1PSBA

Solution structure of calcium loaded s100b complexed to a peptide from n-terminal regulatory domain of ndr kinase.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-100 protein, beta chain
publication title Structure of the Ca(2+)/S100B/NDR Kinase Peptide Complex: Insights into S100 Target Specificity and Activation of the Kinase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 36
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1psbA00
2GGMA 1IJ6A 1BR1B 1J7PA 1F4QA 2M97A 4MRYA 2CT9A 1KWOB 3CZTX 4OKHA 1EG3A 2V53A 4DUQA 1DMOA 1H4BA 1MXLC 1F4OA 2G9BA 1V1GA 3BYAA 1TNXA 1TOPA 2KI6C 3TS5C 4E68A 2NLNA 2NZ0A 3OB2B 1F8HA 5KU1A 2JULA 1KFUS 5CSIA 2KI6D 4CFQA 3AAKA 1CDNA 1DJGA 1K9KA 2F2PA 2LLTA 1CKKA 1IQ3A 3CR5X 2M49B 1SCMB 2ZN8A 5F6TA 1XFXO 5AERA 1PSRA 3PATA 2OTGB 1IGVA 1K93D 4QJ3B 1NYAA 3JTDB 1JFKA 4MZJA 1A2XA 1PALA 1NX1A 2QACA 3TDIA 2GGZA 3I5HC 2WCBA 2K7BA 4WQ3A 1AP4A 1GGZA 1K96A 1ZFSA 3LK0A 5JJGA 5AXIA 2LP2A 4HREE 1AUIB 2CXJA 1JF2A 2CCMA 1EL4A 1DGUA 2E30A 5AEQA 2O5GA 1JBAA 1CMFA 2CBLA 1RTP1 5AFPA 3OB1B 1B9AA 1SNLA 2TN4A 1QTXA 1SL9A 3NSLA 4MZKA 2LLUA 1JSAA 3DVJA 2LHIA 3DD4A 3VGOA 1CLBA 2LVIA 3VRPA 4MSPA 1IKUA 4A4BA 1XFWO 2VRGA 3IQQA 1B8CA 1N65A 1Y1AA 1FF1A 1J55A 1SCVA 1HT9A 3HX4A 1SMGA 1PVAA 1ALVA 1KFXL 1YX8A 2H61A 4HRGA 4MBEA 1KWOC 1YVHA 1ODBA 4AQJA 3BUWB 5B8IB 1C7VA 2LP3A 2BBMA 2MHHA 1S1EA 3TS5B 4YI9A 2ZNDA 1ZUZA 4OVNF 3CLNA 5HLOA 4M2QA 3SJSA 1SRAA 4OV2A 2JNXA 2JRFA 2EGDA 2PVBA 1SBJA 1CDPA 2L5XB 1TNQA 1AJ4A 5D7FA 1J1EA 1MUXA 3TUYC 1QLSA 1SCMC 4GBAA 1XYDA 2KBMA 1KFUL 1NX3A 2MAZA 3AAJA 3KPXA 2JT8A 2LNKA 5I2LA 2OTGC 1TN4A 2L98A 1B7TZ 1NCXA 1YTZC 2MLEC 2FCEA 4WRIA 1L2OB 1EG4A 3VRQA 2BECA 2KHNA 2FJUB 1PULA 3I5HB 2WCEA 1MHOA 3OHMB 5KTYA 2H2KA 2LCPA 1XFYO 2HQ8A 3IF7A 2H61C 1CLLA 1RFJA 1SK6D 1VRKA 2AUCA 3F45A 4HRHA 1ALWA 2LV7A 2JTZA 5CSNA 4CFRA 3ZNIA 4MEWA 2KYFA 1C7WA 1OZOA 2MJWB 1DT7B 3A4UB 4AQIA 4AOMA 1M63B 4C0KA 2BCXA 2I94A 4DCKA 4N5XA 1CFPA 4PE1A 1B8RA 1NX2A 5J3XA 4GNKB 1M46A 1DTLA 4PE0A 2M7LA 1NCYA 2JU0A 1TCOB 2WORA 4QJ4B 2JZIA 2KAYA 1XA5A 3JVTB 1QX7A 1BMOA 4NDCA 1TIZA 3VROA 2KOTA 1NIWA 1B4CA 2K7OA 3PFVA 4PE7A 4FTGA 2ZRSA 2KQ6A 2KGBC 4CIDA 1OMRA 4ETOA 2BCBA 1EJ3A 1XVJA 1S6IA 1WDCC 2CNPA 3OX5A 5DKQA 1XFUO 4TNCA 1OMVA 3FWCA 2K0JA 3K21A 4OCIA 1A4PA 1UHHA 1ZMZA 2LUCA 2KFGA 1IQ5A 2NCOA 2M0RA 2KDHA 1E8AA 1QV1A 2SASA 1K8UA 1OSAA 1NWDA 1W7JB 1TTXA 1BJFA 1UHJA 3TUYB 2LUXA 1R2UA 4C0LA 2JTTA 1QX2A 5G08A 3EKJA 4NQGA 1AVSA 5FYXA 1L2OC 3WNXB 2P6BB 3BQ3A 3CS1A 1GQMA 1UURA 1BR4B 1PVBA 2PASA 4MN0A 4PDZA 1K94A 1QASA 3FIAA 4JPZB 3IQOA 2HETA 1BODA 1PK0D 3GK2A 1SYMA 1CM4A 2MRDA 1W7IB 2LLSA 5DKRA 2LVJA 2WOSA 2Q91A 1X02A 1QV0A 1IH0A 3GOFA 4FQOA 1S6JA 1QIWA 3WHTB 2BE6A 3PM8A 4OR9B 4YBHB 2R2IA 2BKIB 2BCAA 2M9GA 3I5IC 4YI8A 4MLWA 5JOLA 1KK8C 3SIBA 3O78A 2DOQA 1C07A 1UHIA 3I5GC 1S6CA 1FPWA 2LE9B 3JVTC 1QXPA 2OPOA 2M29A 3EVVA 4MRXA 1TRFA 1KK7Y 1QS7A 1BT6A 1RECA 1JFJA 3SIAA 1CTRA 2L2EA 1MWNA 1TCFA 2LAPA 2PRUA 2LM5A 2ZRTA 4I5NB 2LHLA 1WDCB 1PRWA 2AAOA 2I7AA 1B1GA 1NSHA 5HYDA 4XYNA 1BF5A 1XO5A 1YR5A 2KAXA 1WLZA 3O4YA 3C1VA 5HKWA 1IG5A 1G33A 1JF0A 1K9PA 1UP5A 3DVMA 5KSZA 1KSMA 5HKZA 2FCDA 1J7OA 1ZACA 2F2OA 5D69A 4ZCUA 4DIRA 2ISDA 5BPJA 2KBIA 3BUOB 1Y6WA 4YGEB 1DF0B 1A75B 1QJTA 1NX0A 2Y4QA 3CGAA 2M1KB 4PE4A 2EC6C 4I5KA 5K89A 1IRJA 1CB1A 2WC8A 1CDLA 1YX7A 2A4JA 2KGRA 2HPSA 4I5JA 1Y1XA 5I8NA 1S36A 4L9MA 3WXAA 3LLEA 1B47A 1U5IB 3LL8B 4GGNA 3VRRA 1KSOA 1H8BA 1SR6B 1J1DA 3ICBA 4D1EA 5IBWA 1WRKA 2BBNA 3KF9A 1OE9B 1LVCD 2WCFA 2B1UA 1KCYA 2M3WA 4PHNA 4YGDB 3I5IB 1RJVA 3RM1A 2K7CA 1LXFC 1ZOTB 3SG3A 1DF0A 1A75A 1KK8B 1QLKA 1SPYA 5ER4X 3AKAA 2ZFDA 3I5GB 2L50A 2OS8C 3BXKA 1GGWA 5CSJA 2JWWA 1GJYA 1OQPA 2KNEA 4I5LB 2AMIA 3BOWB 3GK4X 2K8MB 4WQ2A 1RWYA 2JXCA 2MLFC 4ORAB 1UHKA 1DJIA 3LCPC 4PHKA 2JOJA 1JC2A 3AKBA 3EVRA 1U5IA 4DS7A 2BE4A 2JXLA 4A4CA 1OZSA 1AJ5A 3O6BA 2M1UA 3OP0A 1L7ZA 4YGAA 4IL1A 1K95A 1S5GZ 1G4YR 3RLZA 2BL0C 4N1GA 3HCMA 3BUNB 3PSRA 1YUUA 3M0WA 1EH2A 4M2PA 5DKNA 2NCPA 2F33A 1SKTA 2Y5IA 4GFTA 1XK4A 4PHJA 1CFDA 1RROA 4F0ZB 1N0YA 4YGBB 3KEVA 1MXEA 3BOWA 4Q04A 1K90D 1A29A 1YRTB 2HF5A 1V1FA 1SY9A 1KQMC 2EC6B 1N2DA 2D8NA 1WLMA 4YGCB 1CNPA 3D10A 3SG7A 1YVLA 2Q4UA 1JUOA 1LA3A 2KI4C 3CR4X 1SL7A 3H4SE 1UHNA 5GQQC 2EHBA 2G2BA 4YRUA 1NPQA 3E3RA 3FS7A 1IWQA 4DRWA 5TNCA 1MR8A 3TDUA 1EXRA 1F70A 1DJXA 1SR6C 1NUBA 2E6WA 2QPTA 3PLFB 2PMYA 3I5FB 5ER5A 2MBXA 3CR2A 2LMUA 1OOJA 3BUMB 2F3ZA 3EK4A 2JC2A 3TDZA 4MZLA 1QVIZ 3NSKA 1B7TY 1UWOA 2JQ6A 2F8PA 4QJ5B 3NXAA 3A8RA 5CPVA 4ICBA 2ZN9A 1BOCA 1TNWA 2LMTA 4GUKA 4XJKB 3SG6A 1K9UA 1MQ1A 3TZ1A 2M8UA 3EK7A 1DJHA 1M39A 2KQYA 2PALA 1XK4C 2O60A 4MVFA 1CFFA 1MF8B 1J7QA 1NP8A 2OS8B 4JQ0D 1QIVA 1R6PA 2NXQA 2SCPA 1CDMA 2K2AA 2KFFA 2LVKA 4JWQA 2IS9A 3EKHA 1G8IA 1Y0VH 2F3YA 3PALA 2Y1NA 2GV5A 1F55A 5AANA 4UPGA 1AHRA 1LINA 1Y1UA 3OX6A 1YRUB 1A03A 2KYCA 3PN7C 2K7DA 4PCWA 4GPLB 1D1OA 4P5OE 1KQVA 1LKJA 2BL0B 2LVVA 5HKYA 1CM1A 1S3PA 1YUTA 2LMVA 1RK9A 4PALA 4NDBA 1YUSA 3KHEA 4XJKA 1CMGA 5PALA 3GK1A 1CLMA 1BU3A 1HQVA 2L4IA 5CSFA 4P2YB 1WRLA 5HLVA 1Q80A 2K2FA 1CFCA 1FI5A 2LANA 1OMDA 2KSPA 2JT0A 2JPTA 1KQMB 2L0PA 1JWDA 1S5GY 3EK8A 2KI4B 4GAOA 3DVEA 3SG4A 1FBVA 1WRZA 3SG2A 3CWGA 4ORCB 1AK8A 3VRNA 5I2OA 1DVIA 1UUSA 3I5FC 2MA2A 4HSZA 4M2OA 2JNFA 4GGFA 3D0YB 2K61A 3ZWHA 3KO0A 2HQWA 4C0JA 3CTNA 2JT3A 3JTDC 2WNDA 1F71A 2PSRA 3BUXB 4NDDA 2FOTA 2L51A 4U8DA 3NSOA 4BY4A 1K2HA 3SG5A 1SW8A 1QATA 1WY9A 1QX5B 1IJ5A 2I18A 3DF0B 3FWBA 2KFHA 1S26D 4ORBB 1FW4A 2I2RE 2KAVA 2L4HA 3WHUB 1B8LA 1KK7Z 1DGVA 1XFZO 4CLNA 3EVUA 3DVKA 4USLA 5I2QA 1F54A 2Y1MA 1QVIY 3O2PA 4PHMA 1YURA 3QRXA 1BG1A 2M7NA 2CTNA 4R1EA 4ZCVA 1M45A 1DJYA 3NSIA 4CPVA 4N1FA 4BY5A 3D0YA 1KFXS 3LK1A 3PN7B 1J7RA 1DJZA 1NCZA 1XFVO 1FI6A 2BKHB 2RGIA 1M31A 1BLQA 4GGFC 1SL8A 2COLB 3MSEB 2ZNEA 2ZKMX 1TNPA 2LC5A 1PSBA 1LA0A 1DJWA 3DF0A
