1UP5A

Chicken calmodulin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
145
structure length
144
Chain Sequence
b'LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGELTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
molecule tags Signalling protein
publication title Crystallization and Preliminary X-Ray Analysis of Two New Crystal Forms of Calmodulin
pubmed doi rcsb
total genus 55
structure length 144
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1up5A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1up5A02
3TDIA 4WQ3A 1AP4A 4TNCA 1U5IB 1TIZA 3BUMB 1XA5A 5AEQA 1DJWA 1PRWA 1CLMA 3SIAA 3BOWB 4GFTA 1SRAA 2JT3A 2L4IA 2M1UA 1MWNA 4YI9A 1WRLA 2M0RA 4DUQA 2F33A 1CLLA 1QIVA 1NCXA 3CS1A 2LMVA 1F8HA 2FJUB 3A4UB 1KK8B 1SW8A 1IG5A 2KBIA 1JF0A 2KFGA 4MZKA 3E3RA 2CT9A 2LVKA 5DKQA 2JXLA 4YBHB 3DVJA 3EK7A 2I94A 4XYNA 1QX2A 1SR6C 4U8DA 1MHOA 3KHEA 2LUCA 1TNQA 2V53A 1BR4B 1M46A 3SG2A 3TUYB 4AOMA 1DGVA 4YRUA 2LV7A 1Q80A 1B9AA 5AERA 3A8RA 1FI5A 3TUYC 1A75A 3TS5B 1A29A 2KAYA 1RROA 3LCPC 1FBVA 1CDMA 1QLSA 1TNXA 1QX7A 5D69A 2Q4UA 1BJFA 1BG1A 3EVRA 2CTNA 1K96A 1LA3A 4OR9B 4PALA 2WCFA 3VRPA 4DCKA 2MRDA 1KWOB 4DS7A 4M2PA 1KCYA 2LVJA 2HQWA 4HRHA 3F45A 1OSAA 1K2HA 2KQYA 4PDZA 3PFVA 4I5JA 3PSRA 2KFFA 1DTLA 1AHRA 1SYMA 1C07A 3PM8A 3JTDC 2LLTA 4JPZB 2KSPA 1SKTA 1PVBA 2WORA 4ORCB 1BLQA 4C0KA 4MN0A 5CSFA 4ETOA 1S26D 3KEVA 2LHIA 1FI6A 1Y0VH 3NSKA 4MBEA 2FCEA 2JRFA 5ER4X 4JWQA 2ZRSA 1MF8B 4N1GA 4NDBA 1LINA 2BL0B 1M39A 3HX4A 1YRTB 1N2DA 3LL8B 3VROA 1OQPA 1RFJA 4ORAB 1TTXA 1B7TY 4MZJA 2OPOA 4GBAA 4HSZA 3LLEA 3EK8A 3DVEA 4A4BA 1K95A 1CFDA 1DJYA 1B47A 1IH0A 2PALA 2MLFC 2D8NA 2LHLA 3O6BA 1NUBA 1Y1AA 1YTZC 4NQGA 1S6IA 2ZN9A 3AAJA 2KFHA 2CXJA 2JNXA 3M0WA 1YUUA 4IL1A 1QJTA 1WDCC 2K2FA 2LLUA 3WXAA 3AKBA 4P2YB 4PHMA 1J7QA 1ODBA 3WHTB 1OMVA 4PE4A 1QVIZ 2CCMA 1KFXL 1B1GA 2H2KA 1J7PA 3EVVA 2MHHA 1SCVA 3TDZA 1AUIB 1K93D 4ORBB 3BQ3A 1ZMZA 4YGDB 1UWOA 2L4HA 4XJKB 1OMDA 2LCPA 1ZUZA 2NXQA 4QJ4B 1JBAA 1PSBA 2KOTA 1YVHA 5J3XA 3VGOA 1XFWO 1NX3A 4E68A 4ZCVA 2PMYA 4FQOA 2K2AA 1F54A 4I5LB 1OZOA 4CLNA 2M29A 4USLA 1NCZA 1QV0A 2NZ0A 1C7VA 1CNPA 1UHJA 3PLFB 1RTP1 2Y1NA 2KGBC 1IJ6A 4MRXA 4N5XA 1B7TZ 2I7AA 1LXFC 1QX5B 2IS9A 2L51A 1NPQA 1CM4A 1TNPA 1Y1UA 3BYAA 5HKZA 2JC2A 1WRKA 2LANA 1QV1A 1DF0A 3OX5A 5G08A 2FOTA 1S1EA 2M97A 5ER5A 1K9KA 1PALA 2KYCA 1A03A 1W7JB 2WC8A 1DJIA 1YX7A 3OHMB 3ICBA 3OB1B 1RECA 3CLNA 2I18A 4BY5A 3DF0B 5I8NA 2M7LA 1BOCA 1M31A 1UURA 1MQ1A 5BPJA 1XYDA 4MRYA 4MEWA 1AVSA 5KU1A 2KI6D 2A4JA 2AMIA 3FS7A 2P6BB 2LUXA 2Y1MA 3I5GB 1CDPA 1PULA 2BKIB 1PVAA 1OZSA 2LC5A 4JQ0D 1QTXA 1S5GY 2E6WA 2O60A 2PASA 3C1VA 5I2LA 1TCOB 3BUNB 3KF9A 4DRWA 2BE4A 1OE9B 1MR8A 1SCMC 2CBLA 5F6TA 2L2EA 1NSHA 2LVVA 1YRUB 5AXIA 3ZNIA 2WCEA 1NIWA 1J7OA 2BCXA 2OTGC 1K9PA 2SASA 1QXPA 1X02A 3HCMA 3LK1A 3OB2B 1YVLA 2VRGA 1G33A 3QRXA 4AQJA 4OCIA 1DJZA 2JXCA 5HKWA 5CSIA 3GK2A 1QVIY 4P5OE 4GNKB 3TZ1A 5TNCA 1A75B 5HKYA 3I5FC 3O4YA 2F3YA 2KYFA 1EH2A 1DGUA 1UHHA 1YUTA 2JU0A 2BECA 1TNWA 5CPVA 4QJ5B 3WHUB 1QLKA 2L98A 1FPWA 1B8CA 1JSAA 5D7FA 3IQQA 2G9BA 4GGFC 1IGVA 2KI6C 2JTZA 1J55A 1BMOA 1K90D 1IKUA 1GQMA 3DVKA 1M63B 1CMFA 1SMGA 1KWOC 4Q04A 3AKAA 1JFJA 5PALA 1MXLC 5GQQC 2K7DA 5I2OA 2JT8A 2EHBA 1WY9A 1S5GZ 3FIAA 5AANA 2HQ8A 3BUOB 5JJGA 1V1GA 2KNEA 5B8IB 1YUSA 1Y1XA 2ZRTA 3VRQA 1EL4A 5CSNA 2K8MB 1MUXA 2H61C 2I2RE 2FCDA 1CMGA 2AUCA 4PHNA 4PE7A 2L50A 2ZKMX 1JUOA 3CWGA 1N0YA 2K7OA 4HREE 1CDNA 4WQ2A 1JC2A 1EXRA 2K7CA 1XVJA 2H61A 2JOJA 3BUWB 3CZTX 4YI8A 2E30A 2MBXA 2KDHA 5K89A 1UHKA 1CFCA 2JNFA 5HYDA 1K9UA 2F2OA 4NDCA 3I5IC 3I5HC 4C0LA 4YGCB 2LNKA 3NSOA 1NCYA 1RJVA 2HPSA 2L0PA 4XJKA 2GGMA 1NYAA 4PE0A 4YGAA 1EG3A 1NP8A 3VRNA 2JTTA 1TCFA 4ZCUA 1KFXS 1HT9A 2BBMA 5DKNA 2KI4C 1BU3A 4L9MA 1IQ5A 3JVTB 1XO5A 1U5IA 1SR6B 1QASA 2AAOA 2JWWA 2HF5A 1FF1A 2LE9B 1H4BA 2JZIA 2KQ6A 4R1EA 2M3WA 1ALWA 3TDUA 4CIDA 3LK0A 1B8RA 2TN4A 1KK8C 4I5KA 2LVIA 4MVFA 1K94A 3MSEB 5DKRA 3VRRA 1R2UA 4BY4A 5IBWA 4PCWA 5CSJA 1PK0D 3D0YB 2KAVA 1TOPA 1VRKA 2M1KB 3GOFA 1LA0A 4FTGA 1CFPA 2F3ZA 1YX8A 2LMTA 3D0YA 4PE1A 1F4QA 5AFPA 1SPYA 3DF0A 4YGEB 5HLVA 4GUKA 3GK1A 3DD4A 2L5XB 3RLZA 1DJXA 1ZACA 1G8IA 1TRFA 4CPVA 1BODA 2WNDA 2DOQA 4A4CA 1S6JA 4WRIA 2GV5A 2M49B 2OTGB 1B4CA 2MA2A 4M2QA 2MLEC 3BXKA 5JOLA 2LAPA 1IJ5A 2JPTA 4GGNA 1KK7Z 1M45A 1SY9A 1XFVO 1XK4A 3O78A 1BF5A 1QIWA 2B1UA 1XK4C 2ISDA 2PRUA 4F0ZB 3EVUA 1J1EA 1N65A 1XFYO 3OP0A 4HRGA 1EG4A 1UP5A 2M8UA 3IQOA 4GPLB 2WCBA 2KAXA 3IF7A 3K21A 1SL7A 5I2QA 3FWCA 2O5GA 4OVNF 2ZFDA 1DF0B 1DT7B 1A2XA 1C7WA 1SBJA 1SL9A 2K7BA 1LKJA 2GGZA 1DJHA 1LVCD 2COLB 1AJ4A 4GGFA 3SJSA 3SG5A 1CLBA 4OV2A 2RGIA 1SCMB 1CFFA 1F71A 1DJGA 4UPGA 2M9GA 1KSOA 3NSLA 3TS5C 4CFRA 2K61A 2MJWB 2Y4QA 3SIBA 3KPXA 2LP3A 1OOJA 2KBMA 5KTYA 2F8PA 1JF2A 3BOWA 4CFQA 2BKHB 1CB1A 2BL0C 2R2IA 3SG7A 3EK4A 5KSZA 1GJYA 1HQVA 1W7IB 1DMOA 1L2OB 1SNLA 1AK8A 4MZLA 1SK6D 1XFZO 2M7NA 4N1FA 4PHJA 1ALVA 4C0JA 1FW4A 2NCPA 2BBNA 1JWDA 1SL8A 2KGRA 2PVBA 1F55A 1WLMA 2F2PA 2KI4B 1JFKA 3CR5X 3JVTC 1XFUO 2EGDA 4MLWA 4PHKA 3H4SE 1YR5A 3CTNA 1UHIA 3BUXB 3PALA 1KK7Y 2MAZA 2HETA 2QPTA 1WLZA 3EKHA 1S6CA 1E8AA 3SG6A 1CDLA 2LMUA 1MXEA 2BE6A 1ZFSA 3I5HB 2SCPA 3GK4X 1KQVA 1NX1A 3NXAA 4NDDA 3CR4X 4OKHA 1CKKA 2CNPA 3EKJA 3O2PA 1XFXO 2Y5IA 1ZOTB 1L2OC 4M2OA 1YURA 3PN7B 4QJ3B 2OS8B 2WOSA 1OMRA 1BT6A 1WRZA 4AQIA 3CGAA 1WDCB 3FWBA 1IQ3A 1R6PA 3RM1A 2NLNA 1J7RA 1F4OA 3NSIA 1J1DA 1UUSA 1UHNA 2NCOA 1H8BA 2BCBA 1KFUL 1KQMC 3I5IB 3ZWHA 3AAKA 2JT0A 2Q91A 4DIRA 1NX2A 1QATA 1KSMA 2LP2A 1GGZA 3SG4A 2ZNEA 1IRJA 2ZNDA 4D1EA 4ICBA 2QACA 1TN4A 5FYXA 1CTRA 3CR2A 1S3PA 1CM1A 4GAOA 1RWYA 2K0JA 2ZN8A 3DVMA 1Y6WA 1G4YR 1EJ3A 1NWDA 2LLSA 3D10A 1AJ5A 4MSPA 1PSRA 1RK9A 1V1FA 1F70A 1K8UA 1DVIA 2EC6C 3WNXB 3JTDB 1KFUS 1BR1B 1NX0A 3I5FB 1S36A 3SG3A 2JULA 1KQMB 2EC6B 4I5NB 1B8LA 1D1OA 1L7ZA 2KHNA 5HLOA 1IWQA 2JQ6A 2PSRA 3I5GC 3KO0A 3OX6A 1A4PA 2BCAA 2LM5A 2OS8C 1GGWA 1QS7A 4YGBB 3PATA 2G2BA 3PN7C
