;  4JPZ B;  1JC2 A;  2JRF A;  1SK6 D;  2JTZ A;  3D75 A;  5HKZ A;  1OMR A;  5ER5 A;  1QXP A;  2WC6 A;  1NX2 A;  3VRQ A;  4DRW A;  2I2R E;  4FTG A;  1MF8 B;  2L98 A;  1L7Z A;  1K90 D;  2MA2 A;  2BCB A;  4A4C A;  1TNW A;  2GGM A;  3TUY C;  1TCF A;  3GK2 A;  3BUX B;  2JU0 A;  3D78 A;  3S0F A;  4DUQ A;  2PSR A;  4IJ7 A;  3PJI A;  2BE6 A;  3CZ2 A;  1ZMZ A;  4CLN A;  3FE6 A;  3WNX B;  2BEC A;  3GOF A;  2KAX A;  2SAS A;  3ICB A;  1PSR A;  3CLN A;  2LAP A;  3OX5 A;  2EGD A;  1C7V A;  2K61 A;  3K1E A;  3AKB A;  1TTX A;  1XA5 A;  3FE8 A;  1U5I A;  1Y1X A;  2JT0 A;  1K93 D;  3IQQ A;  1A2X A;  1QLK A;  4I5K A;  1TWO A;  1N0Y A;  2FJU B;  2ERB A;  2L51 A;  3LK1 A;  3PSR A;  2LVJ A;  2K7D A;  4F7F A;  3CZT X;  1QIW A;  1UHK A;  3KEV A;  1DF0 B;  2QEH A;  1GGW A;  1FI6 A;  1TNX A;  1YUS A;  1AVS A;  1F54 A;  2M29 A;  4HRG A;  4PAL A;  1YX7 A;  2WCB A;  2EC6 C;  5DIC A;  5I2Q A;  4OV2 A;  2JOJ A;  1MWN A;  3I5F B;  1BOD A;  1XK4 A;  5CSF A;  2HET A;  3VB1 A;  4CFR A;  3HCM A;  3EKH A;  3L4L A;  3N7H A;  2PVB A;  1KFX L;  2WND A;  4PT1 A;  1CFD A;  1NX0 A;  3LLE A;  3FE9 A;  3R1V A;  2Y1M A;  4GPL B;  4GGF A;  3DYE A;  2TN4 A;  1QWV A;  2WC5 A;  3A8R A;  3PLF B;  4U8D A;  3RLZ A;  1CB1 A;  3FWC A;  1J7O A;  1KQM C;  2BAP A;  3C1V A;  1B7T Y;  3EK8 A;  3R1P A;  2PMY A;  3DVJ A;  4AOM A;  1YRT B;  1XYD A;  3SIA A;  1Y1U A;  4ORA B;  5HKY A;  3S0A A;  1UP5 A;  1UUR A;  3QME A;  3I5I B;  2G9B A;  3EK4 A;  5HKW A;  2Q91 A;  1SL8 A;  4FQO A;  1TNQ A;  3PM2 A;  1HQV A;  1F71 A;  4QJ5 B;  3IVT A;  2O5G A;  4GNK B;  2RGI A;  4N1F A;  2LVK A;  1XO5 A;  3CTN A;  2QEO A;  1ORG A;  1YX8 A;  2MJW B;  3SS4 A;  4Q04 A;  3I5G C;  4BY5 A;  2NXQ A;  2KAV A;  3OB1 B;  1BMO A;  1CDL A;  1M39 A;  1KK7 Y;  2EHB A;  1RRO A;  1OZO A;  1DTL A;  3CWG A;  2H61 C;  1NWD A;  2P70 A;  2H8V A;  1YVL A;  3TUY B;  1IG5 A;  2LP2 A;  1JFK A;  1LA3 A;  1T14 A;  4GBA A;  4PCW A;  3NSI A;  1CFP A;  2WCF A;  3A4U B;  5D3O A;  5ER4 X;  3DVK A;  3F45 A;  4HRE E;  4IL1 A;  3B7A A;  3SG3 A;  3ZWH A;  1JUO A;  1D1O A;  1M46 A;  2YGU A;  4YRU A;  2JPT A;  5F6T A;  1B4C A;  1TUJ A;  2AAO A;  