chains in the Genus database with same CATH superfamily
2GGMA 1IJ6A 1BR1B 1J7PA 1F4QA 3D77A 5FI2A 2M97A 3S0GA 4MRYA 2CT9A 1KWOB 3CZTX 4OKHA 1EG3A 2V53A 4DUQA 1DMOA 1H4BA 1MXLC 1F4OA 2G9BA 1V1GA 3BYAA 1TNXA 1TOPA 2KI6C 3TS5C 4E68A 2NLNA 2NZ0A 3OB2B 1TWOA 1F8HA 2P71A 5KU1A 2JULA 1KFUS 2WCHA 5CSIA 2KI6D 1XFRA 4CFQA 3AAKA 1CDNA 1DJGA 1K9KA 2F2PA 2LLTA 1CKKA 1IQ3A 1DELA 3CR5X 3S0EA 2M49B 1SCMB 2ZN8A 5F6TA 1XFXO 5AERA 1PSRA 3PATA 2OTGB 1IGVA 1K93D 3Q8IA 2QEVA 4QJ3B 1NYAA 3JTDB 1JFKA 2P70A 1A2XA 1PALA 4MZJA 1DEKA 3L4AA 1NX1A 2QACA 3S0AA 3TDIA 2GGZA 3I5HC 2WCBA 2K7BA 4WQ3A 1AP4A 1GGZA 1K96A 1ZFSA 3LK0A 5JJGA 5AXIA 1TUJA 5HL1A 2LP2A 4HREE 1AUIB 2CXJA 3CDNA 1JF2A 2CCMA 1EL4A 1DGUA 2E30A 5AEQA 2O5GA 1JBAA 3DYEA 1CMFA 2CBLA 1RTP1 5AFPA 3OB1B 1B9AA 1SNLA 2TN4A 1QTXA 2KPHA 1SL9A 3NSLA 3PJIA 4MZKA 2LLUA 1JSAA 3DVJA 2LHIA 3DD4A 3VB1A 3VGOA 2LVIA 1CLBA 1DQEA 3VRPA 4MSPA 4IJ7A 1IKUA 4A4BA 1XFWO 2VRGA 3IQQA 1B8CA 1N65A 1Y1AA 1FF1A 1J55A 1SCVA 1HT9A 3HX4A 1SMGA 1PVAA 1ALVA 1KFXL 1YX8A 2H61A 3OBVA 4HRGA 1IIOA 4MBEA 1KWOC 1YVHA 1ODBA 4AQJA 3BUWB 4INXA 5B8IB 1C7VA 2LP3A 2BBMA 2MHHA 1S1EA 3TS5B 4YI9A 2ZNDA 1ZUZA 4OVNF 3CLNA 5HLOA 4M2QA 3SJSA 1SRAA 3D73A 4OV2A 2JNXA 2JRFA 2EGDA 2PVBA 1SBJA 1CDPA 2L5XB 1TNQA 1AJ4A 2H8VA 5D7FA 1J1EA 1MUXA 3CABA 3TUYC 1QLSA 1SCMC 4GBAA 1XYDA 2KBMA 1KFUL 1NX3A 2MAZA 3AAJA 3KPXA 2JT8A 2LNKA 3N7HA 5I2LA 2OTGC 1TN4A 2L98A 1B7TZ 1NCXA 1YTZC 2MLEC 2WCJA 2FCEA 4WRIA 1L2OB 1EG4A 3VRQA 2BECA 2KHNA 2FJUB 1PULA 3I5HB 2WCEA 1MHOA 3OHMB 3R1OA 2H2KA 2LCPA 5KTYA 1XFYO 2HQ8A 3IF7A 2H61C 1CLLA 1LS8A 1RFJA 1SK6D 1VRKA 2AUCA 3F45A 4HRHA 1ALWA 2LV7A 2JTZA 5CSNA 4CFRA 3ZNIA 4MEWA 2KYFA 1C7WA 1OZOA 2MJWB 1DT7B 3A4UB 4AQIA 4AOMA 1M63B 4C0KA 2BCXA 2I94A 4DCKA 2L5YA 4N5XA 1CFPA 1TUZA 4PE1A 3BFAA 1B8RA 1NX2A 5J3XA 4GNKB 1M46A 1DTLA 3FE8A 4PE0A 2M7LA 1NCYA 2JU0A 1TCOB 2WORA 4QJ4B 2JZIA 2KAYA 1XA5A 3JVTB 1QX7A 1BMOA 4NDCA 1TIZA 3VROA 2KOTA 1NIWA 1B4CA 2K7OA 3PFVA 4PE7A 4FTGA 2ZRSA 2KQ6A 2KGBC 4CIDA 1OMRA 4ETOA 1EJ3A 1XVJA 1S6IA 1WDCC 2BCBA 2CNPA 3OX5A 5DKQA 1XFUO 4TNCA 1OMVA 3RZSA 3FWCA 2K0JA 3K21A 4OCIA 1A4PA 1UHHA 1ZMZA 2LUCA 2KFGA 1IQ5A 2NCOA 2M0RA 2KDHA 4INWA 4JKTA 1E8AA 3DZTA 1QV1A 2SASA 1K8UA 1OSAA 2WCKA 1NWDA 1W7JB 3D78A 1TTXA 1BJFA 1UHJA 3R72A 2LUXA 1R2UA 3BFHA 3TUYB 4C0LA 2JTTA 1QX2A 1W9ZA 5G08A 3NGVA 1GM0A 3EKJA 1Z2CB 4NQGA 1AVSA 5FYXA 1L2OC 3WNXB 2P6BB 3BQ3A 3CS1A 3D75A 1GQMA 1UURA 1BR4B 1PVBA 2PASA 4MN0A 4PDZA 1K94A 1QASA 3FIAA 4JPZB 3IQOA 2HETA 1BODA 1PK0D 3GK2A 1SYMA 1CM4A 2BAPA 3DXLA 2MRDA 1W7IB 2LLSA 4PT1A 5DKRA 2LVJA 2WOSA 2Q91A 1X02A 1QV0A 1IH0A 3GOFA 3CYZA 4FQOA 3D74A 1S6JA 1QIWA 3WHTB 2BE6A 3PM8A 4OR9B 4YBHB 2R2IA 2BKIB 2BCAA 2M9GA 3I5IC 1P28A 4YI8A 4MLWA 5JOLA 1KK8C 3SIBA 3O78A 2DOQA 1C07A 1UHIA 3I5GC 1S6CA 1FPWA 2LE9B 3JVTC 1QXPA 2OPOA 2M29A 3EVVA 3NHTA 4MRXA 1TRFA 1KK7Y 1QS7A 1BT6A 1RECA 1JFJA 3SIAA 1CTRA 2L2EA 3FE6A 1MWNA 1TCFA 2LAPA 2PRUA 2QEOA 3K1EA 2LM5A 2ZRTA 4I5NB 2LHLA 1WDCB 1PRWA 3L4LA 2AAOA 1OOIX 2I7AA 1B1GA 1NSHA 5HYDA 4XYNA 1BF5A 1XO5A 1YR5A 2KAXA 1WLZA 3CZ0A 3C1VA 3NHIA 1IG5A 1G33A 3O4YA 5HKWA 1JF0A 3B7AA 1K9PA 1UP5A 3DVMA 5KSZA 1KSMA 5HKZA 2FCDA 1J7OA 1ZACA 2F2OA 1CMGA 5D69A 4ZCUA 4DIRA 2ISDA 5BPJA 2KBIA 3BUOB 1Y6WA 4YGEB 1DC1A 1DF0B 1A75B 1QJTA 1NX0A 2Y4QA 3CGAA 2M1KB 4PE4A 2EC6C 4I5KA 5K89A 1IRJA 3FE9A 2WC8A 1CB1A 1CDLA 1YX7A 2A4JA 2KGRA 3PM2A 2K60A 3SS5A 2HPSA 4I5JA 2FJYA 3R1VA 1Y1XA 5I8NA 1S36A 4L9MA 1QWVA 3WXAA 3LLEA 3B6XA 1B47A 1U5IB 3LL8B 4GGNA 3VRRA 1KSOA 1T14A 1H8BA 1SR6B 1J1DA 3ICBA 4D1EA 5IBWA 1WRKA 2BBNA 3KF9A 2WCMA 1OE9B 1LVCD 2WCFA 2B1UA 1KCYA 2PQLA 2M3WA 4PHNA 4YGDB 1ORGA 3I5IB 1RJVA 3RM1A 2K7CA 3R1PA 1LXFC 1ZOTB 3SG3A 1DF0A 1A75A 1KK8B 1QLKA 1SPYA 5ER4X 3AKAA 2ZFDA 3I5GB 2L50A 2OS8C 3BXKA 1GGWA 5CSJA 2JWWA 1GJYA 1OQPA 1C3ZA 2KNEA 3BJHA 2AMIA 3BOWB 3GK4X 2K8MB 4I5LB 1RWYA 2JXCA 2MLFC 4ORAB 4WQ2A 1UHKA 1DJIA 3LCPC 4PHKA 2JOJA 1JC2A 3AKBA 3EVRA 3OGNA 1U5IA 4DS7A 1OOHA 2BE4A 2JXLA 4A4CA 1OZSA 3V2LA 1AJ5A 3O6BA 2M1UA 3OP0A 5FI7A 1L7ZA 4YGAA 4IL1A 1K95A 1S5GZ 1G4YR 3RLZA 1SSEB 2BL0C 4N1GA 3HCMA 3BUNB 3PSRA 1YUUA 3M0WA 1EH2A 4M2PA 5DKNA 2NCPA 2F33A 1SKTA 2Y5IA 4GFTA 3EG5B 1XK4A 4PHJA 1CFDA 1RROA 4F0ZB 1N0YA 4YGBB 2ERBA 3KEVA 1MXEA 2JPOA 3BOWA 1OOFA 3O4XA 4Q04A 1K90D 1A29A 1YRTB 2HF5A 1V1FA 1SY9A 1KQMC 2EC6B 1N2DA 2D8NA 1WLMA 4YGCB 1CNPA 3D10A 3SG7A 1YVLA 2Q4UA 1JUOA 1LA3A 2KI4C 3CR4X 1SL7A 3H4SE 1UHNA 5FI6A 5GQQC 2EHBA 2G2BA 4YRUA 1NPQA 3E3RA 3FS7A 1IWQA 4DRWA 5TNCA 1MR8A 3TDUA 1EXRA 1F70A 1DJXA 1SR6C 1NUBA 2E6WA 2QPTA 3UNWA 3PLFB 2PMYA 1C3YA 3I5FB 5ER5A 2MBXA 3CR2A 2LMUA 1OOJA 3BUMB 2F3ZA 3EK4A 2JC2A 3TDZA 4MZLA 1QVIZ 3NSKA 1B7TY 3CZ2A 1UWOA 2JQ6A 2F8PA 2QEHA 4QJ5B 5D3OA 3NXAA 3A8RA 2PYQA 5CPVA 4ICBA 2ZN9A 1BOCA 1TNWA 2LMTA 4GUKA 4XJKB 3SG6A 1K9UA 1MQ1A 3TZ1A 2M8UA 3EK7A 1DJHA 1M39A 2KQYA 2PALA 1XK4C 2O60A 4MVFA 1CFFA 1MF8B 2QDIA 1NP8A 2OS8B 3B87A 4JQ0D 1QIVA 1J7QA 1R6PA 2NXQA 2SCPA 1CDMA 2K2AA 