chains in the Genus database with same CATH superfamily
3DY9A 4WQ3A 3TDIA 1AP4A 4TNCA 1U5IB 1TIZA 3BUMB 1XA5A 5AEQA 1DJWA 3QMEA 1PRWA 1CLMA 3SIAA 3BOWB 4GFTA 1SRAA 2JT3A 2L4IA 2M1UA 4INXA 1MWNA 4YI9A 1WRLA 2M0RA 4DUQA 2F33A 1CLLA 1QIVA 1NCXA 3CS1A 5D3OA 2LMVA 1F8HA 2FJUB 3N7HA 3A4UB 1KK8B 1SW8A 1IG5A 2KBIA 3O4XA 1JF0A 3S0DA 2KFGA 4MZKA 3E3RA 2CT9A 2LVKA 5DKQA 2JXLA 4YBHB 1DEKA 3DVJA 3EK7A 2I94A 4XYNA 1QX2A 1SR6C 4U8DA 1MHOA 3KHEA 2LUCA 1TNQA 2K60A 2V53A 1BR4B 1M46A 5I94A 3SG2A 3TUYB 4AOMA 1DGVA 4YRUA 2LV7A 1Q80A 1B9AA 5AERA 3V2LA 3A8RA 3S0FA 1FI5A 3TUYC 1A75A 1TUZA 3TS5B 3BJHA 1A29A 2KAYA 1RROA 3LCPC 4FQTA 1FBVA 1CDMA 1QLSA 1TNXA 1QX7A 5D69A 2Q4UA 1BJFA 1BG1A 3EVRA 2CTNA 1K96A 1LA3A 4OR9B 4PALA 2WCFA 3VRPA 4DCKA 1OOFA 1KWOB 2MRDA 4M2PA 4DS7A 1KCYA 2LVJA 2HQWA 4HRHA 3SS3A 3F45A 1OSAA 1TUJA 1K2HA 2KQYA 4PDZA 3PFVA 4I5JA 3PSRA 2KFFA 2QEOA 1DTLA 1AHRA 1SYMA 3BFBA 1C07A 3PM8A 3JTDC 2LLTA 4JPZB 2KSPA 3S0AA 1SKTA 4PT1A 1PVBA 1DELA 2WORA 4ORCB 1BLQA 4C0KA 4MN0A 5CSFA 4ETOA 1S26D 3KEVA 2LHIA 2GTEA 1FI6A 1Y0VH 3NSKA 4MBEA 1C3ZA 2FCEA 2JRFA 5ER4X 4JWQA 3S0GA 2ZRSA 1MF8B 4N1GA 3R1VA 4NDBA 1LINA 2BL0B 1M39A 3HX4A 1YRTB 1N2DA 3LL8B 3R1PA 3VROA 1OQPA 1RFJA 4ORAB 1TTXA 1B7TY 4MZJA 3CABA 2OPOA 1OW4A 4GBAA 4HSZA 3D74A 3LLEA 3EK8A 3DVEA 4A4BA 1K95A 3L4LA 1CFDA 1DJYA 1B47A 1IH0A 3NHIA 2PALA 2MLFC 2D8NA 2LHLA 3O6BA 1NUBA 1Y1AA 1YTZC 4NQGA 1S6IA 2ZN9A 3AAJA 2KFHA 2CXJA 2JNXA 3M0WA 1YUUA 4IL1A 1QJTA 1WDCC 4JKTA 2K2FA 2LLUA 3WXAA 3D78A 3AKBA 4P2YB 2PYQA 4PHMA 1J7QA 1ODBA 3WHTB 1OMVA 4PE4A 1QVIZ 2CCMA 1KFXL 1B1GA 4OZDA 2H2KA 1J7PA 3EVVA 3CZ1A 2MHHA 1SCVA 3TDZA 1AUIB 1K93D 4ORBB 3BQ3A 1ZMZA 2WC5A 4YGDB 1UWOA 2L4HA 4XJKB 1OMDA 2L5YA 2LCPA 1ZUZA 2NXQA 4QJ4B 1JBAA 1PSBA 2KLDA 2KOTA 3IVTA 1YVHA 5J3XA 3VGOA 1XFWO 4IJ7A 1NX3A 4E68A 4ZCVA 2PMYA 4FQOA 3BFHA 2K2AA 1F54A 4I5LB 1OZOA 4CLNA 3L47A 2M29A 4USLA 2KLEA 1NCZA 1QV0A 2NZ0A 1C7VA 1CNPA 1UHJA 3PLFB 1RTP1 2Y1NA 2KGBC 1IJ6A 4MRXA 4N5XA 1B7TZ 2I7AA 1LXFC 1QX5B 2IS9A 2L51A 1NPQA 1CM4A 1TNPA 1Y1UA 4JD9A 3BYAA 5HKZA 1TWOA 2JC2A 1WRKA 2LANA 1QV1A 1DF0A 3OX5A 5G08A 1DC1A 2FOTA 1S1EA 2M97A 2P70A 3R72A 5ER5A 1K9KA 1PALA 2KYCA 1A03A 1W7JB 2WC8A 1DJIA 1YX7A 3OHMB 3ICBA 3OB1B 1RECA 3CLNA 2I18A 4BY5A 3DF0B 5I8NA 2M7LA 1BOCA 1M31A 1UURA 1MQ1A 3PM2A 1XYDA 4MRYA 5BPJA 4MEWA 2WCLA 1AVSA 5KU1A 3FE8A 2BNXA 2KI6D 2A4JA 2AMIA 2WCJA 3FS7A 2P6BB 2LUXA 2Y1MA 3I5GB 1CDPA 1PULA 2BKIB 1PVAA 1OZSA 2LC5A 4JQ0D 1QTXA 1S5GY 2E6WA 2O60A 2PASA 3C1VA 5DICA 5I2LA 1TCOB 3BUNB 3CZ2A 3KF9A 2BE4A 4DRWA 1OE9B 1MR8A 1SCMC 2CBLA 5F6TA 2L2EA 1NSHA 2LVVA 1YRUB 5AXIA 3ZNIA 2WCEA 1NIWA 1J7OA 2BCXA 2OTGC 1K9PA 2SASA 1QXPA 1OOHA 1X02A 3HCMA 3LK1A 1YVLA 3OB2B 1T14A 2VRGA 3VB1A 1G33A 3EG5B 3QRXA 4AQJA 4OCIA 1DJZA 2JXCA 3B7AA 5HKWA 5CSIA 3GK2A 1QVIY 4P5OE 2WCKA 4GNKB 3TZ1A 5TNCA 1A75B 5HKYA 3I5FC 3O4YA 2F3YA 2KYFA 1EH2A 1DGUA 1UHHA 1YUTA 2JU0A 2BECA 1TNWA 5CPVA 2QEHA 4QJ5B 3WHUB 1QLKA 2L98A 1FPWA 1B8CA 1ORGA 1JSAA 5D7FA 3IQQA 2G9BA 4GGFC 1IGVA 2KI6C 2JTZA 1J55A 3CYZA 2QEBA 1BMOA 1K90D 1IKUA 1GQMA 3DVKA 1M63B 1CMFA 1SMGA 1KWOC 4Q04A 3AKAA 1C3YA 4KYNA 1JFJA 5PALA 1MXLC 5GQQC 2K7DA 5I2OA 2JT8A 2EHBA 1WY9A 1S5GZ 3B6XA 3FIAA 5AANA 2HQ8A 3BUOB 2FJYA 5JJGA 1V1GA 2KNEA 5B8IB 1YUSA 1Y1XA 2ZRTA 3VRQA 1EL4A 5CSNA 3D75A 2K8MB 1MUXA 2H61C 2I2RE 2FCDA 1CMGA 2AUCA 4PHNA 4PE7A 1LS8A 2L50A 2ZKMX 1JUOA 3CWGA 1N0YA 2K7OA 4HREE 2KPHA 1CDNA 4WQ2A 1JC2A 1EXRA 2K7CA 1XVJA 2H61A 2JOJA 3BUWB 3CZTX 4YI8A 2E30A 2MBXA 2KDHA 5K89A 1UHKA 3CDNA 1CFCA 2JNFA 5HYDA 1K9UA 2F2OA 3FE9A 4NDCA 3I5IC 3I5HC 3NHTA 4YGCB 4C0LA 2LNKA 3NSOA 1NCYA 1RJVA 2HPSA 2L0PA 4XJKA 2GGMA 1IIOA 1NYAA 3DYEA 4PE0A 3UO9A 4YGAA 1EG3A 1NP8A 3VRNA 2JTTA 1TCFA 2P71A 4ZCUA 1KFXS 1HT9A 3D73A 2BBMA 5DKNA 2KI4C 5EL2A 1BU3A 4L9MA 1IQ5A 3JVTB 1XO5A 1U5IA 1SR6B 3SS5A 1QASA 3PN7C 2AAOA 2JWWA 2HF5A 1FF1A 2LE9B 1H4BA 2JZIA 2KQ6A 4R1EA 2M3WA 1ALWA 3TDUA 4CIDA 3LK0A 1B8RA 2TN4A 1KK8C 4I5KA 2LVIA 4MVFA 1Z4HA 1K94A 3MSEB 5DKRA 3VRRA 1R2UA 4BY4A 1OOGA 2WCHA 4PCWA 5CSJA 5IBWA 1PK0D 3D0YB 1P28A 2KAVA 1TOPA 1VRKA 2M1KB 3GOFA 1LA0A 4FTGA 1CFPA 2F3ZA 3OGNA 1YX8A 2LMTA 3D0YA 4PE1A 1F4QA 3L4AA 5AFPA 1SPYA 3DF0A 3S0EA 4YGEB 5HLVA 4GUKA 3GK1A 3DD4A 2L5XB 3RLZA 1DJXA 5FI2A 1ZACA 1G8IA 2L2CA 1TRFA 4CPVA 1BODA 3R1OA 2WNDA 2DOQA 1W9ZA 4A4CA 1S6JA 4WRIA 2GV5A 2M49B 2OTGB 1B4CA 2MA2A 4M2QA 3BFAA 2MLEC 3BXKA 5JOLA 2LAPA 1IJ5A 2JPTA 4GGNA 1KK7Z 1M45A 1SY9A 1XFVO 1XK4A 3O78A 1BF5A 1QIWA 2B1UA 1XK4C 2ISDA 2PRUA 4F0ZB 3EVUA 1J1EA 1N65A 1XFYO 3OP0A 4HRGA 1EG4A 1UP5A 2M8UA 3IQOA 4GPLB 2WCBA 2KAXA 3IF7A 3K21A 1SL7A 5I2QA 3FWCA 2O5GA 4OVNF 2ZFDA 1DF0B 1DT7B 1A2XA 1C7WA 3D76A 1SBJA 1SL9A 2K7BA 1LKJA 2GGZA 1DJHA 1LVCD 2COLB 1AJ4A 4GGFA 2WC6A 3SJSA 1XFRA 3SG5A 1CLBA 4OV2A 2RGIA 1SCMB 1CFFA 5FI6A 1F71A 1DJGA 4UPGA 2M9GA 3RZSA 3SS4A 1KSOA 3NSLA 3TS5C 4CFRA 2K61A 2MJWB 2Y4QA 3SIBA 3KPXA 2LP3A 1OOJA 