1PSBA

Solution structure of calcium loaded s100b complexed to a peptide from n-terminal regulatory domain of ndr kinase.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S-100 protein, beta chain
publication title Structure of the Ca(2+)/S100B/NDR Kinase Peptide Complex: Insights into S100 Target Specificity and Activation of the Kinase.
pubmed doi rcsb
source organism Bos taurus
total genus 36
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1psbA00
1KK8C 4FQOA 1AK8A 1DGUA 1TCFA 3FS7A 1ZMZA 2MJWB 2IS9A 1B8CA 3VGOA 4BY5A 2HPSA 2L50A 3WHUB 1RROA 1UHIA 1JWDA 1W7JB 1U5IB 3NXAA 1CDNA 1QX7A 3SIBA 2EC6C 4PHNA 1XFXO 3QRXA 1NCYA 3DF0A 1PSRA 4PDZA 3EVUA 1C07A 3CR5X 2KFHA 3D0YA 1DGVA 1BG1A 2BL0B 1J1EA 1EH2A 2L4HA 2O5GA 5ER5A 3OX5A 1JBAA 3JVTB 3KHEA 1AJ4A 1MWNA 1WY9A 5AXIA 1DJZA 2KI6C 2JXCA 1NWDA 1WRZA 2LM5A 4HRHA 1H8BA 1ALWA 1BODA 1S36A 1CDLA 1EJ3A 1OMVA 4MRYA 1ZFSA 1IRJA 2OS8C 3O78A 1TNWA 1X02A 1C7WA 2JT8A 1KK8B 2M9GA 5HKWA 2NZ0A 1M46A 5DKNA 4CFRA 4MN0A 1J7PA 2H61C 3DVEA 4YGBB 4C0LA 3DVKA 1K95A 2Y4QA 4GGNA 4XJKA 3FWCA 1NUBA 1F70A 2JRFA 1MHOA 2ZNEA 1S3PA 4MSPA 5DKQA 1AP4A 1SK6D 2EC6B 3EK4A 2LVVA 1NCXA 4R1EA 2KFGA 3BUNB 2KYCA 3AAJA 2KSPA 1GGZA 2M8UA 2COLB 1NYAA 2OPOA 4GNKB 2Y1MA 1CM4A 3DD4A 2VRGA 1LVCD 1XFVO 1IKUA 2K61A 3VRRA 1TN4A 5CPVA 2MHHA 2NCPA 2BKHB 2LHIA 1L2OB 2LNKA 1DJIA 2KGBC 2CNPA 2KAYA 3H4SE 4HREE 3LL8B 3CS1A 1K8UA 3MSEB 4GUKA 2KI6D 3SG2A 2LLTA 4PALA 3I5GC 4PE4A 1WRLA 3TZ1A 1SKTA 2I7AA 3WHTB 2JWWA 2L0PA 5I2OA 3M0WA 1TNXA 1KQMC 1WDCB 2F2PA 3TDZA 2OS8B 1LA0A 2MLEC 3PSRA 5IBWA 1N0YA 5D7FA 5B8IB 2BCAA 1XFWO 2CBLA 1A2XA 1EL4A 1B7TY 1QVIY 4I5NB 2CT9A 1A03A 3GK2A 2JULA 1S26D 1BU3A 2HQ8A 2LC5A 1SCMB 1F54A 3SG4A 5ER4X 1JF2A 2JOJA 2M3WA 1F8HA 1DJXA 1RWYA 5BPJA 2JNFA 4P5OE 1G8IA 4FTGA 2D8NA 5AEQA 2KI4C 2G2BA 1QX5B 1SL7A 1JUOA 1BLQA 2BL0C 1IJ6A 3NSKA 1QIVA 5CSNA 5HLOA 3VROA 3TDIA 2PRUA 4NQGA 4C0KA 4L9MA 2WNDA 2P6BB 3I5IC 3I5GB 4PCWA 1YX7A 2K7BA 4PHMA 1M31A 2KBIA 1SBJA 2GV5A 2HF5A 3PLFB 3NSOA 1KCYA 1BT6A 1KQMB 1YURA 2LUCA 3DF0B 3CR2A 2M7LA 1NCZA 3A8RA 5I2LA 3EKHA 1DJWA 4JPZB 3ZNIA 1YR5A 3D0YB 5HLVA 1EG4A 3CWGA 2NCOA 2KBMA 2L4IA 3BUMB 2JU0A 2JTZA 1UHNA 2LLUA 3SG6A 1B47A 2K2AA 4MZJA 1J55A 1CB1A 2K7DA 2Y1NA 1SL8A 3I5HB 1CLLA 1ZUZA 2I94A 2KHNA 3PFVA 1QATA 4PE1A 2G9BA 3DVMA 1B7TZ 1QVIZ 1J7QA 1PALA 3CZTX 2I18A 2FJUB 1OMRA 2R2IA 1Y1XA 4WRIA 1OE9B 3A4UB 3SG3A 2QACA 1LA3A 2KI4B 4CIDA 4Q04A 4MZLA 1MQ1A 3O4YA 3AKAA 1KFXL 3HX4A 2GGZA 2O60A 1NX3A 4XJKB 2FCEA 1L2OC 4P2YB 4M2QA 2KAXA 3I5IB 1MR8A 1CDMA 1QJTA 1NX1A 2KFFA 1XFUO 2PSRA 1AJ5A 1S6CA 2LP3A 2V53A 2WC8A 5HKYA 3C1VA 2CXJA 3TS5C 4GAOA 1TOPA 4AQIA 1ODBA 3GK1A 1PVAA 1M45A 2ZRSA 4OR9B 1FF1A 4PHKA 1MXEA 3SJSA 1WDCC 2WORA 2K7OA 1TIZA 1UP5A 4NDDA 2ZRTA 1TNQA 1M39A 1UHJA 2FCDA 3OP0A 1BMOA 2QPTA 1BF5A 4GBAA 1YTZC 2TN4A 4GGFC 3D10A 3EK7A 3SG5A 1AVSA 3WNXB 3VRNA 3GK4X 2LCPA 3OB1B 2WCBA 1QS7A 2EHBA 1K94A 1SCMC 3EVRA 1RFJA 1OOJA 2JXLA 3JTDB 3VRQA 1CLBA 2WOSA 4PE7A 1QIWA 2HQWA 5FYXA 2KGRA 1GGWA 3FWBA 4DUQA 3OB2B 4PHJA 1YRTB 2LLSA 2MAZA 1SMGA 1G4YR 1NSHA 1OZOA 1RTP1 2JQ6A 4YGAA 1RJVA 1FI5A 5CSJA 2L5XB 1B1GA 1OZSA 4WQ3A 3BUWB 2KQYA 5DKRA 4DS7A 2RGIA 1XK4A 3AAKA 2AAOA 3TS5B 1CNPA 3BOWA 1Y6WA 3NSLA 2M1UA 1ZACA 5F6TA 5G08A 4MRXA 1AUIB 1JSAA 1A75A 4UPGA 2LMTA 5CSFA 1DT7B 4QJ5B 1YVHA 1CFFA 1TNPA 1DMOA 1OSAA 1DF0A 1N2DA 3O2PA 1DJYA 1CFDA 1AHRA 4TNCA 3IF7A 1KSMA 2MLFC 4A4CA 1YUUA 3I5HC 2SCPA 4N1GA 1B8RA 2LUXA 1KFUL 1UHHA 3E3RA 1YUTA 4I5JA 4A4BA 2LVJA 3I5FC 4ICBA 4U8DA 4ZCVA 1SW8A 4DIRA 5KTYA 4CPVA 1B4CA 1SR6C 2BE6A 1SRAA 4BY4A 5K89A 3KF9A 2FOTA 1TRFA 1S6JA 3PALA 2BECA 1K90D 1UURA 1K93D 1TCOB 1PULA 5TNCA 3LCPC 1CMGA 5KSZA 2JT3A 2Q4UA 2KDHA 1BOCA 4I5LB 5AERA 1OMDA 2KYFA 3HCMA 1S1EA 4AOMA 1QTXA 1DVIA 3VRPA 1K2HA 1CDPA 5KU1A 5AFPA 2L51A 1WLMA 1JFJA 1Y1UA 4OKHA 4F0ZB 1DTLA 1MXLC 1K96A 2LVIA 1S5GY 4NDCA 1R2UA 1NX2A 2SASA 3KO0A 5D69A 1F71A 1G33A 5AANA 1NP8A 1KFUS 1J7OA 1HT9A 1LINA 4YBHB 1XK4C 1KWOC 1QASA 1V1FA 2H61A 3I5FB 4WQ2A 3BYAA 1XVJA 1PK0D 4E68A 5J3XA 4MZKA 2K7CA 1SR6B 1E8AA 4GPLB 1QLSA 1ZOTB 2GGMA 3RLZA 1CM1A 5PALA 2K0JA 2I2RE 3BXKA 2F3ZA 3FIAA 1LKJA 1KQVA 3JTDC 3RM1A 5GQQC 2JTTA 2DOQA 2AUCA 2K2FA 2M1KB 1SY9A 1QX2A 1XFZO 4MVFA 3TUYC 2PMYA 1MUXA 1W7IB 4MBEA 4GFTA 2NXQA 4DCKA 2ZN9A 1YRUB 2LVKA 4XYNA 3LK1A 2EGDA 1TTXA 2F33A 1PRWA 2ZN8A 1WLZA 4MEWA 1IQ3A 4YGEB 5I2QA 1QXPA 4IL1A 2Y5IA 1J1DA 1DJGA 2CCMA 3OHMB 3SG7A 5JJGA 2LV7A 1YX8A 2JNXA 2PVBA 2M7NA 1B8LA 3IQOA 1ALVA 1FI6A 1JFKA 1EG3A 1IG5A 1IJ5A 1K9PA 1QV1A 1SYMA 2M0RA 2OTGB 1RK9A 3CR4X 3K21A 1F55A 1EXRA 1B9AA 1FPWA 1NPQA 1L7ZA 3WXAA 1S5GZ 2E30A 1KWOB 3KPXA 3O6BA 4HRGA 1JC2A 2MA2A 3BOWB 2LANA 3F45A 1R6PA 5HKZA 2NLNA 2WCFA 1M63B 2KOTA 4CLNA 1SCVA 1A75B 3TDUA 1K9KA 1Q80A 1JF0A 2LP2A 3PN7C 1H4BA 1DJHA 4USLA 1U5IA 2BE4A 2KQ6A 1FW4A 1DF0B 2BBNA 2PASA 2M49B 3ZWHA 4QJ4B 1OQPA 2K8MB 3NSIA 1KFXS 3TUYB 2ZNDA 1CKKA 4OVNF 1IH0A 2KNEA 4N1FA 1IQ5A 4I5KA 2WCEA 2CTNA 1BR1B 4OCIA 2AMIA 2ZFDA 1QV0A 3CLNA 1J7RA 4N5XA 1KSOA 2LMUA 3CTNA 1IWQA 3EVVA 1XA5A 4OV2A 3BUOB 1SPYA 2LE9B 4ETOA 4ORAB 1CTRA 3EKJA 1KK7Y 1UWOA 1GQMA 1A29A 2MBXA 2A4JA 1V1GA 4QJ3B 1CFPA 1A4PA 3LLEA 2JZIA 2E6WA 1HQVA 2L2EA 4YGDB 4YRUA 2LHLA 1QLKA 2L98A 3PN7B 4D1EA 4JWQA 4HSZA 1XYDA 1Y1AA 1XFYO 4ZCUA 3DVJA 4YI8A 4NDBA 2B1UA 2BCXA 1K9UA 2LAPA 4M2PA 4YI9A 4ORCB 2KAVA 3GOFA 2LMVA 2JT0A 4MLWA 2HETA 2JPTA 2F3YA 1C7VA 1CMFA 1NIWA 3BQ3A 1UUSA 1SL9A 3CGAA 1YVLA 1S6IA 2BCBA 4ORBB 1N65A 1LXFC 3PM8A 1NX0A 1UHKA 1CLMA 3AKBA 2PALA 2JC2A 3SIAA 1BR4B 1F4QA 4AQJA 4JQ0D 1PSBA 3IQQA 2OTGC 1XO5A 2Q91A 3EK8A 1IGVA 1Y0VH 2BKIB 2F8PA 5CSIA 5I8NA 1MF8B 3BUXB 3KEVA 1CFCA 1FBVA 1KK7Z 1RECA 2ZKMX 3JVTC 2ISDA 1PVBA 2F2OA 2H2KA 4GGFA 1WRKA 1BJFA 1YUSA 1VRKA 3LK0A 2M29A 1GJYA 1F4OA 2M97A 1D1OA 2BBMA 2MRDA 4YGCB 4CFQA 3PATA 3OX6A 4PE0A 5HYDA 5JOLA 4DRWA 1SNLA 3ICBA 4M2OA 4C0JA