2KFFA 2QEBA 2LVKA 4JWQA 2IS9A 1Z4HA 3EKHA 1G8IA 1Y0VH 2F3YA 3PALA 2Y1NA 4OZDA 2GV5A 1F55A 5AANA 4UPGA 1AHRA 1LINA 1Y1UA 3OX6A 1YRUB 2KLDA 1A03A 2KYCA 3PN7C 2K7DA 4PCWA 3D76A 4GPLB 1D1OA 4P5OE 1KQVA 1LKJA 2BL0B 2LVVA 5HKYA 1CM1A 1S3PA 1YUTA 2LMVA 4KYNA 1RK9A 4PALA 4NDBA 1YUSA 3B86A 3KHEA 4XJKA 5PALA 3GK1A 4F7FA 1CLMA 1BU3A 1HQVA 2L4IA 5CSFA 4P2YB 1WRLA 5HLVA 4FQTA 2L2CA 1Q80A 2K2FA 1CFCA 1FI5A 2WC5A 2LANA 1OMDA 2KSPA 2JT0A 5DICA 2JPTA 1KQMB 2L0PA 1JWDA 3S0DA 1S5GY 3EK8A 2KI4B 4GAOA 3DVEA 3SG4A 5I94A 1FBVA 1WRZA 3SG2A 3B88A 2WC6A 3CWGA 4ORCB 1AK8A 3VRNA 5I2OA 1DVIA 1UUSA 3I5FC 2MA2A 4HSZA 4M2OA 2JNFA 4GGFA 3D0YB 1OOGA 2K61A 3ZWHA 3KO0A 2HQWA 4C0JA 3CTNA 2JT3A 3JTDC 2WNDA 1F71A 2PSRA 3BUXB 4NDDA 2FOTA 3L47A 2L51A 4U8DA 3NSOA 4BY4A 1K2HA 3SG5A 1SW8A 1QATA 1WY9A 1QX5B 1IJ5A 2I18A 3DF0B 3FWBA 2KFHA 4JD9A 1S26D 3S0FA 4ORBB 1FW4A 2I2RE 2KAVA 3IVTA 2L4HA 3SS4A 2GTEA 3WHUB 1B8LA 1KK7Z 1DGVA 1XFZO 4CLNA 3EVUA 3DVKA 4USLA 5I2QA 1F54A 2KLEA 3SS3A 3BFBA 2Y1MA 1QVIY 3O2PA 4PHMA 1OW4A 1YURA 3QRXA 3UO9A 2M7NA 1BG1A 2CTNA 4R1EA 4ZCVA 3CZ1A 1M45A 1DJYA 3NSIA 4CPVA 2YGUA 2WCLA 4N1FA 4BY5A 3D0YA 1KFXS 3LK1A 3PN7B 1J7RA 1DJZA 1NCZA 1XFVO 5EL2A 1FI6A 2BKHB 2RGIA 1M31A 1BLQA 4GGFC 1SL8A 2COLB 3MSEB 2ZNEA 2ZKMX 1TNPA 3S0BA 3DY9A 2LC5A 1PSBA 1LA0A 2BNXA 1DJWA 3DF0A 3QMEA
chains in the Genus database with same CATH topology
2GGMA 1IJ6A 1BR1B 1J7PA 1F4QA 2M97A 4MRYA 2CT9A 1KWOB 3CZTX 4OKHA 1EG3A 2V53A 4DUQA 1DMOA 1H4BA 1MXLC 1F4OA 2G9BA 1V1GA 3BYAA 1TNXA 1TOPA 2KI6C 3TS5C 4E68A 2NLNA 2NZ0A 3OB2B 1F8HA 5KU1A 2JULA 1KFUS 5CSIA 2KI6D 4CFQA 3AAKA 1CDNA 1DJGA 1K9KA 2F2PA 2LLTA 1CKKA 1IQ3A 3CR5X 2M49B 1SCMB 2ZN8A 5F6TA 1XFXO 5AERA 1PSRA 3PATA 2OTGB 1IGVA 1K93D 4QJ3B 1NYAA 3JTDB 1JFKA 4MZJA 1A2XA 1PALA 1NX1A 2QACA 3TDIA 2GGZA 3I5HC 2WCBA 2K7BA 4WQ3A 1AP4A 1GGZA 1K96A 1ZFSA 3LK0A 5JJGA 5AXIA 2LP2A 4HREE 1AUIB 2CXJA 1JF2A 2CCMA 1EL4A 1DGUA 2E30A 5AEQA 2O5GA 1JBAA 1CMFA 2CBLA 1RTP1 5AFPA 3OB1B 1B9AA 1SNLA 2TN4A 1QTXA 1SL9A 3NSLA 4MZKA 2LLUA 1JSAA 3DVJA 2LHIA 3DD4A 3VGOA 1CLBA 2LVIA 3VRPA 4MSPA 1IKUA 4A4BA 1XFWO 2VRGA 3IQQA 1B8CA 1N65A 1Y1AA 1FF1A 1J55A 1SCVA 1HT9A 3HX4A 1SMGA 1PVAA 1ALVA 1KFXL 1YX8A 2H61A 4HRGA 4MBEA 1KWOC 1YVHA 1ODBA 4AQJA 3BUWB 5B8IB 1C7VA 2LP3A 2BBMA 2MHHA 1S1EA 3TS5B 4YI9A 2ZNDA 1ZUZA 4OVNF 3CLNA 5HLOA 4M2QA 3SJSA 1SRAA 4OV2A 2JNXA 2JRFA 2EGDA 2PVBA 1SBJA 1CDPA 2L5XB 1TNQA 1AJ4A 5D7FA 1J1EA 1MUXA 3TUYC 1QLSA 1SCMC 4GBAA 1XYDA 2KBMA 1KFUL 1NX3A 2MAZA 3AAJA 3KPXA 2JT8A 2LNKA 5I2LA 2OTGC 1TN4A 2L98A 1B7TZ 1NCXA 1YTZC 2MLEC 2FCEA 4WRIA 1L2OB 1EG4A 3VRQA 2BECA 2KHNA 2FJUB 1PULA 3I5HB 2WCEA 1MHOA 3OHMB 5KTYA 2H2KA 2LCPA 1XFYO 2HQ8A 3IF7A 2H61C 1CLLA 1RFJA 1SK6D 1VRKA 2AUCA 3F45A 4HRHA 1ALWA 2LV7A 2JTZA 5CSNA 4CFRA 3ZNIA 4MEWA 2KYFA 1C7WA 1OZOA 2MJWB 1DT7B 3A4UB 4AQIA 4AOMA 1M63B 4C0KA 2BCXA 2I94A 4DCKA 4N5XA 1CFPA 4PE1A 1B8RA 1NX2A 5J3XA 4GNKB 1M46A 1DTLA 4PE0A 2M7LA 1NCYA 2JU0A 1TCOB 2WORA 4QJ4B 2JZIA 2KAYA 1XA5A 3JVTB 1QX7A 1BMOA 4NDCA 1TIZA 3VROA 2KOTA 1NIWA 1B4CA 2K7OA 3PFVA 4PE7A 4FTGA 2ZRSA 2KQ6A 2KGBC 4CIDA 1OMRA 4ETOA 2BCBA 1EJ3A 1XVJA 1S6IA 1WDCC 2CNPA 3OX5A 5DKQA 1XFUO 4TNCA 1OMVA 3FWCA 2K0JA 3K21A 4OCIA 1A4PA 1UHHA 1ZMZA 2LUCA 2KFGA 1IQ5A 2NCOA 2M0RA 2KDHA 1E8AA 1QV1A 2SASA 1K8UA 1OSAA 1NWDA 1W7JB 1TTXA 1BJFA 1UHJA 3TUYB 2LUXA 1R2UA 4C0LA 2JTTA 1QX2A 5G08A 3EKJA 4NQGA 1AVSA 5FYXA 1L2OC 3WNXB 2P6BB 3BQ3A 3CS1A 1GQMA 1UURA 1BR4B 1PVBA 2PASA 4MN0A 4PDZA 1K94A 1QASA 3FIAA 4JPZB 3IQOA 2HETA 1BODA 1PK0D 3GK2A 1SYMA 1CM4A 2MRDA 1W7IB 2LLSA 5DKRA 2LVJA 2WOSA 2Q91A 1X02A 1QV0A 1IH0A 3GOFA 4FQOA 1S6JA 1QIWA 3WHTB 2BE6A 3PM8A 4OR9B 4YBHB 2R2IA 2BKIB 2BCAA 2M9GA 3I5IC 4YI8A 4MLWA 5JOLA 1KK8C 3SIBA 3O78A 2DOQA 1C07A 1UHIA 3I5GC 1S6CA 1FPWA 2LE9B 3JVTC 1QXPA 2OPOA 2M29A 3EVVA 4MRXA 1TRFA 1KK7Y 1QS7A 1BT6A 1RECA 1JFJA 3SIAA 1CTRA 2L2EA 1MWNA 1TCFA 2LAPA 2PRUA 2LM5A 2ZRTA 4I5NB 2LHLA 1WDCB 1PRWA 2AAOA 2I7AA 1B1GA 1NSHA 5HYDA 4XYNA 1BF5A 1XO5A 1YR5A 2KAXA 1WLZA 3O4YA 3C1VA 5HKWA 1IG5A 1G33A 1JF0A 1K9PA 1UP5A 3DVMA 5KSZA 1KSMA 5HKZA 2FCDA 1J7OA 1ZACA 2F2OA 5D69A 4ZCUA 4DIRA 2ISDA 5BPJA 2KBIA 3BUOB 1Y6WA 4YGEB 1DF0B 1A75B 1QJTA 1NX0A 2Y4QA 3CGAA 2M1KB 4PE4A 2EC6C 4I5KA 5K89A 1IRJA 1CB1A 2WC8A 1CDLA 1YX7A 2A4JA 2KGRA 2HPSA 4I5JA 1Y1XA 5I8NA 1S36A 4L9MA 3WXAA 3LLEA 1B47A 1U5IB 3LL8B 4GGNA 3VRRA 1KSOA 1H8BA 1SR6B 1J1DA 3ICBA 4D1EA 5IBWA 1WRKA 2BBNA 3KF9A 1OE9B 1LVCD 2WCFA 2B1UA 1KCYA 2M3WA 4PHNA 4YGDB 3I5IB 1RJVA 3RM1A 2K7CA 1LXFC 1ZOTB 3SG3A 1DF0A 1A75A 1KK8B 1QLKA 1SPYA 5ER4X 3AKAA 2ZFDA 3I5GB 2L50A 2OS8C 3BXKA 1GGWA 5CSJA 2JWWA 1GJYA 1OQPA 2KNEA 4I5LB 2AMIA 3BOWB 3GK4X 2K8MB 4WQ2A 1RWYA 2JXCA 2MLFC 4ORAB 1UHKA 1DJIA 3LCPC 4PHKA 2JOJA 1JC2A 3AKBA 3EVRA 1U5IA 4DS7A 2BE4A 2JXLA 4A4CA 1OZSA 1AJ5A 3O6BA 2M1UA 3OP0A 1L7ZA 4YGAA 4IL1A 1K95A 1S5GZ 1G4YR 3RLZA 2BL0C 4N1GA 3HCMA 3BUNB 3PSRA 1YUUA 3M0WA 1EH2A 4M2PA 5DKNA 2NCPA 2F33A 1SKTA 2Y5IA 4GFTA 1XK4A 4PHJA 1CFDA 1RROA 4F0ZB 1N0YA 4YGBB 3KEVA 1MXEA 3BOWA 4Q04A 1K90D 1A29A 1YRTB 2HF5A 1V1FA 1SY9A 1KQMC 2EC6B 1N2DA 2D8NA 1WLMA 4YGCB 1CNPA 3D10A 3SG7A 1YVLA 2Q4UA 1JUOA 1LA3A 2KI4C 3CR4X 1SL7A 3H4SE 1UHNA 5GQQC 2EHBA 2G2BA 4YRUA 1NPQA 3E3RA 3FS7A 1IWQA 4DRWA 5TNCA 1MR8A 3TDUA 1EXRA 1F70A 1DJXA 1SR6C 1NUBA 2E6WA 2QPTA 3PLFB 2PMYA 3I5FB 5ER5A 2MBXA 3CR2A 2LMUA 1OOJA 3BUMB 2F3ZA 3EK4A 2JC2A 3TDZA 4MZLA 1QVIZ 3NSKA 1B7TY 1UWOA 