2KBMA 5KTYA 2F8PA 2H8VA 1JF2A 3BOWA 1GM0A 4CFQA 2BKHB 1CB1A 2BL0C 2R2IA 3DXLA 3EK4A 3SG7A 3B87A 5KSZA 1GJYA 1HQVA 1W7IB 1DMOA 1L2OB 1SNLA 2YGUA 1AK8A 1SSEB 4MZLA 1SK6D 1XFZO 2M7NA 4N1FA 4PHJA 1ALVA 4C0JA 1FW4A 2NCPA 2BBNA 1JWDA 1SL8A 1Z2CB 1DQEA 2KGRA 2PVBA 3Q8IA 1WLMA 1F55A 2F2PA 2KI4B 1JFKA 3CR5X 3JVTC 1XFUO 2EGDA 2QEVA 4MLWA 4PHKA 3H4SE 1YR5A 3CTNA 1UHIA 3BUXB 3PALA 1KK7Y 2MAZA 2HETA 2QPTA 1WLZA 3EKHA 1S6CA 1E8AA 3SG6A 1CDLA 2LMUA 3B86A 1MXEA 2BE6A 1ZFSA 3I5HB 2SCPA 4INWA 5HL1A 1QWVA 3GK4X 1KQVA 1NX1A 3NXAA 4NDDA 2QDIA 3CR4X 4OKHA 1CKKA 2CNPA 3EKJA 3O2PA 1XFXO 2Y5IA 1OOIX 1ZOTB 1L2OC 4M2OA 1YURA 3PN7B 2BAPA 3D77A 4QJ3B 2OS8B 2WOSA 1OMRA 1BT6A 3B88A 3K1EA 1WRZA 4AQIA 3CGAA 1WDCB 3FWBA 1IQ3A 1R6PA 3RM1A 3OBVA 2NLNA 1J7RA 1F4OA 3NSIA 1J1DA 1UUSA 1UHNA 2NCOA 1H8BA 2BCBA 1KFUL 1KQMC 3I5IB 3ZWHA 3AAKA 2JT0A 2Q91A 4DIRA 1NX2A 1QATA 2PQLA 1KSMA 2ERBA 2LP2A 1GGZA 2JPOA 3SG4A 4F7FA 2ZNEA 1IRJA 2ZNDA 4D1EA 4ICBA 3S0BA 3DZTA 2QACA 1TN4A 5FYXA 1CTRA 3CR2A 1S3PA 1CM1A 4GAOA 1RWYA 2K0JA 2ZN8A 3DVMA 1Y6WA 1G4YR 1EJ3A 3UNWA 1NWDA 2LLSA 3D10A 1AJ5A 3FE6A 4MSPA 1PSRA 1RK9A 1V1FA 1F70A 2WCMA 1K8UA 5FI7A 1DVIA 2EC6C 3PJIA 3WNXB 3JTDB 1KFUS 1BR1B 1NX0A 3I5FB 1S36A 3SG3A 2JULA 1KQMB 2EC6B 4I5NB 1B8LA 1D1OA 1L7ZA 2KHNA 5HLOA 1IWQA 2JQ6A 2PSRA 3I5GC 3KO0A 3OX6A 1A4PA 2BCAA 2LM5A 2OS8C 3CZ0A 1GGWA 1QS7A 4YGBB 3PATA 2G2BA 3NGVA
chains in the Genus database with same CATH topology
3TDIA 4WQ3A 1AP4A 4TNCA 1U5IB 1TIZA 3BUMB 1XA5A 5AEQA 1DJWA 1PRWA 1CLMA 3SIAA 3BOWB 4GFTA 1SRAA 2JT3A 2L4IA 2M1UA 1MWNA 4YI9A 1WRLA 2M0RA 4DUQA 2F33A 1CLLA 1QIVA 1NCXA 3CS1A 2LMVA 1F8HA 2FJUB 3A4UB 1KK8B 1SW8A 1IG5A 2KBIA 1JF0A 2KFGA 4MZKA 3E3RA 2CT9A 2LVKA 5DKQA 2JXLA 4YBHB 3DVJA 3EK7A 2I94A 4XYNA 1QX2A 1SR6C 4U8DA 1MHOA 3KHEA 2LUCA 1TNQA 2V53A 1BR4B 1M46A 3SG2A 3TUYB 4AOMA 1DGVA 4YRUA 2LV7A 1Q80A 1B9AA 5AERA 3A8RA 1FI5A 3TUYC 1A75A 3TS5B 1A29A 2KAYA 1RROA 3LCPC 1FBVA 1CDMA 1QLSA 1TNXA 1QX7A 5D69A 2Q4UA 1BJFA 1BG1A 3EVRA 2CTNA 1K96A 1LA3A 4OR9B 4PALA 2WCFA 3VRPA 4DCKA 2MRDA 1KWOB 4DS7A 4M2PA 1KCYA 2LVJA 2HQWA 4HRHA 3F45A 1OSAA 1K2HA 2KQYA 4PDZA 3PFVA 4I5JA 3PSRA 2KFFA 1DTLA 1AHRA 1SYMA 1C07A 3PM8A 3JTDC 2LLTA 4JPZB 2KSPA 1SKTA 1PVBA 2WORA 4ORCB 1BLQA 4C0KA 4MN0A 5CSFA 4ETOA 1S26D 3KEVA 2LHIA 1FI6A 1Y0VH 3NSKA 4MBEA 2FCEA 2JRFA 5ER4X 4JWQA 2ZRSA 1MF8B 4N1GA 4NDBA 1LINA 2BL0B 1M39A 3HX4A 1YRTB 1N2DA 3LL8B 3VROA 1OQPA 1RFJA 4ORAB 1TTXA 1B7TY 4MZJA 2OPOA 4GBAA 4HSZA 3LLEA 3EK8A 3DVEA 4A4BA 1K95A 1CFDA 1DJYA 1B47A 1IH0A 2PALA 2MLFC 2D8NA 2LHLA 3O6BA 1NUBA 1Y1AA 1YTZC 4NQGA 1S6IA 2ZN9A 3AAJA 2KFHA 2CXJA 2JNXA 3M0WA 1YUUA 4IL1A 1QJTA 1WDCC 2K2FA 2LLUA 3WXAA 3AKBA 4P2YB 4PHMA 1J7QA 1ODBA 3WHTB 1OMVA 4PE4A 1QVIZ 2CCMA 1KFXL 1B1GA 2H2KA 1J7PA 3EVVA 2MHHA 1SCVA 3TDZA 1AUIB 1K93D 4ORBB 3BQ3A 1ZMZA 4YGDB 1UWOA 2L4HA 4XJKB 1OMDA 2LCPA 1ZUZA 2NXQA 4QJ4B 1JBAA 1PSBA 2KOTA 1YVHA 5J3XA 3VGOA 1XFWO 1NX3A 4E68A 4ZCVA 2PMYA 4FQOA 2K2AA 1F54A 4I5LB 1OZOA 4CLNA 2M29A 4USLA 1NCZA 1QV0A 2NZ0A 1C7VA 1CNPA 1UHJA 3PLFB 1RTP1 2Y1NA 2KGBC 1IJ6A 4MRXA 4N5XA 1B7TZ 2I7AA 1LXFC 1QX5B 2IS9A 2L51A 1NPQA 1CM4A 1TNPA 1Y1UA 3BYAA 5HKZA 2JC2A 1WRKA 2LANA 1QV1A 1DF0A 3OX5A 5G08A 2FOTA 1S1EA 2M97A 5ER5A 1K9KA 1PALA 2KYCA 1A03A 1W7JB 2WC8A 1DJIA 1YX7A 3OHMB 3ICBA 3OB1B 1RECA 3CLNA 2I18A 4BY5A 3DF0B 5I8NA 2M7LA 1BOCA 1M31A 1UURA 1MQ1A 5BPJA 1XYDA 4MRYA 4MEWA 1AVSA 5KU1A 2KI6D 2A4JA 2AMIA 3FS7A 2P6BB 2LUXA 2Y1MA 3I5GB 1CDPA 1PULA 2BKIB 1PVAA 1OZSA 2LC5A 4JQ0D 1QTXA 1S5GY 2E6WA 2O60A 2PASA 3C1VA 5I2LA 1TCOB 3BUNB 3KF9A 4DRWA 2BE4A 1OE9B 1MR8A 1SCMC 2CBLA 5F6TA 2L2EA 1NSHA 2LVVA 1YRUB 5AXIA 3ZNIA 2WCEA 1NIWA 1J7OA 2BCXA 2OTGC 1K9PA 2SASA 1QXPA 1X02A 3HCMA 3LK1A 3OB2B 1YVLA 2VRGA 1G33A 3QRXA 4AQJA 4OCIA 1DJZA 2JXCA 5HKWA 5CSIA 3GK2A 1QVIY 4P5OE 4GNKB 3TZ1A 5TNCA 1A75B 5HKYA 3I5FC 3O4YA 2F3YA 2KYFA 1EH2A 1DGUA 1UHHA 1YUTA 2JU0A 2BECA 1TNWA 5CPVA 4QJ5B 3WHUB 1QLKA 2L98A 1FPWA 1B8CA 1JSAA 5D7FA 3IQQA 2G9BA 4GGFC 1IGVA 2KI6C 2JTZA 1J55A 1BMOA 1K90D 1IKUA 1GQMA 3DVKA 1M63B 1CMFA 1SMGA 1KWOC 4Q04A 3AKAA 1JFJA 5PALA 1MXLC 5GQQC 2K7DA 5I2OA 2JT8A 2EHBA 1WY9A 1S5GZ 3FIAA 5AANA 2HQ8A 3BUOB 5JJGA 1V1GA 2KNEA 5B8IB 1YUSA 1Y1XA 2ZRTA 3VRQA 1EL4A 5CSNA 2K8MB 1MUXA 2H61C 2I2RE 2FCDA 1CMGA 2AUCA 4PHNA 4PE7A 2L50A 2ZKMX 1JUOA 3CWGA 1N0YA 2K7OA 4HREE 1CDNA 4WQ2A 1JC2A 1EXRA 2K7CA 1XVJA 2H61A 2JOJA 3BUWB 3CZTX 4YI8A 2E30A 2MBXA 2KDHA 5K89A 1UHKA 1CFCA 2JNFA 5HYDA 1K9UA 2F2OA 4NDCA 3I5IC 3I5HC 4C0LA 4YGCB 2LNKA 3NSOA 1NCYA 1RJVA 2HPSA 2L0PA 4XJKA 2GGMA 1NYAA 4PE0A 4YGAA 1EG3A 1NP8A 3VRNA 2JTTA 1TCFA 4ZCUA 1KFXS 1HT9A 2BBMA 5DKNA 2KI4C 1BU3A 4L9MA 1IQ5A 3JVTB 1XO5A 1U5IA 1SR6B 1QASA 2AAOA 2JWWA 2HF5A 1FF1A 2LE9B 1H4BA 2JZIA 2KQ6A 4R1EA 2M3WA 1ALWA 3TDUA 4CIDA 3LK0A 1B8RA 2TN4A 1KK8C 4I5KA 2LVIA 4MVFA 1K94A 3MSEB 5DKRA 3VRRA 1R2UA 4BY4A 5IBWA 4PCWA 5CSJA 1PK0D 3D0YB 2KAVA 1TOPA 1VRKA 2M1KB 3GOFA 1LA0A 4FTGA 1CFPA 2F3ZA 1YX8A 2LMTA 3D0YA 4PE1A 1F4QA 5AFPA 1SPYA 3DF0A 4YGEB 5HLVA 4GUKA 3GK1A 3DD4A 2L5XB 3RLZA 1DJXA 1ZACA 1G8IA 1TRFA 4CPVA 1BODA 2WNDA 2DOQA 4A4CA 1S6JA 4WRIA 2GV5A 2M49B 2OTGB 1B4CA 2MA2A 4M2QA 2MLEC 3BXKA 5JOLA 2LAPA 1IJ5A 2JPTA 4GGNA 1KK7Z 1M45A 1SY9A 1XFVO 1XK4A 3O78A 1BF5A 1QIWA 2B1UA 1XK4C 2ISDA 2PRUA 4F0ZB 3EVUA 1J1EA 1N65A 1XFYO 3OP0A 4HRGA 1EG4A 1UP5A 2M8UA 3IQOA 4GPLB 2WCBA 2KAXA 3IF7A 3K21A 1SL7A 5I2QA 3FWCA 2O5GA 4OVNF 2ZFDA 1DF0B 1DT7B 