5CSFA

S100b-rsk1 crystal structure a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
b'GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 27
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csfA00
1SR6B 2LVIA 2NLNA 1DF0B 1BODA 3AAJA 4PDZA 1B7TZ 3DVKA 4MBEA 2LUCA 1NCZA 1RJVA 2LMTA 2KBIA 3SG6A 2BBNA 1OMDA 2KQ6A 1FF1A 1TNXA 3SG2A 3C1VA 4JPZB 2CNPA 1N2DA 2LE9B 4YI9A 1WLMA 2E30A 2O5GA 1DGVA 3RLZA 1MXEA 1DJGA 1MR8A 3CR5X 1YR5A 3EK7A 5CPVA 1NCXA 2KGRA 3PSRA 4OV2A 1EH2A 1PVAA 1ZMZA 3D10A 2JTTA 2M1KB 1XFXO 2EHBA 3WNXB 2JZIA 2MAZA 2BKIB 4L9MA 4XJKB 5K89A 5D69A 1XFZO 1CB1A 1UP5A 3I5HB 2KOTA 4FTGA 2I2RE 4BY5A 3CTNA 5D7FA 1QLKA 2EC6B 4DCKA 2F8PA 1S5GY 1NYAA 5PALA 3SG3A 4CFRA 1SR6C 2KBMA 3A8RA 3BQ3A 1BT6A 4R1EA 3TDUA 4UPGA 2G9BA 2H2KA 1H8BA 4PHMA 2BE4A 2GGZA 3EKJA 1KQVA 4I5KA 1Y1AA 1QLSA 4GGFA 4GUKA 1FI6A 1MUXA 3CLNA 2I18A 4MZKA 1XFWO 1A2XA 1QS7A 3O2PA 2JOJA 1X02A 1XVJA 4NDBA 2K2FA 1UHJA 2KSPA 2ZN9A 4YGDB 5CSJA 2KGBC 1RWYA 1B8LA 3K21A 1SMGA 1F4OA 1SKTA 1RFJA 1OQPA 2ZRSA 4FQOA 2LLUA 4MRXA 1KK8B 3SIAA 1CDNA 3A4UB 1IKUA 1CM4A 3TUYB 2MA2A 4PHKA 2KNEA 1Y1XA 1A4PA 1QXPA 3I5HC 1WRLA 1E8AA 1CFCA 2KI4B 3FIAA 1ZFSA 4OR9B 5DKRA 2EC6C 4ORCB 3IQOA 5HKYA 1GGZA 3SIBA 1DJIA 2WNDA 2LP2A 1DT7B 1B9AA 1FW4A 2K2AA 3EVVA 1IJ5A 2A4JA 4HRHA 4IL1A 4DIRA 4YGEB 2ZNDA 3IF7A 5CSFA 3CWGA 1AK8A 1WRZA 1BR4B 2RGIA 3O4YA 1F71A 1K94A 2L5XB 1QIVA 3D0YA 2ISDA 1OMVA 2LLSA 3OP0A 2P6BB 1B8RA 2KYFA 3EKHA 4OKHA 4JWQA 3ZNIA 3PFVA 1AP4A 2L2EA 1KFXS 1KK8C 2LVKA 2M97A 1D1OA 1PK0D 1CFDA 3TUYC 1R2UA 4NQGA 1SK6D 3JVTC 1G4YR 4BY4A 2IS9A 2PVBA 3AKAA 3EK8A 1YUTA 2M1UA 3KPXA 2LHLA 3BUOB 4MRYA 2EGDA 3OB1B 1JFJA 2F3YA 1C7WA 1KK7Y 1GQMA 4GGFC 4MSPA 1M39A 3LLEA 2MHHA 4AQJA 2WOSA 5F6TA 3NXAA 2MLEC 3D0YB 4N1GA 4QJ5B 5FYXA 2K61A 4DS7A 3FS7A 2FJUB 2LP3A 1BR1B 2M8UA 1TNQA 1CDLA 1WDCB 1J7OA 4XJKA 1NX2A 3OHMB 1FBVA 1A75A 4PHJA 5CSNA 3CZTX 4ETOA 3NSIA 1XK4A 1PSRA 2AAOA 1QX2A 1S36A 2BCXA 1SRAA 4PALA 1F70A 3SG4A 1J7RA 1AHRA 5AXIA 1PSBA 1UHHA 1YVHA 1XO5A 1NPQA 1AJ4A 1SPYA 1HT9A 1XFVO 3KEVA 3GK2A 1PRWA 2I7AA 1M45A 1KFUL 1SCMB 1W7IB 1SY9A 3ICBA 1TNPA 3GOFA 1M31A 2K7BA 2KFFA 1K8UA 1ZOTB 3OX5A 1DGUA 2E6WA 2G2BA 4I5JA 4WQ3A 1SL9A 1EXRA 1AVSA 1RTP1 1YUUA 2BL0B 2Q4UA 3BUWB 2COLB 1A75B 1UUSA 3DVJA 3VROA 1KCYA 1IJ6A 1CM1A 1L2OB 1WDCC 4CIDA 4WRIA 3SG5A 1ALWA 4E68A 2OTGB 1UHIA 1B8CA 1TRFA 4YGCB 1MWNA 1S1EA 3I5IB 2LAPA 1JSAA 1CTRA 1JFKA 4ICBA 4N1FA 3TZ1A 3VGOA 5CSIA 4CLNA 1TOPA 2KQYA 1NX0A 1CMGA 3EVUA 1K90D 2B1UA 1M46A 3BYAA 3PATA 5AEQA 1QJTA 5KTYA 1FPWA 2L51A 3PN7B 2K7CA 2CTNA 3E3RA 1CMFA 2Q91A 2LANA 4GFTA 1A03A 1B1GA 1TCOB 1NCYA 1F55A 1OOJA 3GK4X 2K0JA 2HF5A 1JF2A 3HX4A 3WXAA 2PSRA 1GGWA 1R6PA 4NDDA 2OS8B 1YX8A 3NSLA 2BL0C 1LKJA 1GJYA 1KK7Z 3TS5B 1XK4C 2CXJA 2KFGA 1L2OC 2HPSA 1AUIB 4WQ2A 4C0KA 4D1EA 2FOTA 4XYNA 2OTGC 2K7DA 2PMYA 1V1GA 5AERA 5BPJA 3IQQA 1UHKA 3I5IC 5DKNA 3SG7A 4CFQA 5I2LA 2Y1MA 1NSHA 4AOMA 5G08A 4DRWA 4PE7A 2LUXA 1OMRA 4CPVA 1YRTB 1K9KA 1KQMB 3LCPC 1CDPA 2F2OA 2JPTA 1NX3A 1JF0A 2M9GA 2JT8A 1OZSA 1BU3A 1U5IA 4P2YB 1CKKA 1SW8A 4GPLB 5B8IB 2LMUA 1S26D 3BUXB 5GQQC 1QV0A 3VRQA 2SASA 4N5XA 3CGAA 5ER4X 4GGNA 1PVBA 2KAYA 2JULA 5HYDA 1J1EA 2OS8C 2KI6D 2FCEA 2M29A 2BKHB 1MQ1A 2I94A 1S6JA 1QVIZ 3TS5C 2AUCA 2PRUA 1UHNA 2JC2A 3EVRA 3VRPA 5JJGA 2WORA 2KI4C 2PALA 1YTZC 3PALA 1LA0A 2O60A 1SYMA 1KWOB 2AMIA 3TDZA 3KHEA 1DMOA 2L98A 1JWDA 2BECA 2ZN8A 1CLLA 1N65A 1K9PA 3BUMB 3F45A 2MLFC 1IH0A 1NIWA 1IGVA 1IRJA 1U5IB 2R2IA 4YRUA 1IWQA 2F3ZA 2L50A 4HRGA 1S6CA 1KQMC 1J55A 2KHNA 1EJ3A 1SBJA 1LVCD 3JTDB 2CCMA 1CDMA 1DJXA 3SJSA 1S6IA 2PASA 2LCPA 4QJ3B 3WHTB 1EL4A 4P5OE 3NSOA 3PLFB 1QX5B 1VRKA 3KO0A 4USLA 1K93D 1CFPA 3LL8B 4C0LA 5I2OA 2LHIA 4PE1A 3OX6A 1Y1UA 2QACA 1F4QA 1MF8B 2Y5IA 5AFPA 5JOLA 2HQWA 3BUNB 1G8IA 2HQ8A 4PE0A 1SL7A 2TN4A 3BOWA 1A29A 1LA3A 1RROA 3FWBA 2SCPA 2BCAA 1YX7A 1NP8A 2M49B 4NDCA 4YI8A 1KWOC 4MVFA 1J7PA 1CLMA 4YGBB 2JT3A 1NX1A 2JTZA 4MZLA 1QVIY 2L4HA 2MJWB 1DJWA 1TTXA 2KYCA 3LK1A 4AQIA 2NZ0A 1Y6WA 1M63B 3EK4A 4A4BA 1EG3A 1OE9B 3JTDC 1PULA 4HSZA 2Y4QA 1C07A 1YRUB 2QPTA 1KFUS 3ZWHA 1UWOA 1DVIA 1MHOA 2M0RA 1L7ZA 4M2PA 4ORAB 1RECA 2LC5A 2ZKMX 3KF9A 1WLZA 4ORBB 3BOWB 1F54A 1ODBA 5HLOA 2V53A 4GBAA 3OB2B 2LNKA 2H61A 3CR2A 5HLVA 5DKQA 1DTLA 1N0YA 1QV1A 1B4CA 1EG4A 4U8DA 1FI5A 4F0ZB 5KSZA 2JT0A 2JU0A 2JWWA 5I8NA 2WCFA 1Y0VH 3I5FB 2LVVA 1SCMC 3GK1A 3I5GB 1B47A 5J3XA 1NWDA 1YURA 1QX7A 2BBMA 1G33A 4MLWA 1QIWA 2WC8A 1BG1A 2JQ6A 1SL8A 1XFUO 2LV7A 2JXLA 1Q80A 1XYDA 2NXQA 1UURA 1ZUZA 1TNWA 4TNCA 1J7QA 2HETA 3H4SE 5IBWA 1NUBA 1XA5A 4GAOA 1C7VA 1ALVA 2F33A 5TNCA 1CLBA 4C0JA 5KU1A 2K8MB 4JQ0D 2JNFA 1OSAA 1MXLC 3DVEA 3VRNA 1B7TY 1HQVA 1WY9A 2M7NA 5ER5A 2LM5A 1WRKA 1QTXA 3RM1A 5I2QA 1BJFA 1BMOA 3AAKA 1K95A 1KSOA 2FCDA 2ZNEA 2D8NA 3MSEB 2BE6A 3O78A 4GNKB 4OVNF 3PN7C 2KDHA 2LVJA 2M7LA 3M0WA 2OPOA 1S3PA 2L4IA 3JVTB 3I5FC 3I5GC 1K2HA 4MEWA 1JUOA 2CBLA 5HKZA 2DOQA 2GGMA 3DF0A 4HREE 4ZCUA 1H4BA 3VRRA 1BOCA 1BF5A 2LMVA 4YBHB 1IG5A 2K7OA 3NSKA 1OZOA 1TN4A 4M2QA 4YGAA 3BXKA 1XFYO 1KFXL 1J1DA 1SCVA 2KI6C 2BCBA 2WCBA 3DD4A 1CNPA 1KSMA 3CS1A 2H61C 3O6BA 1F8HA 4I5LB 1IQ5A 1BLQA 1QATA 4OCIA 4MN0A 2KFHA 1V1FA 4M2OA 5AANA 3DVMA 4PE4A 2JXCA 1K9UA 3DF0B 2WCEA 3TDIA 2CT9A 1LXFC 2JNXA 1JBAA 4A4CA 1IQ3A 4ZCVA 2KAVA 1DJZA 1JC2A 1QASA 1DF0A 1K96A 1LINA 3AKBA 2M3WA 1W7JB 1ZACA 4PHNA 4Q04A 5HKWA 2ZFDA 1TIZA 2VRGA 4PCWA 1YUSA 3FWCA 3HCMA 3LK0A 2L0PA 3QRXA 2NCPA 1SNLA 2MRDA 1AJ5A 1YVLA 4MZJA 1DJHA 2ZRTA 2F2PA 2NCOA 1PALA 1S5GZ 2KAXA 3WHUB 4QJ4B 2Y1NA 1CFFA 2GV5A 2LLTA 3PM8A 3CR4X 2MBXA 1RK9A 2JRFA 1TCFA 4I5NB 4DUQA 1DJYA
