1UP5A

Chicken calmodulin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
145
structure length
144
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGELTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and Preliminary X-Ray Analysis of Two New Crystal Forms of Calmodulin
pubmed doi rcsb
molecule keywords Calmodulin
molecule tags Signalling protein
total genus 55
structure length 144
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1up5A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1up5A02
3MSEB 1UP5A 1BT6A 2AUCA 5AERA 1S6JA 1XFVO 3ICBA 4N1FA 5D7FA 1RJVA 1V1GA 1JSAA 1Y1XA 2KI6C 1UUSA 1ZUZA 2BL0C 1JF2A 3I5FB 5PALA 3BOWA 1EXRA 2MLFC 1K95A 1KSMA 1OMVA 3SG2A 2WCFA 1MHOA 1DJHA 4XJKA 1NWDA 3GK2A 1F8HA 5G08A 2K7CA 1YVHA 1DJIA 4PE1A 4DS7A 1NCXA 2HPSA 4HSZA 1XA5A 2PSRA 3C1VA 2Y4QA 4YGBB 1CNPA 3SJSA 2OTGB 4ORCB 1SRAA 1CLBA 1TRFA 1F4QA 2SCPA 5BPJA 3I5FC 1YX8A 1LKJA 1DJGA 1WDCB 2KI4B 3OP0A 2M1UA 1CDPA 2KQYA 2KYFA 4I5KA 1QV1A 2CTNA 4TNCA 3VRRA 1LINA 2K7BA 1ZOTB 1N0YA 1QIVA 3FWCA 1KK8B 1AK8A 4N5XA 1XYDA 5AXIA 1MXEA 1WLZA 5KU1A 2SASA 2M8UA 4PCWA 1D1OA 2OTGC 2HETA 3WNXB 1F71A 1WDCC 2M9GA 1JC2A 2LVIA 1E8AA 1HT9A 3E3RA 3I5GB 3PATA 4M2QA 4MZJA 5HLVA 1M31A 4JWQA 1MR8A 3TDZA 2K7OA 2I94A 1NCZA 1L2OB 2JULA 2JT8A 3TDUA 4XYNA 1NIWA 1H4BA 3A8RA 1SKTA 2Q4UA 1TNQA 1AUIB 1ZACA 1Q80A 2K2FA 2ZN9A 2LE9B 3JTDB 3VROA 2JPTA 4DUQA 1SPYA 2LVKA 1DT7B 2O5GA 2LLSA 1IRJA 2NXQA 1KQMB 2HQ8A 2JOJA 4PDZA 2E30A 3HCMA 2P6BB 3OB1B 1IH0A 1NSHA 1YVLA 4GPLB 3I5GC 3PLFB 3RM1A 1RECA 4D1EA 1L2OC 1MUXA 1S36A 1TN4A 2FOTA 3LK0A 4C0KA 1AJ5A 1CFFA 4UPGA 3NXAA 1K9UA 1G4YR 4R1EA 1PVBA 1OZSA 1Y1UA 3JTDC 1SL9A 1GGZA 3RLZA 4PHMA 1V1FA 1CDNA 2KFHA 5HKZA 1KQMC 5DKNA 2MLEC 3SG3A 1KK7Z 4NDDA 1G8IA 2JT3A 2H61C 2ZKMX 2PVBA 2M1KB 1FPWA 1CLMA 1N2DA 4Q04A 5HLOA 4CFQA 1A2XA 3I5HB 3I5IB 1QS7A 