1A2XA 1C7WA 1SBJA 1SL9A 2K7BA 1LKJA 2GGZA 1DJHA 1LVCD 2COLB 1AJ4A 4GGFA 3SJSA 3SG5A 1CLBA 4OV2A 2RGIA 1SCMB 1CFFA 1F71A 1DJGA 4UPGA 2M9GA 1KSOA 3NSLA 3TS5C 4CFRA 2K61A 2MJWB 2Y4QA 3SIBA 3KPXA 2LP3A 1OOJA 2KBMA 5KTYA 2F8PA 1JF2A 3BOWA 4CFQA 2BKHB 1CB1A 2BL0C 2R2IA 3SG7A 3EK4A 5KSZA 1GJYA 1HQVA 1W7IB 1DMOA 1L2OB 1SNLA 1AK8A 4MZLA 1SK6D 1XFZO 2M7NA 4N1FA 4PHJA 1ALVA 4C0JA 1FW4A 2NCPA 2BBNA 1JWDA 1SL8A 2KGRA 2PVBA 1F55A 1WLMA 2F2PA 2KI4B 1JFKA 3CR5X 3JVTC 1XFUO 2EGDA 4MLWA 4PHKA 3H4SE 1YR5A 3CTNA 1UHIA 3BUXB 3PALA 1KK7Y 2MAZA 2HETA 2QPTA 1WLZA 3EKHA 1S6CA 1E8AA 3SG6A 1CDLA 2LMUA 1MXEA 2BE6A 1ZFSA 3I5HB 2SCPA 3GK4X 1KQVA 1NX1A 3NXAA 4NDDA 3CR4X 4OKHA 1CKKA 2CNPA 3EKJA 3O2PA 1XFXO 2Y5IA 1ZOTB 1L2OC 4M2OA 1YURA 3PN7B 4QJ3B 2OS8B 2WOSA 1OMRA 1BT6A 1WRZA 4AQIA 3CGAA 1WDCB 3FWBA 1IQ3A 1R6PA 3RM1A 2NLNA 1J7RA 1F4OA 3NSIA 1J1DA 1UUSA 1UHNA 2NCOA 1H8BA 2BCBA 1KFUL 1KQMC 3I5IB 3ZWHA 3AAKA 2JT0A 2Q91A 4DIRA 1NX2A 1QATA 1KSMA 2LP2A 1GGZA 3SG4A 2ZNEA 1IRJA 2ZNDA 4D1EA 4ICBA 2QACA 1TN4A 5FYXA 1CTRA 3CR2A 1S3PA 1CM1A 4GAOA 1RWYA 2K0JA 2ZN8A 3DVMA 1Y6WA 1G4YR 1EJ3A 1NWDA 2LLSA 3D10A 1AJ5A 4MSPA 1PSRA 1RK9A 1V1FA 1F70A 1K8UA 1DVIA 2EC6C 3WNXB 3JTDB 1KFUS 1BR1B 1NX0A 3I5FB 1S36A 3SG3A 2JULA 1KQMB 2EC6B 4I5NB 1B8LA 1D1OA 1L7ZA 2KHNA 5HLOA 1IWQA 2JQ6A 2PSRA 3I5GC 3KO0A 3OX6A 1A4PA 2BCAA 2LM5A 2OS8C 1GGWA 1QS7A 4YGBB 3PATA 2G2BA 3PN7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDI A;  4WQ3 A;  1AP4 A;  4TNC A;  1U5I B;  1TIZ A;  3BUM B;  1XA5 A;  5AEQ A;  1DJW A;  1PRW A;  1CLM A;  3SIA A;  3BOW B;  4GFT A;  1SRA A;  2JT3 A;  2L4I A;  2M1U A;  1MWN A;  4YI9 A;  1WRL A;  2M0R A;  4DUQ A;  2F33 A;  1CLL A;  1QIV A;  1NCX A;  3CS1 A;  2LMV A;  1F8H A;  2FJU B;  3A4U B;  1KK8 B;  1SW8 A;  1IG5 A;  2KBI A;  1JF0 A;  2KFG A;  4MZK A;  3E3R A;  2CT9 A;  2LVK A;  5DKQ A;  2JXL A;  4YBH B;  3DVJ A;  3EK7 A;  2I94 A;  4XYN A;  1QX2 A;  1SR6 C;  4U8D A;  1MHO A;  3KHE A;  2LUC A;  1TNQ A;  2V53 A;  1BR4 B;  1M46 A;  3SG2 A;  3TUY B;  4AOM A;  1DGV A;  4YRU A;  2LV7 A;  1Q80 A;  1B9A A;  5AER A;  3A8R A;  1FI5 A;  3TUY C;  1A75 A;  3TS5 B;  1A29 A;  2KAY A;  1RRO A;  3LCP C;  1FBV A;  1CDM A;  1QLS A;  1TNX A;  1QX7 A;  5D69 A;  2Q4U A;  1BJF A;  1BG1 A;  3EVR A;  2CTN A;  1K96 A;  1LA3 A;  4OR9 B;  4PAL A;  2WCF A;  3VRP A;  4DCK A;  2MRD A;  1KWO B;  4DS7 A;  4M2P A;  1KCY A;  2LVJ A;  2HQW A;  4HRH A;  3F45 A;  1OSA A;  1K2H A;  2KQY A;  4PDZ A;  3PFV A;  4I5J A;  3PSR A;  2KFF A;  1DTL A;  1AHR A;  1SYM A;  1C07 A;  3PM8 A;  3JTD C;  2LLT A;  4JPZ B;  2KSP A;  1SKT A;  1PVB A;  2WOR A;  4ORC B;  1BLQ A;  4C0K A;  4MN0 A;  5CSF A;  4ETO A;  1S26 D;  3KEV A;  2LHI A;  1FI6 A;  1Y0V H;  3NSK A;  4MBE A;  2FCE A;  2JRF A;  5ER4 X;  4JWQ A;  2ZRS A;  1MF8 B;  4N1G A;  4NDB A;  1LIN A;  2BL0 B;  1M39 A;  3HX4 A;  1YRT B;  1N2D A;  3LL8 B;  3VRO A;  1OQP A;  1RFJ A;  4ORA B;  1TTX A;  1B7T Y;  4MZJ A;  2OPO A;  4GBA A;  4HSZ A;  3LLE A;  3EK8 A;  3DVE A;  4A4B A;  1K95 A;  1CFD A;  1DJY A;  1B47 A;  1IH0 A;  2PAL A;  2MLF C;  2D8N A;  2LHL A;  3O6B A;  1NUB A;  1Y1A A;  1YTZ C;  4NQG A;  1S6I A;  2ZN9 A;  3AAJ A;  2KFH A;  2CXJ A;  2JNX A;  3M0W A;  1YUU A;  4IL1 A;  1QJT A;  1WDC C;  2K2F A;  2LLU A;  3WXA A;  3AKB A;  4P2Y B;  4PHM A;  1J7Q A;  1ODB A;  3WHT B;  1OMV A;  4PE4 A;  1QVI Z;  2CCM A;  1KFX L;  1B1G A;  2H2K A;  1J7P A;  3EVV A;  2MHH A;  1SCV A;  3TDZ A;  1AUI B;  1K93 D;  4ORB B;  3BQ3 A;  1ZMZ A;  4YGD B;  1UWO A;  2L4H A;  4XJK B;  1OMD A;  2LCP A;  1ZUZ A;  2NXQ A;  4QJ4 B;  1JBA A;  1PSB A;  2KOT A;  1YVH A;  5J3X A;  3VGO A;  1XFW O;  1NX3 A;  4E68 A;  4ZCV A;  2PMY A;  4FQO A;  2K2A A;  1F54 A;  4I5L B;  1OZO A;  4CLN A;  2M29 A;  4USL A;  1NCZ A;  1QV0 A;  2NZ0 A;  1C7V A;  1CNP A;  1UHJ A;  3PLF B;  1RTP 1;  2Y1N A;  2KGB C;  1IJ6 A;  4MRX A;  4N5X A;  1B7T Z;  2I7A A;  1LXF C;  1QX5 B;  2IS9 A;  2L51 A;  1NPQ A;  1CM4 A;  1TNP A;  1Y1U A;  3BYA A;  5HKZ A;  2JC2 A;  1WRK A;  2LAN A;  1QV1 A;  1DF0 A;  3OX5 A;  5G08 A;  2FOT A;  1S1E A;  2M97 A;  5ER5 A;  1K9K A;  1PAL A;  2KYC A;  1A03 A;  1W7J B;  2WC8 A;  1DJI A;  1YX7 A;  3OHM B;  3ICB A;  3OB1 B;  1REC A;  3CLN A;  2I18 A;  4BY5 A;  3DF0 B;  5I8N A;  2M7L A;  1BOC A;  1M31 A;  1UUR A;  1MQ1 A;  5BPJ A;  1XYD A;  4MRY A;  4MEW A;  1AVS A;  5KU1 A;  2KI6 D;  2A4J A;  2AMI A;  3FS7 A;  2P6B B;  2LUX A;  2Y1M A;  3I5G B;  1CDP A;  1PUL A;  2BKI B;  1PVA A;  1OZS A;  2LC5 A;  4JQ0 D;  1QTX A;  1S5G Y;  2E6W A;  2O60 A;  2PAS A;  3C1V A;  5I2L A;  1TCO B;  3BUN B;  3KF9 A;  4DRW A;  2BE4 A;  1OE9 B;  1MR8 A;  1SCM C;  2CBL A;  5F6T A;  2L2E A;  1NSH A;  2LVV A;  1YRU B;  5AXI A;  3ZNI A;  2WCE A;  1NIW A;  1J7O A;  2BCX A;  2OTG C;  1K9P A;  2SAS A;  1QXP A;  1X02 A;  3HCM A;  3LK1 A;  3OB2 B;  1YVL A;  2VRG A;  1G33 A;  3QRX A;  4AQJ A;  4OCI A;  1DJZ A;  2JXC A;  5HKW A;  5CSI A;  3GK2 A;  1QVI Y;  4P5O E;  4GNK B;  3TZ1 A;  5TNC A;  1A75 B;  5HKY A;  3I5F C;  3O4Y A;  2F3Y A;  2KYF A;  1EH2 A;  1DGU A;  1UHH A;  1YUT A;  2JU0 A;  2BEC A;  1TNW A;  5CPV A;  4QJ5 B;  3WHU B;  1QLK A;  2L98 A;  1FPW A;  1B8C A;  1JSA A;  5D7F A;  3IQQ A;  2G9B A;  4GGF C;  1IGV A;  2KI6 C;  2JTZ A;  1J55 A;  1BMO A;  1K90 D;  1IKU A;  1GQM A;  3DVK A;  1M63 B;  1CMF A;  1SMG A;  1KWO C;  4Q04 A;  3AKA A;  1JFJ A;  5PAL