chains in the Genus database with same CATH superfamily
1SR6B 2LVIA 2NLNA 1DF0B 1BODA 3AAJA 4PDZA 1B7TZ 3DVKA 4MBEA 2LUCA 1DELA 1NCZA 1RJVA 2LMTA 2KBIA 2YGUA 3SG6A 2BBNA 3OGNA 1OMDA 2KQ6A 1FF1A 1TNXA 3UNWA 3SG2A 3C1VA 4JPZB 2CNPA 1N2DA 2LE9B 4YI9A 3DXLA 1WLMA 2E30A 2O5GA 4KYNA 1DGVA 3RLZA 1MXEA 1DJGA 1MR8A 3CR5X 1YR5A 3EK7A 5CPVA 1NCXA 2KGRA 3PSRA 4OV2A 1EH2A 3B86A 1PVAA 3DYEA 1ZMZA 3D10A 2L2CA 2JTTA 2M1KB 1XFXO 1SSEB 2EHBA 3WNXB 2JZIA 2MAZA 2BKIB 4L9MA 4XJKB 5K89A 5D69A 1XFZO 1CB1A 3CYZA 1UP5A 4IJ7A 3I5HB 2KOTA 4FTGA 2I2RE 4BY5A 3R1OA 5HL1A 3CTNA 3Q8IA 5D7FA 1QLKA 2EC6B 4DCKA 2F8PA 1S5GY 1NYAA 3B87A 5PALA 3SG3A 4CFRA 1SR6C 2KBMA 3CZ1A 3A8RA 3BQ3A 1BT6A 4R1EA 3TDUA 4UPGA 2G9BA 2H2KA 3CZ0A 4PHMA 4PT1A 3SS5A 2BE4A 2GGZA 3L47A 3EKJA 1KQVA 4I5KA 1Y1AA 1QLSA 4GGFA 4GUKA 1FI6A 1MUXA 3CLNA 2I18A 4JKTA 4MZKA 1XFWO 1A2XA 1QS7A 3O2PA 4FQTA 3S0EA 2JOJA 1X02A 1XVJA 4NDBA 2K2FA 1UHJA 2KSPA 2ZN9A 3D76A 4YGDB 5CSJA 2KGBC 1RWYA 1B8LA 3K21A 1SMGA 1F4OA 1SKTA 1RFJA 1OQPA 2ZRSA 4FQOA 2LLUA 4MRXA 1KK8B 3SIAA 1CDNA 3A4UB 1IKUA 1CM4A 3TUYB 2MA2A 4PHKA 2KNEA 3SS3A 1Y1XA 1A4PA 1QXPA 3I5HC 1WRLA 1E8AA 1CFCA 2KI4B 3FIAA 1ZFSA 2H8VA 4OR9B 2EC6C 4ORCB 3IQOA 5DKRA 5HKYA 1GGZA 2P70A 3B88A 3SIBA 1DJIA 2WNDA 2LP2A 3O4XA 1B9AA 1FW4A 2K2AA 1DT7B 3EVVA 1IJ5A 3V2LA 2A4JA 4HRHA 4IL1A 4DIRA 4YGEB 2ZNDA 3IF7A 5CSFA 3CWGA 1AK8A 2WC5A 1WRZA 1BR4B 2RGIA 3O4YA 1F71A 1K94A 2L5XB 1QIVA 3D0YA 2ISDA 1OMVA 2LLSA 3FE8A 3OP0A 2P6BB 1B8RA 2KYFA 3EKHA 4OKHA 4JWQA 1ORGA 3PFVA 3ZNIA 1AP4A 2L2EA 1KFXS 1KK8C 2LVKA 2M97A 1D1OA 1PK0D 2L5YA 1CFDA 3TUYC 1R2UA 2GTEA 4NQGA 2WC6A 1SK6D 3JVTC 1G4YR 1DQEA 4BY4A 2IS9A 2PVBA 3BFBA 3AKAA 3EK8A 1YUTA 2M1UA 3KPXA 2LHLA 3BUOB 4MRYA 2EGDA 3OB1B 1JFJA 2F3YA 1C7WA 1KK7Y 1GQMA 4GGFC 4MSPA 1M39A 3LLEA 2MHHA 4AQJA 2WOSA 5F6TA 3NXAA 2MLEC 3D0YB 4N1GA 4QJ5B 5FYXA 1DC1A 2K61A 4DS7A 3RZSA 3FS7A 2FJUB 2LP3A 1BR1B 5D3OA 2M8UA 1TNQA 1CDLA 1WDCB 1J7OA 4XJKA 1NX2A 3OHMB 1FBVA 1A75A 4PHJA 1OOHA 2BAPA 3CZTX 3NSIA 5CSNA 1XK4A 1PSRA 2AAOA 1QX2A 3R72A 1S36A 2BCXA 1SRAA 4PALA 1F70A 3SG4A 1J7RA 1QWVA 1AHRA 5AXIA 1PSBA 1UHHA 1YVHA 2KPHA 1XO5A 1NPQA 1AJ4A 1SPYA 1HT9A 1XFVO 3KEVA 3GK2A 1PRWA 2I7AA 3S0BA 1M45A 1KFUL 1SCMB 1W7IB 1SY9A 3ICBA 1TNPA 3GOFA 1M31A 2K7BA 2KFFA 1K8UA 1ZOTB 3OX5A 1DGUA 1TUZA 2E6WA 2G2BA 4I5JA 3D74A 1SL9A 4WQ3A 1EXRA 1AVSA 1RTP1 1YUUA 2BL0B 2Q4UA 3BUWB 2COLB 1A75B 1UUSA 3DVJA 3VROA 2QEHA 1KCYA 1IJ6A 1CM1A 1L2OB 1WDCC 4CIDA 1OOFA 4WRIA 1ALWA 3SG5A 4E68A 2OTGB 1UHIA 1B8CA 1TRFA 1TWOA 2KLEA 4YGCB 5FI6A 1C3YA 1MWNA 1S1EA 3I5IB 2LAPA 1JSAA 1CTRA 1JFKA 4ICBA 4N1FA 3TZ1A 3VGOA 5CSIA 4CLNA 1TOPA 2KQYA 1NX0A 1CMGA 3EVUA 3L4AA 3CZ2A 1K90D 2B1UA 1M46A 3BYAA 3S0AA 3PJIA 3PATA 5AEQA 1QJTA 5KTYA 1FPWA 2L51A 3PN7B 2K7CA 2CTNA 3E3RA 1CMFA 2Q91A 1TUJA 2LANA 4GFTA 1A03A 1B1GA 1TCOB 1NCYA 1F55A 1OOJA 3GK4X 2K0JA 2HF5A 1JF2A 3HX4A 3WXAA 2PSRA 3UO9A 1GGWA 1R6PA 4NDDA 2OS8B 1YX8A 3NSLA 1IIOA 2BL0C 1LKJA 1GJYA 1KK7Z 3TS5B 1XK4C 2CXJA 2KFGA 3OBVA 1L2OC 2HPSA 1AUIB 4WQ2A 4C0KA 4D1EA 2FOTA 4XYNA 2OTGC 2QEVA 2K7DA 2PMYA 1T14A 3DY9A 2WCHA 1V1GA 4OZDA 3VB1A 3IQQA 1UHKA 3I5IC 5DKNA 3SG7A 5AERA 4CFQA 5BPJA 3R1PA 5I2LA 2QEOA 1NSHA 2Y1MA 3S0FA 1GM0A 4AOMA 5G08A 4DRWA 4PE7A 2K60A 2LUXA 1OMRA 3S0DA 1YRTB 3FE9A 1K9KA 1KQMB 4CPVA 1Z2CB 3LCPC 1CDPA 2F2OA 2JPTA 1NX3A 1JF0A 2M9GA 2JT8A 3SS4A 1OZSA 1BU3A 1U5IA 4P2YB 1CKKA 1SW8A 4GPLB 5B8IB 2LMUA 1S26D 3N7HA 3BUXB 5GQQC 1QV0A 3EG5B 3VRQA 2SASA 5FI7A 4N5XA 3CGAA 5ER4X 4GGNA 1PVBA 2KAYA 2JULA 5HYDA 1J1EA 2OS8C 2KI6D 2QDIA 2FCEA 2M29A 2BKHB 1MQ1A 2I94A 1S6JA 3NGVA 3CABA 1QVIZ 3TS5C 2AUCA 2PRUA 1UHNA 2JC2A 3EVRA 4ETOA 3VRPA 5JJGA 2WORA 2KI4C 5DICA 2PALA 1YTZC 3PALA 1LA0A 2O60A 1SYMA 1KWOB 2AMIA 3TDZA 3KHEA 3IVTA 1DMOA 2L98A 1JWDA 2BECA 2ZN8A 1CLLA 1N65A 1K9PA 3BUMB 3F45A 2MLFC 1IH0A 1NIWA 1IGVA 1IRJA 1U5IB 2R2IA 4YRUA 1IWQA 2F3ZA 2L50A 4HRGA 1S6CA 1KQMC 1J55A 2KHNA 1EJ3A 1SBJA 1LVCD 3JTDB 2CCMA 2WCMA 1CDMA 1DJXA 3SJSA 1S6IA 2PASA 2LCPA 4QJ3B 3WHTB 1EL4A 4P5OE 3NSOA 3PLFB 1QX5B 1VRKA 2WCJA 3KO0A 3BFAA 4USLA 1K93D 3BFHA 3LL8B 4C0LA 5I2OA 2LHIA 4PE1A 1CFPA 2ERBA 1Y1UA 3OX6A 2QACA 1F4QA 1MF8B 2Y5IA 5AFPA 5JOLA 2HQWA 3BUNB 1G8IA 2HQ8A 4PE0A 1SL7A 1OW4A 2TN4A 3FE6A 3BOWA 1A29A 1LA3A 1RROA 3FWBA 2SCPA 2BCAA 1YX7A 1NP8A 2M49B 4NDCA 4YI8A 1KWOC 4MVFA 1J7PA 1CLMA 4YGBB 2JT3A 1NX1A 5EL2A 2JTZA 3CDNA 4MZLA 1QVIY 2L4HA 2MJWB 3S0GA 3D73A 1DJWA 1TTXA 2KYCA 3BJHA 3LK1A 4AQIA 2NZ0A 1Y6WA 1M63B 3B6XA 3EK4A 4A4BA 1EG3A 1OE9B 3L4LA 3JTDC 1PULA 4HSZA 2Y4QA 1C07A 1YRUB 2QPTA 1KFUS 1XFRA 2PYQA 3ZWHA 1UWOA 1DVIA 1MHOA 2M0RA 1L7ZA 4M2PA 4ORAB 1RECA 2LC5A 2ZKMX 3KF9A 1WLZA 4ORBB 3BOWB 1F54A 1ODBA 5HLOA 2V53A 4GBAA 3OB2B 2LNKA 2H61A 3CR2A 5HLVA 5DKQA 1DTLA 1N0YA 1C3ZA 1QV1A 4F7FA 1EG4A 4U8DA 3R1VA 4F0ZB 5KSZA 1B4CA 2JT0A 1FI5A 2JU0A 2JWWA 5I8NA 2WCFA 1Y0VH 3I5FB 2LVVA 1SCMC 3GK1A 3I5GB 1B47A 1OOIX 5J3XA 1NWDA 1YURA 1QX7A 2BBMA 3B7AA 1G33A 4MLWA 1QIWA 2WC8A 1BG1A 2JQ6A 1SL8A 1XFUO 2LV7A 2JXLA 1Q80A 1XYDA 2NXQA 1UURA 1ZUZA 1TNWA 4TNCA 1J7QA 2HETA 3H4SE 5IBWA 1NUBA 1XA5A 4GAOA 1C7VA 1ALVA 2F33A 4INXA 5TNCA 1CLBA 4C0JA 5KU1A 2K8MB 1DEKA 2JNFA 4JQ0D 