chains in the Genus database with same CATH superfamily
5FI7A 1KK8C 1IIOA 4FQOA 1AK8A 1DGUA 1TCFA 3FS7A 3FE9A 1ZMZA 2MJWB 2IS9A 1B8CA 4IJ7A 3VGOA 2HPSA 2L50A 3WHUB 4BY5A 1RROA 1UHIA 3CYZA 1JWDA 1W7JB 1U5IB 3OGNA 3NXAA 1CDNA 1QX7A 3SIBA 2EC6C 4PHNA 5FI2A 1XFXO 3QRXA 3BFAA 1NCYA 3DF0A 1PSRA 4PDZA 3EVUA 1C07A 3CR5X 2KFHA 3D0YA 1DGVA 1BG1A 2BL0B 1J1EA 1EH2A 2L4HA 2O5GA 5ER5A 3S0BA 3OX5A 1JBAA 3JVTB 3CZ2A 3KHEA 1AJ4A 1MWNA 1WY9A 5AXIA 1DJZA 3CDNA 2KI6C 1TUJA 2JXCA 1NWDA 1WRZA 2LM5A 4HRHA 1H8BA 1ALWA 1BODA 1S36A 1CDLA 1EJ3A 1OMVA 4MRYA 1ZFSA 2QEVA 3D78A 1IRJA 2OS8C 3O78A 1TNWA 1X02A 1C7WA 2JT8A 1KK8B 3N7HA 2M9GA 5HKWA 2NZ0A 1M46A 5DKNA 4CFRA 4MN0A 1OW4A 2H61C 1J7PA 3DVEA 4YGBB 4C0LA 3DVKA 1K95A 2Y4QA 4GGNA 4XJKA 4JD9A 3FWCA 1NUBA 1F70A 2JRFA 1MHOA 2ZNEA 1S3PA 4MSPA 5DKQA 1AP4A 1SK6D 2EC6B 4FQTA 3EK4A 2LVVA 1NCXA 4R1EA 2KFGA 3BUNB 2ERBA 2KYCA 3AAJA 3BFHA 2KSPA 1GGZA 2KLDA 2M8UA 2COLB 1NYAA 2OPOA 4GNKB 1XFRA 2Y1MA 1CM4A 3DD4A 2VRGA 1LVCD 1XFVO 1IKUA 2K61A 3SS3A 3VRRA 1TN4A 5CPVA 2MHHA 2NCPA 2BKHB 2LHIA 1L2OB 2LNKA 1DJIA 1P28A 2KGBC 2CNPA 2QEHA 2KAYA 3H4SE 4HREE 3LL8B 3CS1A 1K8UA 3MSEB 4GUKA 2KI6D 3SG2A 2LLTA 4PALA 3I5GC 3O4XA 1WRLA 4PE4A 3TZ1A 1SKTA 2I7AA 3WHTB 2JWWA 2L0PA 5I2OA 3M0WA 1TNXA 1DC1A 1KQMC 1WDCB 2F2PA 3TDZA 2OS8B 1LA0A 2MLEC 3PSRA 2PYQA 5IBWA 1N0YA 5D7FA 5B8IB 2BCAA 1XFWO 2CBLA 1A2XA 1EL4A 1B7TY 1QVIY 1LS8A 4I5NB 2CT9A 1A03A 3GK2A 1TWOA 2JULA 1S26D 1BU3A 2HQ8A 2LC5A 1SCMB 1F54A 3SG4A 5ER4X 1JF2A 2JOJA 2M3WA 1F8HA 1DJXA 1RWYA 5BPJA 1OOGA 2JNFA 4P5OE 1G8IA 1OOIX 4FTGA 3OBVA 2D8NA 5AEQA 2KI4C 4INXA 2P70A 2G2BA 1QX5B 2QEOA 1SL7A 1C3YA 3RZSA 1JUOA 1BLQA 2BL0C 1IJ6A 3NSKA 1QIVA 5CSNA 2BNXA 5HLOA 3VROA 3B86A 2PRUA 4NQGA 3TDIA 4C0KA 4L9MA 2WNDA 2P6BB 3I5IC 3I5GB 4PCWA 3B7AA 1YX7A 2K7BA 4PHMA 1M31A 5DICA 2KBIA 1SBJA 2GV5A 2HF5A 3PLFB 3NSOA 1KCYA 1BT6A 1KQMB 1YURA 2LUCA 3DF0B 3CR2A 2M7LA 1NCZA 3A8RA 5I2LA 3EKHA 1DJWA 4JPZB 3S0GA 3ZNIA 2K60A 1YR5A 3D0YB 5HLVA 1EG4A 3CWGA 2NCOA 2KBMA 2L4IA 3BUMB 2JU0A 2JTZA 1UHNA 2LLUA 3SG6A 1B47A 2K2AA 4MZJA 1J55A 1CB1A 3VB1A 2K7DA 2Y1NA 1SL8A 3I5HB 1CLLA 1ZUZA 2I94A 2KHNA 3PFVA 1QATA 4PE1A 2G9BA 5D3OA 1GM0A 3DVMA 1B7TZ 1QVIZ 1J7QA 1PALA 3CZTX 2I18A 2FJUB 1OMRA 3IVTA 2R2IA 1Y1XA 4WRIA 3EG5B 1DQEA 1OE9B 3D76A 3DYEA 3A4UB 3SG3A 2QACA 1LA3A 2KI4B 4CIDA 4Q04A 4MZLA 2WC5A 1MQ1A 3B6XA 3O4YA 3AKAA 1KFXL 3HX4A 1OOFA 2GGZA 2O60A 1NX3A 4XJKB 2FCEA 2L2CA 1L2OC 4P2YB 4M2QA 2KAXA 3I5IB 1MR8A 1CDMA 1QJTA 1NX1A 2KFFA 1XFUO 3QMEA 2PSRA 1AJ5A 1S6CA 2LP3A 2V53A 2WC8A 5HKYA 3C1VA 2CXJA 3TS5C 4GAOA 1TOPA 4AQIA 1ODBA 3GK1A 1PVAA 1M45A 2ZRSA 4OR9B 1FF1A 4PHKA 1MXEA 3SJSA 1WDCC 2WORA 2K7OA 1TIZA 1UP5A 4NDDA 2ZRTA 1TNQA 1M39A 1UHJA 2FCDA 3L4AA 3OP0A 1BMOA 2QPTA 1BF5A 4GBAA 1YTZC 2TN4A 3DXLA 3D10A 4GGFC 3EK7A 3SG5A 1AVSA 5EL2A 3WNXB 3VRNA 3GK4X 2LCPA 3BFBA 3OB1B 2WCBA 3UNWA 1QS7A 3B88A 2EHBA 1K94A 1SCMC 4F7FA 3EVRA 1RFJA 3PJIA 3R1OA 1OOJA 2JXLA 3JTDB 3VRQA 4OZDA 2WOSA 4JKTA 1QIWA 2HQWA 4PE7A 2KGRA 5FYXA 1CLBA 3FWBA 1GGWA 4DUQA 3K1EA 3OB2B 4PHJA 1YRTB 2LLSA 2MAZA 1SMGA 1G4YR 1NSHA 1OZOA 1RTP1 2JQ6A 2QEBA 4YGAA 1RJVA 3DZTA 1FI5A 5CSJA 2L5XB 1B1GA 1OZSA 4WQ3A 3BUWB 2KQYA 5DKRA 4DS7A 2RGIA 2WCMA 1XK4A 3AAKA 2AAOA 3TS5B 1CNPA 3BOWA 3R1VA 1Y6WA 3NSLA 2M1UA 1ZACA 5F6TA 5G08A 2WCJA 4MRXA 1AUIB 1JSAA 1A75A 4UPGA 2LMTA 5CSFA 1DT7B 4QJ5B 3D77A 1YVHA 1CFFA 1TNPA 1DMOA 1OSAA 1DF0A 1N2DA 3O2PA 1DJYA 1CFDA 1AHRA 4TNCA 3IF7A 1KSMA 2KLEA 2MLFC 4A4CA 3PM2A 1YUUA 3I5HC 2SCPA 4N1GA 1B8RA 5FI6A 2LUXA 1KFUL 1UHHA 3E3RA 1YUTA 3B87A 4I5JA 2LVJA 3I5FC 4ICBA 4U8DA 4ZCVA 1SW8A 4A4BA 4DIRA 5KTYA 4CPVA 1B4CA 1SR6C 2BE6A 1SRAA 4BY4A 3V2LA 5K89A 3KF9A 4KYNA 2FOTA 2WC6A 1TRFA 1S6JA 3PALA 2BECA 1K90D 1UURA 1K93D 1TCOB 2H8VA 3CABA 3FE8A 1PULA 5TNCA 2JPOA 3LCPC 1CMGA 5KSZA 2JT3A 2Q4UA 2KDHA 1BOCA 4I5LB 5AERA 1OMDA 2KYFA 3HCMA 3D74A 1S1EA 4AOMA 1QTXA 2QDIA 1DVIA 3VRPA 1K2HA 1CDPA 5KU1A 5AFPA 2L51A 1WLMA 1JFJA 1Y1UA 4OKHA 4F0ZB 3R1PA 4PT1A 1DTLA 1MXLC 1K96A 2LVIA 1S5GY 4NDCA 3D73A 3S0FA 1R2UA 1NX2A 2SASA 1W9ZA 3KO0A 5D69A 1F71A 1G33A 5AANA 1NP8A 1KFUS 1J7OA 1HT9A 1LINA 4YBHB 1XK4C 1KWOC 1QASA 1V1FA 2H61A 3I5FB 4WQ2A 3BYAA 1XVJA 1PK0D 4E68A 5J3XA 4MZKA 2K7CA 1SR6B 1E8AA 4GPLB 1QLSA 1ZOTB 2GGMA 3RLZA 1CM1A 5PALA 2K0JA 4INWA 3S0EA 2I2RE 3BXKA 2F3ZA 3FIAA 1LKJA 1KQVA 3JTDC 3RM1A 5GQQC 2JTTA 3CZ1A 1OOHA 2DOQA 2WCLA 2AUCA 2K2FA 2M1KB 1SY9A 1QX2A 1ORGA 1XFZO 4MVFA 3TUYC 2PMYA 1MUXA 1W7IB 4MBEA 4GFTA 2NXQA 4DCKA 2ZN9A 1YRUB 2LVKA 5HL1A 4XYNA 3LK1A 2EGDA 3L4LA 1TTXA 2F33A 1PRWA 2ZN8A 1WLZA 4MEWA 1IQ3A 3Q8IA 4YGEB 5I2QA 1QXPA 4IL1A 2Y5IA 1J1DA 1DJGA 2CCMA 3OHMB 3SG7A 5JJGA 2LV7A 1YX8A 2JNXA 2PVBA 2M7NA 1B8LA 1SSEB 1ALVA 3IQOA 1FI6A 1JFKA 2BAPA 1EG3A 1IG5A 1IJ5A 1K9PA 1QV1A 1SYMA 1T14A 2M0RA 1RK9A 2OTGB 3CR4X 3K21A 1F55A 1EXRA 1B9AA 1FPWA 1NPQA 1L7ZA 3WXAA 1S5GZ 2E30A 1KWOB 3KPXA 3O6BA 4HRGA 1JC2A 2MA2A 3BOWB 2LANA 3F45A 1R6PA 5HKZA 2NLNA 2WCFA 1M63B 2KOTA 