2JQ6A 2F8PA 4QJ5B 3NXAA 3A8RA 5CPVA 4ICBA 2ZN9A 1BOCA 1TNWA 2LMTA 4GUKA 4XJKB 3SG6A 1K9UA 1MQ1A 3TZ1A 2M8UA 3EK7A 1DJHA 1M39A 2KQYA 2PALA 1XK4C 2O60A 4MVFA 1CFFA 1MF8B 1J7QA 1NP8A 2OS8B 4JQ0D 1QIVA 1R6PA 2NXQA 2SCPA 1CDMA 2K2AA 2KFFA 2LVKA 4JWQA 2IS9A 3EKHA 1G8IA 1Y0VH 2F3YA 3PALA 2Y1NA 2GV5A 1F55A 5AANA 4UPGA 1AHRA 1LINA 1Y1UA 3OX6A 1YRUB 1A03A 2KYCA 3PN7C 2K7DA 4PCWA 4GPLB 1D1OA 4P5OE 1KQVA 1LKJA 2BL0B 2LVVA 5HKYA 1CM1A 1S3PA 1YUTA 2LMVA 1RK9A 4PALA 4NDBA 1YUSA 3KHEA 4XJKA 1CMGA 5PALA 3GK1A 1CLMA 1BU3A 1HQVA 2L4IA 5CSFA 4P2YB 1WRLA 5HLVA 1Q80A 2K2FA 1CFCA 1FI5A 2LANA 1OMDA 2KSPA 2JT0A 2JPTA 1KQMB 2L0PA 1JWDA 1S5GY 3EK8A 2KI4B 4GAOA 3DVEA 3SG4A 1FBVA 1WRZA 3SG2A 3CWGA 4ORCB 1AK8A 3VRNA 5I2OA 1DVIA 1UUSA 3I5FC 2MA2A 4HSZA 4M2OA 2JNFA 4GGFA 3D0YB 2K61A 3ZWHA 3KO0A 2HQWA 4C0JA 3CTNA 2JT3A 3JTDC 2WNDA 1F71A 2PSRA 3BUXB 4NDDA 2FOTA 2L51A 4U8DA 3NSOA 4BY4A 1K2HA 3SG5A 1SW8A 1QATA 1WY9A 1QX5B 1IJ5A 2I18A 3DF0B 3FWBA 2KFHA 1S26D 4ORBB 1FW4A 2I2RE 2KAVA 2L4HA 3WHUB 1B8LA 1KK7Z 1DGVA 1XFZO 4CLNA 3EVUA 3DVKA 4USLA 5I2QA 1F54A 2Y1MA 1QVIY 3O2PA 4PHMA 1YURA 3QRXA 1BG1A 2M7NA 2CTNA 4R1EA 4ZCVA 1M45A 1DJYA 3NSIA 4CPVA 4N1FA 4BY5A 3D0YA 1KFXS 3LK1A 3PN7B 1J7RA 1DJZA 1NCZA 1XFVO 1FI6A 2BKHB 2RGIA 1M31A 1BLQA 4GGFC 1SL8A 2COLB 3MSEB 2ZNEA 2ZKMX 1TNPA 2LC5A 1PSBA 1LA0A 1DJWA 3DF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGM A;  1IJ6 A;  1BR1 B;  1J7P A;  1F4Q A;  2M97 A;  4MRY A;  2CT9 A;  1KWO B;  3CZT X;  4OKH A;  1EG3 A;  2V53 A;  4DUQ A;  1DMO A;  1H4B A;  1MXL C;  1F4O A;  2G9B A;  1V1G A;  3BYA A;  1TNX A;  1TOP A;  2KI6 C;  3TS5 C;  4E68 A;  2NLN A;  2NZ0 A;  3OB2 B;  1F8H A;  5KU1 A;  2JUL A;  1KFU S;  5CSI A;  2KI6 D;  4CFQ A;  3AAK A;  1CDN A;  1DJG A;  1K9K A;  2F2P A;  2LLT A;  1CKK A;  1IQ3 A;  3CR5 X;  2M49 B;  1SCM B;  2ZN8 A;  5F6T A;  1XFX O;  5AER A;  1PSR A;  3PAT A;  2OTG B;  1IGV A;  1K93 D;  4QJ3 B;  1NYA A;  3JTD B;  1JFK A;  4MZJ A;  1A2X A;  1PAL A;  1NX1 A;  2QAC A;  3TDI A;  2GGZ A;  3I5H C;  2WCB A;  2K7B A;  4WQ3 A;  1AP4 A;  1GGZ A;  1K96 A;  1ZFS A;  3LK0 A;  5JJG A;  5AXI A;  2LP2 A;  4HRE E;  1AUI B;  2CXJ A;  1JF2 A;  2CCM A;  1EL4 A;  1DGU A;  2E30 A;  5AEQ A;  2O5G A;  1JBA A;  1CMF A;  2CBL A;  1RTP 1;  5AFP A;  3OB1 B;  1B9A A;  1SNL A;  2TN4 A;  1QTX A;  1SL9 A;  3NSL A;  4MZK A;  2LLU A;  1JSA A;  3DVJ A;  2LHI A;  3DD4 A;  3VGO A;  1CLB A;  2LVI A;  3VRP A;  4MSP A;  1IKU A;  4A4B A;  1XFW O;  2VRG A;  3IQQ A;  1B8C A;  1N65 A;  1Y1A A;  1FF1 A;  1J55 A;  1SCV A;  1HT9 A;  3HX4 A;  1SMG A;  1PVA A;  1ALV A;  1KFX L;  1YX8 A;  2H61 A;  4HRG A;  4MBE A;  1KWO C;  1YVH A;  1ODB A;  4AQJ A;  3BUW B;  5B8I B;  1C7V A;  2LP3 A;  2BBM A;  2MHH A;  1S1E A;  3TS5 B;  4YI9 A;  2ZND A;  1ZUZ A;  4OVN F;  3CLN A;  5HLO A;  4M2Q A;  3SJS A;  1SRA A;  4OV2 A;  2JNX A;  2JRF A;  2EGD A;  2PVB A;  1SBJ A;  1CDP A;  2L5X B;  1TNQ A;  1AJ4 A;  5D7F A;  1J1E A;  1MUX A;  3TUY C;  1QLS A;  1SCM C;  4GBA A;  1XYD A;  2KBM A;  1KFU L;  1NX3 A;  2MAZ A;  3AAJ A;  3KPX A;  2JT8 A;  2LNK A;  5I2L A;  2OTG C;  1TN4 A;  2L98 A;  1B7T Z;  1NCX A;  1YTZ C;  2MLE C;  2FCE A;  4WRI A;  1L2O B;  1EG4 A;  3VRQ A;  2BEC A;  2KHN A;  2FJU B;  1PUL A;  3I5H B;  2WCE A;  1MHO A;  3OHM B;  5KTY A;  2H2K A;  2LCP A;  1XFY O;  2HQ8 A;  3IF7 A;  2H61 C;  1CLL A;  1RFJ A;  1SK6 D;  1VRK A;  2AUC A;  3F45 A;  4HRH A;  1ALW A;  2LV7 A;  2JTZ A;  5CSN A;  4CFR A;  3ZNI A;  4MEW A;  2KYF A;  1C7W A;  1OZO A;  2MJW B;  1DT7 B;  3A4U B;  4AQI A;  4AOM A;  1M63 B;  4C0K A;  2BCX A;  2I94 A;  4DCK A;  4N5X A;  1CFP A;  4PE1 A;  1B8R A;  1NX2 A;  5J3X A;  4GNK B;  1M46 A;  1DTL A;  4PE0 A;  2M7L A;  1NCY A;  2JU0 A;  1TCO B;  2WOR A;  4QJ4 B;  2JZI A;  2KAY A;  1XA5 A;  3JVT B;  1QX7 A;  1BMO A;  4NDC A;  1TIZ A;  3VRO A;  2KOT A;  1NIW A;  1B4C A;  2K7O A;  3PFV A;  4PE7 A;  4FTG A;  2ZRS A;  2KQ6 A;  2KGB C;  4CID A;  1OMR A;  4ETO A;  2BCB A;  1EJ3 A;  1XVJ A;  1S6I A;  1WDC C;  2CNP A;  3OX5 A;  5DKQ A;  1XFU O;  4TNC A;  1OMV A;  3FWC A;  2K0J A;  3K21 A;  4OCI A;  1A4P A;  1UHH A;  1ZMZ A;  2LUC A;  2KFG A;  1IQ5 A;  2NCO A;  2M0R A;  2KDH A;  1E8A A;  1QV1 A;  2SAS A;  1K8U A;  1OSA A;  1NWD A;  1W7J B;  1TTX A;  1BJF A;  1UHJ A;  3TUY B;  2LUX A;  1R2U A;  4C0L A;  2JTT A;  1QX2 A;  5G08 A;  3EKJ A;  4NQG A;  1AVS A;  5FYX A;  1L2O C;  3WNX B;  2P6B B;  3BQ3 A;  3CS1 A;  1GQM A;  1UUR A;  1BR4 B;  1PVB A;  2PAS A;  4MN0 A;  4PDZ A;  1K94 A;  1QAS A;  3FIA A;  4JPZ B;  3IQO A;  2HET A;  1BOD A;  1PK0 D;  3GK2 A;  1SYM A;  1CM4 A;  2MRD A;  1W7I B;  2LLS A;  5DKR A;  2LVJ A;  2WOS A;  2Q91 A;  1X02 A;  1QV0 A;  1IH0 A;  3GOF A;  4FQO A;  1S6J A;  1QIW A;  3WHT B;  2BE6 A;  3PM8 A;  4OR9 B;  4YBH B;  2R2I A;  2BKI B;  2BCA A;  2M9G A;  3I5I C;  4YI8 A;  4MLW A;  5JOL A;  1KK8 C;  3SIB A;  3O78 A;  2DOQ A;  1C07 A;  1UHI A;  3I5G C;  1S6C A;  1FPW A;  2LE9 B;  3JVT C;  1QXP A;  2OPO A;  2M29 A;  3EVV A;  4MRX A;  1TRF A;  1KK7 Y;  1QS7 A;  1BT6 A;  1REC A;  1JFJ A;  3SIA A;  1CTR A;  2L2E A;  1MWN A;  1TCF A;  2LAP A;  2PRU A;  2LM5 A;  2ZRT A;  4I5N B;  2LHL A;  1WDC B;  1PRW A;  2AAO A;  2I7A A;  1B1G A;  1NSH A;  5HYD A;  4XYN A;  1BF5 A;  1XO5 A;  1YR5 A;  2KAX A;  1WLZ A;  3O4Y A;  3C1V A;  5HKW A;  1IG5 A;  1G33 A;  1JF0 A;  1K9P A;  1UP5 A;  