1OSAA 1MXLC 3DVEA 3VRNA 1B7TY 1HQVA 1WY9A 2JPOA 1H8BA 2M7NA 5ER5A 2LM5A 1WRKA 2KLDA 1QTXA 3RM1A 5I2QA 1BJFA 3D75A 5I94A 1BMOA 3AAKA 1K95A 1KSOA 2FCDA 2ZNEA 2D8NA 3MSEB 2BE6A 3O78A 4GNKB 4OVNF 3PN7C 2KDHA 2LVJA 2M7LA 3M0WA 2OPOA 1S3PA 2L4IA 3JVTB 3I5FC 3I5GC 1K2HA 4MEWA 1JUOA 2CBLA 5HKZA 2DOQA 2GGMA 3DF0A 4HREE 4ZCUA 1H4BA 2FJYA 3VRRA 1BOCA 1BF5A 2LMVA 2QEBA 4YBHB 1IG5A 2K7OA 3NSKA 1OZOA 1TN4A 4M2QA 4YGAA 3BXKA 1XFYO 1KFXL 1J1DA 1SCVA 2KI6C 2BCBA 2WCBA 3DD4A 1CNPA 4INWA 1KSMA 3CS1A 2H61C 2WCKA 3O6BA 1F8HA 4I5LB 1IQ5A 1BLQA 3D77A 1P28A 1QATA 4OCIA 4MN0A 2KFHA 1V1FA 4M2OA 5AANA 3DVMA 4PE4A 2JXCA 3DZTA 1K9UA 3DF0B 2WCEA 3TDIA 2CT9A 1LXFC 2JNXA 3NHIA 1JBAA 4A4CA 1IQ3A 4ZCVA 2KAVA 1W9ZA 1DJZA 2BNXA 1JC2A 1QASA 1DF0A 1K96A 1LINA 3AKBA 2M3WA 1W7JB 1ZACA 4PHNA 4Q04A 5HKWA 3PM2A 2ZFDA 1TIZA 3QMEA 4JD9A 2VRGA 4PCWA 1YUSA 3FWCA 3HCMA 3LK0A 2L0PA 3QRXA 2NCPA 1SNLA 2MRDA 1AJ5A 1YVLA 4MZJA 3K1EA 1DJHA 2ZRTA 2F2PA 1LS8A 2P71A 2NCOA 1PALA 1S5GZ 2KAXA 3WHUB 1OOGA 4QJ4B 3D78A 2WCLA 2Y1NA 1CFFA 2GV5A 2LLTA 3PM8A 3CR4X 2MBXA 3NHTA 2PQLA 1RK9A 2JRFA 5FI2A 1TCFA 1Z4HA 4I5NB 4DUQA 1DJYA
chains in the Genus database with same CATH topology
1SR6B 2LVIA 2NLNA 1DF0B 1BODA 3AAJA 4PDZA 1B7TZ 3DVKA 4MBEA 2LUCA 1NCZA 1RJVA 2LMTA 2KBIA 3SG6A 2BBNA 1OMDA 2KQ6A 1FF1A 1TNXA 3SG2A 3C1VA 4JPZB 2CNPA 1N2DA 2LE9B 4YI9A 1WLMA 2E30A 2O5GA 1DGVA 3RLZA 1MXEA 1DJGA 1MR8A 3CR5X 1YR5A 3EK7A 5CPVA 1NCXA 2KGRA 3PSRA 4OV2A 1EH2A 1PVAA 1ZMZA 3D10A 2JTTA 2M1KB 1XFXO 2EHBA 3WNXB 2JZIA 2MAZA 2BKIB 4L9MA 4XJKB 5K89A 5D69A 1XFZO 1CB1A 1UP5A 3I5HB 2KOTA 4FTGA 2I2RE 4BY5A 3CTNA 5D7FA 1QLKA 2EC6B 4DCKA 2F8PA 1S5GY 1NYAA 5PALA 3SG3A 4CFRA 1SR6C 2KBMA 3A8RA 3BQ3A 1BT6A 4R1EA 3TDUA 4UPGA 2G9BA 2H2KA 1H8BA 4PHMA 2BE4A 2GGZA 3EKJA 1KQVA 4I5KA 1Y1AA 1QLSA 4GGFA 4GUKA 1FI6A 1MUXA 3CLNA 2I18A 4MZKA 1XFWO 1A2XA 1QS7A 3O2PA 2JOJA 1X02A 1XVJA 4NDBA 2K2FA 1UHJA 2KSPA 2ZN9A 4YGDB 5CSJA 2KGBC 1RWYA 1B8LA 3K21A 1SMGA 1F4OA 1SKTA 1RFJA 1OQPA 2ZRSA 4FQOA 2LLUA 4MRXA 1KK8B 3SIAA 1CDNA 3A4UB 1IKUA 1CM4A 3TUYB 2MA2A 4PHKA 2KNEA 1Y1XA 1A4PA 1QXPA 3I5HC 1WRLA 1E8AA 1CFCA 2KI4B 3FIAA 1ZFSA 4OR9B 5DKRA 2EC6C 4ORCB 3IQOA 5HKYA 1GGZA 3SIBA 1DJIA 2WNDA 2LP2A 1DT7B 1B9AA 1FW4A 2K2AA 3EVVA 1IJ5A 2A4JA 4HRHA 4IL1A 4DIRA 4YGEB 2ZNDA 3IF7A 5CSFA 3CWGA 1AK8A 1WRZA 1BR4B 2RGIA 3O4YA 1F71A 1K94A 2L5XB 1QIVA 3D0YA 2ISDA 1OMVA 2LLSA 3OP0A 2P6BB 1B8RA 2KYFA 3EKHA 4OKHA 4JWQA 3ZNIA 3PFVA 1AP4A 2L2EA 1KFXS 1KK8C 2LVKA 2M97A 1D1OA 1PK0D 1CFDA 3TUYC 1R2UA 4NQGA 1SK6D 3JVTC 1G4YR 4BY4A 2IS9A 2PVBA 3AKAA 3EK8A 1YUTA 2M1UA 3KPXA 2LHLA 3BUOB 4MRYA 2EGDA 3OB1B 1JFJA 2F3YA 1C7WA 1KK7Y 1GQMA 4GGFC 4MSPA 1M39A 3LLEA 2MHHA 4AQJA 2WOSA 5F6TA 3NXAA 2MLEC 3D0YB 4N1GA 4QJ5B 5FYXA 2K61A 4DS7A 3FS7A 2FJUB 2LP3A 1BR1B 2M8UA 1TNQA 1CDLA 1WDCB 1J7OA 4XJKA 1NX2A 3OHMB 1FBVA 1A75A 4PHJA 5CSNA 3CZTX 4ETOA 3NSIA 1XK4A 1PSRA 2AAOA 1QX2A 1S36A 2BCXA 1SRAA 4PALA 1F70A 3SG4A 1J7RA 1AHRA 5AXIA 1PSBA 1UHHA 1YVHA 1XO5A 1NPQA 1AJ4A 1SPYA 1HT9A 1XFVO 3KEVA 3GK2A 1PRWA 2I7AA 1M45A 1KFUL 1SCMB 1W7IB 1SY9A 3ICBA 1TNPA 3GOFA 1M31A 2K7BA 2KFFA 1K8UA 1ZOTB 3OX5A 1DGUA 2E6WA 2G2BA 4I5JA 4WQ3A 1SL9A 1EXRA 1AVSA 1RTP1 1YUUA 2BL0B 2Q4UA 3BUWB 2COLB 1A75B 1UUSA 3DVJA 3VROA 1KCYA 1IJ6A 1CM1A 1L2OB 1WDCC 4CIDA 4WRIA 3SG5A 1ALWA 4E68A 2OTGB 1UHIA 1B8CA 1TRFA 4YGCB 1MWNA 1S1EA 3I5IB 2LAPA 1JSAA 1CTRA 1JFKA 4ICBA 4N1FA 3TZ1A 3VGOA 5CSIA 4CLNA 1TOPA 2KQYA 1NX0A 1CMGA 3EVUA 1K90D 2B1UA 1M46A 3BYAA 3PATA 5AEQA 1QJTA 5KTYA 1FPWA 2L51A 3PN7B 2K7CA 2CTNA 3E3RA 1CMFA 2Q91A 2LANA 4GFTA 1A03A 1B1GA 1TCOB 1NCYA 1F55A 1OOJA 3GK4X 2K0JA 2HF5A 1JF2A 3HX4A 3WXAA 2PSRA 1GGWA 1R6PA 4NDDA 2OS8B 1YX8A 3NSLA 2BL0C 1LKJA 1GJYA 1KK7Z 3TS5B 1XK4C 2CXJA 2KFGA 1L2OC 2HPSA 1AUIB 4WQ2A 4C0KA 4D1EA 2FOTA 4XYNA 2OTGC 2K7DA 2PMYA 1V1GA 5AERA 5BPJA 3IQQA 1UHKA 3I5IC 5DKNA 3SG7A 4CFQA 5I2LA 2Y1MA 1NSHA 4AOMA 5G08A 4DRWA 4PE7A 2LUXA 1OMRA 4CPVA 1YRTB 1K9KA 1KQMB 3LCPC 1CDPA 2F2OA 2JPTA 1NX3A 1JF0A 2M9GA 2JT8A 1OZSA 1BU3A 1U5IA 4P2YB 1CKKA 1SW8A 4GPLB 5B8IB 2LMUA 1S26D 3BUXB 5GQQC 1QV0A 3VRQA 2SASA 4N5XA 3CGAA 5ER4X 4GGNA 1PVBA 2KAYA 2JULA 5HYDA 1J1EA 2OS8C 2KI6D 2FCEA 2M29A 2BKHB 1MQ1A 2I94A 1S6JA 1QVIZ 3TS5C 2AUCA 2PRUA 1UHNA 2JC2A 3EVRA 3VRPA 5JJGA 2WORA 2KI4C 2PALA 1YTZC 3PALA 1LA0A 2O60A 1SYMA 1KWOB 2AMIA 3TDZA 3KHEA 1DMOA 2L98A 1JWDA 2BECA 2ZN8A 1CLLA 1N65A 1K9PA 3BUMB 3F45A 2MLFC 1IH0A 1NIWA 1IGVA 1IRJA 1U5IB 2R2IA 4YRUA 1IWQA 2F3ZA 2L50A 4HRGA 1S6CA 1KQMC 1J55A 2KHNA 1EJ3A 1SBJA 1LVCD 3JTDB 2CCMA 1CDMA 1DJXA 3SJSA 1S6IA 2PASA 2LCPA 4QJ3B 3WHTB 1EL4A 4P5OE 3NSOA 3PLFB 1QX5B 1VRKA 3KO0A 4USLA 1K93D 1CFPA 3LL8B 4C0LA 5I2OA 2LHIA 4PE1A 3OX6A 1Y1UA 2QACA 1F4QA 1MF8B 2Y5IA 5AFPA 5JOLA 2HQWA 3BUNB 1G8IA 2HQ8A 4PE0A 1SL7A 2TN4A 3BOWA 1A29A 1LA3A 1RROA 3FWBA 2SCPA 2BCAA 1YX7A 1NP8A 2M49B 4NDCA 4YI8A 1KWOC 4MVFA 1J7PA 1CLMA 4YGBB 2JT3A 1NX1A 2JTZA 4MZLA 1QVIY 2L4HA 2MJWB 1DJWA 1TTXA 2KYCA 3LK1A 4AQIA 2NZ0A 1Y6WA 1M63B 3EK4A 4A4BA 1EG3A 1OE9B 3JTDC 1PULA 4HSZA 2Y4QA 1C07A 1YRUB 2QPTA 1KFUS 3ZWHA 1UWOA 1DVIA 1MHOA 2M0RA 1L7ZA 4M2PA 4ORAB 1RECA 2LC5A 2ZKMX 3KF9A 1WLZA 4ORBB 3BOWB 1F54A 1ODBA 5HLOA 2V53A 4GBAA 3OB2B 2LNKA 2H61A 3CR2A 5HLVA 5DKQA 1DTLA 1N0YA 1QV1A 1B4CA 1EG4A 4U8DA 1FI5A 4F0ZB 5KSZA 2JT0A 2JU0A 2JWWA 5I8NA 2WCFA 1Y0VH 3I5FB 2LVVA 1SCMC 3GK1A 3I5GB 1B47A 5J3XA 1NWDA 1YURA 