1YUUA 4N1GA 3PALA 1K90D 3LK1A 4USLA 1FI5A 5JJGA 2LHLA 4MBEA 1S3PA 3AAJA 1L7ZA 1FW4A 1XK4C 1KFXS 3CZTX 2M7LA 1F4OA 2HQWA 3IF7A 5KTYA 1DGUA 2K8MB 3OHMB 2LUXA 1ZMZA 2H61A 3O78A 4BY4A 1F70A 3WXAA 1TCOB 3BUOB 3I5HC 3BUXB 3I5IC 3IQOA 1QX2A 4MZKA 2JWWA 1CFPA 1A4PA 1WY9A 1KFXL 1YX7A 4YI9A 3SIAA 1YURA 2WCEA 1SCMB 2CT9A 2LUCA 2BBNA 2FCDA 2GGZA 2DOQA 1XK4A 2K0JA 3D0YB 4I5LB 4ZCVA 4BY5A 1B1GA 2KYCA 2BCBA 1NX0A 3PFVA 1BR4B 1SL8A 1RWYA 1M46A 4M2PA 5K89A 1KK7Y 1DJYA 2Y1MA 1ODBA 2K7DA 1SCVA 2ISDA 3FIAA 1SCMC 2NCOA 4YGDB 2GGMA 1B9AA 1RROA 2ZFDA 2JQ6A 3CR4X 4JQ0D 2LCPA 3SG6A 2KAXA 1CMGA 1C7WA 2KFFA 4WRIA 4PHJA 2CCMA 2QPTA 3SIBA 3KHEA 1IQ3A 1CFDA 3LL8B 2ZN8A 2MAZA 1C07A 1KCYA 2IS9A 1LVCD 1M39A 1GQMA 1TNPA 2KSPA 2L2EA 2BBMA 2I2RE 1NX1A 5GQQC 1DMOA 4GGFC 3DF0B 1J1DA 1CDMA 3AKBA 4JPZB 4U8DA 1EL4A 5CSJA 1A75B 3D0YA 4OVNF 1K8UA 4PALA 1A29A 2KGRA 3OB2B 4ETOA 5CPVA 1QATA 3CGAA 1OOJA 1YR5A 2BECA 5I2QA 1FBVA 1J7RA 1S6CA 2R2IA 3KEVA 1UHKA 4MZLA 4AOMA 4FQOA 4OV2A 2F2OA 4GBAA 1BF5A 1GGWA 3GK4X 2M97A 2GV5A 1F54A 4GGFA 2LC5A 1TNXA 1DGVA 1EJ3A 4QJ3B 3OX5A 4CPVA 1K96A 1KQVA 1JWDA 2KI4C 3NSOA 2L0PA 5FYXA 2LMTA 3KO0A 2MRDA 1PULA 1B8CA 1TCFA 1KWOB 1QX5B 5DKRA 1CB1A 1JBAA 1NP8A 1S6IA 1SNLA 4FTGA 1K2HA 2I18A 1KK8C 1YRTB 1WLMA 2M49B 2KNEA 3O4YA 1J7OA 2WOSA 3DF0A 1IJ6A 3WHTB 2ZNDA 1UURA 2G2BA 4MSPA 1NX3A 1A75A 2OS8B 5I2LA 1XFUO 1NYAA 1ALVA 2BKIB 1PALA 3A4UB 3BUNB 1WRLA 4WQ2A 1KWOC 4HREE 1BU3A 1UHJA 1U5IB 1EG3A 1RFJA 1SY9A 2KI6D 4PHNA 1B7TZ 1SYMA 1JF0A 1X02A 2OS8C 2EGDA 2LMVA 1CTRA 2E6WA 1QV0A 4CFRA 5HKWA 4DCKA 4MN0A 5HKYA 1N65A 4PE4A 4PE7A 3PM8A 2CXJA 1MF8B 2LP3A 2KBIA 1B47A 1QJTA 1H8BA 3NSIA 2CBLA 2MBXA 2KGBC 2JTTA 4AQJA 1SBJA 3TDIA 1CMFA 4L9MA 1J1EA 5HYDA 2L4IA 4GUKA 4CIDA 2MA2A 1PRWA 1BODA 1LXFC 3AAKA 3M0WA 2KDHA 1DTLA 3OX6A 4YI8A 1LA3A 1Y0VH 1SW8A 3DD4A 3DVJA 5AEQA 2F8PA 1GJYA 3PN7B 