3DVM A;  5KSZ A;  1KSM A;  5HKZ A;  2FCD A;  1J7O A;  1ZAC A;  2F2O A;  5D69 A;  4ZCU A;  4DIR A;  2ISD A;  5BPJ A;  2KBI A;  3BUO B;  1Y6W A;  4YGE B;  1DF0 B;  1A75 B;  1QJT A;  1NX0 A;  2Y4Q A;  3CGA A;  2M1K B;  4PE4 A;  2EC6 C;  4I5K A;  5K89 A;  1IRJ A;  1CB1 A;  2WC8 A;  1CDL A;  1YX7 A;  2A4J A;  2KGR A;  2HPS A;  4I5J A;  1Y1X A;  5I8N A;  1S36 A;  4L9M A;  3WXA A;  3LLE A;  1B47 A;  1U5I B;  3LL8 B;  4GGN A;  3VRR A;  1KSO A;  1H8B A;  1SR6 B;  1J1D A;  3ICB A;  4D1E A;  5IBW A;  1WRK A;  2BBN A;  3KF9 A;  1OE9 B;  1LVC D;  2WCF A;  2B1U A;  1KCY A;  2M3W A;  4PHN A;  4YGD B;  3I5I B;  1RJV A;  3RM1 A;  2K7C A;  1LXF C;  1ZOT B;  3SG3 A;  1DF0 A;  1A75 A;  1KK8 B;  1QLK A;  1SPY A;  5ER4 X;  3AKA A;  2ZFD A;  3I5G B;  2L50 A;  2OS8 C;  3BXK A;  1GGW A;  5CSJ A;  2JWW A;  1GJY A;  1OQP A;  2KNE A;  4I5L B;  2AMI A;  3BOW B;  3GK4 X;  2K8M B;  4WQ2 A;  1RWY A;  2JXC A;  2MLF C;  4ORA B;  1UHK A;  1DJI A;  3LCP C;  4PHK A;  2JOJ A;  1JC2 A;  3AKB A;  3EVR A;  1U5I A;  4DS7 A;  2BE4 A;  2JXL A;  4A4C A;  1OZS A;  1AJ5 A;  3O6B A;  2M1U A;  3OP0 A;  1L7Z A;  4YGA A;  4IL1 A;  1K95 A;  1S5G Z;  1G4Y R;  3RLZ A;  2BL0 C;  4N1G A;  3HCM A;  3BUN B;  3PSR A;  1YUU A;  3M0W A;  1EH2 A;  4M2P A;  5DKN A;  2NCP A;  2F33 A;  1SKT A;  2Y5I A;  4GFT A;  1XK4 A;  4PHJ A;  1CFD A;  1RRO A;  4F0Z B;  1N0Y A;  4YGB B;  3KEV A;  1MXE A;  3BOW A;  4Q04 A;  1K90 D;  1A29 A;  1YRT B;  2HF5 A;  1V1F A;  1SY9 A;  1KQM C;  2EC6 B;  1N2D A;  2D8N A;  1WLM A;  4YGC B;  1CNP A;  3D10 A;  3SG7 A;  1YVL A;  2Q4U A;  1JUO A;  1LA3 A;  2KI4 C;  3CR4 X;  1SL7 A;  3H4S E;  1UHN A;  5GQQ C;  2EHB A;  2G2B A;  4YRU A;  1NPQ A;  3E3R A;  3FS7 A;  1IWQ A;  4DRW A;  5TNC A;  1MR8 A;  3TDU A;  1EXR A;  1F70 A;  1DJX A;  1SR6 C;  1NUB A;  2E6W A;  2QPT A;  3PLF B;  2PMY A;  3I5F B;  5ER5 A;  2MBX A;  3CR2 A;  2LMU A;  1OOJ A;  3BUM B;  2F3Z A;  3EK4 A;  2JC2 A;  3TDZ A;  4MZL A;  1QVI Z;  3NSK A;  1B7T Y;  1UWO A;  2JQ6 A;  2F8P A;  4QJ5 B;  3NXA A;  3A8R A;  5CPV A;  4ICB A;  2ZN9 A;  1BOC A;  1TNW A;  2LMT A;  4GUK A;  4XJK B;  3SG6 A;  1K9U A;  1MQ1 A;  3TZ1 A;  2M8U A;  3EK7 A;  1DJH A;  1M39 A;  2KQY A;  2PAL A;  1XK4 C;  2O60 A;  4MVF A;  1CFF A;  1MF8 B;  1J7Q A;  1NP8 A;  2OS8 B;  4JQ0 D;  1QIV A;  1R6P A;  2NXQ A;  2SCP A;  1CDM A;  2K2A A;  2KFF A;  2LVK A;  4JWQ A;  2IS9 A;  3EKH A;  1G8I A;  1Y0V H;  2F3Y A;  3PAL A;  2Y1N A;  2GV5 A;  1F55 A;  5AAN A;  4UPG A;  1AHR A;  1LIN A;  1Y1U A;  3OX6 A;  1YRU B;  1A03 A;  2KYC A;  3PN7 C;  2K7D A;  4PCW A;  4GPL B;  1D1O A;  4P5O E;  1KQV A;  1LKJ A;  2BL0 B;  2LVV A;  5HKY A;  1CM1 A;  1S3P A;  1YUT A;  2LMV A;  1RK9 A;  4PAL A;  4NDB A;  1YUS A;  3KHE A;  4XJK A;  1CMG A;  5PAL A;  3GK1 A;  1CLM A;  1BU3 A;  1HQV A;  2L4I A;  5CSF A;  4P2Y B;  1WRL A;  5HLV A;  1Q80 A;  2K2F A;  1CFC A;  1FI5 A;  2LAN A;  1OMD A;  2KSP A;  2JT0 A;  2JPT A;  1KQM B;  2L0P A;  1JWD A;  1S5G Y;  3EK8 A;  2KI4 B;  4GAO A;  3DVE A;  3SG4 A;  1FBV A;  1WRZ A;  3SG2 A;  3CWG A;  4ORC B;  1AK8 A;  3VRN A;  5I2O A;  1DVI A;  1UUS A;  3I5F C;  2MA2 A;  4HSZ A;  4M2O A;  2JNF A;  4GGF A;  3D0Y B;  2K61 A;  3ZWH A;  3KO0 A;  2HQW A;  4C0J A;  3CTN A;  2JT3 A;  3JTD C;  2WND A;  1F71 A;  2PSR A;  3BUX B;  4NDD A;  2FOT A;  2L51 A;  4U8D A;  3NSO A;  4BY4 A;  1K2H A;  3SG5 A;  1SW8 A;  1QAT A;  1WY9 A;  1QX5 B;  1IJ5 A;  2I18 A;  3DF0 B;  3FWB A;  2KFH A;  1S26 D;  4ORB B;  1FW4 A;  2I2R E;  2KAV A;  2L4H A;  3WHU B;  1B8L A;  1KK7 Z;  1DGV A;  1XFZ O;  4CLN A;  3EVU A;  3DVK A;  4USL A;  5I2Q A;  1F54 A;  2Y1M A;  1QVI Y;  3O2P A;  4PHM A;  1YUR A;  3QRX A;  1BG1 A;  2M7N A;  2CTN A;  4R1E A;  4ZCV A;  1M45 A;  1DJY A;  3NSI A;  4CPV A;  4N1F A;  4BY5 A;  3D0Y A;  1KFX S;  3LK1 A;  3PN7 B;  1J7R A;  1DJZ A;  1NCZ A;  1XFV O;  1FI6 A;  2BKH B;  2RGI A;  1M31 A;  1BLQ A;  4GGF C;  1SL8 A;  2COL B;  3MSE B;  2ZNE A;  2ZKM X;  1TNP A;  2LC5 A;  1PSB A;  1LA0 A;  1DJW A;  3DF0 A; 
#chains in the Genus database with same CATH topology
 2GGM A;  1IJ6 A;  1BR1 B;  1J7P A;  1F4Q A;  3D77 A;  5FI2 A;  2M97 A;  3S0G A;  4MRY A;  2CT9 A;  1KWO B;  3CZT X;  4OKH A;  1EG3 A;  2V53 A;  4DUQ A;  1DMO A;  1H4B A;  1MXL C;  1F4O A;  2G9B A;  1V1G A;  3BYA A;  1TNX A;  1TOP A;  2KI6 C;  3TS5 C;  4E68 A;  2NLN A;  2NZ0 A;  3OB2 B;  1TWO A;  1F8H A;  2P71 A;  5KU1 A;  2JUL A;  1KFU S;  2WCH A;  5CSI A;  2KI6 D;  1XFR A;  4CFQ A;  3AAK A;  1CDN A;  1DJG A;  1K9K A;  2F2P A;  2LLT A;  1CKK A;  1IQ3 A;  1DEL A;  3CR5 X;  3S0E A;  2M49 B;  1SCM B;  2ZN8 A;  5F6T A;  1XFX O;  5AER A;  1PSR A;  3PAT A;  2OTG B;  1IGV A;  1K93 D;  3Q8I A;  2QEV A;  4QJ3 B;  1NYA A;  3JTD B;  1JFK A;  2P70 A;  1A2X A;  1PAL A;  4MZJ A;  1DEK A;  3L4A A;  1NX1 A;  2QAC A;  3S0A A;  3TDI A;  2GGZ A;  3I5H C;  2WCB A;  2K7B A;  4WQ3 A;  1AP4 A;  1GGZ A;  1K96 A;  1ZFS A;  3LK0 A;  5JJG A;  5AXI A;  1TUJ A;  5HL1 A;  2LP2 A;  4HRE E;  1AUI B;  2CXJ A;  3CDN A;  1JF2 A;  2CCM A;  1EL4 A;  1DGU A;  2E30 A;  5AEQ A;  2O5G A;  1JBA A;  3DYE A;  1CMF A;  2CBL A;  1RTP 1;  5AFP A;  3OB1 B;  1B9A A;  1SNL A;  2TN4 A;  1QTX A;  2KPH A;  1SL9 A;  3NSL A;  3PJI A;  4MZK A;  2LLU A;  1JSA A;  3DVJ A;  2LHI A;  3DD4 A;  3VB1 A;  3VGO A;  2LVI A;  1CLB A;  1DQE A;  3VRP A;  4MSP A;  4IJ7 A;  1IKU A;  