1QX7A 2BBMA 1G33A 4MLWA 1QIWA 2WC8A 1BG1A 2JQ6A 1SL8A 1XFUO 2LV7A 2JXLA 1Q80A 1XYDA 2NXQA 1UURA 1ZUZA 1TNWA 4TNCA 1J7QA 2HETA 3H4SE 5IBWA 1NUBA 1XA5A 4GAOA 1C7VA 1ALVA 2F33A 5TNCA 1CLBA 4C0JA 5KU1A 2K8MB 4JQ0D 2JNFA 1OSAA 1MXLC 3DVEA 3VRNA 1B7TY 1HQVA 1WY9A 2M7NA 5ER5A 2LM5A 1WRKA 1QTXA 3RM1A 5I2QA 1BJFA 1BMOA 3AAKA 1K95A 1KSOA 2FCDA 2ZNEA 2D8NA 3MSEB 2BE6A 3O78A 4GNKB 4OVNF 3PN7C 2KDHA 2LVJA 2M7LA 3M0WA 2OPOA 1S3PA 2L4IA 3JVTB 3I5FC 3I5GC 1K2HA 4MEWA 1JUOA 2CBLA 5HKZA 2DOQA 2GGMA 3DF0A 4HREE 4ZCUA 1H4BA 3VRRA 1BOCA 1BF5A 2LMVA 4YBHB 1IG5A 2K7OA 3NSKA 1OZOA 1TN4A 4M2QA 4YGAA 3BXKA 1XFYO 1KFXL 1J1DA 1SCVA 2KI6C 2BCBA 2WCBA 3DD4A 1CNPA 1KSMA 3CS1A 2H61C 3O6BA 1F8HA 4I5LB 1IQ5A 1BLQA 1QATA 4OCIA 4MN0A 2KFHA 1V1FA 4M2OA 5AANA 3DVMA 4PE4A 2JXCA 1K9UA 3DF0B 2WCEA 3TDIA 2CT9A 1LXFC 2JNXA 1JBAA 4A4CA 1IQ3A 4ZCVA 2KAVA 1DJZA 1JC2A 1QASA 1DF0A 1K96A 1LINA 3AKBA 2M3WA 1W7JB 1ZACA 4PHNA 4Q04A 5HKWA 2ZFDA 1TIZA 2VRGA 4PCWA 1YUSA 3FWCA 3HCMA 3LK0A 2L0PA 3QRXA 2NCPA 1SNLA 2MRDA 1AJ5A 1YVLA 4MZJA 1DJHA 2ZRTA 2F2PA 2NCOA 1PALA 1S5GZ 2KAXA 3WHUB 4QJ4B 2Y1NA 1CFFA 2GV5A 2LLTA 3PM8A 3CR4X 2MBXA 1RK9A 2JRFA 1TCFA 4I5NB 4DUQA 1DJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SR6 B;  2LVI A;  2NLN A;  1DF0 B;  1BOD A;  3AAJ A;  4PDZ A;  1B7T Z;  3DVK A;  4MBE A;  2LUC A;  1NCZ A;  1RJV A;  2LMT A;  2KBI A;  3SG6 A;  2BBN A;  1OMD A;  2KQ6 A;  1FF1 A;  1TNX A;  3SG2 A;  3C1V A;  4JPZ B;  2CNP A;  1N2D A;  2LE9 B;  4YI9 A;  1WLM A;  2E30 A;  2O5G A;  1DGV A;  3RLZ A;  1MXE A;  1DJG A;  1MR8 A;  3CR5 X;  1YR5 A;  3EK7 A;  5CPV A;  1NCX A;  2KGR A;  3PSR A;  4OV2 A;  1EH2 A;  1PVA A;  1ZMZ A;  3D10 A;  2JTT A;  2M1K B;  1XFX O;  2EHB A;  3WNX B;  2JZI A;  2MAZ A;  2BKI B;  4L9M A;  4XJK B;  5K89 A;  5D69 A;  1XFZ O;  1CB1 A;  1UP5 A;  3I5H B;  2KOT A;  4FTG A;  2I2R E;  4BY5 A;  3CTN A;  5D7F A;  1QLK A;  2EC6 B;  4DCK A;  2F8P A;  1S5G Y;  1NYA A;  5PAL A;  3SG3 A;  4CFR A;  1SR6 C;  2KBM A;  3A8R A;  3BQ3 A;  1BT6 A;  4R1E A;  3TDU A;  4UPG A;  2G9B A;  2H2K A;  1H8B A;  4PHM A;  2BE4 A;  2GGZ A;  3EKJ A;  1KQV A;  4I5K A;  1Y1A A;  1QLS A;  4GGF A;  4GUK A;  1FI6 A;  1MUX A;  3CLN A;  2I18 A;  4MZK A;  1XFW O;  1A2X A;  1QS7 A;  3O2P A;  2JOJ A;  1X02 A;  1XVJ A;  4NDB A;  2K2F A;  1UHJ A;  2KSP A;  2ZN9 A;  4YGD B;  5CSJ A;  2KGB C;  1RWY A;  1B8L A;  3K21 A;  1SMG A;  1F4O A;  1SKT A;  1RFJ A;  1OQP A;  2ZRS A;  4FQO A;  2LLU A;  4MRX A;  1KK8 B;  3SIA A;  1CDN A;  3A4U B;  1IKU A;  1CM4 A;  3TUY B;  2MA2 A;  4PHK A;  2KNE A;  1Y1X A;  1A4P A;  1QXP A;  3I5H C;  1WRL A;  1E8A A;  1CFC A;  2KI4 B;  3FIA A;  1ZFS A;  4OR9 B;  5DKR A;  2EC6 C;  4ORC B;  3IQO A;  5HKY A;  1GGZ A;  3SIB A;  1DJI A;  2WND A;  2LP2 A;  1DT7 B;  1B9A A;  1FW4 A;  2K2A A;  3EVV A;  1IJ5 A;  2A4J A;  4HRH A;  4IL1 A;  4DIR A;  4YGE B;  2ZND A;  3IF7 A;  5CSF A;  3CWG A;  1AK8 A;  1WRZ A;  1BR4 B;  2RGI A;  3O4Y A;  1F71 A;  1K94 A;  2L5X B;  1QIV A;  3D0Y A;  2ISD A;  1OMV A;  2LLS A;  3OP0 A;  2P6B B;  1B8R A;  2KYF A;  3EKH A;  4OKH A;  4JWQ A;  3ZNI A;  3PFV A;  1AP4 A;  2L2E A;  1KFX S;  1KK8 C;  2LVK A;  2M97 A;  1D1O A;  1PK0 D;  1CFD A;  3TUY C;  1R2U A;  4NQG A;  1SK6 D;  3JVT C;  1G4Y R;  4BY4 A;  2IS9 A;  2PVB A;  3AKA A;  3EK8 A;  1YUT A;  2M1U A;  3KPX A;  2LHL A;  3BUO B;  4MRY A;  2EGD A;  3OB1 B;  1JFJ A;  2F3Y A;  1C7W A;  1KK7 Y;  1GQM A;  4GGF C;  4MSP A;  1M39 A;  3LLE A;  2MHH A;  4AQJ A;  2WOS A;  5F6T A;  3NXA A;  2MLE C;  3D0Y B;  4N1G A;  4QJ5 B;  5FYX A;  2K61 A;  4DS7 A;  3FS7 A;  2FJU B;  2LP3 A;  1BR1 B;  2M8U A;  1TNQ A;  1CDL A;  1WDC B;  1J7O A;  4XJK A;  1NX2 A;  3OHM B;  1FBV A;  1A75 A;  4PHJ A;  5CSN A;  3CZT X;  4ETO A;  3NSI A;  1XK4 A;  1PSR A;  2AAO A;  1QX2 A;  1S36 A;  2BCX A;  1SRA A;  4PAL A;  1F70 A;  3SG4 A;  1J7R A;  1AHR A;  5AXI A;  1PSB A;  1UHH A;  1YVH A;  1XO5 A;  1NPQ A;  1AJ4 A;  1SPY A;  1HT9 A;  1XFV O;  3KEV A;  3GK2 A;  1PRW A;  2I7A A;  1M45 A;  1KFU L;  1SCM B;  1W7I B;  1SY9 A;  3ICB A;  1TNP A;  3GOF A;  1M31 A;  2K7B A;  2KFF A;  1K8U A;  1ZOT B;  3OX5 A;  1DGU A;  2E6W A;  2G2B A;  4I5J A;  4WQ3 A;  1SL9 A;  1EXR A;  1AVS A;  1RTP 1;  1YUU A;  2BL0 B;  2Q4U A;  3BUW B;  2COL B;  1A75 B;  1UUS A;  3DVJ A;  3VRO A;  1KCY A;  1IJ6 A;  1CM1 A;  1L2O B;  1WDC C;  4CID A;  4WRI A;  3SG5 A;  1ALW A;  4E68 A;  2OTG B;  1UHI A;  1B8C A;  1TRF A;  4YGC B;  1MWN A;  1S1E A;  3I5I B;  2LAP A;  1JSA A;  1CTR A;  1JFK A;  4ICB A;  4N1F A;  3TZ1 A;  3VGO A;  5CSI A;  4CLN A;  1TOP A;  2KQY A;  1NX0 A;  1CMG A;  3EVU A;  1K90 D;  2B1U A;  1M46 A;  3BYA A;  3PAT A;  5AEQ A;  1QJT A;  5KTY A;  1FPW A;  2L51 A;  3PN7 B;  2K7C A;  2CTN A;  3E3R A;  1CMF A;  2Q91 A;  2LAN A;  4GFT A;  1A03 A;  1B1G A;  1TCO B;  1NCY A;  1F55 A;  1OOJ A;  3GK4 X;  2K0J A;  2HF5 A;  1JF2 A;  3HX4 A;  3WXA A;  2PSR A;  1GGW A;  1R6P A;  4NDD A;  2OS8 B;  1YX8 A;  3NSL A;  2BL0 C;  1LKJ A;  1GJY A;  1KK7 Z;  3TS5 B;  1XK4 C;  2CXJ A;  2KFG A;  1L2O C;  2HPS A;  1AUI B;  4WQ2 A;  4C0K A;  4D1E A;  2FOT A;  4XYN A;  2OTG C;  2K7D A;  2PMY A;  1V1G A;  5AER A;  5BPJ A;  3IQQ A;  1UHK A;  3I5I C;  5DKN A;  3SG7 A;  4CFQ A;  5I2L A;  2Y1M A;  1NSH A;  4AOM A;  5G08 A;  4DRW A;  4PE7 A;  2LUX A;  1OMR A;  4CPV A;  1YRT B;  1K9K