4CLNA 1SCVA 1A75B 3CZ0A 3TDUA 1K9KA 2WCHA 1Q80A 1JF0A 2LP2A 3PN7C 1H4BA 1DJHA 4USLA 1U5IA 2BE4A 2KQ6A 1FW4A 1DF0B 2BBNA 2PASA 2M49B 3ZWHA 4QJ4B 1OQPA 2K8MB 3NSIA 1KFXS 3TUYB 2PQLA 2WCKA 2P71A 2ZNDA 1CKKA 4OVNF 1IH0A 2KNEA 4N1FA 1IQ5A 4I5KA 2WCEA 2CTNA 1BR1B 3R72A 4OCIA 2AMIA 3S0AA 2ZFDA 1QV0A 3CLNA 1J7RA 4N5XA 1KSOA 2LMUA 3CTNA 3SS4A 1IWQA 3EVVA 1XA5A 4OV2A 3BUOB 2GTEA 1SPYA 2LE9B 3UO9A 4ETOA 4ORAB 1CTRA 3EKJA 1KK7Y 1UWOA 1A29A 1GQMA 1Z2CB 2MBXA 2A4JA 1QWVA 1V1GA 4QJ3B 1CFPA 1A4PA 3L47A 3LLEA 2JZIA 3NHTA 2E6WA 1HQVA 2L2EA 4YGDB 4YRUA 3DY9A 1Z4HA 2LHLA 1QLKA 2L98A 3PN7B 4D1EA 5I94A 4JWQA 4HSZA 1XYDA 1Y1AA 1XFYO 4ZCUA 3DVJA 4YI8A 4NDBA 2B1UA 2BCXA 1K9UA 2LAPA 4M2PA 4YI9A 2L5YA 4ORCB 2KAVA 3GOFA 2LMVA 2JT0A 4MLWA 2HETA 2JPTA 3SS5A 2F3YA 1C7VA 1CMFA 1DELA 1NIWA 3BQ3A 1UUSA 1DEKA 1SL9A 3BJHA 1YVLA 3CGAA 1S6IA 2BCBA 4ORBB 1N65A 1LXFC 3PM8A 1NX0A 1UHKA 1CLMA 3AKBA 2YGUA 2PALA 2JC2A 3S0DA 1BR4B 1F4QA 3SIAA 4JQ0D 4AQJA 1PSBA 3IQQA 2KPHA 2OTGC 1XO5A 2Q91A 3EK8A 1IGVA 1Y0VH 2BKIB 2F8PA 5CSIA 5I8NA 3FE6A 1MF8B 3BUXB 3NHIA 3KEVA 1CFCA 1FBVA 1KK7Z 1RECA 2ZKMX 3JVTC 2ISDA 1PVBA 2F2OA 2H2KA 4GGFA 1WRKA 1BJFA 1YUSA 1VRKA 3LK0A 2M29A 1GJYA 1F4OA 2M97A 1D1OA 1TUZA 2BBMA 2MRDA 3D75A 4YGCB 4CFQA 3PATA 3OX6A 4PE0A 5HYDA 5JOLA 3NGVA 4DRWA 2FJYA 1C3ZA 1SNLA 3ICBA 4M2OA 4C0JA
chains in the Genus database with same CATH topology
1KK8C 4FQOA 1AK8A 1DGUA 1TCFA 3FS7A 1ZMZA 2MJWB 2IS9A 1B8CA 3VGOA 4BY5A 2HPSA 2L50A 3WHUB 1RROA 1UHIA 1JWDA 1W7JB 1U5IB 3NXAA 1CDNA 1QX7A 3SIBA 2EC6C 4PHNA 1XFXO 3QRXA 1NCYA 3DF0A 1PSRA 4PDZA 3EVUA 1C07A 3CR5X 2KFHA 3D0YA 1DGVA 1BG1A 2BL0B 1J1EA 1EH2A 2L4HA 2O5GA 5ER5A 3OX5A 1JBAA 3JVTB 3KHEA 1AJ4A 1MWNA 1WY9A 5AXIA 1DJZA 2KI6C 2JXCA 1NWDA 1WRZA 2LM5A 4HRHA 1H8BA 1ALWA 1BODA 1S36A 1CDLA 1EJ3A 1OMVA 4MRYA 1ZFSA 1IRJA 2OS8C 3O78A 1TNWA 1X02A 1C7WA 2JT8A 1KK8B 2M9GA 5HKWA 2NZ0A 1M46A 5DKNA 4CFRA 4MN0A 1J7PA 2H61C 3DVEA 4YGBB 4C0LA 3DVKA 1K95A 2Y4QA 4GGNA 4XJKA 3FWCA 1NUBA 1F70A 2JRFA 1MHOA 2ZNEA 1S3PA 4MSPA 5DKQA 1AP4A 1SK6D 2EC6B 3EK4A 2LVVA 1NCXA 4R1EA 2KFGA 3BUNB 2KYCA 3AAJA 2KSPA 1GGZA 2M8UA 2COLB 1NYAA 2OPOA 4GNKB 2Y1MA 1CM4A 3DD4A 2VRGA 1LVCD 1XFVO 1IKUA 2K61A 3VRRA 1TN4A 5CPVA 2MHHA 2NCPA 2BKHB 2LHIA 1L2OB 2LNKA 1DJIA 2KGBC 2CNPA 2KAYA 3H4SE 4HREE 3LL8B 3CS1A 1K8UA 3MSEB 4GUKA 2KI6D 3SG2A 2LLTA 4PALA 3I5GC 4PE4A 1WRLA 3TZ1A 1SKTA 2I7AA 3WHTB 2JWWA 2L0PA 5I2OA 3M0WA 1TNXA 1KQMC 1WDCB 2F2PA 3TDZA 2OS8B 1LA0A 2MLEC 3PSRA 5IBWA 1N0YA 5D7FA 5B8IB 2BCAA 1XFWO 2CBLA 1A2XA 1EL4A 1B7TY 1QVIY 4I5NB 2CT9A 1A03A 3GK2A 2JULA 1S26D 1BU3A 2HQ8A 2LC5A 1SCMB 1F54A 3SG4A 5ER4X 1JF2A 2JOJA 2M3WA 1F8HA 1DJXA 1RWYA 5BPJA 2JNFA 4P5OE 1G8IA 4FTGA 2D8NA 5AEQA 2KI4C 2G2BA 1QX5B 1SL7A 1JUOA 1BLQA 2BL0C 1IJ6A 3NSKA 1QIVA 5CSNA 5HLOA 3VROA 3TDIA 2PRUA 4NQGA 4C0KA 4L9MA 2WNDA 2P6BB 3I5IC 3I5GB 4PCWA 1YX7A 2K7BA 4PHMA 1M31A 2KBIA 1SBJA 2GV5A 2HF5A 3PLFB 3NSOA 1KCYA 1BT6A 1KQMB 1YURA 2LUCA 3DF0B 3CR2A 2M7LA 1NCZA 3A8RA 5I2LA 3EKHA 1DJWA 4JPZB 3ZNIA 1YR5A 3D0YB 5HLVA 1EG4A 3CWGA 2NCOA 2KBMA 2L4IA 3BUMB 2JU0A 2JTZA 1UHNA 2LLUA 3SG6A 1B47A 2K2AA 4MZJA 1J55A 1CB1A 2K7DA 2Y1NA 1SL8A 3I5HB 1CLLA 1ZUZA 2I94A 2KHNA 3PFVA 1QATA 4PE1A 2G9BA 3DVMA 1B7TZ 1QVIZ 1J7QA 1PALA 3CZTX 2I18A 2FJUB 1OMRA 2R2IA 1Y1XA 4WRIA 1OE9B 3A4UB 3SG3A 2QACA 1LA3A 2KI4B 4CIDA 4Q04A 4MZLA 1MQ1A 3O4YA 3AKAA 1KFXL 3HX4A 2GGZA 2O60A 1NX3A 4XJKB 2FCEA 1L2OC 4P2YB 4M2QA 2KAXA 3I5IB 1MR8A 1CDMA 1QJTA 1NX1A 2KFFA 1XFUO 2PSRA 1AJ5A 1S6CA 2LP3A 2V53A 2WC8A 5HKYA 3C1VA 2CXJA 3TS5C 4GAOA 1TOPA 4AQIA 1ODBA 3GK1A 1PVAA 1M45A 2ZRSA 4OR9B 1FF1A 4PHKA 1MXEA 3SJSA 1WDCC 2WORA 2K7OA 1TIZA 1UP5A 4NDDA 2ZRTA 1TNQA 1M39A 1UHJA 2FCDA 3OP0A 1BMOA 2QPTA 1BF5A 4GBAA 1YTZC 2TN4A 4GGFC 3D10A 3EK7A 3SG5A 1AVSA 3WNXB 3VRNA 3GK4X 2LCPA 3OB1B 2WCBA 1QS7A 2EHBA 1K94A 1SCMC 3EVRA 1RFJA 1OOJA 2JXLA 3JTDB 3VRQA 1CLBA 2WOSA 4PE7A 1QIWA 2HQWA 5FYXA 2KGRA 1GGWA 3FWBA 4DUQA 3OB2B 4PHJA 1YRTB 2LLSA 2MAZA 1SMGA 1G4YR 1NSHA 1OZOA 1RTP1 2JQ6A 4YGAA 1RJVA 1FI5A 5CSJA 2L5XB 1B1GA 1OZSA 4WQ3A 3BUWB 2KQYA 5DKRA 4DS7A 2RGIA 1XK4A 3AAKA 2AAOA 3TS5B 1CNPA 3BOWA 1Y6WA 3NSLA 2M1UA 1ZACA 5F6TA 5G08A 4MRXA 1AUIB 1JSAA 1A75A 4UPGA 2LMTA 5CSFA 1DT7B 4QJ5B 1YVHA 1CFFA 1TNPA 1DMOA 1OSAA 1DF0A 1N2DA 3O2PA 1DJYA 1CFDA 1AHRA 4TNCA 3IF7A 1KSMA 2MLFC 4A4CA 1YUUA 3I5HC 2SCPA 4N1GA 1B8RA 2LUXA 1KFUL 1UHHA 3E3RA 1YUTA 4I5JA 4A4BA 2LVJA 3I5FC 4ICBA 4U8DA 4ZCVA 1SW8A 4DIRA 5KTYA 4CPVA 1B4CA 1SR6C 2BE6A 1SRAA 4BY4A 5K89A 3KF9A 2FOTA 1TRFA 1S6JA 3PALA 2BECA 1K90D 1UURA 1K93D 1TCOB 1PULA 5TNCA 3LCPC 1CMGA 5KSZA 2JT3A 2Q4UA 2KDHA 1BOCA 4I5LB 5AERA 1OMDA 2KYFA 3HCMA 1S1EA 4AOMA 1QTXA 1DVIA 3VRPA 1K2HA 1CDPA 5KU1A 5AFPA 2L51A 1WLMA 1JFJA 1Y1UA 4OKHA 4F0ZB 1DTLA 1MXLC 1K96A 2LVIA 1S5GY 4NDCA 1R2UA 1NX2A 2SASA 3KO0A 5D69A 1F71A 1G33A 5AANA 1NP8A 1KFUS 1J7OA 1HT9A 1LINA 4YBHB 1XK4C 1KWOC 1QASA 1V1FA 2H61A 3I5FB 4WQ2A 3BYAA 1XVJA 1PK0D 4E68A 5J3XA 4MZKA 2K7CA 1SR6B 1E8AA 4GPLB 1QLSA 1ZOTB 2GGMA 3RLZA 1CM1A 5PALA 2K0JA 2I2RE 3BXKA 2F3ZA 3FIAA 1LKJA 1KQVA 3JTDC 3RM1A 5GQQC 2JTTA 2DOQA 2AUCA 2K2FA 2M1KB 1SY9A 1QX2A 1XFZO 4MVFA 3TUYC 2PMYA 1MUXA 1W7IB 4MBEA 4GFTA 2NXQA 4DCKA 2ZN9A 1YRUB 2LVKA 4XYNA 3LK1A 2EGDA 1TTXA 2F33A 1PRWA 2ZN8A 1WLZA 4MEWA 1IQ3A 4YGEB 5I2QA 1QXPA 4IL1A 2Y5IA 1J1DA 1DJGA 2CCMA 3OHMB 3SG7A 5JJGA 2LV7A 1YX8A 2JNXA 2PVBA 2M7NA 1B8LA 3IQOA 1ALVA 1FI6A 1JFKA 1EG3A 