4A4B A;  1XFW O;  2VRG A;  3IQQ A;  1B8C A;  1N65 A;  1Y1A A;  1FF1 A;  1J55 A;  1SCV A;  1HT9 A;  3HX4 A;  1SMG A;  1PVA A;  1ALV A;  1KFX L;  1YX8 A;  2H61 A;  3OBV A;  4HRG A;  1IIO A;  4MBE A;  1KWO C;  1YVH A;  1ODB A;  4AQJ A;  3BUW B;  4INX A;  5B8I B;  1C7V A;  2LP3 A;  2BBM A;  2MHH A;  1S1E A;  3TS5 B;  4YI9 A;  2ZND A;  1ZUZ A;  4OVN F;  3CLN A;  5HLO A;  4M2Q A;  3SJS A;  1SRA A;  3D73 A;  4OV2 A;  2JNX A;  2JRF A;  2EGD A;  2PVB A;  1SBJ A;  1CDP A;  2L5X B;  1TNQ A;  1AJ4 A;  2H8V A;  5D7F A;  1J1E A;  1MUX A;  3CAB A;  3TUY C;  1QLS A;  1SCM C;  4GBA A;  1XYD A;  2KBM A;  1KFU L;  1NX3 A;  2MAZ A;  3AAJ A;  3KPX A;  2JT8 A;  2LNK A;  3N7H A;  5I2L A;  2OTG C;  1TN4 A;  2L98 A;  1B7T Z;  1NCX A;  1YTZ C;  2MLE C;  2WCJ A;  2FCE A;  4WRI A;  1L2O B;  1EG4 A;  3VRQ A;  2BEC A;  2KHN A;  2FJU B;  1PUL A;  3I5H B;  2WCE A;  1MHO A;  3OHM B;  3R1O A;  2H2K A;  2LCP A;  5KTY A;  1XFY O;  2HQ8 A;  3IF7 A;  2H61 C;  1CLL A;  1LS8 A;  1RFJ A;  1SK6 D;  1VRK A;  2AUC A;  3F45 A;  4HRH A;  1ALW A;  2LV7 A;  2JTZ A;  5CSN A;  4CFR A;  3ZNI A;  4MEW A;  2KYF A;  1C7W A;  1OZO A;  2MJW B;  1DT7 B;  3A4U B;  4AQI A;  4AOM A;  1M63 B;  4C0K A;  2BCX A;  2I94 A;  4DCK A;  2L5Y A;  4N5X A;  1CFP A;  1TUZ A;  4PE1 A;  3BFA A;  1B8R A;  1NX2 A;  5J3X A;  4GNK B;  1M46 A;  1DTL A;  3FE8 A;  4PE0 A;  2M7L A;  1NCY A;  2JU0 A;  1TCO B;  2WOR A;  4QJ4 B;  2JZI A;  2KAY A;  1XA5 A;  3JVT B;  1QX7 A;  1BMO A;  4NDC A;  1TIZ A;  3VRO A;  2KOT A;  1NIW A;  1B4C A;  2K7O A;  3PFV A;  4PE7 A;  4FTG A;  2ZRS A;  2KQ6 A;  2KGB C;  4CID A;  1OMR A;  4ETO A;  1EJ3 A;  1XVJ A;  1S6I A;  1WDC C;  2BCB A;  2CNP A;  3OX5 A;  5DKQ A;  1XFU O;  4TNC A;  1OMV A;  3RZS A;  3FWC A;  2K0J A;  3K21 A;  4OCI A;  1A4P A;  1UHH A;  1ZMZ A;  2LUC A;  2KFG A;  1IQ5 A;  2NCO A;  2M0R A;  2KDH A;  4INW A;  4JKT A;  1E8A A;  3DZT A;  1QV1 A;  2SAS A;  1K8U A;  1OSA A;  2WCK A;  1NWD A;  1W7J B;  3D78 A;  1TTX A;  1BJF A;  1UHJ A;  3R72 A;  2LUX A;  1R2U A;  3BFH A;  3TUY B;  4C0L A;  2JTT A;  1QX2 A;  1W9Z A;  5G08 A;  3NGV A;  1GM0 A;  3EKJ A;  1Z2C B;  4NQG A;  1AVS A;  5FYX A;  1L2O C;  3WNX B;  2P6B B;  3BQ3 A;  3CS1 A;  3D75 A;  1GQM A;  1UUR A;  1BR4 B;  1PVB A;  2PAS A;  4MN0 A;  4PDZ A;  1K94 A;  1QAS A;  3FIA A;  4JPZ B;  3IQO A;  2HET A;  1BOD A;  1PK0 D;  3GK2 A;  1SYM A;  1CM4 A;  2BAP A;  3DXL A;  2MRD A;  1W7I B;  2LLS A;  4PT1 A;  5DKR A;  2LVJ A;  2WOS A;  2Q91 A;  1X02 A;  1QV0 A;  1IH0 A;  3GOF A;  3CYZ A;  4FQO A;  3D74 A;  1S6J A;  1QIW A;  3WHT B;  2BE6 A;  3PM8 A;  4OR9 B;  4YBH B;  2R2I A;  2BKI B;  2BCA A;  2M9G A;  3I5I C;  1P28 A;  4YI8 A;  4MLW A;  5JOL A;  1KK8 C;  3SIB A;  3O78 A;  2DOQ A;  1C07 A;  1UHI A;  3I5G C;  1S6C A;  1FPW A;  2LE9 B;  3JVT C;  1QXP A;  2OPO A;  2M29 A;  3EVV A;  3NHT A;  4MRX A;  1TRF A;  1KK7 Y;  1QS7 A;  1BT6 A;  1REC A;  1JFJ A;  3SIA A;  1CTR A;  2L2E A;  3FE6 A;  1MWN A;  1TCF A;  2LAP A;  2PRU A;  2QEO A;  3K1E A;  2LM5 A;  2ZRT A;  4I5N B;  2LHL A;  1WDC B;  1PRW A;  3L4L A;  2AAO A;  1OOI X;  2I7A A;  1B1G A;  1NSH A;  5HYD A;  4XYN A;  1BF5 A;  1XO5 A;  1YR5 A;  2KAX A;  1WLZ A;  3CZ0 A;  3C1V A;  3NHI A;  1IG5 A;  1G33 A;  3O4Y A;  5HKW A;  1JF0 A;  3B7A A;  1K9P A;  1UP5 A;  3DVM A;  5KSZ A;  1KSM A;  5HKZ A;  2FCD A;  1J7O A;  1ZAC A;  2F2O A;  1CMG A;  5D69 A;  4ZCU A;  4DIR A;  2ISD A;  5BPJ A;  2KBI A;  3BUO B;  1Y6W A;  4YGE B;  1DC1 A;  1DF0 B;  1A75 B;  1QJT A;  1NX0 A;  2Y4Q A;  3CGA A;  2M1K B;  4PE4 A;  2EC6 C;  4I5K A;  5K89 A;  1IRJ A;  3FE9 A;  2WC8 A;  1CB1 A;  1CDL A;  1YX7 A;  2A4J A;  2KGR A;  3PM2 A;  2K60 A;  3SS5 A;  2HPS A;  4I5J A;  2FJY A;  3R1V A;  1Y1X A;  5I8N A;  1S36 A;  4L9M A;  1QWV A;  3WXA A;  3LLE A;  3B6X A;  1B47 A;  1U5I B;  3LL8 B;  4GGN A;  3VRR A;  1KSO A;  1T14 A;  1H8B A;  1SR6 B;  1J1D A;  3ICB A;  4D1E A;  5IBW A;  1WRK A;  2BBN A;  3KF9 A;  2WCM A;  1OE9 B;  1LVC D;  2WCF A;  2B1U A;  1KCY A;  2PQL A;  2M3W A;  4PHN A;  4YGD B;  1ORG A;  3I5I B;  1RJV A;  3RM1 A;  2K7C A;  3R1P A;  1LXF C;  1ZOT B;  3SG3 A;  1DF0 A;  1A75 A;  1KK8 B;  1QLK A;  1SPY A;  5ER4 X;  3AKA A;  2ZFD A;  3I5G B;  2L50 A;  2OS8 C;  3BXK A;  1GGW A;  5CSJ A;  2JWW A;  1GJY A;  1OQP A;  1C3Z A;  2KNE A;  3BJH A;  2AMI A;  3BOW B;  3GK4 X;  2K8M B;  4I5L B;  1RWY A;  2JXC A;  2MLF C;  4ORA B;  4WQ2 A;  1UHK A;  1DJI A;  3LCP C;  4PHK A;  2JOJ A;  1JC2 A;  3AKB A;  3EVR A;  3OGN A;  1U5I A;  4DS7 A;  1OOH A;  2BE4 A;  2JXL A;  4A4C A;  1OZS A;  3V2L A;  1AJ5 A;  3O6B A;  2M1U A;  3OP0 A;  5FI7 A;  1L7Z A;  4YGA A;  4IL1 A;  1K95 A;  1S5G Z;  1G4Y R;  3RLZ A;  1SSE B;  2BL0 C;  4N1G A;  3HCM A;  3BUN B;  3PSR A;  1YUU A;  3M0W A;  1EH2 A;  4M2P A;  5DKN A;  2NCP A;  2F33 A;  1SKT A;  2Y5I A;  4GFT A;  3EG5 B;  1XK4 A;  4PHJ A;  1CFD A;  1RRO A;  4F0Z B;  1N0Y A;  4YGB B;  2ERB A;  3KEV A;  1MXE A;  2JPO A;  3BOW A;  1OOF A;  3O4X A;  4Q04 A;  1K90 D;  1A29 A;  1YRT B;  2HF5 A;  1V1F A;  1SY9 A;  1KQM C;  2EC6 B;  1N2D A;  2D8N A;  1WLM A;  4YGC B;  1CNP A;  3D10 A;  3SG7 A;  1YVL A;  2Q4U A;  1JUO A;  1LA3 A;  2KI4 C;  3CR4 X;  1SL7 A;  3H4S E;  1UHN A;  5FI6 A;  5GQQ C;  2EHB A;  2G2B A;  4YRU A;  1NPQ A;  3E3R A;  3FS7 A;  1IWQ A;  4DRW A;  5TNC A;  1MR8 A;  3TDU A;  1EXR A;  1F70 A;  1DJX