1J7R A;  1XFY O;  2QPT A;  4L9M A;  2KLD A;  2M7N A;  5CPV A;  2EC6 B;  2KQY A;  2L4H A;  4ZCV A;  3SIB A;  3WHT B;  1DGV A;  4N5X A;  2ZN8 A;  1AP4 A;  2JTT A;  3S0E A;  2KOT A;  1IQ5 A;  2LUX A;  1DJY A;  3Q8I A;  2LLS A;  2GGZ A;  3AAJ A;  3D73 A;  4I5N B;  4PE0 A;  4GUK A;  1YVH A;  4NDC A;  1SNL A;  2KI4 B;  2LMT A;  3CR4 X;  2JXL A;  3M0W A;  1B9A A;  1NSH A;  2QAC A;  1XK4 C;  5DKN A;  3BUN B;  3SJS A;  2D8N A;  3FWB A;  4CPV A;  2QEB A;  3VRO A;  2O60 A;  2H2K A;  3O2P A;  1QV0 A;  3E3R A;  1X02 A; 
#chains in the Genus database with same CATH homology
 1KQV A;  1KK8 B;  2I94 A;  5GQQ C;  1PVA A;  3FIA A;  4ETO A;  2BCX A;  2BKH B;  2E6W A;  1DT7 B;  1CDN A;  1YUR A;  4UPG A;  5D7F A;  1OSA A;  1J1E A;  5AAN A;  5HYD A;  1ALV A;  4PDZ A;  5CSN A;  1XFZ O;  1GGZ A;  1DGU A;  1OQP A;  3TS5 B;  1BJF A;  2OTG B;  2F2P A;  2KI6 C;  1DMO A;  1NX1 A;  1JSA A;  4NQG A;  5PAL A;  1V1G A;  2CCM A;  2K7O A;  1SRA A;  4CID A;  2FOT A;  4C0J A;  2LLT A;  3BQ3 A;  2OPO A;  1OOJ A;  4NDD A;  1XFU O;  1OE9 B;  1PVB A;  1RK9 A;  4MZJ A;  2BE4 A;  1B7T Z;  4P5O E;  4PE7 A;  2KSP A;  1KCY A;  3OHM B;  1C7W A;  3I5F C;  2KFH A;  1KFX S;  2BKI B;  4XJK A;  2I18 A;  2CBL A;  1AJ5 A;  3JVT C;  1NUB A;  3SG5 A;  1LXF C;  1BR4 B;  4OCI A;  2ZND A;  3LK0 A;  2AMI A;  1WLM A;  4WQ2 A;  1AHR A;  1CLL A;  1QX5 B;  2K8M B;  2LE9 B;  5DKR A;  1BT6 A;  2OS8 C;  1QLS A;  5FYX A;  1PSB A;  1RJV A;  2JUL A;  1TIZ A;  1DJX A;  1S3P A;  1DJW A;  1YUU A;  2F33 A;  4YGE B;  2LMV A;  1SCM C;  1BF5 A;  3RM1 A;  1S6I A;  2KFF A;  2LVV A;  1FI5 A;  1RWY A;  1QAT A;  2M8U A;  1MXE A;  1K9K A;  1SCV A;  3I5H B;  2KI4 C;  1FPW A;  5G08 A;  4YGA A;  2CTN A;  3CR5 X;  4ORC B;  1SMG A;  2LM5 A;  3BOW B;  3LCP C;  4GGN A;  4MBE A;  4C0L A;  1LA0 A;  3TZ1 A;  1VRK A;  1QIV A;  2KBM A;  2L5X B;  1K2H A;  2JXC A;  4A4B A;  2JQ6 A;  3PAT A;  5B8I B;  3IQO A;  2K7B A;  1XFV O;  2LP3 A;  1GJY A;  2K2A A;  2KGR A;  1Y6W A;  1TCO B;  2ZNE A;  5KU1 A;  2BBN A;  2KQ6 A;  1NP8 A;  4XYN A;  3GK4 X;  2M1U A;  1NYA A;  2PAS A;  1QS7 A;  2LNK A;  2KI6 D;  1BLQ A;  2E30 A;  2M1K B;  1R6P