1IG5A 1IJ5A 1K9PA 1QV1A 1SYMA 2M0RA 2OTGB 1RK9A 3CR4X 3K21A 1F55A 1EXRA 1B9AA 1FPWA 1NPQA 1L7ZA 3WXAA 1S5GZ 2E30A 1KWOB 3KPXA 3O6BA 4HRGA 1JC2A 2MA2A 3BOWB 2LANA 3F45A 1R6PA 5HKZA 2NLNA 2WCFA 1M63B 2KOTA 4CLNA 1SCVA 1A75B 3TDUA 1K9KA 1Q80A 1JF0A 2LP2A 3PN7C 1H4BA 1DJHA 4USLA 1U5IA 2BE4A 2KQ6A 1FW4A 1DF0B 2BBNA 2PASA 2M49B 3ZWHA 4QJ4B 1OQPA 2K8MB 3NSIA 1KFXS 3TUYB 2ZNDA 1CKKA 4OVNF 1IH0A 2KNEA 4N1FA 1IQ5A 4I5KA 2WCEA 2CTNA 1BR1B 4OCIA 2AMIA 2ZFDA 1QV0A 3CLNA 1J7RA 4N5XA 1KSOA 2LMUA 3CTNA 1IWQA 3EVVA 1XA5A 4OV2A 3BUOB 1SPYA 2LE9B 4ETOA 4ORAB 1CTRA 3EKJA 1KK7Y 1UWOA 1GQMA 1A29A 2MBXA 2A4JA 1V1GA 4QJ3B 1CFPA 1A4PA 3LLEA 2JZIA 2E6WA 1HQVA 2L2EA 4YGDB 4YRUA 2LHLA 1QLKA 2L98A 3PN7B 4D1EA 4JWQA 4HSZA 1XYDA 1Y1AA 1XFYO 4ZCUA 3DVJA 4YI8A 4NDBA 2B1UA 2BCXA 1K9UA 2LAPA 4M2PA 4YI9A 4ORCB 2KAVA 3GOFA 2LMVA 2JT0A 4MLWA 2HETA 2JPTA 2F3YA 1C7VA 1CMFA 1NIWA 3BQ3A 1UUSA 1SL9A 3CGAA 1YVLA 1S6IA 2BCBA 4ORBB 1N65A 1LXFC 3PM8A 1NX0A 1UHKA 1CLMA 3AKBA 2PALA 2JC2A 3SIAA 1BR4B 1F4QA 4AQJA 4JQ0D 1PSBA 3IQQA 2OTGC 1XO5A 2Q91A 3EK8A 1IGVA 1Y0VH 2BKIB 2F8PA 5CSIA 5I8NA 1MF8B 3BUXB 3KEVA 1CFCA 1FBVA 1KK7Z 1RECA 2ZKMX 3JVTC 2ISDA 1PVBA 2F2OA 2H2KA 4GGFA 1WRKA 1BJFA 1YUSA 1VRKA 3LK0A 2M29A 1GJYA 1F4OA 2M97A 1D1OA 2BBMA 2MRDA 4YGCB 4CFQA 3PATA 3OX6A 4PE0A 5HYDA 5JOLA 4DRWA 1SNLA 3ICBA 4M2OA 4C0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK8 C;  4FQO A;  1AK8 A;  1DGU A;  1TCF A;  3FS7 A;  1ZMZ A;  2MJW B;  2IS9 A;  1B8C A;  3VGO A;  4BY5 A;  2HPS A;  2L50 A;  3WHU B;  1RRO A;  1UHI A;  1JWD A;  1W7J B;  1U5I B;  3NXA A;  1CDN A;  1QX7 A;  3SIB A;  2EC6 C;  4PHN A;  1XFX O;  3QRX A;  1NCY A;  3DF0 A;  1PSR A;  4PDZ A;  3EVU A;  1C07 A;  3CR5 X;  2KFH A;  3D0Y A;  1DGV A;  1BG1 A;  2BL0 B;  1J1E A;  1EH2 A;  2L4H A;  2O5G A;  5ER5 A;  3OX5 A;  1JBA A;  3JVT B;  3KHE A;  1AJ4 A;  1MWN A;  1WY9 A;  5AXI A;  1DJZ A;  2KI6 C;  2JXC A;  1NWD A;  1WRZ A;  2LM5 A;  4HRH A;  1H8B A;  1ALW A;  1BOD A;  1S36 A;  1CDL A;  1EJ3 A;  1OMV A;  4MRY A;  1ZFS A;  1IRJ A;  2OS8 C;  3O78 A;  1TNW A;  1X02 A;  1C7W A;  2JT8 A;  1KK8 B;  2M9G A;  5HKW A;  2NZ0 A;  1M46 A;  5DKN A;  4CFR A;  4MN0 A;  1J7P A;  2H61 C;  3DVE A;  4YGB B;  4C0L A;  3DVK A;  1K95 A;  2Y4Q A;  4GGN A;  4XJK A;  3FWC A;  1NUB A;  1F70 A;  2JRF A;  1MHO A;  2ZNE A;  1S3P A;  4MSP A;  5DKQ A;  1AP4 A;  1SK6 D;  2EC6 B;  3EK4 A;  2LVV A;  1NCX A;  4R1E A;  2KFG A;  3BUN B;  2KYC A;  3AAJ A;  2KSP A;  1GGZ A;  2M8U A;  2COL B;  1NYA A;  2OPO A;  4GNK B;  2Y1M A;  1CM4 A;  3DD4 A;  2VRG A;  1LVC D;  1XFV O;  1IKU A;  2K61 A;  3VRR A;  1TN4 A;  5CPV A;  2MHH A;  2NCP A;  2BKH B;  2LHI A;  1L2O B;  2LNK A;  1DJI A;  2KGB C;  2CNP A;  2KAY A;  3H4S E;  4HRE E;  3LL8 B;  3CS1 A;  1K8U A;  3MSE B;  4GUK A;  2KI6 D;  3SG2 A;  2LLT A;  4PAL A;  3I5G C;  4PE4 A;  1WRL A;  3TZ1 A;  1SKT A;  2I7A A;  3WHT B;  2JWW A;  2L0P A;  5I2O A;  3M0W A;  1TNX A;  1KQM C;  1WDC B;  2F2P A;  3TDZ A;  2OS8 B;  1LA0 A;  2MLE C;  3PSR A;  5IBW A;  1N0Y A;  5D7F A;  5B8I B;  2BCA A;  1XFW O;  2CBL A;  1A2X A;  1EL4 A;  1B7T Y;  1QVI Y;  4I5N B;  2CT9 A;  1A03 A;  3GK2 A;  2JUL A;  1S26 D;  1BU3 A;  2HQ8 A;  2LC5 A;  1SCM B;  1F54 A;  3SG4 A;  5ER4 X;  1JF2 A;  2JOJ A;  2M3W A;  1F8H A;  1DJX A;  1RWY A;  5BPJ A;  2JNF A;  4P5O E;  1G8I A;  4FTG A;  2D8N A;  5AEQ A;  2KI4 C;  2G2B A;  1QX5 B;  1SL7 A;  1JUO A;  1BLQ A;  2BL0 C;  1IJ6 A;  3NSK A;  1QIV A;  5CSN A;  5HLO A;  3VRO A;  3TDI A;  2PRU A;  4NQG A;  4C0K A;  4L9M A;  2WND A;  2P6B B;  3I5I C;  3I5G B;  4PCW A;  1YX7 A;  2K7B A;  4PHM A;  1M31 A;  2KBI A;  1SBJ A;  2GV5 A;  2HF5 A;  3PLF B;  3NSO A;  1KCY A;  1BT6 A;  1KQM B;  1YUR A;  2LUC A;  3DF0 B;  3CR2 A;  2M7L A;  1NCZ A;  3A8R A;  5I2L A;  3EKH A;  1DJW A;  4JPZ B;  3ZNI A;  1YR5 A;  3D0Y B;  5HLV A;  1EG4 A;  3CWG A;  2NCO A;  2KBM A;  2L4I A;  3BUM B;  2JU0 A;  2JTZ A;  1UHN A;  2LLU A;  3SG6 A;  1B47 A;  2K2A A;  4MZJ A;  1J55 A;  1CB1 A;  2K7D A;  2Y1N A;  1SL8 A;  3I5H B;  1CLL A;  1ZUZ A;  2I94 A;  2KHN A;  3PFV A;  1QAT A;  4PE1 A;  2G9B A;  3DVM A;  1B7T Z;  1QVI Z;  1J7Q A;  1PAL A;  3CZT X;  2I18 A;  2FJU B;  1OMR A;  2R2I A;  1Y1X A;  4WRI A;  1OE9 B;  3A4U B;  3SG3 A;  2QAC A;  1LA3 A;  2KI4 B;  4CID A;  4Q04 A;  4MZL A;  1MQ1 A;  3O4Y A;  3AKA A;  1KFX L;  3HX4 A;  2GGZ A;  2O60 A;  1NX3 A;  4XJK B;  2FCE A;  1L2O C;  4P2Y B;  4M2Q A;  2KAX A;  3I5I B;  1MR8 A;  1CDM A;  1QJT A;  1NX1 A;  2KFF A;  1XFU O;  2PSR A;  1AJ5 A;  1S6C A;  2LP3 A;  2V53 A;  2WC8 A;  5HKY A;  3C1V A;  2CXJ A;  3TS5 C;  4GAO A;  1TOP A;  4AQI A;  1ODB A;  3GK1 A;  1PVA A;  1M45 A;  2ZRS A;  4OR9 B;  1FF1 A;  4PHK A;  1MXE A;  3SJS A;  1WDC C;  2WOR A;  2K7O A;  1TIZ A;  1UP5 A;  4NDD A;  2ZRT A;  1TNQ A;  1M39 A;  1UHJ A;  2FCD A;  3OP0 A;  1BMO A;  2QPT A;  1BF5 A;  4GBA A;  1YTZ C;  2TN4 A;  4GGF C;  3D10 A;  3EK7 A;  3SG5 A;  1AVS A;  3WNX B;  3VRN A;  3GK4 X;  2LCP A;  3OB1 B;  2WCB A;  1QS7 A;  2EHB A;  1K94 A;  1SCM C;  3EVR A;  1RFJ A;  1OOJ A;  2JXL A;  3JTD B;  3VRQ A;  1CLB A;  2WOS A;  4PE7 A;  1QIW A;  2HQW A;  5FYX A;  2KGR A;  1GGW A;  3FWB A;  4DUQ A;  3OB2 B;  4PHJ A;  1YRT B;  2LLS A;  2MAZ A;  1SMG A;  1G4Y R;  1NSH A;  1OZO A;  1RTP 1;  2JQ6 A;  4YGA A;  1RJV A;  1FI5 A;  5CSJ A;  2L5X B;  1B1G A;  1OZS A;  4WQ3 