1UWOA 1M45A 4MLWA 1CDLA 1U5IA 3O6BA 3VGOA 5D69A 1G33A 4MEWA 3FWBA 1SMGA 5KSZA 2LLUA 1J7PA 2KAVA 2WC8A 2BKHB 4HRGA 2BCXA 2B1UA 4C0JA 1TNWA 1W7IB 1XFZO 4M2OA 3VRNA 2WCBA 2COLB 1NUBA 1B7TY 3PN7C 4NDCA 2K61A 2FJUB 4E68A 1PK0D 2WORA 1LA0A 3BQ3A 1PVAA 2LNKA 2KFGA 3QRXA 4A4BA 2JZIA 5I8NA 2JNFA 2KOTA 1QIWA 4AQIA 3SG7A 1FI6A 2BE6A 3EKHA 1DJWA 1MQ1A 2H2KA 4YGAA 1DJXA 3WHUB 1F55A 4OKHA 4DIRA 3BXKA 4QJ4B 1RTP1 4NDBA 1AJ4A 4MVFA 1Y1AA 1YUTA 3GOFA 3BUWB 2KHNA 2HF5A 2ZRTA 1QXPA 2JXCA 3CS1A 2F3YA 2CNPA 2L50A 3HX4A 4GGNA 1QLKA 2EHBA 3JVTB 2K2AA 3LLEA 5CSFA 4F0ZB 3FS7A 1CKKA 2LVJA 1C7VA 2TN4A 1QTXA 2D8NA 1AP4A 1SL7A 2PASA 1A03A 1BOCA 1KFUS 2MHHA 1TTXA 2V53A 4YBHB 4PHKA 1MXLC 4MRYA 1J55A 1AVSA 2F2PA 2Y5IA 3AKAA 4GNKB 3K21A 3JVTC 1BR1B 3BUMB 4YGEB 2M3WA 4P5OE 1OMRA 1KFUL 2OPOA 4I5NB 2F3ZA 4IL1A 2LMUA 2KBMA 1BG1A 2AAOA 1K9PA 1JFJA 3VRPA 2AMIA 2LP2A 2NLNA 2RGIA 2M0RA 4GAOA 1W7JB 5CSIA 4A4CA 1RK9A 3EVUA 3PSRA 5J3XA 1XVJA 3TZ1A 1HQVA 2BE4A 4PE0A 1QX7A 3EVVA 1UHNA 5AFPA 2LVVA 3ZNIA 1TIZA 4OCIA 5IBWA 3H4SE 1K9KA 5B8IB 2L5XB 2KQ6A 1CLLA 4ORBB 5CSNA 1EH2A 1IKUA 3ZWHA 1OZOA 4C0LA 1OQPA 2PMYA 2JXLA 1UHIA 5JOLA 1UHHA 1R2UA 4DRWA 1DVIA 1SK6D 3GK1A 4QJ5B 5AANA 4ICBA 2LV7A 3LCPC 2LANA 3SG4A 1WRKA 2LHIA 1OMDA 1S26D 2M29A 3CWGA 1IQ5A 4OR9B 3VRQA 2JNXA 3EVRA 3D10A 1ALWA 3CR2A 2JTZA 2O60A 2PALA 3DVEA 1K94A 1XFYO 1YRUB 2A4JA 3EK4A 1QVIZ 2LLTA 3EK8A 1QASA 1S5GZ 2PRUA 1NX2A 3DVKA 4WQ3A 4P2YB 1BMOA 3KF9A 1CM1A 1NPQA 5ER4X 2LAPA 1JFKA 4HRHA 5I2OA 1XFXO 5TNCA 4ORAB 1IJ5A 1QLSA 2FCEA 1B8RA 3DVMA 1B8LA 1IWQA 2JU0A 2NCPA 1IG5A 2JC2A 4CLNA 2Q91A 2Y1NA 1KSOA 2NZ0A 3TS5B 3EK7A 1DF0B 1ZFSA 1MWNA 1AHRA 2L98A 3KPXA 1EG4A 2WNDA 1TOPA 2KAYA 2M7NA 1M63B 3CLNA 1JUOA 2G9BA 4I5JA 1S1EA 2ZNEA 1XO5A 4GFTA 2L4HA 4YGCB 2ZRSA 1VRKA 3TUYB 1WRZA 2VRGA 3TS5C 2MJWB 1YUSA 2JRFA 3BOWB 1BLQA 3NSKA 3BYAA 1PSBA 5ER5A 