A;  1SR6 C;  1NUB A;  2E6W A;  2QPT A;  3UNW A;  3PLF B;  2PMY A;  1C3Y A;  3I5F B;  5ER5 A;  2MBX A;  3CR2 A;  2LMU A;  1OOJ A;  3BUM B;  2F3Z A;  3EK4 A;  2JC2 A;  3TDZ A;  4MZL A;  1QVI Z;  3NSK A;  1B7T Y;  3CZ2 A;  1UWO A;  2JQ6 A;  2F8P A;  2QEH A;  4QJ5 B;  5D3O A;  3NXA A;  3A8R A;  2PYQ A;  5CPV A;  4ICB A;  2ZN9 A;  1BOC A;  1TNW A;  2LMT A;  4GUK A;  4XJK B;  3SG6 A;  1K9U A;  1MQ1 A;  3TZ1 A;  2M8U A;  3EK7 A;  1DJH A;  1M39 A;  2KQY A;  2PAL A;  1XK4 C;  2O60 A;  4MVF A;  1CFF A;  1MF8 B;  2QDI A;  1NP8 A;  2OS8 B;  3B87 A;  4JQ0 D;  1QIV A;  1J7Q A;  1R6P A;  2NXQ A;  2SCP A;  1CDM A;  2K2A A;  2KFF A;  2QEB A;  2LVK A;  4JWQ A;  2IS9 A;  1Z4H A;  3EKH A;  1G8I A;  1Y0V H;  2F3Y A;  3PAL A;  2Y1N A;  4OZD A;  2GV5 A;  1F55 A;  5AAN A;  4UPG A;  1AHR A;  1LIN A;  1Y1U A;  3OX6 A;  1YRU B;  2KLD A;  1A03 A;  2KYC A;  3PN7 C;  2K7D A;  4PCW A;  3D76 A;  4GPL B;  1D1O A;  4P5O E;  1KQV A;  1LKJ A;  2BL0 B;  2LVV A;  5HKY A;  1CM1 A;  1S3P A;  1YUT A;  2LMV A;  4KYN A;  1RK9 A;  4PAL A;  4NDB A;  1YUS A;  3B86 A;  3KHE A;  4XJK A;  5PAL A;  3GK1 A;  4F7F A;  1CLM A;  1BU3 A;  1HQV A;  2L4I A;  5CSF A;  4P2Y B;  1WRL A;  5HLV A;  4FQT A;  2L2C A;  1Q80 A;  2K2F A;  1CFC A;  1FI5 A;  2WC5 A;  2LAN A;  1OMD A;  2KSP A;  2JT0 A;  5DIC A;  2JPT A;  1KQM B;  2L0P A;  1JWD A;  3S0D A;  1S5G Y;  3EK8 A;  2KI4 B;  4GAO A;  3DVE A;  3SG4 A;  5I94 A;  1FBV A;  1WRZ A;  3SG2 A;  3B88 A;  2WC6 A;  3CWG A;  4ORC B;  1AK8 A;  3VRN A;  5I2O A;  1DVI A;  1UUS A;  3I5F C;  2MA2 A;  4HSZ A;  4M2O A;  2JNF A;  4GGF A;  3D0Y B;  1OOG A;  2K61 A;  3ZWH A;  3KO0 A;  2HQW A;  4C0J A;  3CTN A;  2JT3 A;  3JTD C;  2WND A;  1F71 A;  2PSR A;  3BUX B;  4NDD A;  2FOT A;  3L47 A;  2L51 A;  4U8D A;  3NSO A;  4BY4 A;  1K2H A;  3SG5 A;  1SW8 A;  1QAT A;  1WY9 A;  1QX5 B;  1IJ5 A;  2I18 A;  3DF0 B;  3FWB A;  2KFH A;  4JD9 A;  1S26 D;  3S0F A;  4ORB B;  1FW4 A;  2I2R E;  2KAV A;  3IVT A;  2L4H A;  3SS4 A;  2GTE A;  3WHU B;  1B8L A;  1KK7 Z;  1DGV A;  1XFZ O;  4CLN A;  3EVU A;  3DVK A;  4USL A;  5I2Q A;  1F54 A;  2KLE A;  3SS3 A;  3BFB A;  2Y1M A;  1QVI Y;  3O2P A;  4PHM A;  1OW4 A;  1YUR A;  3QRX A;  3UO9 A;  2M7N A;  1BG1 A;  2CTN A;  4R1E A;  4ZCV A;  3CZ1 A;  1M45 A;  1DJY A;  3NSI A;  4CPV A;  2YGU A;  2WCL A;  4N1F A;  4BY5 A;  3D0Y A;  1KFX S;  3LK1 A;  3PN7 B;  1J7R A;  1DJZ A;  1NCZ A;  1XFV O;  5EL2 A;  1FI6 A;  2BKH B;  2RGI A;  1M31 A;  1BLQ A;  4GGF C;  1SL8 A;  2COL B;  3MSE B;  2ZNE A;  2ZKM X;  1TNP A;  3S0B A;  3DY9 A;  2LC5 A;  1PSB A;  1LA0 A;  2BNX A;  1DJW A;  3DF0 A;  3QME A; 
#chains in the Genus database with same CATH homology
 2GGM A;  1IJ6 A;  1BR1 B;  1J7P A;  1F4Q A;  2M97 A;  4MRY A;  2CT9 A;  1KWO B;  3CZT X;  4OKH A;  1EG3 A;  2V53 A;  4DUQ A;  1DMO A;  1H4B A;  1MXL C;  1F4O A;  2G9B A;  1V1G A;  3BYA A;  1TNX A;  1TOP A;  2KI6 C;  3TS5 C;  4E68 A;  2NLN A;  2NZ0 A;  3OB2 B;  1F8H A;  5KU1 A;  2JUL A;  1KFU S;  5CSI A;  2KI6 D;  4CFQ A;  3AAK A;  1CDN A;  1DJG A;  1K9K A;  2F2P A;  2LLT A;  1CKK A;  1IQ3 A;  3CR5 X;  2M49 B;  1SCM B;  2ZN8 A;  5F6T A;  1XFX O;  5AER A;  1PSR A;  3PAT A;  2OTG B;  1IGV A;  1K93 D;  4QJ3 B;  1NYA A;  3JTD B;  1JFK A;  4MZJ A;  1A2X A;  1PAL A;  1NX1 A;  2QAC A;  3TDI A;  2GGZ A;  3I5H C;  2WCB A;  2K7B A;  4WQ3 A;  1AP4 A;  1GGZ A;  1K96 A;  1ZFS A;  3LK0 A;  5JJG A;  5AXI A;  2LP2 A;  4HRE E;  1AUI B;  2CXJ A;  1JF2 A;  2CCM A;  1EL4 A;  1DGU A;  2E30 A;  5AEQ A;  2O5G A;  1JBA A;  1CMF A;  2CBL A;  1RTP 1;  5AFP A;  3OB1 B;  1B9A A;  1SNL A;  2TN4 A;  1QTX A;  1SL9 A;  3NSL A;  4MZK A;  2LLU A;  1JSA A;  3DVJ A;  2LHI A;  3DD4 A;  3VGO A;  1CLB A;  2LVI A;  3VRP A;  4MSP A;  1IKU A;  4A4B A;  1XFW O;  2VRG A;  3IQQ A;  1B8C A;  1N65 A;  1Y1A A;  1FF1 A;  1J55 A;  1SCV A;  1HT9 A;  3HX4 A;  1SMG A;  1PVA A;  1ALV A;  1KFX L;  1YX8 A;  2H61 A;  4HRG A;  4MBE A;  1KWO C;  1YVH A;  1ODB A;  4AQJ A;  3BUW B;  5B8I B;  1C7V A;  2LP3 A;  2BBM A;  2MHH A;  1S1E A;  3TS5 B;  4YI9 A;  2ZND A;  1ZUZ A;  4OVN F;  3CLN A;  5HLO A;  4M2Q A;  3SJS A;  1SRA A;  4OV2 A;  2JNX A;  2JRF A;  2EGD A;  2PVB A;  1SBJ A;  1CDP A;  2L5X B;  1TNQ A;  1AJ4 A;  5D7F A;  1J1E A;  1MUX A;  3TUY C;  1QLS A;  1SCM C;  4GBA A;  1XYD A;  2KBM A;  1KFU L;  1NX3 A;  2MAZ A;  3AAJ A;  3KPX A;  2JT8 A;  2LNK A;  5I2L A;  2OTG C;  1TN4 A;  2L98 A;  1B7T Z;  1NCX A;  1YTZ C;  2MLE C;  2FCE A;  4WRI A;  1L2O B;  1EG4 A;  3VRQ A;  2BEC A;  2KHN A;  2FJU B;  1PUL A;  3I5H B;  2WCE A;  1MHO A;  3OHM B;  5KTY A;  2H2K A;  2LCP A;  1XFY O;  2HQ8 A;  3IF7 A;  2H61 C;  1CLL A;  1RFJ A;  1SK6 D;  1VRK A;  2AUC A;  3F45 A;  4HRH A;  1ALW A;  2LV7 A;  2JTZ A;  5CSN A;  4CFR A;  3ZNI A;  4MEW A;  2KYF A;  1C7W A;  1OZO A;  2MJW B;  1DT7 B;  3A4U B;  4AQI A;  4AOM A;  1M63 B;  4C0K A;  2BCX A;  2I94 A;  4DCK A;  4N5X A;  1CFP A;  4PE1 A;  1B8R A;  1NX2 A;  5J3X A;  4GNK B;  1M46 A;  1DTL A;  4PE0 A;  2M7L A;  1NCY A;  2JU0 A;  1TCO B;  2WOR A;  4QJ4 B;  2JZI A;  2KAY A;  1XA5 A;  3JVT B;  1QX7 A;  1BMO A;  4NDC A;  1TIZ A;  3VRO A;  2KOT A;  1NIW A;  1B4C A;  2K7O A;  3PFV A;  4PE7 A;  4FTG A;  2ZRS A;  2KQ6 A;  2KGB C;  4CID A;  1OMR A;  4ETO A;  2BCB A;  1EJ3 A;  1XVJ A;  1S6I A;  1WDC C;  2CNP A;  3OX5 A;  5DKQ A;  1XFU O;  4TNC A;  1OMV A;  3FWC