A;  3BUW B;  2KQY A;  5DKR A;  4DS7 A;  2RGI A;  1XK4 A;  3AAK A;  2AAO A;  3TS5 B;  1CNP A;  3BOW A;  1Y6W A;  3NSL A;  2M1U A;  1ZAC A;  5F6T A;  5G08 A;  4MRX A;  1AUI B;  1JSA A;  1A75 A;  4UPG A;  2LMT A;  5CSF A;  1DT7 B;  4QJ5 B;  1YVH A;  1CFF A;  1TNP A;  1DMO A;  1OSA A;  1DF0 A;  1N2D A;  3O2P A;  1DJY A;  1CFD A;  1AHR A;  4TNC A;  3IF7 A;  1KSM A;  2MLF C;  4A4C A;  1YUU A;  3I5H C;  2SCP A;  4N1G A;  1B8R A;  2LUX A;  1KFU L;  1UHH A;  3E3R A;  1YUT A;  4I5J A;  4A4B A;  2LVJ A;  3I5F C;  4ICB A;  4U8D A;  4ZCV A;  1SW8 A;  4DIR A;  5KTY A;  4CPV A;  1B4C A;  1SR6 C;  2BE6 A;  1SRA A;  4BY4 A;  5K89 A;  3KF9 A;  2FOT A;  1TRF A;  1S6J A;  3PAL A;  2BEC A;  1K90 D;  1UUR A;  1K93 D;  1TCO B;  1PUL A;  5TNC A;  3LCP C;  1CMG A;  5KSZ A;  2JT3 A;  2Q4U A;  2KDH A;  1BOC A;  4I5L B;  5AER A;  1OMD A;  2KYF A;  3HCM A;  1S1E A;  4AOM A;  1QTX A;  1DVI A;  3VRP A;  1K2H A;  1CDP A;  5KU1 A;  5AFP A;  2L51 A;  1WLM A;  1JFJ A;  1Y1U A;  4OKH A;  4F0Z B;  1DTL A;  1MXL C;  1K96 A;  2LVI A;  1S5G Y;  4NDC A;  1R2U A;  1NX2 A;  2SAS A;  3KO0 A;  5D69 A;  1F71 A;  1G33 A;  5AAN A;  1NP8 A;  1KFU S;  1J7O A;  1HT9 A;  1LIN A;  4YBH B;  1XK4 C;  1KWO C;  1QAS A;  1V1F A;  2H61 A;  3I5F B;  4WQ2 A;  3BYA A;  1XVJ A;  1PK0 D;  4E68 A;  5J3X A;  4MZK A;  2K7C A;  1SR6 B;  1E8A A;  4GPL B;  1QLS A;  1ZOT B;  2GGM A;  3RLZ A;  1CM1 A;  5PAL A;  2K0J A;  2I2R E;  3BXK A;  2F3Z A;  3FIA A;  1LKJ A;  1KQV A;  3JTD C;  3RM1 A;  5GQQ C;  2JTT A;  2DOQ A;  2AUC A;  2K2F A;  2M1K B;  1SY9 A;  1QX2 A;  1XFZ O;  4MVF A;  3TUY C;  2PMY A;  1MUX A;  1W7I B;  4MBE A;  4GFT A;  2NXQ A;  4DCK A;  2ZN9 A;  1YRU B;  2LVK A;  4XYN A;  3LK1 A;  2EGD A;  1TTX A;  2F33 A;  1PRW A;  2ZN8 A;  1WLZ A;  4MEW A;  1IQ3 A;  4YGE B;  5I2Q A;  1QXP A;  4IL1 A;  2Y5I A;  1J1D A;  1DJG A;  2CCM A;  3OHM B;  3SG7 A;  5JJG A;  2LV7 A;  1YX8 A;  2JNX A;  2PVB A;  2M7N A;  1B8L A;  3IQO A;  1ALV A;  1FI6 A;  1JFK A;  1EG3 A;  1IG5 A;  1IJ5 A;  1K9P A;  1QV1 A;  1SYM A;  2M0R A;  2OTG B;  1RK9 A;  3CR4 X;  3K21 A;  1F55 A;  1EXR A;  1B9A A;  1FPW A;  1NPQ A;  1L7Z A;  3WXA A;  1S5G Z;  2E30 A;  1KWO B;  3KPX A;  3O6B A;  4HRG A;  1JC2 A;  2MA2 A;  3BOW B;  2LAN A;  3F45 A;  1R6P A;  5HKZ A;  2NLN A;  2WCF A;  1M63 B;  2KOT A;  4CLN A;  1SCV A;  1A75 B;  3TDU A;  1K9K A;  1Q80 A;  1JF0 A;  2LP2 A;  3PN7 C;  1H4B A;  1DJH A;  4USL A;  1U5I A;  2BE4 A;  2KQ6 A;  1FW4 A;  1DF0 B;  2BBN A;  2PAS A;  2M49 B;  3ZWH A;  4QJ4 B;  1OQP A;  2K8M B;  3NSI A;  1KFX S;  3TUY B;  2ZND A;  1CKK A;  4OVN F;  1IH0 A;  2KNE A;  4N1F A;  1IQ5 A;  4I5K A;  2WCE A;  2CTN A;  1BR1 B;  4OCI A;  2AMI A;  2ZFD A;  1QV0 A;  3CLN A;  1J7R A;  4N5X A;  1KSO A;  2LMU A;  3CTN A;  1IWQ A;  3EVV A;  1XA5 A;  4OV2 A;  3BUO B;  1SPY A;  2LE9 B;  4ETO A;  4ORA B;  1CTR A;  3EKJ A;  1KK7 Y;  1UWO A;  1GQM A;  1A29 A;  2MBX A;  2A4J A;  1V1G A;  4QJ3 B;  1CFP A;  1A4P A;  3LLE A;  2JZI A;  2E6W A;  1HQV A;  2L2E A;  4YGD B;  4YRU A;  2LHL A;  1QLK A;  2L98 A;  3PN7 B;  4D1E A;  4JWQ A;  4HSZ A;  1XYD A;  1Y1A A;  1XFY O;  4ZCU A;  3DVJ A;  4YI8 A;  4NDB A;  2B1U A;  2BCX A;  1K9U A;  2LAP A;  4M2P A;  4YI9 A;  4ORC B;  2KAV A;  3GOF A;  2LMV A;  2JT0 A;  4MLW A;  2HET A;  2JPT A;  2F3Y A;  1C7V A;  1CMF A;  1NIW A;  3BQ3 A;  1UUS A;  1SL9 A;  3CGA A;  1YVL A;  1S6I A;  2BCB A;  4ORB B;  1N65 A;  1LXF C;  3PM8 A;  1NX0 A;  1UHK A;  1CLM A;  3AKB A;  2PAL A;  2JC2 A;  3SIA A;  1BR4 B;  1F4Q A;  4AQJ A;  4JQ0 D;  1PSB A;  3IQQ A;  2OTG C;  1XO5 A;  2Q91 A;  3EK8 A;  1IGV A;  1Y0V H;  2BKI B;  2F8P A;  5CSI A;  5I8N A;  1MF8 B;  3BUX B;  3KEV A;  1CFC A;  1FBV A;  1KK7 Z;  1REC A;  2ZKM X;  3JVT C;  2ISD A;  1PVB A;  2F2O A;  2H2K A;  4GGF A;  1WRK A;  1BJF A;  1YUS A;  1VRK A;  3LK0 A;  2M29 A;  1GJY A;  1F4O A;  2M97 A;  1D1O A;  2BBM A;  2MRD A;  4YGC B;  4CFQ A;  3PAT A;  3OX6 A;  4PE0 A;  5HYD A;  5JOL A;  4DRW A;  1SNL A;  3ICB A;  4M2O A;  4C0J A; 
#chains in the Genus database with same CATH topology
 5FI7 A;  1KK8 C;  1IIO A;  4FQO A;  1AK8 A;  1DGU A;  1TCF A;  3FS7 A;  3FE9 A;  1ZMZ A;  2MJW B;  2IS9 A;  1B8C A;  4IJ7 A;  3VGO A;  2HPS A;  2L50 A;  3WHU B;  4BY5 A;  1RRO A;  1UHI A;  3CYZ A;  1JWD A;  1W7J B;  1U5I B;  3OGN A;  3NXA A;  1CDN A;  1QX7 A;  3SIB A;  2EC6 C;  4PHN A;  5FI2 A;  1XFX O;  3QRX A;  3BFA A;  1NCY A;  3DF0 A;  1PSR A;  4PDZ A;  3EVU A;  1C07 A;  3CR5 X;  2KFH A;  3D0Y A;  1DGV A;  1BG1 A;  2BL0 B;  1J1E A;  1EH2 A;  2L4H A;  2O5G A;  5ER5 A;  3S0B A;  3OX5 A;  1JBA A;  3JVT B;  3CZ2 A;  3KHE A;  1AJ4 A;  1MWN A;  1WY9 A;  5AXI A;  1DJZ A;  3CDN A;  2KI6 C;  1TUJ A;  2JXC A;  1NWD A;  1WRZ A;  2LM5 A;  4HRH A;  1H8B A;  1ALW A;  1BOD A;  1S36 A;  1CDL A;  1EJ3 A;  1OMV A;  4MRY A;  1ZFS A;  2QEV A;  3D78 A;  1IRJ A;  2OS8 C;  3O78 A;  1TNW A;  1X02 A;  1C7W A;  2JT8 A;  1KK8 B;  3N7H A;  2M9G A;  5HKW A;  2NZ0 A;  1M46 A;  5DKN A;  4CFR A;  4MN0 A;  1OW4 A;  2H61 C;  1J7P A;  3DVE A;  4YGB B;  4C0L A;  3DVK A;  1K95 A;  2Y4Q A;  4GGN A;  4XJK A;  4JD9 A;  3FWC A;  1NUB A;  1F70 A;  2JRF A;  1MHO A;  2ZNE A;  1S3P A;  4MSP A;  5DKQ A;  1AP4 A;  1SK6 D;  2EC6 B;  4FQT A;  3EK4 A;  2LVV A;  1NCX A;  4R1E A;  2KFG A;  3BUN B;  2ERB A;  2KYC A;  3AAJ A;  3BFH A;  2KSP A;  1GGZ A;  2KLD