4ZCUA 3NSLA 5F6TA 2EC6B 1OE9B 3O2PA 4XJKB 5DKQA 2BCAA 1NCYA 1SR6B 1IGVA 1K93D 3CTNA 1QVIY 1PSRA 3SG5A 1CFCA 3F45A 1S5GY 3IQQA 2JT0A 3TUYC 1XFWO 2L51A 1DJZA 1BJFA 1Y6WA 3CR5X 3EKJA 1B4CA 2BL0B 1J7QA 2LM5A 4MRXA 1FF1A 1CM4A 2QACA 2EC6C 2I7AA 4NQGA 1DF0A 1YTZC 1OSAA 4YRUA 2F33A 1R6PA 1SR6C
chains in the Genus database with same CATH superfamily
3MSEB 1UP5A 1BT6A 2AUCA 3IVTA 2KLEA 3R1OA 5AERA 1S6JA 1XFVO 3FE9A 3ICBA 4N1FA 5D7FA 1RJVA 1V1GA 1JSAA 1Y1XA 2KI6C 1UUSA 1ZUZA 3DXLA 2BL0C 1JF2A 3I5FB 5PALA 3BOWA 1EXRA 2MLFC 1K95A 3S0FA 1KSMA 1OMVA 3SG2A 2WC6A 2WCFA 1MHOA 1DJHA 4XJKA 1NWDA 3GK2A 4FQTA 2QDIA 1F8HA 2KLDA 5G08A 2K7CA 1YVHA 1DJIA 4PE1A 4DS7A 1DC1A 1NCXA 2HPSA 4HSZA 1XA5A 2PSRA 3C1VA 1DELA 2WCJA 2Y4QA 3B87A 4YGBB 3SJSA 1CNPA 2OTGB 4ORCB 1SRAA 1CLBA 1TRFA 1F4QA 2SCPA 5BPJA 3I5FC 1YX8A 1LKJA 1DJGA 1WDCB 1OOIX 2KI4B 3DY9A 3OP0A 2M1UA 1CDPA 2KQYA 2KYFA 4I5KA 1P28A 1QV1A 2CTNA 2FJYA 4TNCA 3VRRA 1LINA 2K7BA 1ZOTB 1N0YA 2QEVA 3CDNA 1QIVA 3FWCA 1KK8B 1AK8A 4N5XA 3R1VA 1XYDA 5AXIA 1MXEA 1WLZA 5KU1A 2SASA 2M8UA 4PCWA 1D1OA 2OTGC 2HETA 3WNXB 1F71A 1WDCC 2M9GA 1JC2A 2LVIA 1E8AA 1HT9A 1XFRA 3E3RA 3EG5B 3I5GB 3PATA 4M2QA 4MZJA 5HLVA 1M31A 4JWQA 1MR8A 3TDZA 2K7OA 2I94A 1NCZA 1L2OB 2JULA 2JT8A 3CZ1A 3TDUA 4XYNA 1NIWA 1H4BA 3A8RA 5FI6A 1SKTA 2Q4UA 1TNQA 1AUIB 1ZACA 1Q80A 2K2FA 2QEBA 2LE9B 2ZN9A 3JTDB 3VROA 2JPTA 4DUQA 1SPYA 2LVKA 1DT7B 2O5GA 2LLSA 1IRJA 2NXQA 1KQMB 2HQ8A 2JOJA 3NHTA 1OOHA 2E30A 2P6BB 3HCMA 3OB1B 1NSHA 1YVLA 4GPLB 3I5GC 3PLFB 3RM1A 1RECA 4D1EA 1L2OC 1MUXA 1S36A 1TN4A 2FOTA 3LK0A 4PDZA 1AJ5A 4PT1A 4C0KA 1CFFA 4UPGA 3NXAA 1K9UA 1G4YR 4R1EA 1PVBA 1OZSA 1Y1UA 3JTDC 1SL9A 1GGZA 3RLZA 4PHMA 1V1FA 1CDNA 2KFHA 5HKZA 1KQMC 5DKNA 2MLEC 3SG3A 1KK7Z 4NDDA 1G8IA 2JT3A 2H61C 2ZKMX 2PVBA 1SSEB 4JKTA 2M1KB 1FPWA 1CLMA 1N2DA 4Q04A 5HLOA 4CFQA 1A2XA 3I5HB 3I5IB 