A;  1KQM B;  3LCP C;  1CDP A;  2F2O A;  2JPT A;  1NX3 A;  1JF0 A;  2M9G A;  2JT8 A;  1OZS A;  1BU3 A;  1U5I A;  4P2Y B;  1CKK A;  1SW8 A;  4GPL B;  5B8I B;  2LMU A;  1S26 D;  3BUX B;  5GQQ C;  1QV0 A;  3VRQ A;  2SAS A;  4N5X A;  3CGA A;  5ER4 X;  4GGN A;  1PVB A;  2KAY A;  2JUL A;  5HYD A;  1J1E A;  2OS8 C;  2KI6 D;  2FCE A;  2M29 A;  2BKH B;  1MQ1 A;  2I94 A;  1S6J A;  1QVI Z;  3TS5 C;  2AUC A;  2PRU A;  1UHN A;  2JC2 A;  3EVR A;  3VRP A;  5JJG A;  2WOR A;  2KI4 C;  2PAL A;  1YTZ C;  3PAL A;  1LA0 A;  2O60 A;  1SYM A;  1KWO B;  2AMI A;  3TDZ A;  3KHE A;  1DMO A;  2L98 A;  1JWD A;  2BEC A;  2ZN8 A;  1CLL A;  1N65 A;  1K9P A;  3BUM B;  3F45 A;  2MLF C;  1IH0 A;  1NIW A;  1IGV A;  1IRJ A;  1U5I B;  2R2I A;  4YRU A;  1IWQ A;  2F3Z A;  2L50 A;  4HRG A;  1S6C A;  1KQM C;  1J55 A;  2KHN A;  1EJ3 A;  1SBJ A;  1LVC D;  3JTD B;  2CCM A;  1CDM A;  1DJX A;  3SJS A;  1S6I A;  2PAS A;  2LCP A;  4QJ3 B;  3WHT B;  1EL4 A;  4P5O E;  3NSO A;  3PLF B;  1QX5 B;  1VRK A;  3KO0 A;  4USL A;  1K93 D;  1CFP A;  3LL8 B;  4C0L A;  5I2O A;  2LHI A;  4PE1 A;  3OX6 A;  1Y1U A;  2QAC A;  1F4Q A;  1MF8 B;  2Y5I A;  5AFP A;  5JOL A;  2HQW A;  3BUN B;  1G8I A;  2HQ8 A;  4PE0 A;  1SL7 A;  2TN4 A;  3BOW A;  1A29 A;  1LA3 A;  1RRO A;  3FWB A;  2SCP A;  2BCA A;  1YX7 A;  1NP8 A;  2M49 B;  4NDC A;  4YI8 A;  1KWO C;  4MVF A;  1J7P A;  1CLM A;  4YGB B;  2JT3 A;  1NX1 A;  2JTZ A;  4MZL A;  1QVI Y;  2L4H A;  2MJW B;  1DJW A;  1TTX A;  2KYC A;  3LK1 A;  4AQI A;  2NZ0 A;  1Y6W A;  1M63 B;  3EK4 A;  4A4B A;  1EG3 A;  1OE9 B;  3JTD C;  1PUL A;  4HSZ A;  2Y4Q A;  1C07 A;  1YRU B;  2QPT A;  1KFU S;  3ZWH A;  1UWO A;  1DVI A;  1MHO A;  2M0R A;  1L7Z A;  4M2P A;  4ORA B;  1REC A;  2LC5 A;  2ZKM X;  3KF9 A;  1WLZ A;  4ORB B;  3BOW B;  1F54 A;  1ODB A;  5HLO A;  2V53 A;  4GBA A;  3OB2 B;  2LNK A;  2H61 A;  3CR2 A;  5HLV A;  5DKQ A;  1DTL A;  1N0Y A;  1QV1 A;  1B4C A;  1EG4 A;  4U8D A;  1FI5 A;  4F0Z B;  5KSZ A;  2JT0 A;  2JU0 A;  2JWW A;  5I8N A;  2WCF A;  1Y0V H;  3I5F B;  2LVV A;  1SCM C;  3GK1 A;  3I5G B;  1B47 A;  5J3X A;  1NWD A;  1YUR A;  1QX7 A;  2BBM A;  1G33 A;  4MLW A;  1QIW A;  2WC8 A;  1BG1 A;  2JQ6 A;  1SL8 A;  1XFU O;  2LV7 A;  2JXL A;  1Q80 A;  1XYD A;  2NXQ A;  1UUR A;  1ZUZ A;  1TNW A;  4TNC A;  1J7Q A;  2HET A;  3H4S E;  5IBW A;  1NUB A;  1XA5 A;  4GAO A;  1C7V A;  1ALV A;  2F33 A;  5TNC A;  1CLB A;  4C0J A;  5KU1 A;  2K8M B;  4JQ0 D;  2JNF A;  1OSA A;  1MXL C;  3DVE A;  3VRN A;  1B7T Y;  1HQV A;  1WY9 A;  2M7N A;  5ER5 A;  2LM5 A;  1WRK A;  1QTX A;  3RM1 A;  5I2Q A;  1BJF A;  1BMO A;  3AAK A;  1K95 A;  1KSO A;  2FCD A;  2ZNE A;  2D8N A;  3MSE B;  2BE6 A;  3O78 A;  4GNK B;  4OVN F;  3PN7 C;  2KDH A;  2LVJ A;  2M7L A;  3M0W A;  2OPO A;  1S3P A;  2L4I A;  3JVT B;  3I5F C;  3I5G C;  1K2H A;  4MEW A;  1JUO A;  2CBL A;  5HKZ A;  2DOQ A;  2GGM A;  3DF0 A;  4HRE E;  4ZCU A;  1H4B A;  3VRR A;  1BOC A;  1BF5 A;  2LMV A;  4YBH B;  1IG5 A;  2K7O A;  3NSK A;  1OZO A;  1TN4 A;  4M2Q A;  4YGA A;  3BXK A;  1XFY O;  1KFX L;  1J1D A;  1SCV A;  2KI6 C;  2BCB A;  2WCB A;  3DD4 A;  1CNP A;  1KSM A;  3CS1 A;  2H61 C;  3O6B A;  1F8H A;  4I5L B;  1IQ5 A;  1BLQ A;  1QAT A;  4OCI A;  4MN0 A;  2KFH A;  1V1F A;  4M2O A;  5AAN A;  3DVM A;  4PE4 A;  2JXC A;  1K9U A;  3DF0 B;  2WCE A;  3TDI A;  2CT9 A;  1LXF C;  2JNX A;  1JBA A;  4A4C A;  1IQ3 A;  4ZCV A;  2KAV A;  1DJZ A;  1JC2 A;  1QAS A;  1DF0 A;  1K96 A;  1LIN A;  3AKB A;  2M3W A;  1W7J B;  1ZAC A;  4PHN A;  4Q04 A;  5HKW A;  2ZFD A;  1TIZ A;  2VRG A;  4PCW A;  1YUS A;  3FWC A;  3HCM A;  3LK0 A;  2L0P A;  3QRX A;  2NCP A;  1SNL A;  2MRD A;  1AJ5 A;  1YVL A;  4MZJ A;  1DJH A;  2ZRT A;  2F2P A;  2NCO A;  1PAL A;  1S5G Z;  2KAX A;  3WHU B;  4QJ4 B;  2Y1N A;  1CFF A;  2GV5 A;  2LLT A;  3PM8 A;  3CR4 X;  2MBX A;  1RK9 A;  2JRF A;  1TCF A;  4I5N B;  4DUQ A;  1DJY A; 
#chains in the Genus database with same CATH topology
 1SR6 B;  2LVI A;  2NLN A;  1DF0 B;  1BOD A;  3AAJ A;  4PDZ A;  1B7T Z;  3DVK A;  4MBE A;  2LUC A;  1DEL A;  1NCZ A;  1RJV A;  2LMT A;  2KBI A;  2YGU A;  3SG6 A;  2BBN A;  3OGN A;  1OMD A;  2KQ6 A;  1FF1 A;  1TNX A;  3UNW A;  3SG2 A;  3C1V A;  4JPZ B;  2CNP A;  1N2D A;  2LE9 B;  4YI9 A;  3DXL A;  1WLM A;  2E30 A;  2O5G A;  4KYN A;  1DGV A;  3RLZ A;  1MXE A;  1DJG A;  1MR8 A;  3CR5 X;  1YR5 A;  3EK7 A;  5CPV A;  1NCX A;  2KGR A;  3PSR A;  4OV2 A;  1EH2 A;  3B86 A;  1PVA A;  3DYE A;  1ZMZ A;  3D10 A;  2L2C A;  2JTT A;  2M1K B;  1XFX O;  1SSE B;  2EHB A;  3WNX B;  2JZI A;  2MAZ A;  2BKI B;  4L9M A;  4XJK B;  5K89 A;  5D69 A;  1XFZ O;  1CB1 A;  3CYZ A;  1UP5 A;  4IJ7 A;  3I5H B;  2KOT A;  4FTG A;  2I2R E;  4BY5 A;  3R1O A;  5HL1 A;  3CTN A;  3Q8I A;  5D7F A;  1QLK A;  2EC6 B;  4DCK A;  2F8P A;  1S5G Y;  1NYA A;  3B87 A;  5PAL A;  3SG3 A;  4CFR A;  1SR6 C;  2KBM A;  3CZ1 A;  3A8R A;  3BQ3 A;  1BT6 A;  4R1E A;  3TDU A;  4UPG A;  2G9B A;  2H2K A;  3CZ0 A;  4PHM A;  4PT1 A;  3SS5 A;  2BE4 A;  2GGZ A;  3L47 A;  3EKJ A;  1KQV A;  4I5K A;  1Y1A A;  1QLS A;  4GGF A;  4GUK A;  1FI6 A;  1MUX A;  3CLN A;  2I18 A;  4JKT A;  4MZK A;  1XFW O;  1A2X A;  1QS7 A;  3O2P A;  4FQT A;  3S0E A;  2JOJ A;  1X02 A;  1XVJ A;  4NDB A;  2K2F A;  1UHJ A;  2KSP A;  2ZN9 A;  3D76 A;  4YGD B;  5CSJ A;  2KGB C;  1RWY A;  1B8L A;  3K21 A;  