A;  1N65 A;  3IF7 A;  5AFP A;  1Y1A A;  2OTG C;  1S5G Y;  1A03 A;  4OVN F;  3FS7 A;  1K9P A;  4OR9 B;  1UHH A;  2GV5 A;  2LV7 A;  3DF0 B;  1F55 A;  1KK7 Z;  2B1U A;  4HRH A;  2JT8 A;  2M0R A;  4MRY A;  1GQM A;  2IS9 A;  3TS5 C;  1ALW A;  3EVV A;  2PRU A;  1S6C A;  1SYM A;  3I5H C;  4OKH A;  4ZCU A;  4E68 A;  1J7P A;  1XFX O;  3BUO B;  2F2O A;  3I5G B;  1EH2 A;  4C0K A;  1M31 A;  2A4J A;  1FF1 A;  2M9G A;  5AEQ A;  1NCX A;  3VRP A;  2F3Z A;  1S36 A;  3CGA A;  1EG4 A;  1IQ3 A;  3OB2 B;  2CNP A;  4GAO A;  1OMD A;  2JT3 A;  2MRD A;  2SCP A;  4WQ3 A;  2R2I A;  4GGF C;  4PE1 A;  2KDH A;  5J3X A;  4M2O A;  1QVI Z;  4MVF A;  3DVM A;  1FBV A;  2KHN A;  1IRJ A;  1RFJ A;  2F3Y A;  1MQ1 A;  1TN4 A;  4YI9 A;  4AQJ A;  1PAL A;  2MBX A;  1A4P A;  1CTR A;  5TNC A;  2VRG A;  2WOS A;  4PHK A;  4CFQ A;  1F8H A;  1KFU L;  2F8P A;  3AKA A;  1CNP A;  4DS7 A;  1CMG A;  1F70 A;  1QX2 A;  1E8A A;  1KSO A;  1W7J B;  2LC5 A;  1BU3 A;  3NXA A;  1S26 D;  3D0Y B;  3PN7 C;  4M2P A;  2MLE C;  1FW4 A;  5KSZ A;  2M7L A;  3D0Y A;  2LHL A;  5I2L A;  5KTY A;  2LAN A;  3O4Y A;  3TDZ A;  2FCE A;  2JC2 A;  2L50 A;  1J1D A;  1UWO A;  4P2Y B;  1J55 A;  1CFC A;  2K7C A;  1KWO C;  1WDC B;  1KK8 C;  3AAK A;  3VGO A;  4MRX A;  3PAL A;  3D10 A;  4ICB A;  3VRN A;  1V1F A;  4XJK B;  4DCK A;  4D1E A;  1ZFS A;  1WRZ A;  1NX3 A;  1CKK A;  1SKT A;  1K8U A;  3OP0 A;  1K94 A;  1JBA A;  2NCO A;  3SG7 A;  3KO0 A;  1QX7 A;  1R2U A;  1AUI B;  5K89 A;  1IGV A;  1UHI A;  1B8C A;  5DKQ A;  4PHJ A;  1XFW O;  5BPJ A;  1H4B A;  1RTP 1;  1B1G A;  3VRR A;  3EVU A;  2M49 B;  2LHI A;  3GK1 A;  3NSO A;  1EXR A;  2LVI A;  1SY9 A;  1DVI A;  1CDM A;  1KQM B;  1QV1 A;  3KPX A;  3MSE B;  5AXI A;  2Y1N A;  1JF0 A;  1REC A;  1WRK A;  1KFU S;  1UHJ A;  3KF9 A;  1K95 A;  3JVT B;  1WLZ A;  3SG6 A;  2KYC A;  2KGB C;  3OX6 A;  1YTZ C;  1C07 A;  3EKJ A;  1NIW A;  2HQW A;  1IWQ A;  2K0J A;  1ZOT B;  5HLV A;  4BY4 A;  3WXA A;  1KSM A;  1NCY A;  1S6J A;  5I8N A;  2COL B;  1DJZ A;  4I5L B;  1F4O A;  2NZ0 A;  1YUT A;  1LIN A;  1MR8 A;  2NCP A;  1DF0 A;  1SPY A;  3NSL A;  2Y4Q A;  2JWW A;  5CSI A;  1M45 A;  2BCA A;  