5CSFA

S100b-rsk1 crystal structure a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
GSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein S100-B
total genus 27
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5csfA00
4I5LB 3BXKA 1WRKA 3WXAA 2WC8A 1L2OC 1MR8A 2LMTA 2L2EA 2WOSA 1UWOA 1TNQA 2Q91A 1JUOA 1R6PA 1JSAA 3ZNIA 1VRKA 1XO5A 2KBIA 5CSJA 3I5GB 1DGUA 1XK4C 1JF0A 3TS5C 2ISDA 3EKHA 1CNPA 3NSKA 2BBNA 2JPTA 1CFCA 1YVHA 4PDZA 1S26D 1XFXO 2JQ6A 2KYFA 2LVJA 2L4IA 2OPOA 4D1EA 1C7VA 5AERA 2LC5A 2LHIA 4DCKA 4DUQA 2LM5A 2M97A 2K7DA 4FTGA 4BY4A 4MLWA 4JWQA 1IWQA 1ALWA 1NWDA 4ETOA 1MUXA 2KFGA 1PSBA 1YUUA 1KFUL 1M39A 2H61C 2KI6C 5ER4X 2PSRA 4PALA 1DF0B 1CDLA 2I18A 1JFKA 1KSOA 4CPVA 1GGZA 2KNEA 3AAKA 1W7IB 3TUYC 2L51A 1EG4A 4ORBB 4DS7A 1D1OA 2K7CA 1CKKA 5J3XA 2BCAA 2K8MB 2LVIA 3I5IC 5D69A 1YVLA 4PHNA 3TZ1A 1F8HA 2JTZA 1Q80A 1SBJA 4HREE 1NX0A 2PASA 1WY9A 2BCXA 4U8DA 3ZWHA 2PRUA 4C0JA 2I94A 1OMVA 1QV1A 4ZCUA 2RGIA 1YRTB 3VRQA 2B1UA 2L5XB 1UHJA 2KDHA 3BUMB 3CGAA 3KPXA 1YTZC 3LCPC 2K61A 5HKZA 3SG2A 1LVCD 3TDZA 4MRXA 4ZCVA 5TNCA 1F4QA 4P5OE 1AHRA 2GV5A 2SASA 5DKQA 2M7NA 2KHNA 1TRFA 1WRZA 2OS8C 1PRWA 3A4UB 1NCZA 2F2PA 2HPSA 3EVVA 2JU0A 2CNPA 1L2OB 3OP0A 1QVIY 1WLMA 3LL8B 2KFHA 1RJVA 1SR6B 2WCBA 4MZJA 5CSIA 3VGOA 1FI5A 1EG3A 1OZOA 4NDDA 3GOFA 2D8NA 2JWWA 3SG6A 4GGNA 2EHBA 2K0JA 2LANA 1A29A 1UURA 2NLNA 1NX2A 1NPQA 2KFFA 1DJYA 5CSFA 2M7LA 4F0ZB 2M1UA 3PSRA 1N0YA 1PK0D 1RFJA 2DOQA 1DJHA 1MHOA 2O5GA 2LVKA 4I5NB 1BG1A 4YGAA 2KI4C 1WDCB 3I5FC 4DIRA 3TDUA 1OE9B 1KWOC 2JTTA 1MWNA 2O60A 3AKBA 1B8CA 1CM4A 3E3RA 1J1EA 1QLSA 1B8LA 2KQYA 2TN4A 4ICBA 3MSEB 1YUSA 1M46A 1SL7A 5HKYA 1IKUA 1F4OA 4JPZB 4A4BA 4P2YB 2A4JA 3CR5X 1FPWA 1TCFA 3BOWA 4PHMA 1CLMA 1MQ1A 3RM1A 1A03A 1SK6D 2ZKMX 4NDCA 1B8RA 1MXLC 1SRAA 4PE1A 3QRXA 3EK7A 2M8UA 1TTXA 4M2PA 1IJ6A 1XYDA 2LP2A 2FOTA 1K9PA 1QXPA 1IQ3A 1TNXA 4E68A 1J1DA 1X02A 2ZRTA 1QLKA 5HKWA 3O6BA 4DRWA 3LK1A 1EXRA 1Y6WA 3CR4X 2CT9A 2L0PA 3KHEA 2LLSA 1B7TZ 5F6TA 1DF0A 4PHKA 1IH0A 2BBMA 1KK7Z 2LAPA 2JOJA 1EL4A 1TCOB 4XJKA 4CFQA 1XFVO 2CCMA 2KQ6A 1KFXS 1SCMB 4GUKA 1A75A 2JULA 2MHHA 3PN7C 4N1FA 3I5HB 4PCWA 1YUTA 2MLFC 4YGCB 4PE4A 3HX4A 5AXIA 3JVTC 2ZN8A 2JT0A 1ZOTB 1EH2A 3EVRA 4XJKB 1BOCA 1K93D 1QASA 1DJZA 3GK1A 1XA5A 1SL8A 2M29A 3I5HC 1PVBA 3NSIA 1XK4A 1ALVA 2LNKA 2MA2A 5BPJA 3O4YA 1ODBA 2BE4A 4YGBB 1KCYA 2ZNEA 1LKJA 4YBHB 4N5XA 3BYAA 1B47A 1SR6C 2WORA 3EK8A 3CR2A 1OSAA 3TS5B 2WNDA 4WRIA 1RROA 1EJ3A 2BECA 2JXLA 2CTNA 4PE7A 3NSOA 1AJ5A 2K2FA 1DVIA 1SYMA 2KGRA 2M49B 1JFJA 1G33A 3NXAA 1M31A 2KYCA 1WLZA 2BE6A 1RTP1 4YI9A 3OHMB 1N65A 1H4BA 3C1VA 1SCVA 1F70A 1NCXA 1TOPA 2Y4QA 1SNLA 3JTDC 1FF1A 3M0WA 1ZUZA 4MVFA 5AFPA 5K89A 1F55A 2LV7A 3VROA 4OR9B 1S5GZ 1PALA 1CDNA 4C0KA 4PE0A 4AQJA 1OMDA 5B8IB 1NP8A 4A4CA 1AVSA 4AOMA 5KTYA 2H2KA 1AUIB 5JJGA 2PVBA 4OV2A 4MEWA 2QPTA 3F45A 3PFVA 4HSZA 3KO0A 3H4SE 1QJTA 2FCDA 2HETA 1W7JB 2HQWA 2ZN9A 2LLUA 1IRJA 2EC6C 3K21A 1YURA 3OB2B 1JF2A 5I2LA 4M2OA 1RWYA 2MRDA 2PMYA 3LLEA 1J55A 1XVJA 2FCEA 3O78A 4MBEA 4R1EA 1TNWA 5HLOA 3GK4X 3CWGA 1K9UA 2NCPA 1V1FA 1OQPA 1UHKA 1J7PA 1YRUB 2JNFA 4JQ0D 1QV0A 2E30A 4OCIA 1K8UA 2F33A 2LVVA 3I5IB 3KEVA 2Q4UA 1CDMA 3BUXB 2BKHB 3SG3A 1U5IA 2LUCA 2HQ8A 1BF5A 1CLLA 4OKHA 3BQ3A 4Q04A 1HQVA 2L50A 2ZNDA 4GGFC 1B1GA 2LMUA 4GPLB 1TIZA 2BKIB 2OS8B 1NX3A 1A2XA 3PATA 4TNCA 2AAOA 2R2IA 1R2UA 2E6WA 4GBAA 3FWCA 1K94A 1G8IA 5PALA 1IJ5A 2LCPA 1BT6A 1M45A 3PN7B 4ORAB 3TDIA 1CFDA 1KQVA 1SY9A 1UHHA 5CPVA 1S5GY 1SPYA 5GQQC 2JT3A 5KU1A 3HCMA 2M3WA 4QJ4B 1CB1A 1GGWA 1QS7A 2LHLA 4NQGA 2MJWB 1DMOA 3PALA 3O2PA 2AMIA 2Y1NA 3FIAA 4MZKA 1J7OA 2KBMA 3D0YA 2PALA 5KSZA 5HLVA 4I5JA 3EK4A 1BMOA 2VRGA 2IS9A 3DVMA 3PLFB 3SG5A 5D7FA 5I2OA 1MF8B 3JTDB 1QX2A 1S3PA 1YX7A 3LK0A 1K9KA 1UUSA 4PHJA 1SMGA 4AQIA 2NZ0A 5DKNA 2FJUB 2BL0B 1AK8A 2M0RA 1K95A 4UPGA 1C7WA 3DVKA 1IQ5A 1DJXA 3CS1A 1XFWO 3CZTX 1S36A 1KK8C 1RK9A 1FW4A 2MAZA 3DVJA 2LP3A 2COLB 3OB1B 2LE9B 1OMRA 2CXJA 4IL1A 1LINA 2M1KB 3BUWB 3FS7A 1CM1A 2JC2A 4QJ3B 1UHIA 3DD4A 4BY5A 1H8BA 1JWDA 1U5IB 2Y5IA 3IQOA 1NCYA 5FYXA 5AEQA 4CIDA 2CBLA 2H61A 3D10A 2LMVA 2QACA 4WQ3A 1WDCC 1F71A 1ZFSA 1PSRA 2EC6B 1QATA 2G2BA 4YI8A 2KOTA 1AJ4A 3DF0B 2HF5A 3WHTB 5HYDA 1BJFA 1G4YR 4XYNA 5G08A 3IF7A 2KI6D 5I8NA 2L98A 1L7ZA 4YGDB 4GFTA 3GK2A 1A4PA 1ZACA 1NSHA 4NDBA 3VRNA 1NYAA 1IGVA 2M9GA 3EVUA 1BODA 4GNKB 4N1GA 2BCBA 3NSLA 1QTXA 4GAOA 4QJ5B 1K2HA 3AAJA 1DTLA 1QX7A 1WRLA 1OOJA 4MZLA 2KAXA 1PULA 2F3YA 5CSNA 1Y1XA 4OVNF 2I7AA 2K7BA 1A75B 1N2DA 2JT8A 1OZSA 1MXEA 3CLNA 3DF0A 4HRHA 1UP5A 2AUCA 2G9BA 1Y1UA 2I2RE 2F2OA 5ER5A 2F3ZA 3VRPA 1SCMC 1JBAA 1J7QA 1GJYA 1SW8A 1KFUS 1SKTA 1B4CA 1QIVA 1M63B 1SL9A 1S6CA 4C0LA 3WNXB 1RECA 3A8RA 3WHUB 1NUBA 3SIBA 4WQ2A 1KK7Y 3I5GC 1NIWA 1Y1AA 1CTRA 1CFPA 3CTNA 1S1EA 1B7TY 1FBVA 2KSPA 5IBWA 4YRUA 4MN0A 1S6IA 5I2QA 1AP4A 2JXCA 2SCPA 5DKRA 3I5FB 3JVTB 3SIAA 2ZFDA 1CMGA 4L9MA 1CDPA 2JNXA 2WCEA 3SG4A 1KQMC 1KK8B 2OTGB 2LUXA 1C07A 2WCFA 3D0YB 1FI6A 1K90D 1GQMA 1S6JA 3DVEA 4ORCB 2KI4B 1KSMA 1KWOB 2LLTA 4YGEB 2EGDA 4HRGA 1BR1B 1KQMB 2JZIA 2OTGC 4MRYA 1LXFC 2F8PA 1ZMZA 3TUYB 1Y0VH 1V1GA 4CLNA 2K7OA 1XFUO 2MBXA 1K96A 1TNPA 3SG7A 1DJIA 1F54A 3BUOB 3FWBA 4I5KA 4CFRA 1BU3A 1KFXL 2KGBC 5AANA 3BOWB 1YR5A 3AKAA 2KAYA 1DJWA 2BL0C 1DT7B 2Y1MA 1PVAA 1HT9A 3RLZA 1CFFA 1XFYO 1B9AA 1DJGA 1LA0A 2V53A 3OX6A 1QIWA 2GGMA 2K2AA 3KF9A 1QX5B 2KAVA 1YX8A 1CLBA 3PM8A 4MSPA 2P6BB 4M2QA 2MLEC 1DGVA 1TN4A 3IQQA 3ICBA 3EKJA 1BLQA 1E8AA 4FQOA 4USLA 4GGFA 5JOLA 2NXQA 1NX1A 3OX5A 3BUNB 1LA3A 1IG5A 3VRRA 2GGZA 1J7RA 1CMFA 2JRFA 1UHNA 2ZRSA 1JC2A 1XFZO 1BR4B 2NCOA 1QVIZ 3SJSA 2L4HA