A;  1MXL C;  5GQQ C;  2K7D A;  5I2O A;  2JT8 A;  2EHB A;  1WY9 A;  1S5G Z;  3FIA A;  5AAN A;  2HQ8 A;  3BUO B;  5JJG A;  1V1G A;  2KNE A;  5B8I B;  1YUS A;  1Y1X A;  2ZRT A;  3VRQ A;  1EL4 A;  5CSN A;  2K8M B;  1MUX A;  2H61 C;  2I2R E;  2FCD A;  1CMG A;  2AUC A;  4PHN A;  4PE7 A;  2L50 A;  2ZKM X;  1JUO A;  3CWG A;  1N0Y A;  2K7O A;  4HRE E;  1CDN A;  4WQ2 A;  1JC2 A;  1EXR A;  2K7C A;  1XVJ A;  2H61 A;  2JOJ A;  3BUW B;  3CZT X;  4YI8 A;  2E30 A;  2MBX A;  2KDH A;  5K89 A;  1UHK A;  1CFC A;  2JNF A;  5HYD A;  1K9U A;  2F2O A;  4NDC A;  3I5I C;  3I5H C;  4C0L A;  4YGC B;  2LNK A;  3NSO A;  1NCY A;  1RJV A;  2HPS A;  2L0P A;  4XJK A;  2GGM A;  1NYA A;  4PE0 A;  4YGA A;  1EG3 A;  1NP8 A;  3VRN A;  2JTT A;  1TCF A;  4ZCU A;  1KFX S;  1HT9 A;  2BBM A;  5DKN A;  2KI4 C;  1BU3 A;  4L9M A;  1IQ5 A;  3JVT B;  1XO5 A;  1U5I A;  1SR6 B;  1QAS A;  2AAO A;  2JWW A;  2HF5 A;  1FF1 A;  2LE9 B;  1H4B A;  2JZI A;  2KQ6 A;  4R1E A;  2M3W A;  1ALW A;  3TDU A;  4CID A;  3LK0 A;  1B8R A;  2TN4 A;  1KK8 C;  4I5K A;  2LVI A;  4MVF A;  1K94 A;  3MSE B;  5DKR A;  3VRR A;  1R2U A;  4BY4 A;  5IBW A;  4PCW A;  5CSJ A;  1PK0 D;  3D0Y B;  2KAV A;  1TOP A;  1VRK A;  2M1K B;  3GOF A;  1LA0 A;  4FTG A;  1CFP A;  2F3Z A;  1YX8 A;  2LMT A;  3D0Y A;  4PE1 A;  1F4Q A;  5AFP A;  1SPY A;  3DF0 A;  4YGE B;  5HLV A;  4GUK A;  3GK1 A;  3DD4 A;  2L5X B;  3RLZ A;  1DJX A;  1ZAC A;  1G8I A;  1TRF A;  4CPV A;  1BOD A;  2WND A;  2DOQ A;  4A4C A;  1S6J A;  4WRI A;  2GV5 A;  2M49 B;  2OTG B;  1B4C A;  2MA2 A;  4M2Q A;  2MLE C;  3BXK A;  5JOL A;  2LAP A;  1IJ5 A;  2JPT A;  4GGN A;  1KK7 Z;  1M45 A;  1SY9 A;  1XFV O;  1XK4 A;  3O78 A;  1BF5 A;  1QIW A;  2B1U A;  1XK4 C;  2ISD A;  2PRU A;  4F0Z B;  3EVU A;  1J1E A;  1N65 A;  1XFY O;  3OP0 A;  4HRG A;  1EG4 A;  1UP5 A;  2M8U A;  3IQO A;  4GPL B;  2WCB A;  2KAX A;  3IF7 A;  3K21 A;  1SL7 A;  5I2Q A;  3FWC A;  2O5G A;  4OVN F;  2ZFD A;  1DF0 B;  1DT7 B;  1A2X A;  1C7W A;  1SBJ A;  1SL9 A;  2K7B A;  1LKJ A;  2GGZ A;  1DJH A;  1LVC D;  2COL B;  1AJ4 A;  4GGF A;  3SJS A;  3SG5 A;  1CLB A;  4OV2 A;  2RGI A;  1SCM B;  1CFF A;  1F71 A;  1DJG A;  4UPG A;  2M9G A;  1KSO A;  3NSL A;  3TS5 C;  4CFR A;  2K61 A;  2MJW B;  2Y4Q A;  3SIB A;  3KPX A;  2LP3 A;  1OOJ A;  2KBM A;  5KTY A;  2F8P A;  1JF2 A;  3BOW A;  4CFQ A;  2BKH B;  1CB1 A;  2BL0 C;  2R2I A;  3SG7 A;  3EK4 A;  5KSZ A;  1GJY A;  1HQV A;  1W7I B;  1DMO A;  1L2O B;  1SNL A;  1AK8 A;  4MZL A;  1SK6 D;  1XFZ O;  2M7N A;  4N1F A;  4PHJ A;  1ALV A;  4C0J A;  1FW4 A;  2NCP A;  2BBN A;  1JWD A;  1SL8 A;  2KGR A;  2PVB A;  1F55 A;  1WLM A;  2F2P A;  2KI4 B;  1JFK A;  3CR5 X;  3JVT C;  1XFU O;  2EGD A;  4MLW A;  4PHK A;  3H4S E;  1YR5 A;  3CTN A;  1UHI A;  3BUX B;  3PAL A;  1KK7 Y;  2MAZ A;  2HET A;  2QPT A;  1WLZ A;  3EKH A;  1S6C A;  1E8A A;  3SG6 A;  1CDL A;  2LMU A;  1MXE A;  2BE6 A;  1ZFS A;  3I5H B;  2SCP A;  3GK4 X;  1KQV A;  1NX1 A;  3NXA A;  4NDD A;  3CR4 X;  4OKH A;  1CKK A;  2CNP A;  3EKJ A;  3O2P A;  1XFX O;  2Y5I A;  1ZOT B;  1L2O C;  4M2O A;  1YUR A;  3PN7 B;  4QJ3 B;  2OS8 B;  2WOS A;  1OMR A;  1BT6 A;  1WRZ A;  4AQI A;  3CGA A;  1WDC B;  3FWB A;  1IQ3 A;  1R6P A;  3RM1 A;  2NLN A;  1J7R A;  1F4O A;  3NSI A;  1J1D A;  1UUS A;  1UHN A;  2NCO A;  1H8B A;  2BCB A;  1KFU L;  1KQM C;  3I5I B;  3ZWH A;  3AAK A;  2JT0 A;  2Q91 A;  4DIR A;  1NX2 A;  1QAT A;  1KSM A;  2LP2 A;  1GGZ A;  3SG4 A;  2ZNE A;  1IRJ A;  2ZND A;  4D1E A;  4ICB A;  2QAC A;  1TN4 A;  5FYX A;  1CTR A;  3CR2 A;  1S3P A;  1CM1 A;  4GAO A;  1RWY A;  2K0J A;  2ZN8 A;  3DVM A;  1Y6W A;  1G4Y R;  1EJ3 A;  1NWD A;  2LLS A;  3D10 A;  1AJ5 A;  4MSP A;  1PSR A;  1RK9 A;  1V1F A;  1F70 A;  1K8U A;  1DVI A;  2EC6 C;  3WNX B;  3JTD B;  1KFU S;  1BR1 B;  1NX0 A;  3I5F B;  1S36 A;  3SG3 A;  2JUL A;  1KQM B;  2EC6 B;  4I5N B;  1B8L A;  1D1O A;  1L7Z A;  2KHN A;  5HLO A;  1IWQ A;  2JQ6 A;  2PSR A;  3I5G C;  3KO0 A;  3OX6 A;  1A4P A;  2BCA A;  2LM5 A;  2OS8 C;  1GGW A;  1QS7 A;  4YGB B;  3PAT A;  2G2B A;  3PN7 C; 
#chains in the Genus database with same CATH topology
 3DY9 A;  4WQ3 A;  3TDI A;  1AP4 A;  4TNC A;  1U5I B;  1TIZ A;  3BUM B;  1XA5 A;  5AEQ A;  1DJW A;  3QME A;  1PRW A;  1CLM A;  3SIA A;  3BOW B;  4GFT A;  1SRA A;  2JT3 A;  2L4I A;  2M1U A;  4INX A;  1MWN A;  4YI9 A;  1WRL A;  2M0R A;  4DUQ A;  2F33 A;  1CLL A;  1QIV A;  1NCX A;  3CS1 A;  5D3O A;  2LMV A;  1F8H A;  2FJU B;  3N7H A;  3A4U B;  1KK8 B;  1SW8 A;  1IG5 A;  2KBI A;  3O4X A;  1JF0 A;  3S0D A;  2KFG A;  4MZK A;  3E3R A;  2CT9 A;  2LVK A;  5DKQ A;  2JXL A;  4YBH B;  1DEK A;  3DVJ A;  3EK7 A;  2I94 A;  4XYN A;  1QX2 A;  1SR6 C;  4U8D A;  1MHO A;  3KHE A;  2LUC A;  1TNQ A;  2K60 A;  2V53 A;  1BR4 B;  1M46 A;  5I94 A;  3SG2 A;  3TUY B;  4AOM A;  1DGV A;  4YRU A;  2LV7 A;  1Q80 A;  1B9A A;  5AER A;  3V2L A;  3A8R A;  3S0F A;  1FI5 A;  3TUY C;  1A75 A;  1TUZ A;  3TS5 B;  3BJH A;  1A29 A;  2KAY A;  1RRO A;  3LCP C;  4FQT A;  1FBV A;  1CDM A;  1QLS A;  1TNX A;  1QX7 A;  5D69 A;  2Q4U A;  1BJF A;  1BG1 A;  3EVR A;  2CTN A;  1K96 A;  1LA3 A;  4OR9 B;  4PAL A;  2WCF A;  3VRP A;  4DCK A;  1OOF A;  1KWO B;  2MRD A;  4M2P A;  4DS7 A;  1KCY A;  2LVJ A;  2HQW A;  4HRH A;  3SS3 A;  3F45 A;  1OSA A;  1TUJ A;  1K2H A;  2KQY A;  4PDZ A;  3PFV A;  4I5J A;  3PSR A;  2KFF A;  2QEO A;  1DTL A;  1AHR