1SMG A;  1F4O A;  1SKT A;  1RFJ A;  1OQP A;  2ZRS A;  4FQO A;  2LLU A;  4MRX A;  1KK8 B;  3SIA A;  1CDN A;  3A4U B;  1IKU A;  1CM4 A;  3TUY B;  2MA2 A;  4PHK A;  2KNE A;  3SS3 A;  1Y1X A;  1A4P A;  1QXP A;  3I5H C;  1WRL A;  1E8A A;  1CFC A;  2KI4 B;  3FIA A;  1ZFS A;  2H8V A;  4OR9 B;  2EC6 C;  4ORC B;  3IQO A;  5DKR A;  5HKY A;  1GGZ A;  2P70 A;  3B88 A;  3SIB A;  1DJI A;  2WND A;  2LP2 A;  3O4X A;  1B9A A;  1FW4 A;  2K2A A;  1DT7 B;  3EVV A;  1IJ5 A;  3V2L A;  2A4J A;  4HRH A;  4IL1 A;  4DIR A;  4YGE B;  2ZND A;  3IF7 A;  5CSF A;  3CWG A;  1AK8 A;  2WC5 A;  1WRZ A;  1BR4 B;  2RGI A;  3O4Y A;  1F71 A;  1K94 A;  2L5X B;  1QIV A;  3D0Y A;  2ISD A;  1OMV A;  2LLS A;  3FE8 A;  3OP0 A;  2P6B B;  1B8R A;  2KYF A;  3EKH A;  4OKH A;  4JWQ A;  1ORG A;  3PFV A;  3ZNI A;  1AP4 A;  2L2E A;  1KFX S;  1KK8 C;  2LVK A;  2M97 A;  1D1O A;  1PK0 D;  2L5Y A;  1CFD A;  3TUY C;  1R2U A;  2GTE A;  4NQG A;  2WC6 A;  1SK6 D;  3JVT C;  1G4Y R;  1DQE A;  4BY4 A;  2IS9 A;  2PVB A;  3BFB A;  3AKA A;  3EK8 A;  1YUT A;  2M1U A;  3KPX A;  2LHL A;  3BUO B;  4MRY A;  2EGD A;  3OB1 B;  1JFJ A;  2F3Y A;  1C7W A;  1KK7 Y;  1GQM A;  4GGF C;  4MSP A;  1M39 A;  3LLE A;  2MHH A;  4AQJ A;  2WOS A;  5F6T A;  3NXA A;  2MLE C;  3D0Y B;  4N1G A;  4QJ5 B;  5FYX A;  1DC1 A;  2K61 A;  4DS7 A;  3RZS A;  3FS7 A;  2FJU B;  2LP3 A;  1BR1 B;  5D3O A;  2M8U A;  1TNQ A;  1CDL A;  1WDC B;  1J7O A;  4XJK A;  1NX2 A;  3OHM B;  1FBV A;  1A75 A;  4PHJ A;  1OOH A;  2BAP A;  3CZT X;  3NSI A;  5CSN A;  1XK4 A;  1PSR A;  2AAO A;  1QX2 A;  3R72 A;  1S36 A;  2BCX A;  1SRA A;  4PAL A;  1F70 A;  3SG4 A;  1J7R A;  1QWV A;  1AHR A;  5AXI A;  1PSB A;  1UHH A;  1YVH A;  2KPH A;  1XO5 A;  1NPQ A;  1AJ4 A;  1SPY A;  1HT9 A;  1XFV O;  3KEV A;  3GK2 A;  1PRW A;  2I7A A;  3S0B A;  1M45 A;  1KFU L;  1SCM B;  1W7I B;  1SY9 A;  3ICB A;  1TNP A;  3GOF A;  1M31 A;  2K7B A;  2KFF A;  1K8U A;  1ZOT B;  3OX5 A;  1DGU A;  1TUZ A;  2E6W A;  2G2B A;  4I5J A;  3D74 A;  1SL9 A;  4WQ3 A;  1EXR A;  1AVS A;  1RTP 1;  1YUU A;  2BL0 B;  2Q4U A;  3BUW B;  2COL B;  1A75 B;  1UUS A;  3DVJ A;  3VRO A;  2QEH A;  1KCY A;  1IJ6 A;  1CM1 A;  1L2O B;  1WDC C;  4CID A;  1OOF A;  4WRI A;  1ALW A;  3SG5 A;  4E68 A;  2OTG B;  1UHI A;  1B8C A;  1TRF A;  1TWO A;  2KLE A;  4YGC B;  5FI6 A;  1C3Y A;  1MWN A;  1S1E A;  3I5I B;  2LAP A;  1JSA A;  1CTR A;  1JFK A;  4ICB A;  4N1F A;  3TZ1 A;  3VGO A;  5CSI A;  4CLN A;  1TOP A;  2KQY A;  1NX0 A;  1CMG A;  3EVU A;  3L4A A;  3CZ2 A;  1K90 D;  2B1U A;  1M46 A;  3BYA A;  3S0A A;  3PJI A;  3PAT A;  5AEQ A;  1QJT A;  5KTY A;  1FPW A;  2L51 A;  3PN7 B;  2K7C A;  2CTN A;  3E3R A;  1CMF A;  2Q91 A;  1TUJ A;  2LAN A;  4GFT A;  1A03 A;  1B1G A;  1TCO B;  1NCY A;  1F55 A;  1OOJ A;  3GK4 X;  2K0J A;  2HF5 A;  1JF2 A;  3HX4 A;  3WXA A;  2PSR A;  3UO9 A;  1GGW A;  1R6P A;  4NDD A;  2OS8 B;  1YX8 A;  3NSL A;  1IIO A;  2BL0 C;  1LKJ A;  1GJY A;  1KK7 Z;  3TS5 B;  1XK4 C;  2CXJ A;  2KFG A;  3OBV A;  1L2O C;  2HPS A;  1AUI B;  4WQ2 A;  4C0K A;  4D1E A;  2FOT A;  4XYN A;  2OTG C;  2QEV A;  2K7D A;  2PMY A;  1T14 A;  3DY9 A;  2WCH A;  1V1G A;  4OZD A;  3VB1 A;  3IQQ A;  1UHK A;  3I5I C;  5DKN A;  3SG7 A;  5AER A;  4CFQ A;  5BPJ A;  3R1P A;  5I2L A;  2QEO A;  1NSH A;  2Y1M A;  3S0F A;  1GM0 A;  4AOM A;  5G08 A;  4DRW A;  4PE7 A;  2K60 A;  2LUX A;  1OMR A;  3S0D A;  1YRT B;  3FE9 A;  1K9K A;  1KQM B;  4CPV A;  1Z2C B;  3LCP C;  1CDP A;  2F2O A;  2JPT A;  1NX3 A;  1JF0 A;  2M9G A;  2JT8 A;  3SS4 A;  1OZS A;  1BU3 A;  1U5I A;  4P2Y B;  1CKK A;  1SW8 A;  4GPL B;  5B8I B;  2LMU A;  1S26 D;  3N7H A;  3BUX B;  5GQQ C;  1QV0 A;  3EG5 B;  3VRQ A;  2SAS A;  5FI7 A;  4N5X A;  3CGA A;  5ER4 X;  4GGN A;  1PVB A;  2KAY A;  2JUL A;  5HYD A;  1J1E A;  2OS8 C;  2KI6 D;  2QDI A;  2FCE A;  2M29 A;  2BKH B;  1MQ1 A;  2I94 A;  1S6J A;  3NGV A;  3CAB A;  1QVI Z;  3TS5 C;  2AUC A;  2PRU A;  1UHN A;  2JC2 A;  3EVR A;  4ETO A;  3VRP A;  5JJG A;  2WOR A;  2KI4 C;  5DIC A;  2PAL A;  1YTZ C;  3PAL A;  1LA0 A;  2O60 A;  1SYM A;  1KWO B;  2AMI A;  3TDZ A;  3KHE A;  3IVT A;  1DMO A;  2L98 A;  1JWD A;  2BEC A;  2ZN8 A;  1CLL A;  1N65 A;  1K9P A;  3BUM B;  3F45 A;  2MLF C;  1IH0 A;  1NIW A;  1IGV A;  1IRJ A;  1U5I B;  2R2I A;  4YRU A;  1IWQ A;  2F3Z A;  2L50 A;  4HRG A;  1S6C A;  1KQM C;  1J55 A;  2KHN A;  1EJ3 A;  1SBJ A;  1LVC D;  3JTD B;  2CCM A;  2WCM A;  1CDM A;  1DJX A;  3SJS A;  1S6I A;  2PAS A;  2LCP A;  4QJ3 B;  3WHT B;  1EL4 A;  4P5O E;  3NSO A;  3PLF B;  1QX5 B;  1VRK A;  2WCJ A;  3KO0 A;  3BFA A;  4USL A;  1K93 D;  3BFH A;  3LL8 B;  4C0L A;  5I2O A;  2LHI A;  4PE1 A;  1CFP A;  2ERB A;  1Y1U A;  3OX6 A;  2QAC A;  1F4Q A;  1MF8 B;  2Y5I A;  5AFP A;  5JOL A;  2HQW A;  3BUN B;  1G8I A;  2HQ8 A;  4PE0 A;  1SL7 A;  1OW4 A;  2TN4 A;  3FE6 A;  3BOW A;  1A29 A;  1LA3 A;  1RRO A;  3FWB A;  2SCP A;  2BCA A;  1YX7 A;  1NP8 A;  2M49 B;  4NDC A;  4YI8 A;  1KWO C;  4MVF A;  1J7P A;  1CLM A;  4YGB B;  2JT3 A;  1NX1 A;  5EL2 A;  2JTZ A;  3CDN A;  4MZL A;  1QVI Y;  2L4H A;  2MJW B;  3S0G A;  3D73 A;  1DJW A;  1TTX A;  2KYC A;  3BJH A;  3LK1 A;  4AQI A;  2NZ0 A;  1Y6W A;  1M63 B;  3B6X A;  3EK4 A;  4A4B A;  1EG3 A;  1OE9 B;  3L4L A;  3JTD C;  1PUL A;  4HSZ A;  2Y4Q A;  1C07 A;  1YRU B;  2QPT A;  1KFU S;  1XFR A;  2PYQ A;  3ZWH