chains in the Genus database with same CATH superfamily
4I5LB 1Z4HA 3BXKA 1WRKA 3WXAA 1OOFA 2WC8A 1L2OC 1MR8A 2LMTA 2L2EA 2WOSA 1UWOA 1TNQA 2Q91A 1JUOA 1R6PA 1JSAA 3ZNIA 1VRKA 1XO5A 2KBIA 3CYZA 5CSJA 3I5GB 1DGUA 1XK4C 1JF0A 3TS5C 3D77A 3NHIA 2ISDA 3EKHA 3R1OA 3NSKA 1CNPA 1W9ZA 3EG5B 3OBVA 2BBNA 2L2CA 2QEBA 2JPTA 1CFCA 1YVHA 4PDZA 1S26D 1XFXO 2JQ6A 2KYFA 2LVJA 2L4IA 2OPOA 4D1EA 1C7VA 5AERA 2LC5A 2LHIA 4DCKA 4DUQA 2LM5A 2M97A 2K7DA 4FTGA 4BY4A 4MLWA 2P70A 4JWQA 1IWQA 1ALWA 1DQEA 1NWDA 3DY9A 4ETOA 1MUXA 2WC5A 2KFGA 1PSBA 1YUUA 1KFUL 2P71A 1M39A 2H61C 2KI6C 5ER4X 2PSRA 4PALA 3UO9A 1DF0B 1CDLA 2I18A 1JFKA 1KSOA 4CPVA 1GGZA 2KNEA 3S0FA 3AAKA 1W7IB 3TUYC 2L51A 1EG4A 4ORBB 4DS7A 3BFBA 1D1OA 2K7CA 1CKKA 5J3XA 3PM2A 4IJ7A 1XFRA 2BCAA 2K8MB 2LVIA 3I5IC 5D69A 1YVLA 3R72A 4PHNA 3TZ1A 1F8HA 2JTZA 1Q80A 1SBJA 4HREE 1NX0A 2PASA 1WY9A 2BCXA 3D73A 4U8DA 3ZWHA 2PRUA 4C0JA 2I94A 1OMVA 1QV1A 5D3OA 4ZCUA 2RGIA 1YRTB 3VRQA 2B1UA 2L5XB 3DXLA 1UHJA 2KDHA 3BUMB 3CGAA 3KPXA 1YTZC 3LCPC 2K61A 5HKZA 3SG2A 1LVCD 3TDZA 4MRXA 4ZCVA 5TNCA 1F4QA 4P5OE 1AHRA 2GV5A 2SASA 5DKQA 2M7NA 2KHNA 1TRFA 1OW4A 1WRZA 2OS8C 1PRWA 3A4UB 1NCZA 2F2PA 2HPSA 3EVVA 2JU0A 1C3ZA 2CNPA 5FI2A 2WCKA 1L2OB 3OP0A 1QVIY 3RZSA 1WLMA 3LL8B 2KFHA 1RJVA 1SR6B 2WCBA 4MZJA 5CSIA 3VGOA 1FI5A 1EG3A 1OZOA 4NDDA 3GOFA 2D8NA 2JWWA 3SG6A 4GGNA 2EHBA 2K0JA 2LANA 1A29A 1UURA 2BAPA 4INXA 2NLNA 1NX2A 1NPQA 2KFFA 1DJYA 4JD9A 5CSFA 2M7LA 4F0ZB 2M1UA 3PSRA 1N0YA 1PK0D 1RFJA 2DOQA 1DJHA 1MHOA 2O5GA 2LVKA 3CZ2A 3S0AA 4I5NB 1BG1A 4YGAA 2KI4C 1WDCB 3I5FC 4DIRA 3TDUA 1OE9B 1KWOC 2JTTA 1MWNA 2O60A 3AKBA 1B8CA 1CM4A 3E3RA 1J1EA 1QLSA 1B8LA 2KQYA 4F7FA 2TN4A 4ICBA 3MSEB 1YUSA 1M46A 1SL7A 5HL1A 5HKYA 3B87A 1IKUA 1F4OA 4JPZB 4A4BA 4P2YB 2A4JA 3CR5X 1FPWA 1TCFA 3BOWA 4PHMA 1CLMA 1MQ1A 3RM1A 3S0GA 1SK6D 1A03A 3IVTA 2ZKMX 4NDCA 1C3YA 1B8RA 1MXLC 1SRAA 4PE1A 3QRXA 3EK7A 2M8UA 1TTXA 4M2PA 1IJ6A 1XYDA 2LP2A 2FOTA 1K9PA 3PJIA 1QXPA 1IQ3A 1TNXA 4E68A 1J1DA 1X02A 2ZRTA 1QLKA 5HKWA 3O6BA 4DRWA 2JPOA 1EXRA 1Y6WA 3LK1A 4INWA 3CR4X 2PYQA 2CT9A 2L0PA 3KHEA 2LLSA 1B7TZ 3B88A 2KLDA 5F6TA 1DF0A 4PHKA 1IH0A 2BBMA 1KK7Z 2LAPA 2JOJA 1EL4A 1TCOB 4XJKA 4CFQA 1XFVO 2CCMA 2KQ6A 1KFXS 1SCMB 4GUKA 1A75A 2JULA 2MHHA 2K60A 3PN7C 4N1FA 3I5HB 4PCWA 1YUTA 1Z2CB 2MLFC 4PE4A 3HX4A 4YGCB 5EL2A 3JVTC 3FE6A 5AXIA 2ZN8A 2JT0A 2KLEA 1ZOTB 1EH2A 3EVRA 4XJKB 2H8VA 1BOCA 1K93D 1QASA 1DJZA 3GK1A 1XA5A 1SL8A 2M29A 4OZDA 3I5HC 1PVBA 3NSIA 1XK4A 1ALVA 2LNKA 2MA2A 5BPJA 3K1EA 1ODBA 2BE4A 3O4YA 4YGBB 1KCYA 2ZNEA 1LKJA 4YBHB 4N5XA 3BYAA 1B47A 1SR6C 2WORA 3EK8A 2L5YA 3CR2A 1OSAA 3TS5B 2WNDA 4WRIA 1RROA 1EJ3A 2BECA 2JXLA 2CTNA 4PE7A 3NSOA 1AJ5A 2K2FA 1DVIA 3R1PA 1SYMA 2KGRA 2M49B 1JFJA 1G33A 3NXAA 1M31A 2KYCA 1WLZA 2BE6A 1RTP1 4YI9A 3OHMB 1N65A 1H4BA 3C1VA 1SCVA 1F70A 1NCXA 1TOPA 2Y4QA 1SNLA 3JTDC 1FF1A 3M0WA 1ZUZA 3CABA 3O4XA 4MVFA 5AFPA 5K89A 1F55A 2LV7A 3VROA 4OR9B 1S5GZ 2WCMA 3L4AA 1PALA 1SSEB 1CDNA 1T14A 4C0KA 1IIOA 4PE0A 4AQJA 1OMDA 5B8IB 1NP8A 3OGNA 4A4CA 1AVSA 4AOMA 5KTYA 2H2KA 1AUIB 5JJGA 2QEVA 2PVBA 4OV2A 4MEWA 2QPTA 3BFAA 3F45A 3PFVA 2QDIA 4HSZA 3KO0A 3H4SE 1QJTA 3S0BA 2FCDA 2HETA 1W7JB 2HQWA 2ZN9A 2LLUA 3D75A 1IRJA 2EC6C 3K21A 1YURA 3DYEA 3OB2B 1JF2A 5I2LA 4M2OA 1RWYA 2MRDA 2PMYA 3LLEA 1J55A 2WCLA 1XVJA 2FCEA 3O78A 4MBEA 4R1EA 1TNWA 5HLOA 3GK4X 3CWGA 1K9UA 2NCPA 1V1FA 1OQPA 1UHKA 1J7PA 1YRUB 3NGVA 2JNFA 4JQ0D 1QV0A 2E30A 2GTEA 1K8UA 2F33A 4OCIA 2LVVA 3I5IB 3KEVA 2Q4UA 1CDMA 3BUXB 2BKHB 3SG3A 1U5IA 2LUCA 2HQ8A 3B6XA 3CZ1A 1BF5A 1CLLA 4OKHA 3BQ3A 4Q04A 1HQVA 2L50A 1TUZA 2ZNDA 3FE8A 5FI7A 4GGFC 1B1GA 2LMUA 4GPLB 1TIZA 2BKIB 3QMEA 2OS8B 1NX3A 1A2XA 3PATA 4TNCA 2AAOA 2QEHA 2R2IA 1R2UA 2E6WA 4GBAA 3FWCA 1K94A 1G8IA 5PALA 1IJ5A 2LCPA 1BT6A 1M45A 3PN7B 4ORAB 3TDIA 1CFDA 1KQVA 1SY9A 1UHHA 5CPVA 1S5GY 1SPYA 5GQQC 2JT3A 5KU1A 3HCMA 2M3WA 3DZTA 4QJ4B 3BJHA 2WCHA 1CB1A 1GGWA 1QS7A 2LHLA 4NQGA 2KPHA 2MJWB 1DMOA 3PALA 3O2PA 2AMIA 2Y1NA 1DELA 2QEOA 3FIAA 1P28A 4MZKA 1J7OA 2KBMA 3D0YA 2PALA 2ERBA 5KSZA 5HLVA 4I5JA 3EK4A 1BMOA 2WC6A 3R1VA 3FE9A 2VRGA 2IS9A 3DVMA 3PLFB 3SG5A 5D7FA 5I2OA 1MF8B 3JTDB 1QX2A 1S3PA 1YX7A 3LK0A 1K9KA 1UUSA 4PHJA 1SMGA 4AQIA 2NZ0A 3S0DA 5DKNA 2FJUB 2BL0B 1AK8A 2M0RA 1K95A 3NHTA 4UPGA 1C7WA 3DVKA 1IQ5A 1DJXA 1OOIX 3CS1A 1XFWO 3CZTX 1S36A 1KK8C 1RK9A 1FW4A 2MAZA 3DVJA 2LP3A 2COLB 3OB1B 2LE9B 1OMRA 2CXJA 4IL1A 1LINA 2M1KB 3BUWB 3FS7A 1CM1A 2JC2A 4QJ3B 1UHIA 3DD4A 4BY5A 1H8BA 1JWDA 1U5IB 2Y5IA 3SS4A 3V2LA 3IQOA 1NCYA 5FYXA 5AEQA 4CIDA 2CBLA 2H61A 3D10A 2LMVA 2QACA 4WQ3A 1WDCC 1F71A 1ZFSA 1PSRA 2EC6B 1QATA 2G2BA 4YI8A 2KOTA 1AJ4A 3CDNA 3DF0B 2HF5A 3WHTB 5HYDA 1BJFA 1G4YR 4XYNA 5G08A 3IF7A 2KI6D 5I8NA 1GM0A 2L98A 1L7ZA 4YGDB 1DEKA 3GK2A 4GFTA 1A4PA 1ZACA 1NSHA 4NDBA 3VRNA 1NYAA 1IGVA 2M9GA 3EVUA 1BODA 4GNKB 4N1GA 2BCBA 3NSLA 1QTXA 4GAOA 4QJ5B 1K2HA 3AAJA 1DTLA 1QX7A 1WRLA 1OOJA 4MZLA 2KAXA 1PULA 2BNXA 3S0EA 2F3YA 5CSNA 1Y1XA 4OVNF 2I7AA 3B86A 5FI6A 1TWOA 2K7BA 1A75B 1N2DA 2JT8A 1OZSA 1MXEA 3CLNA 3DF0A 4HRHA 1UP5A 2AUCA 2G9BA 1Y1UA 2I2RE 2F2OA 3BFHA 5ER5A 2F3ZA 3VRPA 3SS3A 1SCMC 1JBAA 1J7QA 1GJYA 1SW8A 1KFUS 