1QS7A 1YUUA 4N1GA 3PALA 1K90D 3LK1A 4USLA 1FI5A 5JJGA 2LHLA 4MBEA 1S3PA 3AAJA 3BFBA 1L7ZA 1FW4A 1XK4C 1KFXS 2L5YA 3CZTX 2M7LA 1F4OA 2HQWA 3IF7A 5KTYA 1DGUA 2K8MB 2WC5A 2ERBA 3OHMB 2LUXA 2L2CA 1ZMZA 2H61A 3O78A 4BY4A 1F70A 3WXAA 1TCOB 3BUOB 3I5HC 3BUXB 3I5IC 3D74A 3IQOA 1QX2A 4MZKA 2JWWA 1CFPA 1A4PA 1WY9A 1KFXL 1YX7A 4YI9A 3SIAA 1YURA 2WCEA 1SCMB 2CT9A 2LUCA 2BBNA 2FCDA 2GGZA 2DOQA 2H8VA 1XK4A 2K0JA 3NHIA 3D0YB 4I5LB 5HL1A 4ZCVA 3SS5A 4BY5A 1B1GA 3Q8IA 2KYCA 4OZDA 1TUZA 2BCBA 3B88A 3BJHA 1NX0A 3O4XA 3PFVA 1BR4B 1SL8A 1OW4A 1RWYA 1M46A 4M2PA 5K89A 1KK7Y 1DJYA 2Y1MA 1ODBA 2K7DA 1SCVA 2ISDA 3FIAA 1SCMC 2NCOA 3BFAA 4YGDB 2GGMA 1B9AA 1RROA 2ZFDA 2JQ6A 3CR4X 4JQ0D 2LCPA 3SG6A 1C3YA 2KAXA 1CMGA 3QMEA 1C7WA 2KFFA 4WRIA 4PHJA 2CCMA 2QPTA 3N7HA 3K1EA 3SIBA 3KHEA 1IQ3A 1CFDA 3LL8B 2ZN8A 2MAZA 1C07A 1KCYA 2IS9A 1LVCD 1M39A 1GQMA 1TNPA 2BNXA 3OBVA 2KSPA 2L2EA 2PYQA 3L4LA 2BBMA 2I2RE 1NX1A 5GQQC 1DMOA 4GGFC 3DF0B 1J1DA 3PJIA 1CDMA 3AKBA 2GTEA 4JPZB 4U8DA 1EL4A 5CSJA 1A75B 3CABA 3D0YA 4OVNF 1K8UA 3OGNA 4PALA 1A29A 2KGRA 3OB2B 4ETOA 5CPVA 1QATA 3CGAA 1OOJA 3S0GA 1YR5A 2BECA 5I2QA 1FBVA 1J7RA 1S6CA 2R2IA 3KEVA 1UHKA 4MZLA 4AOMA 4FQOA 4OV2A 2F2OA 4GBAA 1BF5A 1GGWA 3GK4X 2M97A 2GV5A 1F54A 4GGFA 2LC5A 1TNXA 3S0BA 1DGVA 2K60A 1EJ3A 4QJ3B 3OX5A 4CPVA 1K96A 1KQVA 1JWDA 2KI4C 3SS4A 3NSOA 2L0PA 5FYXA 2LMTA 3KO0A 1Z4HA 2MRDA 1PULA 1B8CA 1TCFA 1KWOB 1QX5B 3NGVA 5DKRA 1CB1A 1JBAA 1NP8A 1S6IA 1SNLA 4FTGA 1K2HA 2I18A 1KK8C 1YRTB 1WLMA 2M49B 2KNEA 3O4YA 1J7OA 2WOSA 3DF0A 1IJ6A 3WHTB 2ZNDA 1UURA 2G2BA 4MSPA 1NX3A 1A75A 2OS8B 5I2LA 1XFUO 1NYAA 1ALVA 2BKIB 5D3OA 3L47A 1PALA 3A4UB 3BUNB 1WRLA 4WQ2A 1KWOC 4HREE 2BAPA 3R72A 1BU3A 1UHJA 4INXA 5I94A 1U5IB 1W9ZA 1EG3A 1RFJA 1SY9A 2KI6D 4PHNA 1B7TZ 1SYMA 1TWOA 1JF0A 1X02A 2YGUA 2OS8C 2EGDA 3B86A 2LMVA 3PM2A 1CTRA 2E6WA 1QV0A 3S0DA 