A;  2M8U A;  2COL B;  1NYA A;  2OPO A;  4GNK B;  1XFR A;  2Y1M A;  1CM4 A;  3DD4 A;  2VRG A;  1LVC D;  1XFV O;  1IKU A;  2K61 A;  3SS3 A;  3VRR A;  1TN4 A;  5CPV A;  2MHH A;  2NCP A;  2BKH B;  2LHI A;  1L2O B;  2LNK A;  1DJI A;  1P28 A;  2KGB C;  2CNP A;  2QEH A;  2KAY A;  3H4S E;  4HRE E;  3LL8 B;  3CS1 A;  1K8U A;  3MSE B;  4GUK A;  2KI6 D;  3SG2 A;  2LLT A;  4PAL A;  3I5G C;  3O4X A;  1WRL A;  4PE4 A;  3TZ1 A;  1SKT A;  2I7A A;  3WHT B;  2JWW A;  2L0P A;  5I2O A;  3M0W A;  1TNX A;  1DC1 A;  1KQM C;  1WDC B;  2F2P A;  3TDZ A;  2OS8 B;  1LA0 A;  2MLE C;  3PSR A;  2PYQ A;  5IBW A;  1N0Y A;  5D7F A;  5B8I B;  2BCA A;  1XFW O;  2CBL A;  1A2X A;  1EL4 A;  1B7T Y;  1QVI Y;  1LS8 A;  4I5N B;  2CT9 A;  1A03 A;  3GK2 A;  1TWO A;  2JUL A;  1S26 D;  1BU3 A;  2HQ8 A;  2LC5 A;  1SCM B;  1F54 A;  3SG4 A;  5ER4 X;  1JF2 A;  2JOJ A;  2M3W A;  1F8H A;  1DJX A;  1RWY A;  5BPJ A;  1OOG A;  2JNF A;  4P5O E;  1G8I A;  1OOI X;  4FTG A;  3OBV A;  2D8N A;  5AEQ A;  2KI4 C;  4INX A;  2P70 A;  2G2B A;  1QX5 B;  2QEO A;  1SL7 A;  1C3Y A;  3RZS A;  1JUO A;  1BLQ A;  2BL0 C;  1IJ6 A;  3NSK A;  1QIV A;  5CSN A;  2BNX A;  5HLO A;  3VRO A;  3B86 A;  2PRU A;  4NQG A;  3TDI A;  4C0K A;  4L9M A;  2WND A;  2P6B B;  3I5I C;  3I5G B;  4PCW A;  3B7A A;  1YX7 A;  2K7B A;  4PHM A;  1M31 A;  5DIC A;  2KBI A;  1SBJ A;  2GV5 A;  2HF5 A;  3PLF B;  3NSO A;  1KCY A;  1BT6 A;  1KQM B;  1YUR A;  2LUC A;  3DF0 B;  3CR2 A;  2M7L A;  1NCZ A;  3A8R A;  5I2L A;  3EKH A;  1DJW A;  4JPZ B;  3S0G A;  3ZNI A;  2K60 A;  1YR5 A;  3D0Y B;  5HLV A;  1EG4 A;  3CWG A;  2NCO A;  2KBM A;  2L4I A;  3BUM B;  2JU0 A;  2JTZ A;  1UHN A;  2LLU A;  3SG6 A;  1B47 A;  2K2A A;  4MZJ A;  1J55 A;  1CB1 A;  3VB1 A;  2K7D A;  2Y1N A;  1SL8 A;  3I5H B;  1CLL A;  1ZUZ A;  2I94 A;  2KHN A;  3PFV A;  1QAT A;  4PE1 A;  2G9B A;  5D3O A;  1GM0 A;  3DVM A;  1B7T Z;  1QVI Z;  1J7Q A;  1PAL A;  3CZT X;  2I18 A;  2FJU B;  1OMR A;  3IVT A;  2R2I A;  1Y1X A;  4WRI A;  3EG5 B;  1DQE A;  1OE9 B;  3D76 A;  3DYE A;  3A4U B;  3SG3 A;  2QAC A;  1LA3 A;  2KI4 B;  4CID A;  4Q04 A;  4MZL A;  2WC5 A;  1MQ1 A;  3B6X A;  3O4Y A;  3AKA A;  1KFX L;  3HX4 A;  1OOF A;  2GGZ A;  2O60 A;  1NX3 A;  4XJK B;  2FCE A;  2L2C A;  1L2O C;  4P2Y B;  4M2Q A;  2KAX A;  3I5I B;  1MR8 A;  1CDM A;  1QJT A;  1NX1 A;  2KFF A;  1XFU O;  3QME A;  2PSR A;  1AJ5 A;  1S6C A;  2LP3 A;  2V53 A;  2WC8 A;  5HKY A;  3C1V A;  2CXJ A;  3TS5 C;  4GAO A;  1TOP A;  4AQI A;  1ODB A;  3GK1 A;  1PVA A;  1M45 A;  2ZRS A;  4OR9 B;  1FF1 A;  4PHK A;  1MXE A;  3SJS A;  1WDC C;  2WOR A;  2K7O A;  1TIZ A;  1UP5 A;  4NDD A;  2ZRT A;  1TNQ A;  1M39 A;  1UHJ A;  2FCD A;  3L4A A;  3OP0 A;  1BMO A;  2QPT A;  1BF5 A;  4GBA A;  1YTZ C;  2TN4 A;  3DXL A;  3D10 A;  4GGF C;  3EK7 A;  3SG5 A;  1AVS A;  5EL2 A;  3WNX B;  3VRN A;  3GK4 X;  2LCP A;  3BFB A;  3OB1 B;  2WCB A;  3UNW A;  1QS7 A;  3B88 A;  2EHB A;  1K94 A;  1SCM C;  4F7F A;  3EVR A;  1RFJ A;  3PJI A;  3R1O A;  1OOJ A;  2JXL A;  3JTD B;  3VRQ A;  4OZD A;  2WOS A;  4JKT A;  1QIW A;  2HQW A;  4PE7 A;  2KGR A;  5FYX A;  1CLB A;  3FWB A;  1GGW A;  4DUQ A;  3K1E A;  3OB2 B;  4PHJ A;  1YRT B;  2LLS A;  2MAZ A;  1SMG A;  1G4Y R;  1NSH A;  1OZO A;  1RTP 1;  2JQ6 A;  2QEB A;  4YGA A;  1RJV A;  3DZT A;  1FI5 A;  5CSJ A;  2L5X B;  1B1G A;  1OZS A;  4WQ3 A;  3BUW B;  2KQY A;  5DKR A;  4DS7 A;  2RGI A;  2WCM A;  1XK4 A;  3AAK A;  2AAO A;  3TS5 B;  1CNP A;  3BOW A;  3R1V A;  1Y6W A;  3NSL A;  2M1U A;  1ZAC A;  5F6T A;  5G08 A;  2WCJ A;  4MRX A;  1AUI B;  1JSA A;  1A75 A;  4UPG A;  2LMT A;  5CSF A;  1DT7 B;  4QJ5 B;  3D77 A;  1YVH A;  1CFF A;  1TNP A;  1DMO A;  1OSA A;  1DF0 A;  1N2D A;  3O2P A;  1DJY A;  1CFD A;  1AHR A;  4TNC A;  3IF7 A;  1KSM A;  2KLE A;  2MLF C;  4A4C A;  3PM2 A;  1YUU A;  3I5H C;  2SCP A;  4N1G A;  1B8R A;  5FI6 A;  2LUX A;  1KFU L;  1UHH A;  3E3R A;  1YUT A;  3B87 A;  4I5J A;  2LVJ A;  3I5F C;  4ICB A;  4U8D A;  4ZCV A;  1SW8 A;  4A4B A;  4DIR A;  5KTY A;  4CPV A;  1B4C A;  1SR6 C;  2BE6 A;  1SRA A;  4BY4 A;  3V2L A;  5K89 A;  3KF9 A;  4KYN A;  2FOT A;  2WC6 A;  1TRF A;  1S6J A;  3PAL A;  2BEC A;  1K90 D;  1UUR A;  1K93 D;  1TCO B;  2H8V A;  3CAB A;  3FE8 A;  1PUL A;  5TNC A;  2JPO A;  3LCP C;  1CMG A;  5KSZ A;  2JT3 A;  2Q4U A;  2KDH A;  1BOC A;  4I5L B;  5AER A;  1OMD A;  2KYF A;  3HCM A;  3D74 A;  1S1E A;  4AOM A;  1QTX A;  2QDI A;  1DVI A;  3VRP A;  1K2H A;  1CDP A;  5KU1 A;  5AFP A;  2L51 A;  1WLM A;  1JFJ A;  1Y1U A;  4OKH A;  4F0Z B;  3R1P A;  4PT1 A;  1DTL A;  1MXL C;  1K96 A;  2LVI A;  1S5G Y;  4NDC A;  3D73 A;  3S0F A;  1R2U A;  1NX2 A;  2SAS A;  1W9Z A;  3KO0 A;  5D69 A;  1F71 A;  1G33 A;  5AAN A;  1NP8 A;  1KFU S;  1J7O A;  1HT9 A;  1LIN A;  4YBH B;  1XK4 C;  1KWO C;  1QAS A;  1V1F A;  2H61 A;  3I5F B;  4WQ2 A;  3BYA A;  1XVJ A;  1PK0 D;  4E68 A;  5J3X A;  4MZK A;  2K7C A;  1SR6 B;  1E8A A;  4GPL B;  1QLS A;  1ZOT B;  2GGM A;  3RLZ A;  1CM1 A;  5PAL A;  2K0J A;  4INW A;  3S0E A;  2I2R E;  3BXK A;  2F3Z A;  3FIA A;  1LKJ A;  1KQV A;  3JTD C;  3RM1 A;  5GQQ C;  2JTT A;  3CZ1 A;  1OOH A;  2DOQ A;  2WCL A;  2AUC A;  2K2F A;  2M1K B;  1SY9 A;  1QX2 A;  1ORG A;  1XFZ O;  4MVF A;  3TUY C;  2PMY A;  1MUX A;  1W7I B;  4MBE A;  4GFT A;  2NXQ A;  4DCK A;  2ZN9 A;  1YRU B;  2LVK A;  5HL1 A;  4XYN A;  3LK1 A;  2EGD A;  3L4L