1SKTA 1B4CA 1QIVA 1M63B 1SL9A 1S6CA 4C0LA 3WNXB 1RECA 3A8RA 3WHUB 1NUBA 3SIBA 4WQ2A 1KK7Y 3I5GC 1NIWA 1Y1AA 1CTRA 3UNWA 1CFPA 3CTNA 1S1EA 1B7TY 1FBVA 2KSPA 5IBWA 4YRUA 4MN0A 1S6IA 5I2QA 1AP4A 3Q8IA 1OOHA 2JXCA 2SCPA 5DKRA 2PQLA 3I5FB 3JVTB 3SIAA 2ZFDA 5I94A 1CMGA 4FQTA 3D76A 4L9MA 1CDPA 2JNXA 4PT1A 2WCEA 3SG4A 1KQMC 1KK8B 2OTGB 2LUXA 4KYNA 2WCFA 3D0YB 1C07A 1FI6A 1K90D 1GQMA 1S6JA 3DVEA 4ORCB 2KI4B 1KSMA 3B7AA 1KWOB 2LLTA 4YGEB 2EGDA 4HRGA 1BR1B 1KQMB 2JZIA 2OTGC 3N7HA 4MRYA 1LXFC 2F8PA 1ZMZA 3TUYB 1Y0VH 3D74A 1V1GA 4CLNA 2K7OA 1XFUO 2MBXA 1K96A 1TNPA 3SG7A 1DJIA 2YGUA 1F54A 3BUOB 3FWBA 4I5KA 4CFRA 1ORGA 1BU3A 1KFXL 2KGBC 5AANA 3BOWB 1YR5A 3AKAA 2KAYA 1DJWA 1OOGA 2BL0C 2FJYA 1DT7B 2Y1MA 1DC1A 3D78A 1PVAA 1HT9A 3RLZA 1CFFA 1XFYO 1B9AA 1DJGA 1LA0A 2V53A 3OX6A 1QIWA 2GGMA 2K2AA 3KF9A 1QX5B 1QWVA 2KAVA 1YX8A 1CLBA 1LS8A 3PM8A 4JKTA 4MSPA 2P6BB 4M2QA 2MLEC 3L47A 1DGVA 1TN4A 1TUJA 3ICBA 3IQQA 3EKJA 1BLQA 1E8AA 4FQOA 4USLA 4GGFA 5JOLA 2NXQA 1NX1A 3OX5A 3VB1A 3BUNB 1LA3A 1IG5A 3CZ0A 3VRRA 2GGZA 2WCJA 5DICA 1J7RA 1CMFA 2JRFA 1UHNA 3L4LA 3SS5A 2ZRSA 1JC2A 1XFZO 1BR4B 2NCOA 1QVIZ 3SJSA 2L4HA
chains in the Genus database with same CATH topology
4I5LB 3BXKA 1WRKA 3WXAA 2WC8A 1L2OC 1MR8A 2LMTA 2L2EA 2WOSA 1UWOA 1TNQA 2Q91A 1JUOA 1R6PA 1JSAA 3ZNIA 1VRKA 1XO5A 2KBIA 5CSJA 3I5GB 1DGUA 1XK4C 1JF0A 3TS5C 2ISDA 3EKHA 1CNPA 3NSKA 2BBNA 2JPTA 1CFCA 1YVHA 4PDZA 1S26D 1XFXO 2JQ6A 2KYFA 2LVJA 2L4IA 2OPOA 4D1EA 1C7VA 5AERA 2LC5A 2LHIA 4DCKA 4DUQA 2LM5A 2M97A 2K7DA 4FTGA 4BY4A 4MLWA 4JWQA 1IWQA 1ALWA 1NWDA 4ETOA 1MUXA 2KFGA 1PSBA 1YUUA 1KFUL 1M39A 2H61C 2KI6C 5ER4X 2PSRA 4PALA 1DF0B 1CDLA 2I18A 1JFKA 1KSOA 4CPVA 1GGZA 2KNEA 3AAKA 1W7IB 3TUYC 2L51A 1EG4A 4ORBB 4DS7A 1D1OA 2K7CA 1CKKA 5J3XA 2BCAA 2K8MB 2LVIA 3I5IC 5D69A 1YVLA 4PHNA 3TZ1A 1F8HA 2JTZA 1Q80A 1SBJA 4HREE 1NX0A 2PASA 1WY9A 2BCXA 4U8DA 3ZWHA 2PRUA 4C0JA 2I94A 1OMVA 1QV1A 4ZCUA 2RGIA 1YRTB 3VRQA 2B1UA 2L5XB 1UHJA 2KDHA 3BUMB 3CGAA 3KPXA 1YTZC 3LCPC 2K61A 5HKZA 3SG2A 1LVCD 3TDZA 4MRXA 4ZCVA 5TNCA 1F4QA 4P5OE 1AHRA 2GV5A 2SASA 5DKQA 2M7NA 2KHNA 1TRFA 1WRZA 2OS8C 1PRWA 3A4UB 1NCZA 2F2PA 2HPSA 3EVVA 2JU0A 2CNPA 1L2OB 3OP0A 1QVIY 1WLMA 3LL8B 2KFHA 1RJVA 1SR6B 2WCBA 4MZJA 5CSIA 3VGOA 1FI5A 1EG3A 1OZOA 4NDDA 3GOFA 2D8NA 2JWWA 3SG6A 4GGNA 2EHBA 2K0JA 2LANA 1A29A 1UURA 2NLNA 1NX2A 1NPQA 2KFFA 1DJYA 5CSFA 2M7LA 4F0ZB 2M1UA 3PSRA 1N0YA 1PK0D 1RFJA 2DOQA 1DJHA 1MHOA 2O5GA 2LVKA 4I5NB 1BG1A 4YGAA 2KI4C 1WDCB 3I5FC 4DIRA 3TDUA 1OE9B 1KWOC 2JTTA 1MWNA 2O60A 3AKBA 1B8CA 1CM4A 3E3RA 1J1EA 1QLSA 1B8LA 2KQYA 2TN4A 4ICBA 3MSEB 1YUSA 1M46A 1SL7A 5HKYA 1IKUA 1F4OA 4JPZB 4A4BA 4P2YB 2A4JA 3CR5X 1FPWA 1TCFA 3BOWA 4PHMA 1CLMA 1MQ1A 3RM1A 1A03A 1SK6D 2ZKMX 4NDCA 1B8RA 1MXLC 1SRAA 4PE1A 3QRXA 3EK7A 2M8UA 1TTXA 4M2PA 1IJ6A 1XYDA 2LP2A 2FOTA 1K9PA 1QXPA 1IQ3A 1TNXA 4E68A 1J1DA 1X02A 2ZRTA 1QLKA 5HKWA 3O6BA 4DRWA 3LK1A 1EXRA 1Y6WA 3CR4X 2CT9A 2L0PA 3KHEA 2LLSA 1B7TZ 5F6TA 1DF0A 4PHKA 1IH0A 2BBMA 1KK7Z 2LAPA 2JOJA 1EL4A 1TCOB 4XJKA 4CFQA 1XFVO 2CCMA 2KQ6A 1KFXS 1SCMB 4GUKA 1A75A 2JULA 2MHHA 3PN7C 4N1FA 3I5HB 4PCWA 1YUTA 2MLFC 4YGCB 4PE4A 3HX4A 5AXIA 3JVTC 2ZN8A 2JT0A 1ZOTB 1EH2A 3EVRA 4XJKB 1BOCA 1K93D 1QASA 1DJZA 3GK1A 1XA5A 1SL8A 2M29A 3I5HC 1PVBA 3NSIA 1XK4A 1ALVA 2LNKA 2MA2A 5BPJA 3O4YA 1ODBA 2BE4A 4YGBB 1KCYA 2ZNEA 1LKJA 4YBHB 4N5XA 3BYAA 1B47A 1SR6C 2WORA 3EK8A 3CR2A 1OSAA 3TS5B 2WNDA 4WRIA 1RROA 1EJ3A 2BECA 2JXLA 2CTNA 4PE7A 3NSOA 1AJ5A 2K2FA 1DVIA 1SYMA 2KGRA 2M49B 1JFJA 1G33A 3NXAA 1M31A 2KYCA 1WLZA 2BE6A 1RTP1 4YI9A 3OHMB 1N65A 1H4BA 3C1VA 1SCVA 1F70A 1NCXA 1TOPA 2Y4QA 1SNLA 3JTDC 1FF1A 3M0WA 1ZUZA 4MVFA 5AFPA 5K89A 1F55A 2LV7A 3VROA 4OR9B 1S5GZ 1PALA 1CDNA 4C0KA 4PE0A 4AQJA 1OMDA 5B8IB 1NP8A 4A4CA 1AVSA 4AOMA 5KTYA 2H2KA 1AUIB 5JJGA 2PVBA 4OV2A 4MEWA 2QPTA 3F45A 3PFVA 4HSZA 3KO0A 3H4SE 1QJTA 2FCDA 2HETA 1W7JB 2HQWA 2ZN9A 2LLUA 1IRJA 2EC6C 3K21A 1YURA 3OB2B 1JF2A 5I2LA 4M2OA 1RWYA 2MRDA 2PMYA 3LLEA 1J55A 1XVJA 2FCEA 3O78A 4MBEA 4R1EA 1TNWA 5HLOA 3GK4X 3CWGA 1K9UA 2NCPA 1V1FA 1OQPA 1UHKA 1J7PA 1YRUB 2JNFA 4JQ0D 1QV0A 2E30A 4OCIA 1K8UA 2F33A 2LVVA 3I5IB 3KEVA 2Q4UA 1CDMA 3BUXB 2BKHB 3SG3A 1U5IA 2LUCA 2HQ8A 1BF5A 1CLLA 4OKHA 3BQ3A 4Q04A 1HQVA 2L50A 2ZNDA 4GGFC 1B1GA 2LMUA 4GPLB 1TIZA 2BKIB 2OS8B 1NX3A 1A2XA 3PATA 4TNCA 2AAOA 2R2IA 1R2UA 2E6WA 4GBAA 3FWCA 1K94A 1G8IA 5PALA 1IJ5A 2LCPA 1BT6A 1M45A 3PN7B 4ORAB 3TDIA 1CFDA 1KQVA 1SY9A 1UHHA 5CPVA 1S5GY 1SPYA 5GQQC 2JT3A 5KU1A 3HCMA 2M3WA 4QJ4B 1CB1A 1GGWA 1QS7A 2LHLA 4NQGA 2MJWB 1DMOA 3PALA 3O2PA 2AMIA 2Y1NA 3FIAA 4MZKA 1J7OA 2KBMA 3D0YA 2PALA 5KSZA 5HLVA 4I5JA 3EK4A 1BMOA 2VRGA 2IS9A 3DVMA 3PLFB 3SG5A 5D7FA 5I2OA 1MF8B 3JTDB 1QX2A 1S3PA 1YX7A 3LK0A 1K9KA 1UUSA 4PHJA 1SMGA 4AQIA 2NZ0A 5DKNA 2FJUB 2BL0B 1AK8A 2M0RA 1K95A 4UPGA 1C7WA 3DVKA 1IQ5A 1DJXA 3CS1A 1XFWO 3CZTX 1S36A 1KK8C 1RK9A 1FW4A 2MAZA 3DVJA 2LP3A 2COLB 3OB1B 2LE9B 1OMRA 2CXJA 4IL1A 1LINA 2M1KB 3BUWB 3FS7A 1CM1A 2JC2A 4QJ3B 1UHIA 3DD4A 4BY5A 1H8BA 1JWDA 1U5IB 2Y5IA 3IQOA 1NCYA 5FYXA 5AEQA 4CIDA 2CBLA 2H61A 3D10A 2LMVA 2QACA 4WQ3A 1WDCC 1F71A 1ZFSA 1PSRA 2EC6B 1QATA 2G2BA 4YI8A 2KOTA 1AJ4A 3DF0B 2HF5A 3WHTB 5HYDA 1BJFA 1G4YR 4XYNA 5G08A 3IF7A 2KI6D 5I8NA 2L98A 1L7ZA 4YGDB 4GFTA 3GK2A 1A4PA 1ZACA 1NSHA 4NDBA 3VRNA 1NYAA 1IGVA 2M9GA 3EVUA 1BODA 4GNKB 4N1GA 2BCBA 3NSLA 1QTXA 4GAOA 4QJ5B 1K2HA 3AAJA 