5HKWA 4CFRA 4DCKA 4MN0A 5HKYA 1N65A 4PE4A 4PE7A 3PM8A 3RZSA 2CXJA 1MF8B 1TUJA 2LP3A 2KBIA 1B47A 1QJTA 1H8BA 3NSIA 2CBLA 2MBXA 2KGBC 2JTTA 4AQJA 1SBJA 3TDIA 1CMFA 4L9MA 1J1EA 5HYDA 2L4IA 4GUKA 4CIDA 3L4AA 2MA2A 1PRWA 1BODA 1LXFC 3AAKA 3M0WA 2KDHA 1DTLA 3OX6A 4YI8A 1LA3A 1Y0VH 3FE6A 2P71A 3D73A 1SW8A 3DD4A 3DVJA 5AEQA 2F8PA 1GJYA 3UO9A 3PN7B 1UWOA 1M45A 4MLWA 1CDLA 1U5IA 3O6BA 1LS8A 3VGOA 4KYNA 5D69A 1G33A 4MEWA 3FWBA 1SMGA 5KSZA 2LLUA 1J7PA 2KAVA 5EL2A 2WC8A 2BKHB 2KPHA 4HRGA 1T14A 2BCXA 2B1UA 4C0JA 1TNWA 1W7IB 1XFZO 4M2OA 3VRNA 2WCBA 2COLB 2WCLA 1NUBA 1B7TY 3PN7C 4NDCA 2K61A 1DQEA 2FJUB 4E68A 1PK0D 2WORA 1LA0A 3BQ3A 1PVAA 2LNKA 2KFGA 3QRXA 4A4BA 2JZIA 5I8NA 2JNFA 2KOTA 3D77A 1QIWA 4AQIA 3SG7A 1OOGA 1FI6A 2BE6A 3EKHA 1DJWA 1MQ1A 2H2KA 2JPOA 1DJXA 4YGAA 3WHUB 4OKHA 4DIRA 3BXKA 4QJ4B 1F55A 1RTP1 4NDBA 1AJ4A 3D76A 4MVFA 1Y1AA 1YUTA 3GOFA 3BUWB 2QEOA 2KHNA 2HF5A 2ZRTA 1QXPA 2JXCA 3CS1A 2F3YA 2CNPA 2L50A 3HX4A 4GGNA 1QLKA 2EHBA 3JVTB 2K2AA 3LLEA 5CSFA 4F0ZB 3FS7A 1CKKA 2LVJA 1C7VA 2TN4A 1QTXA 2D8NA 1AP4A 1SL7A 2PASA 1A03A 1BOCA 1KFUS 3CYZA 3SS3A 4INWA 2MHHA 1TTXA 2V53A 4YBHB 3S0AA 4PHKA 1MXLC 4MRYA 1J55A 1AVSA 2F2PA 4IJ7A 2Y5IA 3AKAA 3UNWA 3BFHA 4GNKB 3K21A 3JVTC 1BR1B 3BUMB 3D75A 4YGEB 2M3WA 4P5OE 1OMRA 1KFUL 2OPOA 2PQLA 4I5NB 2F3ZA 1IIOA 4IL1A 1IH0A 3R1PA 2LMUA 2KBMA 1BG1A 2AAOA 1K9PA 1JFJA 3VRPA 2AMIA 2WCMA 2LP2A 2NLNA 2RGIA 2M0RA 4GAOA 1W7JB 5CSIA 4A4CA 1RK9A 3EVUA 3PSRA 5J3XA 1XVJA 3TZ1A 1QWVA 1HQVA 2BE4A 4PE0A 1QX7A 3EVVA 1UHNA 5AFPA 3B6XA 3DZTA 2LVVA 3ZNIA 1TIZA 4OCIA 3V2LA 5IBWA 1Z2CB 3H4SE 1K9KA 5B8IB 2WCKA 2L5XB 3CZ0A 2KQ6A 1CLLA 4ORBB 5CSNA 2WCHA 1EH2A 1IKUA 3ZWHA 1OZOA 3CZ2A 1OQPA 4C0LA 2PMYA 2JXLA 1UHIA 5JOLA 1UHHA 1R2UA 4DRWA 1DVIA 2P70A 1SK6D 3GK1A 4QJ5B 5AANA 5FI2A 4ICBA 2LV7A 3LCPC 2LANA 3SG4A 1WRKA 2LHIA 1OMDA 1S26D 2M29A 3CWGA 1IQ5A 