3K21 A;  1UHN A;  1L2O C;  1TNP A;  1OZS A;  1SR6 B;  1ZUZ A;  1MUX A;  2MAZ A;  4USL A;  2L4I A;  1ZAC A;  1JF2 A;  4YGB B;  1U5I B;  4MSP A;  1M63 B;  2MLF C;  3EK7 A;  1B8L A;  3DVE A;  2LMU A;  4WRI A;  4MZL A;  4PE4 A;  2KFG A;  4GFT A;  1MHO A;  2ZN9 A;  1PUL A;  2OS8 B;  4YI8 A;  1A29 A;  1KWO B;  1WDC C;  2M3W A;  2KYF A;  2WCE A;  2Y5I A;  3ZNI A;  1PK0 D;  1CMF A;  2L2E A;  3TDI A;  2KBI A;  1S5G Z;  1YRU B;  2PAL A;  1PRW A;  1B8R A;  2FCD A;  2BBM A;  1DJH A;  2LCP A;  1XVJ A;  2ZRT A;  4TNC A;  5AER A;  1CLB A;  4QJ3 B;  1CFF A;  1AJ4 A;  5I2O A;  5JOL A;  1A75 B;  1BR1 B;  3CR2 A;  3DD4 A;  2M97 A;  4AQI A;  3H4S E;  4PHM A;  3BUM B;  2ZFD A;  2HPS A;  1K96 A;  3JTD B;  2JNX A;  2V53 A;  2LLU A;  5D69 A;  4MN0 A;  5CSJ A;  2K2F A;  2G2B A;  1QTX A;  2CXJ A;  1G8I A;  1TOP A;  2JZI A;  2KNE A;  2KAY A;  1QVI Y;  1HT9 A;  1QAS A;  2ZRS A;  1ODB A;  3BOW A;  3PN7 B;  3SG2 A;  1H8B A;  5IBW A;  2CT9 A;  3BUW B;  4I5J A;  5HLO A;  1LKJ A;  3TDU A;  1LVC D;  1B47 A;  4PHN A;  4YGC B;  1F4Q A;  3CS1 A;  3DF0 A;  3PM8 A;  2HQ8 A;  3O6B A;  1K9U A;  1CM4 A;  1G33 A;  1Y0V H;  1WRL A;  4N1G A;  4YGD B;  5JJG A;  1DJG A;  1SW8 A;  3QRX A;  1NPQ A;  4HSZ A;  4NDB A;  2ISD A;  3SG4 A;  1IJ6 A;  1QJT A;  3NSK A;  2BL0 B;  1IJ5 A;  1BOC A;  3LL8 B;  1A75 A;  2I7A A;  3I5I C;  2HF5 A;  1SCM B;  4MEW A;  1CLM A;  2BL0 C;  1EJ3 A;  4JWQ A;  3KHE A;  1OMV A;  1MXL C;  1SL7 A;  3HX4 A;  2P6B B;  2JNF A;  1CDP A;  1IKU A;  4JQ0 D;  1UUS A;  1EL4 A;  2H61 A;  1BG1 A;  1TRF A;  1WY9 A;  1L2O B;  2AUC A;  1AK8 A;  3BYA A;  4MLW A;  1JWD A;  1Q80 A;  2LUC A;  1NCZ A;  1N2D A;  4F0Z B;  2WOR A;  3O78 A;  1S1E A;  3BXK A;  2L0P A;  1SR6 C;  3EVR A;  1EG3 A;  1W7I B;  2ZKM X;  2DOQ A;  4YBH B;  2NLN A;  3WHU B;  1G4Y R;  4QJ4 B;  1SL9 A;  4R1E A;  1J7Q A;  1JFJ A;  4M2Q A;  1IH0 A;  1YR5 A;  2MHH A;  4ORB B;  4DIR A;  1SBJ A;  1CM1 A;  1DJI A;  2Q4U A;  3PFV A;  3JTD C;  2WC8 A;  4MZK A;  4JPZ B;  1JC2 A;  2JRF A;  1SK6 D;  2JTZ A;  5HKZ A;  1OMR A;  5ER5 A;  1QXP A;  3VRQ A;  1NX2 A;  4DRW A;  2I2R E;  4FTG A;  1MF8 B;  2L98 A;  1L7Z A;  