1DTLA 1QX7A 1WRLA 1OOJA 4MZLA 2KAXA 1PULA 2F3YA 5CSNA 1Y1XA 4OVNF 2I7AA 2K7BA 1A75B 1N2DA 2JT8A 1OZSA 1MXEA 3CLNA 3DF0A 4HRHA 1UP5A 2AUCA 2G9BA 1Y1UA 2I2RE 2F2OA 5ER5A 2F3ZA 3VRPA 1SCMC 1JBAA 1J7QA 1GJYA 1SW8A 1KFUS 1SKTA 1B4CA 1QIVA 1M63B 1SL9A 1S6CA 4C0LA 3WNXB 1RECA 3A8RA 3WHUB 1NUBA 3SIBA 4WQ2A 1KK7Y 3I5GC 1NIWA 1Y1AA 1CTRA 1CFPA 3CTNA 1S1EA 1B7TY 1FBVA 2KSPA 5IBWA 4YRUA 4MN0A 1S6IA 5I2QA 1AP4A 2JXCA 2SCPA 5DKRA 3I5FB 3JVTB 3SIAA 2ZFDA 1CMGA 4L9MA 1CDPA 2JNXA 2WCEA 3SG4A 1KQMC 1KK8B 2OTGB 2LUXA 1C07A 2WCFA 3D0YB 1FI6A 1K90D 1GQMA 1S6JA 3DVEA 4ORCB 2KI4B 1KSMA 1KWOB 2LLTA 4YGEB 2EGDA 4HRGA 1BR1B 1KQMB 2JZIA 2OTGC 4MRYA 1LXFC 2F8PA 1ZMZA 3TUYB 1Y0VH 1V1GA 4CLNA 2K7OA 1XFUO 2MBXA 1K96A 1TNPA 3SG7A 1DJIA 1F54A 3BUOB 3FWBA 4I5KA 4CFRA 1BU3A 1KFXL 2KGBC 5AANA 3BOWB 1YR5A 3AKAA 2KAYA 1DJWA 2BL0C 1DT7B 2Y1MA 1PVAA 1HT9A 3RLZA 1CFFA 1XFYO 1B9AA 1DJGA 1LA0A 2V53A 3OX6A 1QIWA 2GGMA 2K2AA 3KF9A 1QX5B 2KAVA 1YX8A 1CLBA 3PM8A 4MSPA 2P6BB 4M2QA 2MLEC 1DGVA 1TN4A 3IQQA 3ICBA 3EKJA 1BLQA 1E8AA 4FQOA 4USLA 4GGFA 5JOLA 2NXQA 1NX1A 3OX5A 3BUNB 1LA3A 1IG5A 3VRRA 2GGZA 1J7RA 1CMFA 2JRFA 1UHNA 2ZRSA 1JC2A 1XFZO 1BR4B 2NCOA 1QVIZ 3SJSA 2L4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5L B;  3BXK A;  1WRK A;  3WXA A;  2WC8 A;  1L2O C;  1MR8 A;  2LMT A;  2L2E A;  2WOS A;  1UWO A;  1TNQ A;  2Q91 A;  1JUO A;  1R6P A;  1JSA A;  3ZNI A;  1VRK A;  1XO5 A;  2KBI A;  5CSJ A;  3I5G B;  1DGU A;  1XK4 C;  1JF0 A;  3TS5 C;  2ISD A;  3EKH A;  1CNP A;  3NSK A;  2BBN A;  2JPT A;  1CFC A;  1YVH A;  4PDZ A;  1S26 D;  1XFX O;  2JQ6 A;  2KYF A;  2LVJ A;  2L4I A;  2OPO A;  4D1E A;  1C7V A;  5AER A;  2LC5 A;  2LHI A;  4DCK A;  4DUQ A;  2LM5 A;  2M97 A;  2K7D A;  4FTG A;  4BY4 A;  4MLW A;  4JWQ A;  1IWQ A;  1ALW A;  1NWD A;  4ETO A;  1MUX A;  2KFG A;  1PSB A;  1YUU A;  1KFU L;  1M39 A;  2H61 C;  2KI6 C;  5ER4 X;  2PSR A;  4PAL A;  1DF0 B;  1CDL A;  2I18 A;  1JFK A;  1KSO A;  4CPV A;  1GGZ A;  2KNE A;  3AAK A;  1W7I B;  3TUY C;  2L51 A;  1EG4 A;  4ORB B;  4DS7 A;  1D1O A;  2K7C A;  1CKK A;  5J3X A;  2BCA A;  2K8M B;  2LVI A;  3I5I C;  5D69 A;  1YVL A;  4PHN A;  3TZ1 A;  1F8H A;  2JTZ A;  1Q80 A;  1SBJ A;  4HRE E;  1NX0 A;  2PAS A;  1WY9 A;  2BCX A;  4U8D A;  3ZWH A;  2PRU A;  4C0J A;  2I94 A;  1OMV A;  1QV1 A;  4ZCU A;  2RGI A;  1YRT B;  3VRQ A;  2B1U A;  2L5X B;  1UHJ A;  2KDH A;  3BUM B;  3CGA A;  3KPX A;  1YTZ C;  3LCP C;  2K61 A;  5HKZ A;  3SG2 A;  1LVC D;  3TDZ A;  4MRX A;  4ZCV A;  5TNC A;  1F4Q A;  4P5O E;  1AHR A;  2GV5 A;  2SAS A;  5DKQ A;  2M7N A;  2KHN A;  1TRF A;  1WRZ A;  2OS8 C;  1PRW A;  3A4U B;  1NCZ A;  2F2P A;  2HPS A;  3EVV A;  2JU0 A;  2CNP A;  1L2O B;  3OP0 A;  1QVI Y;  1WLM A;  3LL8 B;  2KFH A;  1RJV A;  1SR6 B;  2WCB A;  4MZJ A;  5CSI A;  3VGO A;  1FI5 A;  1EG3 A;  1OZO A;  4NDD A;  3GOF A;  2D8N A;  2JWW A;  3SG6 A;  4GGN A;  2EHB A;  2K0J A;  2LAN A;  1A29 A;  1UUR A;  2NLN A;  1NX2 A;  1NPQ A;  2KFF A;  1DJY A;  5CSF A;  2M7L A;  4F0Z B;  2M1U A;  3PSR A;  1N0Y A;  1PK0 D;  1RFJ A;  2DOQ A;  1DJH A;  1MHO A;  2O5G A;  2LVK A;  4I5N B;  1BG1 A;  4YGA A;  2KI4 C;  1WDC B;  3I5F C;  4DIR A;  3TDU A;  1OE9 B;  1KWO C;  2JTT A;  1MWN A;  2O60 A;  3AKB A;  1B8C A;  1CM4 A;  3E3R A;  1J1E A;  1QLS A;  1B8L A;  2KQY A;  2TN4 A;  4ICB A;  3MSE B;  1YUS A;  1M46 A;  1SL7 A;  5HKY A;  1IKU A;  1F4O A;  4JPZ B;  4A4B A;  4P2Y B;  2A4J A;  3CR5 X;  1FPW A;  1TCF A;  3BOW A;  4PHM A;  1CLM A;  1MQ1 A;  3RM1 A;  1A03 A;  1SK6 D;  2ZKM X;  4NDC A;  1B8R A;  1MXL C;  1SRA A;  4PE1 A;  3QRX A;  3EK7 A;  2M8U A;  1TTX A;  4M2P A;  1IJ6 A;  1XYD A;  2LP2 A;  2FOT A;  1K9P A;  1QXP A;  1IQ3 A;  1TNX A;  4E68 A;  1J1D A;  1X02 A;  2ZRT A;  1QLK A;  5HKW A;  3O6B A;  4DRW A;  3LK1 A;  1EXR A;  1Y6W A;  3CR4 X;  2CT9 A;  2L0P A;  3KHE A;  2LLS A;  1B7T Z;  5F6T A;  1DF0 A;  4PHK A;  1IH0 A;  2BBM A;  1KK7 Z;  2LAP A;  2JOJ A;  1EL4 A;  1TCO B;  4XJK A;  4CFQ A;  1XFV O;  2CCM A;  2KQ6 A;  1KFX S;  1SCM B;  4GUK A;  1A75 A;  2JUL A;  2MHH A;  3PN7 C;  4N1F A;  3I5H B;  4PCW A;  1YUT A;  2MLF C;  4YGC B;  4PE4 A;  3HX4 A;  5AXI A;  3JVT C;  2ZN8 A;  2JT0 A;  1ZOT B;  1EH2 A;  3EVR A;  4XJK B;  1BOC A;  1K93 D;  1QAS A;  1DJZ A;  3GK1 A;  1XA5 A;  1SL8 A;  2M29 A;  3I5H C;  1PVB A;  3NSI A;  1XK4 A;  1ALV A;  2LNK A;  2MA2 A;  5BPJ A;  3O4Y A;  1ODB A;  2BE4 A;  4YGB B;  1KCY A;  2ZNE A;  1LKJ A;  4YBH B;  4N5X A;  3BYA A;  1B47 A;  1SR6 C;  2WOR A;  3EK8 A;  3CR2 A;  1OSA A;  3TS5 B;  2WND A;  4WRI A;  1RRO A;  1EJ3 A;  2BEC A;  2JXL A;  2CTN A;  4PE7 A;  3NSO A;  1AJ5 A;  2K2F A;  1DVI A;  1SYM A;  2KGR A;  2M49 B;  1JFJ A;  1G33 A;  3NXA A;  1M31 A;  2KYC A;  1WLZ A;  2BE6 A;  1RTP 1;  4YI9 A;  3OHM B;  1N65 A;  1H4B A;  3C1V A;  1SCV A;  1F70 A;  1NCX A;  1TOP A;  2Y4Q A;  1SNL A;  3JTD C;  1FF1 A;  3M0W A;  1ZUZ A;  4MVF A;  5AFP A;  5K89 A;  1F55 A;  2LV7 A;  3VRO A;  4OR9 B;  1S5G Z;  1PAL A;  1CDN A;  4C0K A;  4PE0 A;  4AQJ A;  1OMD A;  5B8I B;  1NP8 A;  4A4C A;  1AVS A;  4AOM A;  5KTY A;  2H2K A;  1AUI B;  5JJG A;  2PVB A;  4OV2 A;  4MEW A;  2QPT A;  3F45 A;  3PFV A;  4HSZ A;  3KO0 A;  3H4S E;  1QJT A;  2FCD A;  2HET A;  1W7J B;  2HQW A;  2ZN9 A;  2LLU A;  1IRJ A;  2EC6 C;  3K21 A;  1YUR A;  3OB2 B;  1JF2 A;  5I2L A;  4M2O A;  1RWY