A;  2K0J A;  3K21 A;  4OCI A;  1A4P A;  1UHH A;  1ZMZ A;  2LUC A;  2KFG A;  1IQ5 A;  2NCO A;  2M0R A;  2KDH A;  1E8A A;  1QV1 A;  2SAS A;  1K8U A;  1OSA A;  1NWD A;  1W7J B;  1TTX A;  1BJF A;  1UHJ A;  3TUY B;  2LUX A;  1R2U A;  4C0L A;  2JTT A;  1QX2 A;  5G08 A;  3EKJ A;  4NQG A;  1AVS A;  5FYX A;  1L2O C;  3WNX B;  2P6B B;  3BQ3 A;  3CS1 A;  1GQM A;  1UUR A;  1BR4 B;  1PVB A;  2PAS A;  4MN0 A;  4PDZ A;  1K94 A;  1QAS A;  3FIA A;  4JPZ B;  3IQO A;  2HET A;  1BOD A;  1PK0 D;  3GK2 A;  1SYM A;  1CM4 A;  2MRD A;  1W7I B;  2LLS A;  5DKR A;  2LVJ A;  2WOS A;  2Q91 A;  1X02 A;  1QV0 A;  1IH0 A;  3GOF A;  4FQO A;  1S6J A;  1QIW A;  3WHT B;  2BE6 A;  3PM8 A;  4OR9 B;  4YBH B;  2R2I A;  2BKI B;  2BCA A;  2M9G A;  3I5I C;  4YI8 A;  4MLW A;  5JOL A;  1KK8 C;  3SIB A;  3O78 A;  2DOQ A;  1C07 A;  1UHI A;  3I5G C;  1S6C A;  1FPW A;  2LE9 B;  3JVT C;  1QXP A;  2OPO A;  2M29 A;  3EVV A;  4MRX A;  1TRF A;  1KK7 Y;  1QS7 A;  1BT6 A;  1REC A;  1JFJ A;  3SIA A;  1CTR A;  2L2E A;  1MWN A;  1TCF A;  2LAP A;  2PRU A;  2LM5 A;  2ZRT A;  4I5N B;  2LHL A;  1WDC B;  1PRW A;  2AAO A;  2I7A A;  1B1G A;  1NSH A;  5HYD A;  4XYN A;  1BF5 A;  1XO5 A;  1YR5 A;  2KAX A;  1WLZ A;  3O4Y A;  3C1V A;  5HKW A;  1IG5 A;  1G33 A;  1JF0 A;  1K9P A;  1UP5 A;  3DVM A;  5KSZ A;  1KSM A;  5HKZ A;  2FCD A;  1J7O A;  1ZAC A;  2F2O A;  5D69 A;  4ZCU A;  4DIR A;  2ISD A;  5BPJ A;  2KBI A;  3BUO B;  1Y6W A;  4YGE B;  1DF0 B;  1A75 B;  1QJT A;  1NX0 A;  2Y4Q A;  3CGA A;  2M1K B;  4PE4 A;  2EC6 C;  4I5K A;  5K89 A;  1IRJ A;  1CB1 A;  2WC8 A;  1CDL A;  1YX7 A;  2A4J A;  2KGR A;  2HPS A;  4I5J A;  1Y1X A;  5I8N A;  1S36 A;  4L9M A;  3WXA A;  3LLE A;  1B47 A;  1U5I B;  3LL8 B;  4GGN A;  3VRR A;  1KSO A;  1H8B A;  1SR6 B;  1J1D A;  3ICB A;  4D1E A;  5IBW A;  1WRK A;  2BBN A;  3KF9 A;  1OE9 B;  1LVC D;  2WCF A;  2B1U A;  1KCY A;  2M3W A;  4PHN A;  4YGD B;  3I5I B;  1RJV A;  3RM1 A;  2K7C A;  1LXF C;  1ZOT B;  3SG3 A;  1DF0 A;  1A75 A;  1KK8 B;  1QLK A;  1SPY A;  5ER4 X;  3AKA A;  2ZFD A;  3I5G B;  2L50 A;  2OS8 C;  3BXK A;  1GGW A;  5CSJ A;  2JWW A;  1GJY A;  1OQP A;  2KNE A;  4I5L B;  2AMI A;  3BOW B;  3GK4 X;  2K8M B;  4WQ2 A;  1RWY A;  2JXC A;  2MLF C;  4ORA B;  1UHK A;  1DJI A;  3LCP C;  4PHK A;  2JOJ A;  1JC2 A;  3AKB A;  3EVR A;  1U5I A;  4DS7 A;  2BE4 A;  2JXL A;  4A4C A;  1OZS A;  1AJ5 A;  3O6B A;  2M1U A;  3OP0 A;  1L7Z A;  4YGA A;  4IL1 A;  1K95 A;  1S5G Z;  1G4Y R;  3RLZ A;  2BL0 C;  4N1G A;  3HCM A;  3BUN B;  3PSR A;  1YUU A;  3M0W A;  1EH2 A;  4M2P A;  5DKN A;  2NCP A;  2F33 A;  1SKT A;  2Y5I A;  4GFT A;  1XK4 A;  4PHJ A;  1CFD A;  1RRO A;  4F0Z B;  1N0Y A;  4YGB B;  3KEV A;  1MXE A;  3BOW A;  4Q04 A;  1K90 D;  1A29 A;  1YRT B;  2HF5 A;  1V1F A;  1SY9 A;  1KQM C;  2EC6 B;  1N2D A;  2D8N A;  1WLM A;  4YGC B;  1CNP A;  3D10 A;  3SG7 A;  1YVL A;  2Q4U A;  1JUO A;  1LA3 A;  2KI4 C;  3CR4 X;  1SL7 A;  3H4S E;  1UHN A;  5GQQ C;  2EHB A;  2G2B A;  4YRU A;  1NPQ A;  3E3R A;  3FS7 A;  1IWQ A;  4DRW A;  5TNC A;  1MR8 A;  3TDU A;  1EXR A;  1F70 A;  1DJX A;  1SR6 C;  1NUB A;  2E6W A;  2QPT A;  3PLF B;  2PMY A;  3I5F B;  5ER5 A;  2MBX A;  3CR2 A;  2LMU A;  1OOJ A;  3BUM B;  2F3Z A;  3EK4 A;  2JC2 A;  3TDZ A;  4MZL A;  1QVI Z;  3NSK A;  1B7T Y;  1UWO A;  2JQ6 A;  2F8P A;  4QJ5 B;  3NXA A;  3A8R A;  5CPV A;  4ICB A;  2ZN9 A;  1BOC A;  1TNW A;  2LMT A;  4GUK A;  4XJK B;  3SG6 A;  1K9U A;  1MQ1 A;  3TZ1 A;  2M8U A;  3EK7 A;  1DJH A;  1M39 A;  2KQY A;  2PAL A;  1XK4 C;  2O60 A;  4MVF A;  1CFF A;  1MF8 B;  1J7Q A;  1NP8 A;  2OS8 B;  4JQ0 D;  1QIV A;  1R6P A;  2NXQ A;  2SCP A;  1CDM A;  2K2A A;  2KFF A;  2LVK A;  4JWQ A;  2IS9 A;  3EKH A;  1G8I A;  1Y0V H;  2F3Y A;  3PAL A;  2Y1N A;  2GV5 A;  1F55 A;  5AAN A;  4UPG A;  1AHR A;  1LIN A;  1Y1U A;  3OX6 A;  1YRU B;  1A03 A;  2KYC A;  3PN7 C;  2K7D A;  4PCW A;  4GPL B;  1D1O A;  4P5O E;  1KQV A;  1LKJ A;  2BL0 B;  2LVV A;  5HKY A;  1CM1 A;  1S3P A;  1YUT A;  2LMV A;  1RK9 A;  4PAL A;  4NDB A;  1YUS A;  3KHE A;  4XJK A;  1CMG A;  5PAL A;  3GK1 A;  1CLM A;  1BU3 A;  1HQV A;  2L4I A;  5CSF A;  4P2Y B;  1WRL A;  5HLV A;  1Q80 A;  2K2F A;  1CFC A;  1FI5 A;  2LAN A;  1OMD A;  2KSP A;  2JT0 A;  2JPT A;  1KQM B;  2L0P A;  1JWD A;  1S5G Y;  3EK8 A;  2KI4 B;  4GAO A;  3DVE A;  3SG4 A;  1FBV A;  1WRZ A;  3SG2 A;  3CWG A;  4ORC B;  1AK8 A;  3VRN A;  5I2O A;  1DVI A;  1UUS A;  3I5F C;  2MA2 A;  4HSZ A;  4M2O A;  2JNF A;  4GGF A;  3D0Y B;  2K61 A;  3ZWH A;  3KO0 A;  2HQW A;  4C0J A;  3CTN A;  2JT3 A;  3JTD C;  2WND A;  1F71 A;  2PSR A;  3BUX B;  4NDD A;  2FOT A;  2L51 A;  4U8D A;  3NSO A;  4BY4 A;  1K2H A;  3SG5 A;  1SW8 A;  1QAT A;  1WY9 A;  1QX5 B;  1IJ5 A;  2I18 A;  3DF0 B;  3FWB A;  2KFH A;  1S26 D;  4ORB B;  1FW4 A;  2I2R E;  2KAV A;  2L4H A;  3WHU B;  1B8L A;  1KK7 Z;  1DGV A;  1XFZ O;  4CLN A;  3EVU A;  3DVK A;  4USL A;  5I2Q A;  1F54 A;  2Y1M A;  1QVI Y;  3O2P A;  4PHM A;  1YUR A;  3QRX A;  1BG1 A;  2M7N A;  2CTN A;  4R1E A;  4ZCV A;  1M45 A;  1DJY A;  3NSI A;  4CPV A;  4N1F A;  4BY5 A;  3D0Y A;  1KFX S;  3LK1 A;  3PN7 B;  1J7R A;  1DJZ A;  1NCZ A;  1XFV O;  1FI6 A;  2BKH B;  2RGI A;  1M31 A;  1BLQ A;  4GGF C;  1SL8 A;  2COL B;  3MSE B;  2ZNE A;  2ZKM X;  1TNP A;  2LC5 A;  1PSB A;  1LA0 A;  1DJW A;  3DF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...