A;  1UWO A;  1DVI A;  1MHO A;  2M0R A;  1L7Z A;  4M2P A;  4ORA B;  1REC A;  2LC5 A;  2ZKM X;  3KF9 A;  1WLZ A;  4ORB B;  3BOW B;  1F54 A;  1ODB A;  5HLO A;  2V53 A;  4GBA A;  3OB2 B;  2LNK A;  2H61 A;  3CR2 A;  5HLV A;  5DKQ A;  1DTL A;  1N0Y A;  1C3Z A;  1QV1 A;  4F7F A;  1EG4 A;  4U8D A;  3R1V A;  4F0Z B;  5KSZ A;  1B4C A;  2JT0 A;  1FI5 A;  2JU0 A;  2JWW A;  5I8N A;  2WCF A;  1Y0V H;  3I5F B;  2LVV A;  1SCM C;  3GK1 A;  3I5G B;  1B47 A;  1OOI X;  5J3X A;  1NWD A;  1YUR A;  1QX7 A;  2BBM A;  3B7A A;  1G33 A;  4MLW A;  1QIW A;  2WC8 A;  1BG1 A;  2JQ6 A;  1SL8 A;  1XFU O;  2LV7 A;  2JXL A;  1Q80 A;  1XYD A;  2NXQ A;  1UUR A;  1ZUZ A;  1TNW A;  4TNC A;  1J7Q A;  2HET A;  3H4S E;  5IBW A;  1NUB A;  1XA5 A;  4GAO A;  1C7V A;  1ALV A;  2F33 A;  4INX A;  5TNC A;  1CLB A;  4C0J A;  5KU1 A;  2K8M B;  1DEK A;  2JNF A;  4JQ0 D;  1OSA A;  1MXL C;  3DVE A;  3VRN A;  1B7T Y;  1HQV A;  1WY9 A;  2JPO A;  1H8B A;  2M7N A;  5ER5 A;  2LM5 A;  1WRK A;  2KLD A;  1QTX A;  3RM1 A;  5I2Q A;  1BJF A;  3D75 A;  5I94 A;  1BMO A;  3AAK A;  1K95 A;  1KSO A;  2FCD A;  2ZNE A;  2D8N A;  3MSE B;  2BE6 A;  3O78 A;  4GNK B;  4OVN F;  3PN7 C;  2KDH A;  2LVJ A;  2M7L A;  3M0W A;  2OPO A;  1S3P A;  2L4I A;  3JVT B;  3I5F C;  3I5G C;  1K2H A;  4MEW A;  1JUO A;  2CBL A;  5HKZ A;  2DOQ A;  2GGM A;  3DF0 A;  4HRE E;  4ZCU A;  1H4B A;  2FJY A;  3VRR A;  1BOC A;  1BF5 A;  2LMV A;  2QEB A;  4YBH B;  1IG5 A;  2K7O A;  3NSK A;  1OZO A;  1TN4 A;  4M2Q A;  4YGA A;  3BXK A;  1XFY O;  1KFX L;  1J1D A;  1SCV A;  2KI6 C;  2BCB A;  2WCB A;  3DD4 A;  1CNP A;  4INW A;  1KSM A;  3CS1 A;  2H61 C;  2WCK A;  3O6B A;  1F8H A;  4I5L B;  1IQ5 A;  1BLQ A;  3D77 A;  1P28 A;  1QAT A;  4OCI A;  4MN0 A;  2KFH A;  1V1F A;  4M2O A;  5AAN A;  3DVM A;  4PE4 A;  2JXC A;  3DZT A;  1K9U A;  3DF0 B;  2WCE A;  3TDI A;  2CT9 A;  1LXF C;  2JNX A;  3NHI A;  1JBA A;  4A4C A;  1IQ3 A;  4ZCV A;  2KAV A;  1W9Z A;  1DJZ A;  2BNX A;  1JC2 A;  1QAS A;  1DF0 A;  1K96 A;  1LIN A;  3AKB A;  2M3W A;  1W7J B;  1ZAC A;  4PHN A;  4Q04 A;  5HKW A;  3PM2 A;  2ZFD A;  1TIZ A;  3QME A;  4JD9 A;  2VRG A;  4PCW A;  1YUS A;  3FWC A;  3HCM A;  3LK0 A;  2L0P A;  3QRX A;  2NCP A;  1SNL A;  2MRD A;  1AJ5 A;  1YVL A;  4MZJ A;  3K1E A;  1DJH A;  2ZRT A;  2F2P A;  1LS8 A;  2P71 A;  2NCO A;  1PAL A;  1S5G Z;  2KAX A;  3WHU B;  1OOG A;  4QJ4 B;  3D78 A;  2WCL A;  2Y1N A;  1CFF A;  2GV5 A;  2LLT A;  3PM8 A;  3CR4 X;  2MBX A;  3NHT A;  2PQL A;  1RK9 A;  2JRF A;  5FI2 A;  1TCF A;  1Z4H A;  4I5N B;  4DUQ A;  1DJY A; 
#chains in the Genus database with same CATH homology
 1SR6 B;  2LVI A;  2NLN A;  1DF0 B;  1BOD A;  3AAJ A;  4PDZ A;  1B7T Z;  3DVK A;  4MBE A;  2LUC A;  1NCZ A;  1RJV A;  2LMT A;  2KBI A;  3SG6 A;  2BBN A;  1OMD A;  2KQ6 A;  1FF1 A;  1TNX A;  3SG2 A;  3C1V A;  4JPZ B;  2CNP A;  1N2D A;  2LE9 B;  4YI9 A;  1WLM A;  2E30 A;  2O5G A;  1DGV A;  3RLZ A;  1MXE A;  1DJG A;  1MR8 A;  3CR5 X;  1YR5 A;  3EK7 A;  5CPV A;  1NCX A;  2KGR A;  3PSR A;  4OV2 A;  1EH2 A;  1PVA A;  1ZMZ A;  3D10 A;  2JTT A;  2M1K B;  1XFX O;  2EHB A;  3WNX B;  2JZI A;  2MAZ A;  2BKI B;  4L9M A;  4XJK B;  5K89 A;  5D69 A;  1XFZ O;  1CB1 A;  1UP5 A;  3I5H B;  2KOT A;  4FTG A;  2I2R E;  4BY5 A;  3CTN A;  5D7F A;  1QLK A;  2EC6 B;  4DCK A;  2F8P A;  1S5G Y;  1NYA A;  5PAL A;  3SG3 A;  4CFR A;  1SR6 C;  2KBM A;  3A8R A;  3BQ3 A;  1BT6 A;  4R1E A;  3TDU A;  4UPG A;  2G9B A;  2H2K A;  1H8B A;  4PHM A;  2BE4 A;  2GGZ A;  3EKJ A;  1KQV A;  4I5K A;  1Y1A A;  1QLS A;  4GGF A;  4GUK A;  1FI6 A;  1MUX A;  3CLN A;  2I18 A;  4MZK A;  1XFW O;  1A2X A;  1QS7 A;  3O2P A;  2JOJ A;  1X02 A;  1XVJ A;  4NDB A;  2K2F A;  1UHJ A;  2KSP A;  2ZN9 A;  4YGD B;  5CSJ A;  2KGB C;  1RWY A;  1B8L A;  3K21 A;  1SMG A;  1F4O A;  1SKT A;  1RFJ A;  1OQP A;  2ZRS A;  4FQO A;  2LLU A;  4MRX A;  1KK8 B;  3SIA A;  1CDN A;  3A4U B;  1IKU A;  1CM4 A;  3TUY B;  2MA2 A;  4PHK A;  2KNE A;  1Y1X A;  1A4P A;  1QXP A;  3I5H C;  1WRL A;  1E8A A;  1CFC A;  2KI4 B;  3FIA A;  1ZFS A;  4OR9 B;  5DKR A;  2EC6 C;  4ORC B;  3IQO A;  5HKY A;  1GGZ A;  3SIB A;  1DJI A;  2WND A;  2LP2 A;  1DT7 B;  1B9A A;  1FW4 A;  2K2A A;  3EVV A;  1IJ5 A;  2A4J A;  4HRH A;  4IL1 A;  4DIR A;  4YGE B;  2ZND A;  3IF7 A;  5CSF A;  3CWG A;  1AK8 A;  1WRZ A;  1BR4 B;  2RGI A;  3O4Y A;  1F71 A;  1K94 A;  2L5X B;  1QIV A;  3D0Y A;  2ISD A;  1OMV A;  2LLS A;  3OP0 A;  2P6B B;  1B8R A;  2KYF A;  3EKH A;  4OKH A;  4JWQ A;  3ZNI A;  3PFV A;  1AP4 A;  2L2E A;  1KFX S;  1KK8 C;  2LVK A;  2M97 A;  1D1O A;  1PK0 D;  1CFD A;  3TUY C;  1R2U A;  4NQG A;  1SK6 D;  3JVT C;  1G4Y R;  4BY4 A;  2IS9 A;  2PVB A;  3AKA A;  3EK8 A;  1YUT A;  2M1U A;  3KPX A;  2LHL A;  3BUO B;  4MRY A;  2EGD A;  3OB1 B;  1JFJ A;  2F3Y A;  1C7W A;  1KK7 Y;  1GQM A;  4GGF C;  4MSP A;  1M39 A;  3LLE A;  2MHH A;  4AQJ A;  2WOS A;  5F6T A;  3NXA A;  2MLE C;  3D0Y B;  4N1G A;  4QJ5 B;  5FYX A;  2K61 A;  4DS7 A;  3FS7 A;  2FJU B;  2LP3 A;  1BR1 B;  2M8U A;  1TNQ A;  1CDL A;  1WDC B;  1J7O A;  4XJK A;  1NX2 A;  3OHM B;  1FBV A;  1A75 A;  4PHJ A;  5CSN A;  3CZT X;  4ETO A;  3NSI A;  1XK4 A;  1PSR A;  2AAO A;  1QX2 A;  1S36 A;  2BCX A;  1SRA A;  4PAL A;  1F70 A;  3SG4 A;  1J7R A;  1AHR A;  5AXI A;  1PSB A;  1UHH A;  1YVH A;  1XO5 A;  1NPQ A;  1AJ4 A;  1SPY A;  