A;  2MRD A;  2PMY A;  3LLE A;  1J55 A;  1XVJ A;  2FCE A;  3O78 A;  4MBE A;  4R1E A;  1TNW A;  5HLO A;  3GK4 X;  3CWG A;  1K9U A;  2NCP A;  1V1F A;  1OQP A;  1UHK A;  1J7P A;  1YRU B;  2JNF A;  4JQ0 D;  1QV0 A;  2E30 A;  4OCI A;  1K8U A;  2F33 A;  2LVV A;  3I5I B;  3KEV A;  2Q4U A;  1CDM A;  3BUX B;  2BKH B;  3SG3 A;  1U5I A;  2LUC A;  2HQ8 A;  1BF5 A;  1CLL A;  4OKH A;  3BQ3 A;  4Q04 A;  1HQV A;  2L50 A;  2ZND A;  4GGF C;  1B1G A;  2LMU A;  4GPL B;  1TIZ A;  2BKI B;  2OS8 B;  1NX3 A;  1A2X A;  3PAT A;  4TNC A;  2AAO A;  2R2I A;  1R2U A;  2E6W A;  4GBA A;  3FWC A;  1K94 A;  1G8I A;  5PAL A;  1IJ5 A;  2LCP A;  1BT6 A;  1M45 A;  3PN7 B;  4ORA B;  3TDI A;  1CFD A;  1KQV A;  1SY9 A;  1UHH A;  5CPV A;  1S5G Y;  1SPY A;  5GQQ C;  2JT3 A;  5KU1 A;  3HCM A;  2M3W A;  4QJ4 B;  1CB1 A;  1GGW A;  1QS7 A;  2LHL A;  4NQG A;  2MJW B;  1DMO A;  3PAL A;  3O2P A;  2AMI A;  2Y1N A;  3FIA A;  4MZK A;  1J7O A;  2KBM A;  3D0Y A;  2PAL A;  5KSZ A;  5HLV A;  4I5J A;  3EK4 A;  1BMO A;  2VRG A;  2IS9 A;  3DVM A;  3PLF B;  3SG5 A;  5D7F A;  5I2O A;  1MF8 B;  3JTD B;  1QX2 A;  1S3P A;  1YX7 A;  3LK0 A;  1K9K A;  1UUS A;  4PHJ A;  1SMG A;  4AQI A;  2NZ0 A;  5DKN A;  2FJU B;  2BL0 B;  1AK8 A;  2M0R A;  1K95 A;  4UPG A;  1C7W A;  3DVK A;  1IQ5 A;  1DJX A;  3CS1 A;  1XFW O;  3CZT X;  1S36 A;  1KK8 C;  1RK9 A;  1FW4 A;  2MAZ A;  3DVJ A;  2LP3 A;  2COL B;  3OB1 B;  2LE9 B;  1OMR A;  2CXJ A;  4IL1 A;  1LIN A;  2M1K B;  3BUW B;  3FS7 A;  1CM1 A;  2JC2 A;  4QJ3 B;  1UHI A;  3DD4 A;  4BY5 A;  1H8B A;  1JWD A;  1U5I B;  2Y5I A;  3IQO A;  1NCY A;  5FYX A;  5AEQ A;  4CID A;  2CBL A;  2H61 A;  3D10 A;  2LMV A;  2QAC A;  4WQ3 A;  1WDC C;  1F71 A;  1ZFS A;  1PSR A;  2EC6 B;  1QAT A;  2G2B A;  4YI8 A;  2KOT A;  1AJ4 A;  3DF0 B;  2HF5 A;  3WHT B;  5HYD A;  1BJF A;  1G4Y R;  4XYN A;  5G08 A;  3IF7 A;  2KI6 D;  5I8N A;  2L98 A;  1L7Z A;  4YGD B;  4GFT A;  3GK2 A;  1A4P A;  1ZAC A;  1NSH A;  4NDB A;  3VRN A;  1NYA A;  1IGV A;  2M9G A;  3EVU A;  1BOD A;  4GNK B;  4N1G A;  2BCB A;  3NSL A;  1QTX A;  4GAO A;  4QJ5 B;  1K2H A;  3AAJ A;  1DTL A;  1QX7 A;  1WRL A;  1OOJ A;  4MZL A;  2KAX A;  1PUL A;  2F3Y A;  5CSN A;  1Y1X A;  4OVN F;  2I7A A;  2K7B A;  1A75 B;  1N2D A;  2JT8 A;  1OZS A;  1MXE A;  3CLN A;  3DF0 A;  4HRH A;  1UP5 A;  2AUC A;  2G9B A;  1Y1U A;  2I2R E;  2F2O A;  5ER5 A;  2F3Z A;  3VRP A;  1SCM C;  1JBA A;  1J7Q A;  1GJY A;  1SW8 A;  1KFU S;  1SKT A;  1B4C A;  1QIV A;  1M63 B;  1SL9 A;  1S6C A;  4C0L A;  3WNX B;  1REC A;  3A8R A;  3WHU B;  1NUB A;  3SIB A;  4WQ2 A;  1KK7 Y;  3I5G C;  1NIW A;  1Y1A A;  1CTR A;  1CFP A;  3CTN A;  1S1E A;  1B7T Y;  1FBV A;  2KSP A;  5IBW A;  4YRU A;  4MN0 A;  1S6I A;  5I2Q A;  1AP4 A;  2JXC A;  2SCP A;  5DKR A;  3I5F B;  3JVT B;  3SIA A;  2ZFD A;  1CMG A;  4L9M A;  1CDP A;  2JNX A;  2WCE A;  3SG4 A;  1KQM C;  1KK8 B;  2OTG B;  2LUX A;  1C07 A;  2WCF A;  3D0Y B;  1FI6 A;  1K90 D;  1GQM A;  1S6J A;  3DVE A;  4ORC B;  2KI4 B;  1KSM A;  1KWO B;  2LLT A;  4YGE B;  2EGD A;  4HRG A;  1BR1 B;  1KQM B;  2JZI A;  2OTG C;  4MRY A;  1LXF C;  2F8P A;  1ZMZ A;  3TUY B;  1Y0V H;  1V1G A;  4CLN A;  2K7O A;  1XFU O;  2MBX A;  1K96 A;  1TNP A;  3SG7 A;  1DJI A;  1F54 A;  3BUO B;  3FWB A;  4I5K A;  4CFR A;  1BU3 A;  1KFX L;  2KGB C;  5AAN A;  3BOW B;  1YR5 A;  3AKA A;  2KAY A;  1DJW A;  2BL0 C;  1DT7 B;  2Y1M A;  1PVA A;  1HT9 A;  3RLZ A;  1CFF A;  1XFY O;  1B9A A;  1DJG A;  1LA0 A;  2V53 A;  3OX6 A;  1QIW A;  2GGM A;  2K2A A;  3KF9 A;  1QX5 B;  2KAV A;  1YX8 A;  1CLB A;  3PM8 A;  4MSP A;  2P6B B;  4M2Q A;  2MLE C;  1DGV A;  1TN4 A;  3IQQ A;  3ICB A;  3EKJ A;  1BLQ A;  1E8A A;  4FQO A;  4USL A;  4GGF A;  5JOL A;  2NXQ A;  1NX1 A;  3OX5 A;  3BUN B;  1LA3 A;  1IG5 A;  3VRR A;  2GGZ A;  1J7R A;  1CMF A;  2JRF A;  1UHN A;  2ZRS A;  1JC2 A;  1XFZ O;  1BR4 B;  2NCO A;  1QVI Z;  3SJS A;  2L4H A; 
#chains in the Genus database with same CATH topology
 4I5L B;  1Z4H A;  3BXK A;  1WRK A;  3WXA A;  1OOF A;  2WC8 A;  1L2O C;  1MR8 A;  2LMT A;  2L2E A;  2WOS A;  1UWO A;  1TNQ A;  2Q91 A;  1JUO A;  1R6P A;  1JSA A;  3ZNI A;  1VRK A;  1XO5 A;  2KBI A;  3CYZ A;  5CSJ A;  3I5G B;  1DGU A;  1XK4 C;  1JF0 A;  3TS5 C;  3D77 A;  3NHI A;  2ISD A;  3EKH A;  3R1O A;  3NSK A;  1CNP A;  1W9Z A;  3EG5 B;  3OBV A;  2BBN A;  2L2C A;  2QEB A;  2JPT A;  1CFC A;  1YVH A;  4PDZ A;  1S26 D;  1XFX O;  2JQ6 A;  2KYF A;  2LVJ A;  2L4I A;  2OPO A;  4D1E A;  1C7V A;  5AER A;  2LC5 A;  2LHI A;  4DCK A;  4DUQ A;  2LM5 A;  2M97 A;  2K7D A;  4FTG A;  4BY4 A;  4MLW A;  2P70 A;  4JWQ A;  1IWQ A;  1ALW A;  1DQE A;  1NWD A;  3DY9 A;  4ETO A;  1MUX A;  2WC5 A;  2KFG A;  1PSB A;  1YUU A;  1KFU L;  2P71 A;  1M39 A;  2H61 C;  2KI6 C;  5ER4 X;  2PSR A;  4PAL A;  3UO9 A;  1DF0 B;  1CDL A;  2I18 A;  1JFK A;  1KSO A;  4CPV A;  1GGZ A;  2KNE A;  3S0F A;  3AAK A;  1W7I B;  3TUY C;  2L51 A;  1EG4 A;  4ORB B;  4DS7 A;  3BFB A;  1D1O A;  2K7C A;  1CKK A;  5J3X A;  3PM2 A;  4IJ7 A;  1XFR A;  2BCA A;  2K8M B;  2LVI A;  3I5I C;  5D69 A;  1YVL A;  3R72 A;  4PHN A;  3TZ1 A;  1F8H A;  2JTZ A;  1Q80 A;  1SBJ A;  4HRE E;  1NX0 A;  2PAS A;  1WY9 A;  2BCX A;  3D73 A;  4U8D A;  3ZWH A;  2PRU A;  4C0J A;  2I94 A;  1OMV A;  1QV1 A;  5D3O A;  4ZCU A;  2RGI A;  1YRT B;  3VRQ A;  2B1U A;  2L5X B;  3DXL A;  