A;  1TTX A;  2F33 A;  1PRW A;  2ZN8 A;  1WLZ A;  4MEW A;  1IQ3 A;  3Q8I A;  4YGE B;  5I2Q A;  1QXP A;  4IL1 A;  2Y5I A;  1J1D A;  1DJG A;  2CCM A;  3OHM B;  3SG7 A;  5JJG A;  2LV7 A;  1YX8 A;  2JNX A;  2PVB A;  2M7N A;  1B8L A;  1SSE B;  1ALV A;  3IQO A;  1FI6 A;  1JFK A;  2BAP A;  1EG3 A;  1IG5 A;  1IJ5 A;  1K9P A;  1QV1 A;  1SYM A;  1T14 A;  2M0R A;  1RK9 A;  2OTG B;  3CR4 X;  3K21 A;  1F55 A;  1EXR A;  1B9A A;  1FPW A;  1NPQ A;  1L7Z A;  3WXA A;  1S5G Z;  2E30 A;  1KWO B;  3KPX A;  3O6B A;  4HRG A;  1JC2 A;  2MA2 A;  3BOW B;  2LAN A;  3F45 A;  1R6P A;  5HKZ A;  2NLN A;  2WCF A;  1M63 B;  2KOT A;  4CLN A;  1SCV A;  1A75 B;  3CZ0 A;  3TDU A;  1K9K A;  2WCH A;  1Q80 A;  1JF0 A;  2LP2 A;  3PN7 C;  1H4B A;  1DJH A;  4USL A;  1U5I A;  2BE4 A;  2KQ6 A;  1FW4 A;  1DF0 B;  2BBN A;  2PAS A;  2M49 B;  3ZWH A;  4QJ4 B;  1OQP A;  2K8M B;  3NSI A;  1KFX S;  3TUY B;  2PQL A;  2WCK A;  2P71 A;  2ZND A;  1CKK A;  4OVN F;  1IH0 A;  2KNE A;  4N1F A;  1IQ5 A;  4I5K A;  2WCE A;  2CTN A;  1BR1 B;  3R72 A;  4OCI A;  2AMI A;  3S0A A;  2ZFD A;  1QV0 A;  3CLN A;  1J7R A;  4N5X A;  1KSO A;  2LMU A;  3CTN A;  3SS4 A;  1IWQ A;  3EVV A;  1XA5 A;  4OV2 A;  3BUO B;  2GTE A;  1SPY A;  2LE9 B;  3UO9 A;  4ETO A;  4ORA B;  1CTR A;  3EKJ A;  1KK7 Y;  1UWO A;  1A29 A;  1GQM A;  1Z2C B;  2MBX A;  2A4J A;  1QWV A;  1V1G A;  4QJ3 B;  1CFP A;  1A4P A;  3L47 A;  3LLE A;  2JZI A;  3NHT A;  2E6W A;  1HQV A;  2L2E A;  4YGD B;  4YRU A;  3DY9 A;  1Z4H A;  2LHL A;  1QLK A;  2L98 A;  3PN7 B;  4D1E A;  5I94 A;  4JWQ A;  4HSZ A;  1XYD A;  1Y1A A;  1XFY O;  4ZCU A;  3DVJ A;  4YI8 A;  4NDB A;  2B1U A;  2BCX A;  1K9U A;  2LAP A;  4M2P A;  4YI9 A;  2L5Y A;  4ORC B;  2KAV A;  3GOF A;  2LMV A;  2JT0 A;  4MLW A;  2HET A;  2JPT A;  3SS5 A;  2F3Y A;  1C7V A;  1CMF A;  1DEL A;  1NIW A;  3BQ3 A;  1UUS A;  1DEK A;  1SL9 A;  3BJH A;  1YVL A;  3CGA A;  1S6I A;  2BCB A;  4ORB B;  1N65 A;  1LXF C;  3PM8 A;  1NX0 A;  1UHK A;  1CLM A;  3AKB A;  2YGU A;  2PAL A;  2JC2 A;  3S0D A;  1BR4 B;  1F4Q A;  3SIA A;  4JQ0 D;  4AQJ A;  1PSB A;  3IQQ A;  2KPH A;  2OTG C;  1XO5 A;  2Q91 A;  3EK8 A;  1IGV A;  1Y0V H;  2BKI B;  2F8P A;  5CSI A;  5I8N A;  3FE6 A;  1MF8 B;  3BUX B;  3NHI A;  3KEV A;  1CFC A;  1FBV A;  1KK7 Z;  1REC A;  2ZKM X;  3JVT C;  2ISD A;  1PVB A;  2F2O A;  2H2K A;  4GGF A;  1WRK A;  1BJF A;  1YUS A;  1VRK A;  3LK0 A;  2M29 A;  1GJY A;  1F4O A;  2M97 A;  1D1O A;  1TUZ A;  2BBM A;  2MRD A;  3D75 A;  4YGC B;  4CFQ A;  3PAT A;  3OX6 A;  4PE0 A;  5HYD A;  5JOL A;  3NGV A;  4DRW A;  2FJY A;  1C3Z A;  1SNL A;  3ICB A;  4M2O A;  4C0J A; 
#chains in the Genus database with same CATH homology
 1KK8 C;  4FQO A;  1AK8 A;  1DGU A;  1TCF A;  3FS7 A;  1ZMZ A;  2MJW B;  2IS9 A;  1B8C A;  3VGO A;  4BY5 A;  2HPS A;  2L50 A;  3WHU B;  1RRO A;  1UHI A;  1JWD A;  1W7J B;  1U5I B;  3NXA A;  1CDN A;  1QX7 A;  3SIB A;  2EC6 C;  4PHN A;  1XFX O;  3QRX A;  1NCY A;  3DF0 A;  1PSR A;  4PDZ A;  3EVU A;  1C07 A;  3CR5 X;  2KFH A;  3D0Y A;  1DGV A;  1BG1 A;  2BL0 B;  1J1E A;  1EH2 A;  2L4H A;  2O5G A;  5ER5 A;  3OX5 A;  1JBA A;  3JVT B;  3KHE A;  1AJ4 A;  1MWN A;  1WY9 A;  5AXI A;  1DJZ A;  2KI6 C;  2JXC A;  1NWD A;  1WRZ A;  2LM5 A;  4HRH A;  1H8B A;  1ALW A;  1BOD A;  1S36 A;  1CDL A;  1EJ3 A;  1OMV A;  4MRY A;  1ZFS A;  1IRJ A;  2OS8 C;  3O78 A;  1TNW A;  1X02 A;  1C7W A;  2JT8 A;  1KK8 B;  2M9G A;  5HKW A;  2NZ0 A;  1M46 A;  5DKN A;  4CFR A;  4MN0 A;  1J7P A;  2H61 C;  3DVE A;  4YGB B;  4C0L A;  3DVK A;  1K95 A;  2Y4Q A;  4GGN A;  4XJK A;  3FWC A;  1NUB A;  1F70 A;  2JRF A;  1MHO A;  2ZNE A;  1S3P A;  4MSP A;  5DKQ A;  1AP4 A;  1SK6 D;  2EC6 B;  3EK4 A;  2LVV A;  1NCX A;  4R1E A;  2KFG A;  3BUN B;  2KYC A;  3AAJ A;  2KSP A;  1GGZ A;  2M8U A;  2COL B;  1NYA A;  2OPO A;  4GNK B;  2Y1M A;  1CM4 A;  3DD4 A;  2VRG A;  1LVC D;  1XFV O;  1IKU A;  2K61 A;  3VRR A;  1TN4 A;  5CPV A;  2MHH A;  2NCP A;  2BKH B;  2LHI A;  1L2O B;  2LNK A;  1DJI A;  2KGB C;  2CNP A;  2KAY A;  3H4S E;  4HRE E;  3LL8 B;  3CS1 A;  1K8U A;  3MSE B;  4GUK A;  2KI6 D;  3SG2 A;  2LLT A;  4PAL A;  3I5G C;  4PE4 A;  1WRL A;  3TZ1 A;  1SKT A;  2I7A A;  3WHT B;  2JWW A;  2L0P A;  5I2O A;  3M0W A;  1TNX A;  1KQM C;  1WDC B;  2F2P A;  3TDZ A;  2OS8 B;  1LA0 A;  2MLE C;  3PSR A;  5IBW A;  1N0Y A;  5D7F A;  5B8I B;  2BCA A;  1XFW O;  2CBL A;  1A2X A;  1EL4 A;  1B7T Y;  1QVI Y;  4I5N B;  2CT9 A;  1A03 A;  3GK2 A;  2JUL A;  1S26 D;  1BU3 A;  2HQ8 A;  2LC5 A;  1SCM B;  1F54 A;  3SG4 A;  5ER4 X;  1JF2 A;  2JOJ A;  2M3W A;  1F8H A;  1DJX A;  1RWY A;  5BPJ A;  2JNF A;  4P5O E;  1G8I A;  4FTG A;  2D8N A;  5AEQ A;  2KI4 C;  2G2B A;  1QX5 B;  1SL7 A;  1JUO A;  1BLQ A;  2BL0 C;  1IJ6 A;  3NSK A;  1QIV A;  5CSN A;  5HLO A;  3VRO A;  3TDI A;  2PRU A;  4NQG A;  4C0K A;  4L9M A;  2WND A;  2P6B B;  3I5I C;  3I5G B;  4PCW A;  1YX7 A;  2K7B A;  4PHM A;  1M31 A;  2KBI A;  1SBJ A;  2GV5 A;  2HF5 A;  3PLF B;  3NSO A;  1KCY A;  1BT6 A;  1KQM B;  1YUR A;  2LUC A;  3DF0 B;  3CR2 A;  2M7L A;  1NCZ A;  3A8R A;  5I2L A;  3EKH A;  1DJW A;  4JPZ B;  3ZNI A;  1YR5 A;  3D0Y B;  5HLV A;  1EG4 A;  3CWG A;  2NCO A;  2KBM A;  2L4I A;  3BUM B;  2JU0 A;  2JTZ A;  1UHN A;  2LLU A;  3SG6 A;  1B47 A;  2K2A A;  4MZJ A;  1J55 A;  1CB1 A;  2K7D A;  2Y1N A;  1SL8 A;  3I5H B;  1CLL A;  1ZUZ A;  2I94 A;  2KHN