A;  1SYM A;  3BFB A;  1C07 A;  3PM8 A;  3JTD C;  2LLT A;  4JPZ B;  2KSP A;  3S0A A;  1SKT A;  4PT1 A;  1PVB A;  1DEL A;  2WOR A;  4ORC B;  1BLQ A;  4C0K A;  4MN0 A;  5CSF A;  4ETO A;  1S26 D;  3KEV A;  2LHI A;  2GTE A;  1FI6 A;  1Y0V H;  3NSK A;  4MBE A;  1C3Z A;  2FCE A;  2JRF A;  5ER4 X;  4JWQ A;  3S0G A;  2ZRS A;  1MF8 B;  4N1G A;  3R1V A;  4NDB A;  1LIN A;  2BL0 B;  1M39 A;  3HX4 A;  1YRT B;  1N2D A;  3LL8 B;  3R1P A;  3VRO A;  1OQP A;  1RFJ A;  4ORA B;  1TTX A;  1B7T Y;  4MZJ A;  3CAB A;  2OPO A;  1OW4 A;  4GBA A;  4HSZ A;  3D74 A;  3LLE A;  3EK8 A;  3DVE A;  4A4B A;  1K95 A;  3L4L A;  1CFD A;  1DJY A;  1B47 A;  1IH0 A;  3NHI A;  2PAL A;  2MLF C;  2D8N A;  2LHL A;  3O6B A;  1NUB A;  1Y1A A;  1YTZ C;  4NQG A;  1S6I A;  2ZN9 A;  3AAJ A;  2KFH A;  2CXJ A;  2JNX A;  3M0W A;  1YUU A;  4IL1 A;  1QJT A;  1WDC C;  4JKT A;  2K2F A;  2LLU A;  3WXA A;  3D78 A;  3AKB A;  4P2Y B;  2PYQ A;  4PHM A;  1J7Q A;  1ODB A;  3WHT B;  1OMV A;  4PE4 A;  1QVI Z;  2CCM A;  1KFX L;  1B1G A;  4OZD A;  2H2K A;  1J7P A;  3EVV A;  3CZ1 A;  2MHH A;  1SCV A;  3TDZ A;  1AUI B;  1K93 D;  4ORB B;  3BQ3 A;  1ZMZ A;  2WC5 A;  4YGD B;  1UWO A;  2L4H A;  4XJK B;  1OMD A;  2L5Y A;  2LCP A;  1ZUZ A;  2NXQ A;  4QJ4 B;  1JBA A;  1PSB A;  2KLD A;  2KOT A;  3IVT A;  1YVH A;  5J3X A;  3VGO A;  1XFW O;  4IJ7 A;  1NX3 A;  4E68 A;  4ZCV A;  2PMY A;  4FQO A;  3BFH A;  2K2A A;  1F54 A;  4I5L B;  1OZO A;  4CLN A;  3L47 A;  2M29 A;  4USL A;  2KLE A;  1NCZ A;  1QV0 A;  2NZ0 A;  1C7V A;  1CNP A;  1UHJ A;  3PLF B;  1RTP 1;  2Y1N A;  2KGB C;  1IJ6 A;  4MRX A;  4N5X A;  1B7T Z;  2I7A A;  1LXF C;  1QX5 B;  2IS9 A;  2L51 A;  1NPQ A;  1CM4 A;  1TNP A;  1Y1U A;  4JD9 A;  3BYA A;  5HKZ A;  1TWO A;  2JC2 A;  1WRK A;  2LAN A;  1QV1 A;  1DF0 A;  3OX5 A;  5G08 A;  1DC1 A;  2FOT A;  1S1E A;  2M97 A;  2P70 A;  3R72 A;  5ER5 A;  1K9K A;  1PAL A;  2KYC A;  1A03 A;  1W7J B;  2WC8 A;  1DJI A;  1YX7 A;  3OHM B;  3ICB A;  3OB1 B;  1REC A;  3CLN A;  2I18 A;  4BY5 A;  3DF0 B;  5I8N A;  2M7L A;  1BOC A;  1M31 A;  1UUR A;  1MQ1 A;  3PM2 A;  1XYD A;  4MRY A;  5BPJ A;  4MEW A;  2WCL A;  1AVS A;  5KU1 A;  3FE8 A;  2BNX A;  2KI6 D;  2A4J A;  2AMI A;  2WCJ A;  3FS7 A;  2P6B B;  2LUX A;  2Y1M A;  3I5G B;  1CDP A;  1PUL A;  2BKI B;  1PVA A;  1OZS A;  2LC5 A;  4JQ0 D;  1QTX A;  1S5G Y;  2E6W A;  2O60 A;  2PAS A;  3C1V A;  5DIC A;  5I2L A;  1TCO B;  3BUN B;  3CZ2 A;  3KF9 A;  2BE4 A;  4DRW A;  1OE9 B;  1MR8 A;  1SCM C;  2CBL A;  5F6T A;  2L2E A;  1NSH A;  2LVV A;  1YRU B;  5AXI A;  3ZNI A;  2WCE A;  1NIW A;  1J7O A;  2BCX A;  2OTG C;  1K9P A;  2SAS A;  1QXP A;  1OOH A;  1X02 A;  3HCM A;  3LK1 A;  1YVL A;  3OB2 B;  1T14 A;  2VRG A;  3VB1 A;  1G33 A;  3EG5 B;  3QRX A;  4AQJ A;  4OCI A;  1DJZ A;  2JXC A;  3B7A A;  5HKW A;  5CSI A;  3GK2 A;  1QVI Y;  4P5O E;  2WCK A;  4GNK B;  3TZ1 A;  5TNC A;  1A75 B;  5HKY A;  3I5F C;  3O4Y A;  2F3Y A;  2KYF A;  1EH2 A;  1DGU A;  1UHH A;  1YUT A;  2JU0 A;  2BEC A;  1TNW A;  5CPV A;  2QEH A;  4QJ5 B;  3WHU B;  1QLK A;  2L98 A;  1FPW A;  1B8C A;  1ORG A;  1JSA A;  5D7F A;  3IQQ A;  2G9B A;  4GGF C;  1IGV A;  2KI6 C;  2JTZ A;  1J55 A;  3CYZ A;  2QEB A;  1BMO A;  1K90 D;  1IKU A;  1GQM A;  3DVK A;  1M63 B;  1CMF A;  1SMG A;  1KWO C;  4Q04 A;  3AKA A;  1C3Y A;  4KYN A;  1JFJ A;  5PAL A;  1MXL C;  5GQQ C;  2K7D A;  5I2O A;  2JT8 A;  2EHB A;  1WY9 A;  1S5G Z;  3B6X A;  3FIA A;  5AAN A;  2HQ8 A;  3BUO B;  2FJY A;  5JJG A;  1V1G A;  2KNE A;  5B8I B;  1YUS A;  1Y1X A;  2ZRT A;  3VRQ A;  1EL4 A;  5CSN A;  3D75 A;  2K8M B;  1MUX A;  2H61 C;  2I2R E;  2FCD A;  1CMG A;  2AUC A;  4PHN A;  4PE7 A;  1LS8 A;  2L50 A;  2ZKM X;  1JUO A;  3CWG A;  1N0Y A;  2K7O A;  4HRE E;  2KPH A;  1CDN A;  4WQ2 A;  1JC2 A;  1EXR A;  2K7C A;  1XVJ A;  2H61 A;  2JOJ A;  3BUW B;  3CZT X;  4YI8 A;  2E30 A;  2MBX A;  2KDH A;  5K89 A;  1UHK A;  3CDN A;  1CFC A;  2JNF A;  5HYD A;  1K9U A;  2F2O A;  3FE9 A;  4NDC A;  3I5I C;  3I5H C;  3NHT A;  4YGC B;  4C0L A;  2LNK A;  3NSO A;  1NCY A;  1RJV A;  2HPS A;  2L0P A;  4XJK A;  2GGM A;  1IIO A;  1NYA A;  3DYE A;  4PE0 A;  3UO9 A;  4YGA A;  1EG3 A;  1NP8 A;  3VRN A;  2JTT A;  1TCF A;  2P71 A;  4ZCU A;  1KFX S;  1HT9 A;  3D73 A;  2BBM A;  5DKN A;  2KI4 C;  5EL2 A;  1BU3 A;  4L9M A;  1IQ5 A;  3JVT B;  1XO5 A;  1U5I A;  1SR6 B;  3SS5 A;  1QAS A;  3PN7 C;  2AAO A;  2JWW A;  2HF5 A;  1FF1 A;  2LE9 B;  1H4B A;  2JZI A;  2KQ6 A;  4R1E A;  2M3W A;  1ALW A;  3TDU A;  4CID A;  3LK0 A;  1B8R A;  2TN4 A;  1KK8 C;  4I5K A;  2LVI A;  4MVF A;  1Z4H A;  1K94 A;  3MSE B;  5DKR A;  3VRR A;  1R2U A;  4BY4 A;  1OOG A;  2WCH A;  4PCW A;  5CSJ A;  5IBW A;  1PK0 D;  3D0Y B;  1P28 A;  2KAV A;  1TOP A;  1VRK A;  2M1K B;  3GOF A;  1LA0 A;  4FTG A;  1CFP A;  2F3Z A;  3OGN A;  1YX8 A;  2LMT A;  3D0Y A;  4PE1 A;  1F4Q A;  3L4A A;  5AFP A;  1SPY A;  3DF0 A;  3S0E A;  4YGE B;  5HLV A;  4GUK A;  3GK1 A;  3DD4 A;  2L5X B;  3RLZ A;  1DJX A;  5FI2 A;  1ZAC A;  1G8I A;  2L2C A;  1TRF A;  4CPV A;  1BOD A;  3R1O A;  2WND A;  2DOQ A;  1W9Z A;  4A4C A;  1S6J A;  4WRI A;  2GV5 A;  2M49 B;  2OTG B;  1B4C A;  2MA2 A;  4M2Q A;  3BFA A;  2MLE C;  3BXK A;  5JOL A;  2LAP A;  1IJ5 A;  2JPT A;  4GGN A;  1KK7 Z;  1M45 A;  1SY9 A;  1XFV O;  1XK4 A;  3O78 A;  1BF5 A;  1QIW A;  2B1U A;  1XK4 C;  2ISD A;  2PRU A;  4F0Z B;  3EVU A;  1J1E A;  1N65 