1UHJ A;  2KDH A;  3BUM B;  3CGA A;  3KPX A;  1YTZ C;  3LCP C;  2K61 A;  5HKZ A;  3SG2 A;  1LVC D;  3TDZ A;  4MRX A;  4ZCV A;  5TNC A;  1F4Q A;  4P5O E;  1AHR A;  2GV5 A;  2SAS A;  5DKQ A;  2M7N A;  2KHN A;  1TRF A;  1OW4 A;  1WRZ A;  2OS8 C;  1PRW A;  3A4U B;  1NCZ A;  2F2P A;  2HPS A;  3EVV A;  2JU0 A;  1C3Z A;  2CNP A;  5FI2 A;  2WCK A;  1L2O B;  3OP0 A;  1QVI Y;  3RZS A;  1WLM A;  3LL8 B;  2KFH A;  1RJV A;  1SR6 B;  2WCB A;  4MZJ A;  5CSI A;  3VGO A;  1FI5 A;  1EG3 A;  1OZO A;  4NDD A;  3GOF A;  2D8N A;  2JWW A;  3SG6 A;  4GGN A;  2EHB A;  2K0J A;  2LAN A;  1A29 A;  1UUR A;  2BAP A;  4INX A;  2NLN A;  1NX2 A;  1NPQ A;  2KFF A;  1DJY A;  4JD9 A;  5CSF A;  2M7L A;  4F0Z B;  2M1U A;  3PSR A;  1N0Y A;  1PK0 D;  1RFJ A;  2DOQ A;  1DJH A;  1MHO A;  2O5G A;  2LVK A;  3CZ2 A;  3S0A A;  4I5N B;  1BG1 A;  4YGA A;  2KI4 C;  1WDC B;  3I5F C;  4DIR A;  3TDU A;  1OE9 B;  1KWO C;  2JTT A;  1MWN A;  2O60 A;  3AKB A;  1B8C A;  1CM4 A;  3E3R A;  1J1E A;  1QLS A;  1B8L A;  2KQY A;  4F7F A;  2TN4 A;  4ICB A;  3MSE B;  1YUS A;  1M46 A;  1SL7 A;  5HL1 A;  5HKY A;  3B87 A;  1IKU A;  1F4O A;  4JPZ B;  4A4B A;  4P2Y B;  2A4J A;  3CR5 X;  1FPW A;  1TCF A;  3BOW A;  4PHM A;  1CLM A;  1MQ1 A;  3RM1 A;  3S0G A;  1SK6 D;  1A03 A;  3IVT A;  2ZKM X;  4NDC A;  1C3Y A;  1B8R A;  1MXL C;  1SRA A;  4PE1 A;  3QRX A;  3EK7 A;  2M8U A;  1TTX A;  4M2P A;  1IJ6 A;  1XYD A;  2LP2 A;  2FOT A;  1K9P A;  3PJI A;  1QXP A;  1IQ3 A;  1TNX A;  4E68 A;  1J1D A;  1X02 A;  2ZRT A;  1QLK A;  5HKW A;  3O6B A;  4DRW A;  2JPO A;  1EXR A;  1Y6W A;  3LK1 A;  4INW A;  3CR4 X;  2PYQ A;  2CT9 A;  2L0P A;  3KHE A;  2LLS A;  1B7T Z;  3B88 A;  2KLD A;  5F6T A;  1DF0 A;  4PHK A;  1IH0 A;  2BBM A;  1KK7 Z;  2LAP A;  2JOJ A;  1EL4 A;  1TCO B;  4XJK A;  4CFQ A;  1XFV O;  2CCM A;  2KQ6 A;  1KFX S;  1SCM B;  4GUK A;  1A75 A;  2JUL A;  2MHH A;  2K60 A;  3PN7 C;  4N1F A;  3I5H B;  4PCW A;  1YUT A;  1Z2C B;  2MLF C;  4PE4 A;  3HX4 A;  4YGC B;  5EL2 A;  3JVT C;  3FE6 A;  5AXI A;  2ZN8 A;  2JT0 A;  2KLE A;  1ZOT B;  1EH2 A;  3EVR A;  4XJK B;  2H8V A;  1BOC A;  1K93 D;  1QAS A;  1DJZ A;  3GK1 A;  1XA5 A;  1SL8 A;  2M29 A;  4OZD A;  3I5H C;  1PVB A;  3NSI A;  1XK4 A;  1ALV A;  2LNK A;  2MA2 A;  5BPJ A;  3K1E A;  1ODB A;  2BE4 A;  3O4Y A;  4YGB B;  1KCY A;  2ZNE A;  1LKJ A;  4YBH B;  4N5X A;  3BYA A;  1B47 A;  1SR6 C;  2WOR A;  3EK8 A;  2L5Y A;  3CR2 A;  1OSA A;  3TS5 B;  2WND A;  4WRI A;  1RRO A;  1EJ3 A;  2BEC A;  2JXL A;  2CTN A;  4PE7 A;  3NSO A;  1AJ5 A;  2K2F A;  1DVI A;  3R1P A;  1SYM A;  2KGR A;  2M49 B;  1JFJ A;  1G33 A;  3NXA A;  1M31 A;  2KYC A;  1WLZ A;  2BE6 A;  1RTP 1;  4YI9 A;  3OHM B;  1N65 A;  1H4B A;  3C1V A;  1SCV A;  1F70 A;  1NCX A;  1TOP A;  2Y4Q A;  1SNL A;  3JTD C;  1FF1 A;  3M0W A;  1ZUZ A;  3CAB A;  3O4X A;  4MVF A;  5AFP A;  5K89 A;  1F55 A;  2LV7 A;  3VRO A;  4OR9 B;  1S5G Z;  2WCM A;  3L4A A;  1PAL A;  1SSE B;  1CDN A;  1T14 A;  4C0K A;  1IIO A;  4PE0 A;  4AQJ A;  1OMD A;  5B8I B;  1NP8 A;  3OGN A;  4A4C A;  1AVS A;  4AOM A;  5KTY A;  2H2K A;  1AUI B;  5JJG A;  2QEV A;  2PVB A;  4OV2 A;  4MEW A;  2QPT A;  3BFA A;  3F45 A;  3PFV A;  2QDI A;  4HSZ A;  3KO0 A;  3H4S E;  1QJT A;  3S0B A;  2FCD A;  2HET A;  1W7J B;  2HQW A;  2ZN9 A;  2LLU A;  3D75 A;  1IRJ A;  2EC6 C;  3K21 A;  1YUR A;  3DYE A;  3OB2 B;  1JF2 A;  5I2L A;  4M2O A;  1RWY A;  2MRD A;  2PMY A;  3LLE A;  1J55 A;  2WCL A;  1XVJ A;  2FCE A;  3O78 A;  4MBE A;  4R1E A;  1TNW A;  5HLO A;  3GK4 X;  3CWG A;  1K9U A;  2NCP A;  1V1F A;  1OQP A;  1UHK A;  1J7P A;  1YRU B;  3NGV A;  2JNF A;  4JQ0 D;  1QV0 A;  2E30 A;  2GTE A;  1K8U A;  2F33 A;  4OCI A;  2LVV A;  3I5I B;  3KEV A;  2Q4U A;  1CDM A;  3BUX B;  2BKH B;  3SG3 A;  1U5I A;  2LUC A;  2HQ8 A;  3B6X A;  3CZ1 A;  1BF5 A;  1CLL A;  4OKH A;  3BQ3 A;  4Q04 A;  1HQV A;  2L50 A;  1TUZ A;  2ZND A;  3FE8 A;  5FI7 A;  4GGF C;  1B1G A;  2LMU A;  4GPL B;  1TIZ A;  2BKI B;  3QME A;  2OS8 B;  1NX3 A;  1A2X A;  3PAT A;  4TNC A;  2AAO A;  2QEH A;  2R2I A;  1R2U A;  2E6W A;  4GBA A;  3FWC A;  1K94 A;  1G8I A;  5PAL A;  1IJ5 A;  2LCP A;  1BT6 A;  1M45 A;  3PN7 B;  4ORA B;  3TDI A;  1CFD A;  1KQV A;  1SY9 A;  1UHH A;  5CPV A;  1S5G Y;  1SPY A;  5GQQ C;  2JT3 A;  5KU1 A;  3HCM A;  2M3W A;  3DZT A;  4QJ4 B;  3BJH A;  2WCH A;  1CB1 A;  1GGW A;  1QS7 A;  2LHL A;  4NQG A;  2KPH A;  2MJW B;  1DMO A;  3PAL A;  3O2P A;  2AMI A;  2Y1N A;  1DEL A;  2QEO A;  3FIA A;  1P28 A;  4MZK A;  1J7O A;  2KBM A;  3D0Y A;  2PAL A;  2ERB A;  5KSZ A;  5HLV A;  4I5J A;  3EK4 A;  1BMO A;  2WC6 A;  3R1V A;  3FE9 A;  2VRG A;  2IS9 A;  3DVM A;  3PLF B;  3SG5 A;  5D7F A;  5I2O A;  1MF8 B;  3JTD B;  1QX2 A;  1S3P A;  1YX7 A;  3LK0 A;  1K9K A;  1UUS A;  4PHJ A;  1SMG A;  4AQI A;  2NZ0 A;  3S0D A;  5DKN A;  2FJU B;  2BL0 B;  1AK8 A;  2M0R A;  1K95 A;  3NHT A;  4UPG A;  1C7W A;  3DVK A;  1IQ5 A;  1DJX A;  1OOI X;  3CS1 A;  1XFW O;  3CZT X;  1S36 A;  1KK8 C;  1RK9 A;  1FW4 A;  2MAZ A;  3DVJ A;  2LP3 A;  2COL B;  3OB1 B;  2LE9 B;  1OMR A;  2CXJ A;  4IL1 A;  1LIN A;  2M1K B;  3BUW B;  3FS7 A;  1CM1 A;  2JC2 A;  4QJ3 B;  1UHI A;  3DD4 A;  4BY5 A;  1H8B A;  1JWD A;  1U5I B;  2Y5I A;  3SS4 A;  3V2L A;  3IQO A;  1NCY A;  5FYX A;  5AEQ A;  4CID A;  2CBL A;  2H61 A;  3D10 A;  2LMV A;  2QAC A;  4WQ3 A;  1WDC C;  