1HT9 A;  1XFV O;  3KEV A;  3GK2 A;  1PRW A;  2I7A A;  1M45 A;  1KFU L;  1SCM B;  1W7I B;  1SY9 A;  3ICB A;  1TNP A;  3GOF A;  1M31 A;  2K7B A;  2KFF A;  1K8U A;  1ZOT B;  3OX5 A;  1DGU A;  2E6W A;  2G2B A;  4I5J A;  4WQ3 A;  1SL9 A;  1EXR A;  1AVS A;  1RTP 1;  1YUU A;  2BL0 B;  2Q4U A;  3BUW B;  2COL B;  1A75 B;  1UUS A;  3DVJ A;  3VRO A;  1KCY A;  1IJ6 A;  1CM1 A;  1L2O B;  1WDC C;  4CID A;  4WRI A;  3SG5 A;  1ALW A;  4E68 A;  2OTG B;  1UHI A;  1B8C A;  1TRF A;  4YGC B;  1MWN A;  1S1E A;  3I5I B;  2LAP A;  1JSA A;  1CTR A;  1JFK A;  4ICB A;  4N1F A;  3TZ1 A;  3VGO A;  5CSI A;  4CLN A;  1TOP A;  2KQY A;  1NX0 A;  1CMG A;  3EVU A;  1K90 D;  2B1U A;  1M46 A;  3BYA A;  3PAT A;  5AEQ A;  1QJT A;  5KTY A;  1FPW A;  2L51 A;  3PN7 B;  2K7C A;  2CTN A;  3E3R A;  1CMF A;  2Q91 A;  2LAN A;  4GFT A;  1A03 A;  1B1G A;  1TCO B;  1NCY A;  1F55 A;  1OOJ A;  3GK4 X;  2K0J A;  2HF5 A;  1JF2 A;  3HX4 A;  3WXA A;  2PSR A;  1GGW A;  1R6P A;  4NDD A;  2OS8 B;  1YX8 A;  3NSL A;  2BL0 C;  1LKJ A;  1GJY A;  1KK7 Z;  3TS5 B;  1XK4 C;  2CXJ A;  2KFG A;  1L2O C;  2HPS A;  1AUI B;  4WQ2 A;  4C0K A;  4D1E A;  2FOT A;  4XYN A;  2OTG C;  2K7D A;  2PMY A;  1V1G A;  5AER A;  5BPJ A;  3IQQ A;  1UHK A;  3I5I C;  5DKN A;  3SG7 A;  4CFQ A;  5I2L A;  2Y1M A;  1NSH A;  4AOM A;  5G08 A;  4DRW A;  4PE7 A;  2LUX A;  1OMR A;  4CPV A;  1YRT B;  1K9K A;  1KQM B;  3LCP C;  1CDP A;  2F2O A;  2JPT A;  1NX3 A;  1JF0 A;  2M9G A;  2JT8 A;  1OZS A;  1BU3 A;  1U5I A;  4P2Y B;  1CKK A;  1SW8 A;  4GPL B;  5B8I B;  2LMU A;  1S26 D;  3BUX B;  5GQQ C;  1QV0 A;  3VRQ A;  2SAS A;  4N5X A;  3CGA A;  5ER4 X;  4GGN A;  1PVB A;  2KAY A;  2JUL A;  5HYD A;  1J1E A;  2OS8 C;  2KI6 D;  2FCE A;  2M29 A;  2BKH B;  1MQ1 A;  2I94 A;  1S6J A;  1QVI Z;  3TS5 C;  2AUC A;  2PRU A;  1UHN A;  2JC2 A;  3EVR A;  3VRP A;  5JJG A;  2WOR A;  2KI4 C;  2PAL A;  1YTZ C;  3PAL A;  1LA0 A;  2O60 A;  1SYM A;  1KWO B;  2AMI A;  3TDZ A;  3KHE A;  1DMO A;  2L98 A;  1JWD A;  2BEC A;  2ZN8 A;  1CLL A;  1N65 A;  1K9P A;  3BUM B;  3F45 A;  2MLF C;  1IH0 A;  1NIW A;  1IGV A;  1IRJ A;  1U5I B;  2R2I A;  4YRU A;  1IWQ A;  2F3Z A;  2L50 A;  4HRG A;  1S6C A;  1KQM C;  1J55 A;  2KHN A;  1EJ3 A;  1SBJ A;  1LVC D;  3JTD B;  2CCM A;  1CDM A;  1DJX A;  3SJS A;  1S6I A;  2PAS A;  2LCP A;  4QJ3 B;  3WHT B;  1EL4 A;  4P5O E;  3NSO A;  3PLF B;  1QX5 B;  1VRK A;  3KO0 A;  4USL A;  1K93 D;  1CFP A;  3LL8 B;  4C0L A;  5I2O A;  2LHI A;  4PE1 A;  3OX6 A;  1Y1U A;  2QAC A;  1F4Q A;  1MF8 B;  2Y5I A;  5AFP A;  5JOL A;  2HQW A;  3BUN B;  1G8I A;  2HQ8 A;  4PE0 A;  1SL7 A;  2TN4 A;  3BOW A;  1A29 A;  1LA3 A;  1RRO A;  3FWB A;  2SCP A;  2BCA A;  1YX7 A;  1NP8 A;  2M49 B;  4NDC A;  4YI8 A;  1KWO C;  4MVF A;  1J7P A;  1CLM A;  4YGB B;  2JT3 A;  1NX1 A;  2JTZ A;  4MZL A;  1QVI Y;  2L4H A;  2MJW B;  1DJW A;  1TTX A;  2KYC A;  3LK1 A;  4AQI A;  2NZ0 A;  1Y6W A;  1M63 B;  3EK4 A;  4A4B A;  1EG3 A;  1OE9 B;  3JTD C;  1PUL A;  4HSZ A;  2Y4Q A;  1C07 A;  1YRU B;  2QPT A;  1KFU S;  3ZWH A;  1UWO A;  1DVI A;  1MHO A;  2M0R A;  1L7Z A;  4M2P A;  4ORA B;  1REC A;  2LC5 A;  2ZKM X;  3KF9 A;  1WLZ A;  4ORB B;  3BOW B;  1F54 A;  1ODB A;  5HLO A;  2V53 A;  4GBA A;  3OB2 B;  2LNK A;  2H61 A;  3CR2 A;  5HLV A;  5DKQ A;  1DTL A;  1N0Y A;  1QV1 A;  1B4C A;  1EG4 A;  4U8D A;  1FI5 A;  4F0Z B;  5KSZ A;  2JT0 A;  2JU0 A;  2JWW A;  5I8N A;  2WCF A;  1Y0V H;  3I5F B;  2LVV A;  1SCM C;  3GK1 A;  3I5G B;  1B47 A;  5J3X A;  1NWD A;  1YUR A;  1QX7 A;  2BBM A;  1G33 A;  4MLW A;  1QIW A;  2WC8 A;  1BG1 A;  2JQ6 A;  1SL8 A;  1XFU O;  2LV7 A;  2JXL A;  1Q80 A;  1XYD A;  2NXQ A;  1UUR A;  1ZUZ A;  1TNW A;  4TNC A;  1J7Q A;  2HET A;  3H4S E;  5IBW A;  1NUB A;  1XA5 A;  4GAO A;  1C7V A;  1ALV A;  2F33 A;  5TNC A;  1CLB A;  4C0J A;  5KU1 A;  2K8M B;  4JQ0 D;  2JNF A;  1OSA A;  1MXL C;  3DVE A;  3VRN A;  1B7T Y;  1HQV A;  1WY9 A;  2M7N A;  5ER5 A;  2LM5 A;  1WRK A;  1QTX A;  3RM1 A;  5I2Q A;  1BJF A;  1BMO A;  3AAK A;  1K95 A;  1KSO A;  2FCD A;  2ZNE A;  2D8N A;  3MSE B;  2BE6 A;  3O78 A;  4GNK B;  4OVN F;  3PN7 C;  2KDH A;  2LVJ A;  2M7L A;  3M0W A;  2OPO A;  1S3P A;  2L4I A;  3JVT B;  3I5F C;  3I5G C;  1K2H A;  4MEW A;  1JUO A;  2CBL A;  5HKZ A;  2DOQ A;  2GGM A;  3DF0 A;  4HRE E;  4ZCU A;  1H4B A;  3VRR A;  1BOC A;  1BF5 A;  2LMV A;  4YBH B;  1IG5 A;  2K7O A;  3NSK A;  1OZO A;  1TN4 A;  4M2Q A;  4YGA A;  3BXK A;  1XFY O;  1KFX L;  1J1D A;  1SCV A;  2KI6 C;  2BCB A;  2WCB A;  3DD4 A;  1CNP A;  1KSM A;  3CS1 A;  2H61 C;  3O6B A;  1F8H A;  4I5L B;  1IQ5 A;  1BLQ A;  1QAT A;  4OCI A;  4MN0 A;  2KFH A;  1V1F A;  4M2O A;  5AAN A;  3DVM A;  4PE4 A;  2JXC A;  1K9U A;  3DF0 B;  2WCE A;  3TDI A;  2CT9 A;  1LXF C;  2JNX A;  1JBA A;  4A4C A;  1IQ3 A;  4ZCV A;  2KAV A;  1DJZ A;  1JC2 A;  1QAS A;  1DF0 A;  1K96 A;  1LIN A;  3AKB A;  2M3W A;  1W7J B;  1ZAC A;  4PHN A;  4Q04 A;  5HKW A;  2ZFD A;  1TIZ A;  2VRG A;  4PCW A;  1YUS A;  3FWC A;  3HCM A;  3LK0 A;  2L0P A;  3QRX A;  2NCP A;  1SNL A;  2MRD A;  1AJ5 A;  1YVL A;  4MZJ A;  1DJH A;  2ZRT A;  2F2P A;  2NCO A;  1PAL A;  1S5G Z;  2KAX A;  3WHU B;  4QJ4 B;  2Y1N A;  1CFF A;  2GV5 A;  2LLT A;  3PM8 A;  3CR4 X;  2MBX A;  1RK9 A;  2JRF A;  1TCF A;  4I5N B;  4DUQ A;  1DJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...