A;  3PFV A;  1QAT A;  4PE1 A;  2G9B A;  3DVM A;  1B7T Z;  1QVI Z;  1J7Q A;  1PAL A;  3CZT X;  2I18 A;  2FJU B;  1OMR A;  2R2I A;  1Y1X A;  4WRI A;  1OE9 B;  3A4U B;  3SG3 A;  2QAC A;  1LA3 A;  2KI4 B;  4CID A;  4Q04 A;  4MZL A;  1MQ1 A;  3O4Y A;  3AKA A;  1KFX L;  3HX4 A;  2GGZ A;  2O60 A;  1NX3 A;  4XJK B;  2FCE A;  1L2O C;  4P2Y B;  4M2Q A;  2KAX A;  3I5I B;  1MR8 A;  1CDM A;  1QJT A;  1NX1 A;  2KFF A;  1XFU O;  2PSR A;  1AJ5 A;  1S6C A;  2LP3 A;  2V53 A;  2WC8 A;  5HKY A;  3C1V A;  2CXJ A;  3TS5 C;  4GAO A;  1TOP A;  4AQI A;  1ODB A;  3GK1 A;  1PVA A;  1M45 A;  2ZRS A;  4OR9 B;  1FF1 A;  4PHK A;  1MXE A;  3SJS A;  1WDC C;  2WOR A;  2K7O A;  1TIZ A;  1UP5 A;  4NDD A;  2ZRT A;  1TNQ A;  1M39 A;  1UHJ A;  2FCD A;  3OP0 A;  1BMO A;  2QPT A;  1BF5 A;  4GBA A;  1YTZ C;  2TN4 A;  4GGF C;  3D10 A;  3EK7 A;  3SG5 A;  1AVS A;  3WNX B;  3VRN A;  3GK4 X;  2LCP A;  3OB1 B;  2WCB A;  1QS7 A;  2EHB A;  1K94 A;  1SCM C;  3EVR A;  1RFJ A;  1OOJ A;  2JXL A;  3JTD B;  3VRQ A;  1CLB A;  2WOS A;  4PE7 A;  1QIW A;  2HQW A;  5FYX A;  2KGR A;  1GGW A;  3FWB A;  4DUQ A;  3OB2 B;  4PHJ A;  1YRT B;  2LLS A;  2MAZ A;  1SMG A;  1G4Y R;  1NSH A;  1OZO A;  1RTP 1;  2JQ6 A;  4YGA A;  1RJV A;  1FI5 A;  5CSJ A;  2L5X B;  1B1G A;  1OZS A;  4WQ3 A;  3BUW B;  2KQY A;  5DKR A;  4DS7 A;  2RGI A;  1XK4 A;  3AAK A;  2AAO A;  3TS5 B;  1CNP A;  3BOW A;  1Y6W A;  3NSL A;  2M1U A;  1ZAC A;  5F6T A;  5G08 A;  4MRX A;  1AUI B;  1JSA A;  1A75 A;  4UPG A;  2LMT A;  5CSF A;  1DT7 B;  4QJ5 B;  1YVH A;  1CFF A;  1TNP A;  1DMO A;  1OSA A;  1DF0 A;  1N2D A;  3O2P A;  1DJY A;  1CFD A;  1AHR A;  4TNC A;  3IF7 A;  1KSM A;  2MLF C;  4A4C A;  1YUU A;  3I5H C;  2SCP A;  4N1G A;  1B8R A;  2LUX A;  1KFU L;  1UHH A;  3E3R A;  1YUT A;  4I5J A;  4A4B A;  2LVJ A;  3I5F C;  4ICB A;  4U8D A;  4ZCV A;  1SW8 A;  4DIR A;  5KTY A;  4CPV A;  1B4C A;  1SR6 C;  2BE6 A;  1SRA A;  4BY4 A;  5K89 A;  3KF9 A;  2FOT A;  1TRF A;  1S6J A;  3PAL A;  2BEC A;  1K90 D;  1UUR A;  1K93 D;  1TCO B;  1PUL A;  5TNC A;  3LCP C;  1CMG A;  5KSZ A;  2JT3 A;  2Q4U A;  2KDH A;  1BOC A;  4I5L B;  5AER A;  1OMD A;  2KYF A;  3HCM A;  1S1E A;  4AOM A;  1QTX A;  1DVI A;  3VRP A;  1K2H A;  1CDP A;  5KU1 A;  5AFP A;  2L51 A;  1WLM A;  1JFJ A;  1Y1U A;  4OKH A;  4F0Z B;  1DTL A;  1MXL C;  1K96 A;  2LVI A;  1S5G Y;  4NDC A;  1R2U A;  1NX2 A;  2SAS A;  3KO0 A;  5D69 A;  1F71 A;  1G33 A;  5AAN A;  1NP8 A;  1KFU S;  1J7O A;  1HT9 A;  1LIN A;  4YBH B;  1XK4 C;  1KWO C;  1QAS A;  1V1F A;  2H61 A;  3I5F B;  4WQ2 A;  3BYA A;  1XVJ A;  1PK0 D;  4E68 A;  5J3X A;  4MZK A;  2K7C A;  1SR6 B;  1E8A A;  4GPL B;  1QLS A;  1ZOT B;  2GGM A;  3RLZ A;  1CM1 A;  5PAL A;  2K0J A;  2I2R E;  3BXK A;  2F3Z A;  3FIA A;  1LKJ A;  1KQV A;  3JTD C;  3RM1 A;  5GQQ C;  2JTT A;  2DOQ A;  2AUC A;  2K2F A;  2M1K B;  1SY9 A;  1QX2 A;  1XFZ O;  4MVF A;  3TUY C;  2PMY A;  1MUX A;  1W7I B;  4MBE A;  4GFT A;  2NXQ A;  4DCK A;  2ZN9 A;  1YRU B;  2LVK A;  4XYN A;  3LK1 A;  2EGD A;  1TTX A;  2F33 A;  1PRW A;  2ZN8 A;  1WLZ A;  4MEW A;  1IQ3 A;  4YGE B;  5I2Q A;  1QXP A;  4IL1 A;  2Y5I A;  1J1D A;  1DJG A;  2CCM A;  3OHM B;  3SG7 A;  5JJG A;  2LV7 A;  1YX8 A;  2JNX A;  2PVB A;  2M7N A;  1B8L A;  3IQO A;  1ALV A;  1FI6 A;  1JFK A;  1EG3 A;  1IG5 A;  1IJ5 A;  1K9P A;  1QV1 A;  1SYM A;  2M0R A;  2OTG B;  1RK9 A;  3CR4 X;  3K21 A;  1F55 A;  1EXR A;  1B9A A;  1FPW A;  1NPQ A;  1L7Z A;  3WXA A;  1S5G Z;  2E30 A;  1KWO B;  3KPX A;  3O6B A;  4HRG A;  1JC2 A;  2MA2 A;  3BOW B;  2LAN A;  3F45 A;  1R6P A;  5HKZ A;  2NLN A;  2WCF A;  1M63 B;  2KOT A;  4CLN A;  1SCV A;  1A75 B;  3TDU A;  1K9K A;  1Q80 A;  1JF0 A;  2LP2 A;  3PN7 C;  1H4B A;  1DJH A;  4USL A;  1U5I A;  2BE4 A;  2KQ6 A;  1FW4 A;  1DF0 B;  2BBN A;  2PAS A;  2M49 B;  3ZWH A;  4QJ4 B;  1OQP A;  2K8M B;  3NSI A;  1KFX S;  3TUY B;  2ZND A;  1CKK A;  4OVN F;  1IH0 A;  2KNE A;  4N1F A;  1IQ5 A;  4I5K A;  2WCE A;  2CTN A;  1BR1 B;  4OCI A;  2AMI A;  2ZFD A;  1QV0 A;  3CLN A;  1J7R A;  4N5X A;  1KSO A;  2LMU A;  3CTN A;  1IWQ A;  3EVV A;  1XA5 A;  4OV2 A;  3BUO B;  1SPY A;  2LE9 B;  4ETO A;  4ORA B;  1CTR A;  3EKJ A;  1KK7 Y;  1UWO A;  1GQM A;  1A29 A;  2MBX A;  2A4J A;  1V1G A;  4QJ3 B;  1CFP A;  1A4P A;  3LLE A;  2JZI A;  2E6W A;  1HQV A;  2L2E A;  4YGD B;  4YRU A;  2LHL A;  1QLK A;  2L98 A;  3PN7 B;  4D1E A;  4JWQ A;  4HSZ A;  1XYD A;  1Y1A A;  1XFY O;  4ZCU A;  3DVJ A;  4YI8 A;  4NDB A;  2B1U A;  2BCX A;  1K9U A;  2LAP A;  4M2P A;  4YI9 A;  4ORC B;  2KAV A;  3GOF A;  2LMV A;  2JT0 A;  4MLW A;  2HET A;  2JPT A;  2F3Y A;  1C7V A;  1CMF A;  1NIW A;  3BQ3 A;  1UUS A;  1SL9 A;  3CGA A;  1YVL A;  1S6I A;  2BCB A;  4ORB B;  1N65 A;  1LXF C;  3PM8 A;  1NX0 A;  1UHK A;  1CLM A;  3AKB A;  2PAL A;  2JC2 A;  3SIA A;  1BR4 B;  1F4Q A;  4AQJ A;  4JQ0 D;  1PSB A;  3IQQ A;  2OTG C;  1XO5 A;  2Q91 A;  3EK8 A;  1IGV A;  1Y0V H;  2BKI B;  2F8P A;  5CSI A;  5I8N A;  1MF8 B;  3BUX B;  3KEV A;  1CFC A;  1FBV A;  1KK7 Z;  1REC A;  2ZKM X;  3JVT C;  2ISD A;  1PVB A;  2F2O A;  2H2K A;  4GGF A;  1WRK A;  1BJF A;  1YUS A;  1VRK A;  3LK0 A;  2M29 A;  1GJY A;  1F4O A;  2M97 A;  1D1O A;  2BBM A;  2MRD A;  4YGC B;  4CFQ A;  3PAT A;  3OX6 A;  4PE0 A;  5HYD A;  5JOL A;  4DRW A;  1SNL A;  3ICB A;  4M2O A;  4C0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...