1K90 D;  2MA2 A;  2BCB A;  4A4C A;  1TNW A;  2GGM A;  3TUY C;  1TCF A;  3GK2 A;  3BUX B;  2JU0 A;  4DUQ A;  2PSR A;  2BE6 A;  4CLN A;  1ZMZ A;  3WNX B;  2BEC A;  3GOF A;  2KAX A;  2SAS A;  3ICB A;  1PSR A;  3CLN A;  2LAP A;  3OX5 A;  2EGD A;  1C7V A;  2K61 A;  3AKB A;  1TTX A;  1XA5 A;  1U5I A;  1Y1X A;  2JT0 A;  1K93 D;  3IQQ A;  1A2X A;  1QLK A;  4I5K A;  1N0Y A;  2FJU B;  2L51 A;  3LK1 A;  3PSR A;  2LVJ A;  2K7D A;  3CZT X;  1QIW A;  1UHK A;  3KEV A;  1DF0 B;  1GGW A;  1FI6 A;  1TNX A;  1YUS A;  1AVS A;  1F54 A;  2M29 A;  4HRG A;  4PAL A;  1YX7 A;  2WCB A;  2EC6 C;  5I2Q A;  4OV2 A;  2JOJ A;  1MWN A;  3I5F B;  1BOD A;  1XK4 A;  5CSF A;  2HET A;  4CFR A;  3HCM A;  3EKH A;  2PVB A;  1KFX L;  2WND A;  1CFD A;  1NX0 A;  3LLE A;  4GPL B;  2Y1M A;  4GGF A;  2TN4 A;  3A8R A;  3PLF B;  4U8D A;  3RLZ A;  1CB1 A;  3FWC A;  1J7O A;  1KQM C;  3C1V A;  1B7T Y;  3EK8 A;  2PMY A;  3DVJ A;  4AOM A;  1YRT B;  1XYD A;  3SIA A;  1Y1U A;  4ORA B;  5HKY A;  1UP5 A;  1UUR A;  3I5I B;  2G9B A;  3EK4 A;  5HKW A;  2Q91 A;  1SL8 A;  4FQO A;  1TNQ A;  1HQV A;  1F71 A;  4QJ5 B;  2O5G A;  4GNK B;  2RGI A;  4N1F A;  2LVK A;  1XO5 A;  3CTN A;  1YX8 A;  2MJW B;  4BY5 A;  4Q04 A;  3I5G C;  2NXQ A;  2KAV A;  3OB1 B;  1BMO A;  1CDL A;  1M39 A;  1KK7 Y;  2EHB A;  1RRO A;  1OZO A;  1DTL A;  3CWG A;  2H61 C;  1NWD A;  1YVL A;  3TUY B;  1IG5 A;  2LP2 A;  1JFK A;  1LA3 A;  4GBA A;  4PCW A;  3NSI A;  1CFP A;  2WCF A;  3A4U B;  5ER4 X;  3DVK A;  3F45 A;  4HRE E;  4IL1 A;  3SG3 A;  3ZWH A;  1JUO A;  1D1O A;  1M46 A;  4YRU A;  2JPT A;  5F6T A;  1B4C A;  2AAO A;  1J7R A;  1XFY O;  2QPT A;  4L9M A;  2M7N A;  5CPV A;  2EC6 B;  2KQY A;  2L4H A;  4ZCV A;  3SIB A;  3WHT B;  1DGV A;  4N5X A;  2ZN8 A;  1AP4 A;  2JTT A;  2KOT A;  1IQ5 A;  2LUX A;  1DJY A;  2LLS A;  2GGZ A;  3AAJ A;  4I5N B;  4PE0 A;  4GUK A;  1YVH A;  4NDC A;  1SNL A;  2KI4 B;  2LMT A;  3CR4 X;  2JXL A;  3M0W A;  1B9A A;  1NSH A;  2QAC A;  1XK4 C;  5DKN A;  3BUN B;  3SJS A;  2D8N A;  3FWB A;  4CPV A;  3VRO A;  2O60 A;  2H2K A;  3O2P A;  1QV0 A;  3E3R A;  1X02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...