A;  1XFY O;  3OP0 A;  4HRG A;  1EG4 A;  1UP5 A;  2M8U A;  3IQO A;  4GPL B;  2WCB A;  2KAX A;  3IF7 A;  3K21 A;  1SL7 A;  5I2Q A;  3FWC A;  2O5G A;  4OVN F;  2ZFD A;  1DF0 B;  1DT7 B;  1A2X A;  1C7W A;  3D76 A;  1SBJ A;  1SL9 A;  2K7B A;  1LKJ A;  2GGZ A;  1DJH A;  1LVC D;  2COL B;  1AJ4 A;  4GGF A;  2WC6 A;  3SJS A;  1XFR A;  3SG5 A;  1CLB A;  4OV2 A;  2RGI A;  1SCM B;  1CFF A;  5FI6 A;  1F71 A;  1DJG A;  4UPG A;  2M9G A;  3RZS A;  3SS4 A;  1KSO A;  3NSL A;  3TS5 C;  4CFR A;  2K61 A;  2MJW B;  2Y4Q A;  3SIB A;  3KPX A;  2LP3 A;  1OOJ A;  2KBM A;  5KTY A;  2F8P A;  2H8V A;  1JF2 A;  3BOW A;  1GM0 A;  4CFQ A;  2BKH B;  1CB1 A;  2BL0 C;  2R2I A;  3DXL A;  3EK4 A;  3SG7 A;  3B87 A;  5KSZ A;  1GJY A;  1HQV A;  1W7I B;  1DMO A;  1L2O B;  1SNL A;  2YGU A;  1AK8 A;  1SSE B;  4MZL A;  1SK6 D;  1XFZ O;  2M7N A;  4N1F A;  4PHJ A;  1ALV A;  4C0J A;  1FW4 A;  2NCP A;  2BBN A;  1JWD A;  1SL8 A;  1Z2C B;  1DQE A;  2KGR A;  2PVB A;  3Q8I A;  1WLM A;  1F55 A;  2F2P A;  2KI4 B;  1JFK A;  3CR5 X;  3JVT C;  1XFU O;  2EGD A;  2QEV A;  4MLW A;  4PHK A;  3H4S E;  1YR5 A;  3CTN A;  1UHI A;  3BUX B;  3PAL A;  1KK7 Y;  2MAZ A;  2HET A;  2QPT A;  1WLZ A;  3EKH A;  1S6C A;  1E8A A;  3SG6 A;  1CDL A;  2LMU A;  3B86 A;  1MXE A;  2BE6 A;  1ZFS A;  3I5H B;  2SCP A;  4INW A;  5HL1 A;  1QWV A;  3GK4 X;  1KQV A;  1NX1 A;  3NXA A;  4NDD A;  2QDI A;  3CR4 X;  4OKH A;  1CKK A;  2CNP A;  3EKJ A;  3O2P A;  1XFX O;  2Y5I A;  1OOI X;  1ZOT B;  1L2O C;  4M2O A;  1YUR A;  3PN7 B;  2BAP A;  3D77 A;  4QJ3 B;  2OS8 B;  2WOS A;  1OMR A;  1BT6 A;  3B88 A;  3K1E A;  1WRZ A;  4AQI A;  3CGA A;  1WDC B;  3FWB A;  1IQ3 A;  1R6P A;  3RM1 A;  3OBV A;  2NLN A;  1J7R A;  1F4O A;  3NSI A;  1J1D A;  1UUS A;  1UHN A;  2NCO A;  1H8B A;  2BCB A;  1KFU L;  1KQM C;  3I5I B;  3ZWH A;  3AAK A;  2JT0 A;  2Q91 A;  4DIR A;  1NX2 A;  1QAT A;  2PQL A;  1KSM A;  2ERB A;  2LP2 A;  1GGZ A;  2JPO A;  3SG4 A;  4F7F A;  2ZNE A;  1IRJ A;  2ZND A;  4D1E A;  4ICB A;  3S0B A;  3DZT A;  2QAC A;  1TN4 A;  5FYX A;  1CTR A;  3CR2 A;  1S3P A;  1CM1 A;  4GAO A;  1RWY A;  2K0J A;  2ZN8 A;  3DVM A;  1Y6W A;  1G4Y R;  1EJ3 A;  3UNW A;  1NWD A;  2LLS A;  3D10 A;  1AJ5 A;  3FE6 A;  4MSP A;  1PSR A;  1RK9 A;  1V1F A;  1F70 A;  2WCM A;  1K8U A;  5FI7 A;  1DVI A;  2EC6 C;  3PJI A;  3WNX B;  3JTD B;  1KFU S;  1BR1 B;  1NX0 A;  3I5F B;  1S36 A;  3SG3 A;  2JUL A;  1KQM B;  2EC6 B;  4I5N B;  1B8L A;  1D1O A;  1L7Z A;  2KHN A;  5HLO A;  1IWQ A;  2JQ6 A;  2PSR A;  3I5G C;  3KO0 A;  3OX6 A;  1A4P A;  2BCA A;  2LM5 A;  2OS8 C;  3CZ0 A;  1GGW A;  1QS7 A;  4YGB B;  3PAT A;  2G2B A;  3NGV A; 
#chains in the Genus database with same CATH homology
 3TDI A;  4WQ3 A;  1AP4 A;  4TNC A;  1U5I B;  1TIZ A;  3BUM B;  1XA5 A;  5AEQ A;  1DJW A;  1PRW A;  1CLM A;  3SIA A;  3BOW B;  4GFT A;  1SRA A;  2JT3 A;  2L4I A;  2M1U A;  1MWN A;  4YI9 A;  1WRL A;  2M0R A;  4DUQ A;  2F33 A;  1CLL A;  1QIV A;  1NCX A;  3CS1 A;  2LMV A;  1F8H A;  2FJU B;  3A4U B;  1KK8 B;  1SW8 A;  1IG5 A;  2KBI A;  1JF0 A;  2KFG A;  4MZK A;  3E3R A;  2CT9 A;  2LVK A;  5DKQ A;  2JXL A;  4YBH B;  3DVJ A;  3EK7 A;  2I94 A;  4XYN A;  1QX2 A;  1SR6 C;  4U8D A;  1MHO A;  3KHE A;  2LUC A;  1TNQ A;  2V53 A;  1BR4 B;  1M46 A;  3SG2 A;  3TUY B;  4AOM A;  1DGV A;  4YRU A;  2LV7 A;  1Q80 A;  1B9A A;  5AER A;  3A8R A;  1FI5 A;  3TUY C;  1A75 A;  3TS5 B;  1A29 A;  2KAY A;  1RRO A;  3LCP C;  1FBV A;  1CDM A;  1QLS A;  1TNX A;  1QX7 A;  5D69 A;  2Q4U A;  1BJF A;  1BG1 A;  3EVR A;  2CTN A;  1K96 A;  1LA3 A;  4OR9 B;  4PAL A;  2WCF A;  3VRP A;  4DCK A;  2MRD A;  1KWO B;  4DS7 A;  4M2P A;  1KCY A;  2LVJ A;  2HQW A;  4HRH A;  3F45 A;  1OSA A;  1K2H A;  2KQY A;  4PDZ A;  3PFV A;  4I5J A;  3PSR A;  2KFF A;  1DTL A;  1AHR A;  1SYM A;  1C07 A;  3PM8 A;  3JTD C;  2LLT A;  4JPZ B;  2KSP A;  1SKT A;  1PVB A;  2WOR A;  4ORC B;  1BLQ A;  4C0K A;  4MN0 A;  5CSF A;  4ETO A;  1S26 D;  3KEV A;  2LHI A;  1FI6 A;  1Y0V H;  3NSK A;  4MBE A;  2FCE A;  2JRF A;  5ER4 X;  4JWQ A;  2ZRS A;  1MF8 B;  4N1G A;  4NDB A;  1LIN A;  2BL0 B;  1M39 A;  3HX4 A;  1YRT B;  1N2D A;  3LL8 B;  3VRO A;  1OQP A;  1RFJ A;  4ORA B;  1TTX A;  1B7T Y;  4MZJ A;  2OPO A;  4GBA A;  4HSZ A;  3LLE A;  3EK8 A;  3DVE A;  4A4B A;  1K95 A;  1CFD A;  1DJY A;  1B47 A;  1IH0 A;  2PAL A;  2MLF C;  2D8N A;  2LHL A;  3O6B A;  1NUB A;  1Y1A A;  1YTZ C;  4NQG A;  1S6I A;  2ZN9 A;  3AAJ A;  2KFH A;  2CXJ A;  2JNX A;  3M0W A;  1YUU A;  4IL1 A;  1QJT A;  1WDC C;  2K2F A;  2LLU A;  3WXA A;  3AKB A;  4P2Y B;  4PHM A;  1J7Q A;  1ODB A;  3WHT B;  1OMV A;  4PE4 A;  1QVI Z;  2CCM A;  1KFX L;  1B1G A;  2H2K A;  1J7P A;  3EVV A;  2MHH A;  1SCV A;  3TDZ A;  1AUI B;  1K93 D;  4ORB B;  3BQ3 A;  1ZMZ A;  4YGD B;  1UWO A;  2L4H A;  4XJK B;  1OMD A;  2LCP A;  1ZUZ A;  2NXQ A;  4QJ4 B;  1JBA A;  1PSB A;  2KOT A;  1YVH A;  5J3X A;  3VGO A;  1XFW O;  1NX3 A;  4E68 A;  4ZCV A;  2PMY A;  4FQO A;  2K2A A;  1F54 A;  4I5L B;  1OZO A;  4CLN A;  2M29 A;  4USL A;  1NCZ A;  1QV0 A;  2NZ0 A;  1C7V A;  1CNP A;  1UHJ A;  3PLF B;  1RTP 1;  2Y1N A;  2KGB C;  1IJ6 A;  4MRX A;  4N5X A;  1B7T Z;  2I7A A;  1LXF C;  1QX5 B;  2IS9 A;  2L51 A;  1NPQ A;  1CM4 A;  1TNP A;  1Y1U A;  3BYA A;  5HKZ A;  2JC2 A;  1WRK A;  2LAN A;  1QV1 A;  1DF0 A;  3OX5 A;  5G08 A;  2FOT A;  1S1E A;  2M97 A;  5ER5 A;  1K9K A;  1PAL