1F71 A;  1ZFS A;  1PSR A;  2EC6 B;  1QAT A;  2G2B A;  4YI8 A;  2KOT A;  1AJ4 A;  3CDN A;  3DF0 B;  2HF5 A;  3WHT B;  5HYD A;  1BJF A;  1G4Y R;  4XYN A;  5G08 A;  3IF7 A;  2KI6 D;  5I8N A;  1GM0 A;  2L98 A;  1L7Z A;  4YGD B;  1DEK A;  3GK2 A;  4GFT A;  1A4P A;  1ZAC A;  1NSH A;  4NDB A;  3VRN A;  1NYA A;  1IGV A;  2M9G A;  3EVU A;  1BOD A;  4GNK B;  4N1G A;  2BCB A;  3NSL A;  1QTX A;  4GAO A;  4QJ5 B;  1K2H A;  3AAJ A;  1DTL A;  1QX7 A;  1WRL A;  1OOJ A;  4MZL A;  2KAX A;  1PUL A;  2BNX A;  3S0E A;  2F3Y A;  5CSN A;  1Y1X A;  4OVN F;  2I7A A;  3B86 A;  5FI6 A;  1TWO A;  2K7B A;  1A75 B;  1N2D A;  2JT8 A;  1OZS A;  1MXE A;  3CLN A;  3DF0 A;  4HRH A;  1UP5 A;  2AUC A;  2G9B A;  1Y1U A;  2I2R E;  2F2O A;  3BFH A;  5ER5 A;  2F3Z A;  3VRP A;  3SS3 A;  1SCM C;  1JBA A;  1J7Q A;  1GJY A;  1SW8 A;  1KFU S;  1SKT A;  1B4C A;  1QIV A;  1M63 B;  1SL9 A;  1S6C A;  4C0L A;  3WNX B;  1REC A;  3A8R A;  3WHU B;  1NUB A;  3SIB A;  4WQ2 A;  1KK7 Y;  3I5G C;  1NIW A;  1Y1A A;  1CTR A;  3UNW A;  1CFP A;  3CTN A;  1S1E A;  1B7T Y;  1FBV A;  2KSP A;  5IBW A;  4YRU A;  4MN0 A;  1S6I A;  5I2Q A;  1AP4 A;  3Q8I A;  1OOH A;  2JXC A;  2SCP A;  5DKR A;  2PQL A;  3I5F B;  3JVT B;  3SIA A;  2ZFD A;  5I94 A;  1CMG A;  4FQT A;  3D76 A;  4L9M A;  1CDP A;  2JNX A;  4PT1 A;  2WCE A;  3SG4 A;  1KQM C;  1KK8 B;  2OTG B;  2LUX A;  4KYN A;  2WCF A;  3D0Y B;  1C07 A;  1FI6 A;  1K90 D;  1GQM A;  1S6J A;  3DVE A;  4ORC B;  2KI4 B;  1KSM A;  3B7A A;  1KWO B;  2LLT A;  4YGE B;  2EGD A;  4HRG A;  1BR1 B;  1KQM B;  2JZI A;  2OTG C;  3N7H A;  4MRY A;  1LXF C;  2F8P A;  1ZMZ A;  3TUY B;  1Y0V H;  3D74 A;  1V1G A;  4CLN A;  2K7O A;  1XFU O;  2MBX A;  1K96 A;  1TNP A;  3SG7 A;  1DJI A;  2YGU A;  1F54 A;  3BUO B;  3FWB A;  4I5K A;  4CFR A;  1ORG A;  1BU3 A;  1KFX L;  2KGB C;  5AAN A;  3BOW B;  1YR5 A;  3AKA A;  2KAY A;  1DJW A;  1OOG A;  2BL0 C;  2FJY A;  1DT7 B;  2Y1M A;  1DC1 A;  3D78 A;  1PVA A;  1HT9 A;  3RLZ A;  1CFF A;  1XFY O;  1B9A A;  1DJG A;  1LA0 A;  2V53 A;  3OX6 A;  1QIW A;  2GGM A;  2K2A A;  3KF9 A;  1QX5 B;  1QWV A;  2KAV A;  1YX8 A;  1CLB A;  1LS8 A;  3PM8 A;  4JKT A;  4MSP A;  2P6B B;  4M2Q A;  2MLE C;  3L47 A;  1DGV A;  1TN4 A;  1TUJ A;  3ICB A;  3IQQ A;  3EKJ A;  1BLQ A;  1E8A A;  4FQO A;  4USL A;  4GGF A;  5JOL A;  2NXQ A;  1NX1 A;  3OX5 A;  3VB1 A;  3BUN B;  1LA3 A;  1IG5 A;  3CZ0 A;  3VRR A;  2GGZ A;  2WCJ A;  5DIC A;  1J7R A;  1CMF A;  2JRF A;  1UHN A;  3L4L A;  3SS5 A;  2ZRS A;  1JC2 A;  1XFZ O;  1BR4 B;  2NCO A;  1QVI Z;  3SJS A;  2L4H A; 
#chains in the Genus database with same CATH homology
 4I5L B;  3BXK A;  1WRK A;  3WXA A;  2WC8 A;  1L2O C;  1MR8 A;  2LMT A;  2L2E A;  2WOS A;  1UWO A;  1TNQ A;  2Q91 A;  1JUO A;  1R6P A;  1JSA A;  3ZNI A;  1VRK A;  1XO5 A;  2KBI A;  5CSJ A;  3I5G B;  1DGU A;  1XK4 C;  1JF0 A;  3TS5 C;  2ISD A;  3EKH A;  1CNP A;  3NSK A;  2BBN A;  2JPT A;  1CFC A;  1YVH A;  4PDZ A;  1S26 D;  1XFX O;  2JQ6 A;  2KYF A;  2LVJ A;  2L4I A;  2OPO A;  4D1E A;  1C7V A;  5AER A;  2LC5 A;  2LHI A;  4DCK A;  4DUQ A;  2LM5 A;  2M97 A;  2K7D A;  4FTG A;  4BY4 A;  4MLW A;  4JWQ A;  1IWQ A;  1ALW A;  1NWD A;  4ETO A;  1MUX A;  2KFG A;  1PSB A;  1YUU A;  1KFU L;  1M39 A;  2H61 C;  2KI6 C;  5ER4 X;  2PSR A;  4PAL A;  1DF0 B;  1CDL A;  2I18 A;  1JFK A;  1KSO A;  4CPV A;  1GGZ A;  2KNE A;  3AAK A;  1W7I B;  3TUY C;  2L51 A;  1EG4 A;  4ORB B;  4DS7 A;  1D1O A;  2K7C A;  1CKK A;  5J3X A;  2BCA A;  2K8M B;  2LVI A;  3I5I C;  5D69 A;  1YVL A;  4PHN A;  3TZ1 A;  1F8H A;  2JTZ A;  1Q80 A;  1SBJ A;  4HRE E;  1NX0 A;  2PAS A;  1WY9 A;  2BCX A;  4U8D A;  3ZWH A;  2PRU A;  4C0J A;  2I94 A;  1OMV A;  1QV1 A;  4ZCU A;  2RGI A;  1YRT B;  3VRQ A;  2B1U A;  2L5X B;  1UHJ A;  2KDH A;  3BUM B;  3CGA A;  3KPX A;  1YTZ C;  3LCP C;  2K61 A;  5HKZ A;  3SG2 A;  1LVC D;  3TDZ A;  4MRX A;  4ZCV A;  5TNC A;  1F4Q A;  4P5O E;  1AHR A;  2GV5 A;  2SAS A;  5DKQ A;  2M7N A;  2KHN A;  1TRF A;  1WRZ A;  2OS8 C;  1PRW A;  3A4U B;  1NCZ A;  2F2P A;  2HPS A;  3EVV A;  2JU0 A;  2CNP A;  1L2O B;  3OP0 A;  1QVI Y;  1WLM A;  3LL8 B;  2KFH A;  1RJV A;  1SR6 B;  2WCB A;  4MZJ A;  5CSI A;  3VGO A;  1FI5 A;  1EG3 A;  1OZO A;  4NDD A;  3GOF A;  2D8N A;  2JWW A;  3SG6 A;  4GGN A;  2EHB A;  2K0J A;  2LAN A;  1A29 A;  1UUR A;  2NLN A;  1NX2 A;  1NPQ A;  2KFF A;  1DJY A;  5CSF A;  2M7L A;  4F0Z B;  2M1U A;  3PSR A;  1N0Y A;  1PK0 D;  1RFJ A;  2DOQ A;  1DJH A;  1MHO A;  2O5G A;  2LVK A;  4I5N B;  1BG1 A;  4YGA A;  2KI4 C;  1WDC B;  3I5F C;  4DIR A;  3TDU A;  1OE9 B;  1KWO C;  2JTT A;  1MWN A;  2O60 A;  3AKB A;  1B8C A;  1CM4 A;  3E3R A;  1J1E A;  1QLS A;  1B8L A;  2KQY A;  2TN4 A;  4ICB A;  3MSE B;  1YUS A;  1M46 A;  1SL7 A;  5HKY A;  1IKU A;  1F4O A;  4JPZ B;  4A4B A;  4P2Y B;  2A4J A;  3CR5 X;  1FPW A;  1TCF A;  3BOW A;  4PHM A;  1CLM A;  1MQ1 A;  3RM1 A;  1A03 A;  1SK6 D;  2ZKM X;  4NDC A;  1B8R A;  1MXL C;  1SRA A;  4PE1 A;  3QRX A;  3EK7 A;  2M8U A;  1TTX A;  4M2P A;  1IJ6 A;  1XYD A;  2LP2 A;  2FOT A;  1K9P A;  1QXP A;  1IQ3 A;  1TNX A;  4E68 A;  1J1D A;  1X02 A;  2ZRT A;  1QLK A;  5HKW A;  3O6B A;  4DRW A;  3LK1 A;  1EXR A;  1Y6W A;  3CR4 X;  2CT9 A;  2L0P A;  3KHE A;  2LLS A;  1B7T Z;  5F6T A;  1DF0 A;  4PHK A;  1IH0 A;  2BBM A;  1KK7 Z;  2LAP A;  2JOJ A;  1EL4 A;  1TCO