A;  2KYC A;  1A03 A;  1W7J B;  2WC8 A;  1DJI A;  1YX7 A;  3OHM B;  3ICB A;  3OB1 B;  1REC A;  3CLN A;  2I18 A;  4BY5 A;  3DF0 B;  5I8N A;  2M7L A;  1BOC A;  1M31 A;  1UUR A;  1MQ1 A;  5BPJ A;  1XYD A;  4MRY A;  4MEW A;  1AVS A;  5KU1 A;  2KI6 D;  2A4J A;  2AMI A;  3FS7 A;  2P6B B;  2LUX A;  2Y1M A;  3I5G B;  1CDP A;  1PUL A;  2BKI B;  1PVA A;  1OZS A;  2LC5 A;  4JQ0 D;  1QTX A;  1S5G Y;  2E6W A;  2O60 A;  2PAS A;  3C1V A;  5I2L A;  1TCO B;  3BUN B;  3KF9 A;  4DRW A;  2BE4 A;  1OE9 B;  1MR8 A;  1SCM C;  2CBL A;  5F6T A;  2L2E A;  1NSH A;  2LVV A;  1YRU B;  5AXI A;  3ZNI A;  2WCE A;  1NIW A;  1J7O A;  2BCX A;  2OTG C;  1K9P A;  2SAS A;  1QXP A;  1X02 A;  3HCM A;  3LK1 A;  3OB2 B;  1YVL A;  2VRG A;  1G33 A;  3QRX A;  4AQJ A;  4OCI A;  1DJZ A;  2JXC A;  5HKW A;  5CSI A;  3GK2 A;  1QVI Y;  4P5O E;  4GNK B;  3TZ1 A;  5TNC A;  1A75 B;  5HKY A;  3I5F C;  3O4Y A;  2F3Y A;  2KYF A;  1EH2 A;  1DGU A;  1UHH A;  1YUT A;  2JU0 A;  2BEC A;  1TNW A;  5CPV A;  4QJ5 B;  3WHU B;  1QLK A;  2L98 A;  1FPW A;  1B8C A;  1JSA A;  5D7F A;  3IQQ A;  2G9B A;  4GGF C;  1IGV A;  2KI6 C;  2JTZ A;  1J55 A;  1BMO A;  1K90 D;  1IKU A;  1GQM A;  3DVK A;  1M63 B;  1CMF A;  1SMG A;  1KWO C;  4Q04 A;  3AKA A;  1JFJ A;  5PAL A;  1MXL C;  5GQQ C;  2K7D A;  5I2O A;  2JT8 A;  2EHB A;  1WY9 A;  1S5G Z;  3FIA A;  5AAN A;  2HQ8 A;  3BUO B;  5JJG A;  1V1G A;  2KNE A;  5B8I B;  1YUS A;  1Y1X A;  2ZRT A;  3VRQ A;  1EL4 A;  5CSN A;  2K8M B;  1MUX A;  2H61 C;  2I2R E;  2FCD A;  1CMG A;  2AUC A;  4PHN A;  4PE7 A;  2L50 A;  2ZKM X;  1JUO A;  3CWG A;  1N0Y A;  2K7O A;  4HRE E;  1CDN A;  4WQ2 A;  1JC2 A;  1EXR A;  2K7C A;  1XVJ A;  2H61 A;  2JOJ A;  3BUW B;  3CZT X;  4YI8 A;  2E30 A;  2MBX A;  2KDH A;  5K89 A;  1UHK A;  1CFC A;  2JNF A;  5HYD A;  1K9U A;  2F2O A;  4NDC A;  3I5I C;  3I5H C;  4C0L A;  4YGC B;  2LNK A;  3NSO A;  1NCY A;  1RJV A;  2HPS A;  2L0P A;  4XJK A;  2GGM A;  1NYA A;  4PE0 A;  4YGA A;  1EG3 A;  1NP8 A;  3VRN A;  2JTT A;  1TCF A;  4ZCU A;  1KFX S;  1HT9 A;  2BBM A;  5DKN A;  2KI4 C;  1BU3 A;  4L9M A;  1IQ5 A;  3JVT B;  1XO5 A;  1U5I A;  1SR6 B;  1QAS A;  2AAO A;  2JWW A;  2HF5 A;  1FF1 A;  2LE9 B;  1H4B A;  2JZI A;  2KQ6 A;  4R1E A;  2M3W A;  1ALW A;  3TDU A;  4CID A;  3LK0 A;  1B8R A;  2TN4 A;  1KK8 C;  4I5K A;  2LVI A;  4MVF A;  1K94 A;  3MSE B;  5DKR A;  3VRR A;  1R2U A;  4BY4 A;  5IBW A;  4PCW A;  5CSJ A;  1PK0 D;  3D0Y B;  2KAV A;  1TOP A;  1VRK A;  2M1K B;  3GOF A;  1LA0 A;  4FTG A;  1CFP A;  2F3Z A;  1YX8 A;  2LMT A;  3D0Y A;  4PE1 A;  1F4Q A;  5AFP A;  1SPY A;  3DF0 A;  4YGE B;  5HLV A;  4GUK A;  3GK1 A;  3DD4 A;  2L5X B;  3RLZ A;  1DJX A;  1ZAC A;  1G8I A;  1TRF A;  4CPV A;  1BOD A;  2WND A;  2DOQ A;  4A4C A;  1S6J A;  4WRI A;  2GV5 A;  2M49 B;  2OTG B;  1B4C A;  2MA2 A;  4M2Q A;  2MLE C;  3BXK A;  5JOL A;  2LAP A;  1IJ5 A;  2JPT A;  4GGN A;  1KK7 Z;  1M45 A;  1SY9 A;  1XFV O;  1XK4 A;  3O78 A;  1BF5 A;  1QIW A;  2B1U A;  1XK4 C;  2ISD A;  2PRU A;  4F0Z B;  3EVU A;  1J1E A;  1N65 A;  1XFY O;  3OP0 A;  4HRG A;  1EG4 A;  1UP5 A;  2M8U A;  3IQO A;  4GPL B;  2WCB A;  2KAX A;  3IF7 A;  3K21 A;  1SL7 A;  5I2Q A;  3FWC A;  2O5G A;  4OVN F;  2ZFD A;  1DF0 B;  1DT7 B;  1A2X A;  1C7W A;  1SBJ A;  1SL9 A;  2K7B A;  1LKJ A;  2GGZ A;  1DJH A;  1LVC D;  2COL B;  1AJ4 A;  4GGF A;  3SJS A;  3SG5 A;  1CLB A;  4OV2 A;  2RGI A;  1SCM B;  1CFF A;  1F71 A;  1DJG A;  4UPG A;  2M9G A;  1KSO A;  3NSL A;  3TS5 C;  4CFR A;  2K61 A;  2MJW B;  2Y4Q A;  3SIB A;  3KPX A;  2LP3 A;  1OOJ A;  2KBM A;  5KTY A;  2F8P A;  1JF2 A;  3BOW A;  4CFQ A;  2BKH B;  1CB1 A;  2BL0 C;  2R2I A;  3SG7 A;  3EK4 A;  5KSZ A;  1GJY A;  1HQV A;  1W7I B;  1DMO A;  1L2O B;  1SNL A;  1AK8 A;  4MZL A;  1SK6 D;  1XFZ O;  2M7N A;  4N1F A;  4PHJ A;  1ALV A;  4C0J A;  1FW4 A;  2NCP A;  2BBN A;  1JWD A;  1SL8 A;  2KGR A;  2PVB A;  1F55 A;  1WLM A;  2F2P A;  2KI4 B;  1JFK A;  3CR5 X;  3JVT C;  1XFU O;  2EGD A;  4MLW A;  4PHK A;  3H4S E;  1YR5 A;  3CTN A;  1UHI A;  3BUX B;  3PAL A;  1KK7 Y;  2MAZ A;  2HET A;  2QPT A;  1WLZ A;  3EKH A;  1S6C A;  1E8A A;  3SG6 A;  1CDL A;  2LMU A;  1MXE A;  2BE6 A;  1ZFS A;  3I5H B;  2SCP A;  3GK4 X;  1KQV A;  1NX1 A;  3NXA A;  4NDD A;  3CR4 X;  4OKH A;  1CKK A;  2CNP A;  3EKJ A;  3O2P A;  1XFX O;  2Y5I A;  1ZOT B;  1L2O C;  4M2O A;  1YUR A;  3PN7 B;  4QJ3 B;  2OS8 B;  2WOS A;  1OMR A;  1BT6 A;  1WRZ A;  4AQI A;  3CGA A;  1WDC B;  3FWB A;  1IQ3 A;  1R6P A;  3RM1 A;  2NLN A;  1J7R A;  1F4O A;  3NSI A;  1J1D A;  1UUS A;  1UHN A;  2NCO A;  1H8B A;  2BCB A;  1KFU L;  1KQM C;  3I5I B;  3ZWH A;  3AAK A;  2JT0 A;  2Q91 A;  4DIR A;  1NX2 A;  1QAT A;  1KSM A;  2LP2 A;  1GGZ A;  3SG4 A;  2ZNE A;  1IRJ A;  2ZND A;  4D1E A;  4ICB A;  2QAC A;  1TN4 A;  5FYX A;  1CTR A;  3CR2 A;  1S3P A;  1CM1 A;  4GAO A;  1RWY A;  2K0J A;  2ZN8 A;  3DVM A;  1Y6W A;  1G4Y R;  1EJ3 A;  1NWD A;  2LLS A;  3D10 A;  1AJ5 A;  4MSP A;  1PSR A;  1RK9 A;  1V1F A;  1F70 A;  1K8U A;  1DVI A;  2EC6 C;  3WNX B;  3JTD B;  1KFU S;  1BR1 B;  1NX0 A;  3I5F B;  1S36 A;  3SG3 A;  2JUL A;  1KQM B;  2EC6 B;  4I5N B;  1B8L A;  1D1O A;  1L7Z A;  2KHN A;  5HLO A;  1IWQ A;  2JQ6 A;  2PSR A;  3I5G C;  3KO0 A;  3OX6 A;  1A4P A;  2BCA A;  2LM5 A;  2OS8 C;  1GGW A;  1QS7 A;  4YGB B;  3PAT A;  2G2B A;  3PN7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...