B;  4XJK A;  4CFQ A;  1XFV O;  2CCM A;  2KQ6 A;  1KFX S;  1SCM B;  4GUK A;  1A75 A;  2JUL A;  2MHH A;  3PN7 C;  4N1F A;  3I5H B;  4PCW A;  1YUT A;  2MLF C;  4YGC B;  4PE4 A;  3HX4 A;  5AXI A;  3JVT C;  2ZN8 A;  2JT0 A;  1ZOT B;  1EH2 A;  3EVR A;  4XJK B;  1BOC A;  1K93 D;  1QAS A;  1DJZ A;  3GK1 A;  1XA5 A;  1SL8 A;  2M29 A;  3I5H C;  1PVB A;  3NSI A;  1XK4 A;  1ALV A;  2LNK A;  2MA2 A;  5BPJ A;  3O4Y A;  1ODB A;  2BE4 A;  4YGB B;  1KCY A;  2ZNE A;  1LKJ A;  4YBH B;  4N5X A;  3BYA A;  1B47 A;  1SR6 C;  2WOR A;  3EK8 A;  3CR2 A;  1OSA A;  3TS5 B;  2WND A;  4WRI A;  1RRO A;  1EJ3 A;  2BEC A;  2JXL A;  2CTN A;  4PE7 A;  3NSO A;  1AJ5 A;  2K2F A;  1DVI A;  1SYM A;  2KGR A;  2M49 B;  1JFJ A;  1G33 A;  3NXA A;  1M31 A;  2KYC A;  1WLZ A;  2BE6 A;  1RTP 1;  4YI9 A;  3OHM B;  1N65 A;  1H4B A;  3C1V A;  1SCV A;  1F70 A;  1NCX A;  1TOP A;  2Y4Q A;  1SNL A;  3JTD C;  1FF1 A;  3M0W A;  1ZUZ A;  4MVF A;  5AFP A;  5K89 A;  1F55 A;  2LV7 A;  3VRO A;  4OR9 B;  1S5G Z;  1PAL A;  1CDN A;  4C0K A;  4PE0 A;  4AQJ A;  1OMD A;  5B8I B;  1NP8 A;  4A4C A;  1AVS A;  4AOM A;  5KTY A;  2H2K A;  1AUI B;  5JJG A;  2PVB A;  4OV2 A;  4MEW A;  2QPT A;  3F45 A;  3PFV A;  4HSZ A;  3KO0 A;  3H4S E;  1QJT A;  2FCD A;  2HET A;  1W7J B;  2HQW A;  2ZN9 A;  2LLU A;  1IRJ A;  2EC6 C;  3K21 A;  1YUR A;  3OB2 B;  1JF2 A;  5I2L A;  4M2O A;  1RWY A;  2MRD A;  2PMY A;  3LLE A;  1J55 A;  1XVJ A;  2FCE A;  3O78 A;  4MBE A;  4R1E A;  1TNW A;  5HLO A;  3GK4 X;  3CWG A;  1K9U A;  2NCP A;  1V1F A;  1OQP A;  1UHK A;  1J7P A;  1YRU B;  2JNF A;  4JQ0 D;  1QV0 A;  2E30 A;  4OCI A;  1K8U A;  2F33 A;  2LVV A;  3I5I B;  3KEV A;  2Q4U A;  1CDM A;  3BUX B;  2BKH B;  3SG3 A;  1U5I A;  2LUC A;  2HQ8 A;  1BF5 A;  1CLL A;  4OKH A;  3BQ3 A;  4Q04 A;  1HQV A;  2L50 A;  2ZND A;  4GGF C;  1B1G A;  2LMU A;  4GPL B;  1TIZ A;  2BKI B;  2OS8 B;  1NX3 A;  1A2X A;  3PAT A;  4TNC A;  2AAO A;  2R2I A;  1R2U A;  2E6W A;  4GBA A;  3FWC A;  1K94 A;  1G8I A;  5PAL A;  1IJ5 A;  2LCP A;  1BT6 A;  1M45 A;  3PN7 B;  4ORA B;  3TDI A;  1CFD A;  1KQV A;  1SY9 A;  1UHH A;  5CPV A;  1S5G Y;  1SPY A;  5GQQ C;  2JT3 A;  5KU1 A;  3HCM A;  2M3W A;  4QJ4 B;  1CB1 A;  1GGW A;  1QS7 A;  2LHL A;  4NQG A;  2MJW B;  1DMO A;  3PAL A;  3O2P A;  2AMI A;  2Y1N A;  3FIA A;  4MZK A;  1J7O A;  2KBM A;  3D0Y A;  2PAL A;  5KSZ A;  5HLV A;  4I5J A;  3EK4 A;  1BMO A;  2VRG A;  2IS9 A;  3DVM A;  3PLF B;  3SG5 A;  5D7F A;  5I2O A;  1MF8 B;  3JTD B;  1QX2 A;  1S3P A;  1YX7 A;  3LK0 A;  1K9K A;  1UUS A;  4PHJ A;  1SMG A;  4AQI A;  2NZ0 A;  5DKN A;  2FJU B;  2BL0 B;  1AK8 A;  2M0R A;  1K95 A;  4UPG A;  1C7W A;  3DVK A;  1IQ5 A;  1DJX A;  3CS1 A;  1XFW O;  3CZT X;  1S36 A;  1KK8 C;  1RK9 A;  1FW4 A;  2MAZ A;  3DVJ A;  2LP3 A;  2COL B;  3OB1 B;  2LE9 B;  1OMR A;  2CXJ A;  4IL1 A;  1LIN A;  2M1K B;  3BUW B;  3FS7 A;  1CM1 A;  2JC2 A;  4QJ3 B;  1UHI A;  3DD4 A;  4BY5 A;  1H8B A;  1JWD A;  1U5I B;  2Y5I A;  3IQO A;  1NCY A;  5FYX A;  5AEQ A;  4CID A;  2CBL A;  2H61 A;  3D10 A;  2LMV A;  2QAC A;  4WQ3 A;  1WDC C;  1F71 A;  1ZFS A;  1PSR A;  2EC6 B;  1QAT A;  2G2B A;  4YI8 A;  2KOT A;  1AJ4 A;  3DF0 B;  2HF5 A;  3WHT B;  5HYD A;  1BJF A;  1G4Y R;  4XYN A;  5G08 A;  3IF7 A;  2KI6 D;  5I8N A;  2L98 A;  1L7Z A;  4YGD B;  4GFT A;  3GK2 A;  1A4P A;  1ZAC A;  1NSH A;  4NDB A;  3VRN A;  1NYA A;  1IGV A;  2M9G A;  3EVU A;  1BOD A;  4GNK B;  4N1G A;  2BCB A;  3NSL A;  1QTX A;  4GAO A;  4QJ5 B;  1K2H A;  3AAJ A;  1DTL A;  1QX7 A;  1WRL A;  1OOJ A;  4MZL A;  2KAX A;  1PUL A;  2F3Y A;  5CSN A;  1Y1X A;  4OVN F;  2I7A A;  2K7B A;  1A75 B;  1N2D A;  2JT8 A;  1OZS A;  1MXE A;  3CLN A;  3DF0 A;  4HRH A;  1UP5 A;  2AUC A;  2G9B A;  1Y1U A;  2I2R E;  2F2O A;  5ER5 A;  2F3Z A;  3VRP A;  1SCM C;  1JBA A;  1J7Q A;  1GJY A;  1SW8 A;  1KFU S;  1SKT A;  1B4C A;  1QIV A;  1M63 B;  1SL9 A;  1S6C A;  4C0L A;  3WNX B;  1REC A;  3A8R A;  3WHU B;  1NUB A;  3SIB A;  4WQ2 A;  1KK7 Y;  3I5G C;  1NIW A;  1Y1A A;  1CTR A;  1CFP A;  3CTN A;  1S1E A;  1B7T Y;  1FBV A;  2KSP A;  5IBW A;  4YRU A;  4MN0 A;  1S6I A;  5I2Q A;  1AP4 A;  2JXC A;  2SCP A;  5DKR A;  3I5F B;  3JVT B;  3SIA A;  2ZFD A;  1CMG A;  4L9M A;  1CDP A;  2JNX A;  2WCE A;  3SG4 A;  1KQM C;  1KK8 B;  2OTG B;  2LUX A;  1C07 A;  2WCF A;  3D0Y B;  1FI6 A;  1K90 D;  1GQM A;  1S6J A;  3DVE A;  4ORC B;  2KI4 B;  1KSM A;  1KWO B;  2LLT A;  4YGE B;  2EGD A;  4HRG A;  1BR1 B;  1KQM B;  2JZI A;  2OTG C;  4MRY A;  1LXF C;  2F8P A;  1ZMZ A;  3TUY B;  1Y0V H;  1V1G A;  4CLN A;  2K7O A;  1XFU O;  2MBX A;  1K96 A;  1TNP A;  3SG7 A;  1DJI A;  1F54 A;  3BUO B;  3FWB A;  4I5K A;  4CFR A;  1BU3 A;  1KFX L;  2KGB C;  5AAN A;  3BOW B;  1YR5 A;  3AKA A;  2KAY A;  1DJW A;  2BL0 C;  1DT7 B;  2Y1M A;  1PVA A;  1HT9 A;  3RLZ A;  1CFF A;  1XFY O;  1B9A A;  1DJG A;  1LA0 A;  2V53 A;  3OX6 A;  1QIW A;  2GGM A;  2K2A A;  3KF9 A;  1QX5 B;  2KAV A;  1YX8 A;  1CLB A;  3PM8 A;  4MSP A;  2P6B B;  4M2Q A;  2MLE C;  1DGV A;  1TN4 A;  3IQQ A;  3ICB A;  3EKJ A;  1BLQ A;  1E8A A;  4FQO A;  4USL A;  4GGF A;  5JOL A;  2NXQ A;  1NX1 A;  3OX5 A;  3BUN B;  1LA3 A;  1IG5 A;  3VRR A;  2GGZ A;  1J7R A;  1CMF A;  2JRF A;  1UHN A;  2ZRS A;  1JC2 A;  1XFZ O;  1BR4 B;  2NCO A;  1QVI Z;  3SJS A;  2L4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...