4OR9B 3VRQA 2JNXA 3EVRA 3D10A 1ALWA 3CR2A 2JTZA 3D78A 2O60A 2PALA 3DVEA 4F7FA 1K94A 1XFYO 1YRUB 2A4JA 3EK4A 1QVIZ 2LLTA 3EK8A 1QASA 1S5GZ 2PRUA 1NX2A 5DICA 3DVKA 4WQ3A 4P2YB 1BMOA 3KF9A 1CM1A 1NPQA 1OOFA 5ER4X 3VB1A 2LAPA 1JFKA 4HRHA 5I2OA 1XFXO 5TNCA 4ORAB 1IJ5A 1QLSA 2FCEA 1B8RA 3DVMA 1B8LA 1IWQA 2JU0A 2NCPA 3DYEA 1IG5A 2JC2A 4CLNA 2Q91A 2Y1NA 1KSOA 2NZ0A 3TS5B 3EK7A 1DF0B 1ZFSA 1MWNA 1AHRA 2L98A 3KPXA 1EG4A 2WNDA 3FE8A 1TOPA 2KAYA 2M7NA 1M63B 3CLNA 3B7AA 1JUOA 2G9BA 4I5JA 1S1EA 2ZNEA 1C3ZA 3S0EA 1XO5A 4GFTA 2L4HA 4YGCB 2ZRSA 1GM0A 1VRKA 3TUYB 1WRZA 2VRGA 3TS5C 2MJWB 1YUSA 2JRFA 2QEHA 3BOWB 1BLQA 3NSKA 3BYAA 1PSBA 5ER5A 4ZCUA 3NSLA 5F6TA 2EC6B 1OE9B 3O2PA 4XJKB 1DEKA 5DKQA 1NCYA 1SR6B 2BCAA 1IGVA 1K93D 3CTNA 1QVIY 1PSRA 3SG5A 5FI7A 1CFCA 3F45A 1S5GY 3IQQA 2JT0A 3TUYC 1XFWO 2L51A 4JD9A 1DJZA 1BJFA 1Y6WA 3CR5X 3EKJA 1B4CA 1ORGA 2BL0B 1J7QA 2LM5A 4MRXA 1FF1A 1CM4A 2QACA 2EC6C 2I7AA 4NQGA 1DF0A 1YTZC 1OSAA 4YRUA 2F33A 1R6PA 1SR6C
chains in the Genus database with same CATH topology
3MSEB 1UP5A 1BT6A 2AUCA 5AERA 1S6JA 1XFVO 3ICBA 4N1FA 5D7FA 1RJVA 1V1GA 1JSAA 1Y1XA 2KI6C 1UUSA 1ZUZA 2BL0C 1JF2A 3I5FB 5PALA 3BOWA 1EXRA 2MLFC 1K95A 1KSMA 1OMVA 3SG2A 2WCFA 1MHOA 1DJHA 4XJKA 1NWDA 3GK2A 1F8HA 5G08A 2K7CA 1YVHA 1DJIA 4PE1A 4DS7A 1NCXA 2HPSA 4HSZA 1XA5A 2PSRA 3C1VA 2Y4QA 4YGBB 1CNPA 3SJSA 2OTGB 4ORCB 1SRAA 1CLBA 1TRFA 1F4QA 2SCPA 5BPJA 3I5FC 1YX8A 1LKJA 1DJGA 1WDCB 2KI4B 3OP0A 2M1UA 1CDPA 2KQYA 2KYFA 4I5KA 1QV1A 2CTNA 4TNCA 3VRRA 1LINA 2K7BA 1ZOTB 1N0YA 1QIVA 3FWCA 1KK8B 1AK8A 4N5XA 1XYDA 5AXIA 1MXEA 1WLZA 5KU1A 2SASA 2M8UA 4PCWA 1D1OA 2OTGC 2HETA 3WNXB 1F71A 1WDCC 2M9GA 1JC2A 2LVIA 1E8AA 1HT9A 3E3RA 3I5GB 3PATA 4M2QA 4MZJA 5HLVA 1M31A 4JWQA 1MR8A 3TDZA 2K7OA 2I94A 1NCZA 1L2OB 2JULA 2JT8A 3TDUA 4XYNA 1NIWA 1H4BA 3A8RA 1SKTA 2Q4UA 1TNQA 1AUIB 1ZACA 1Q80A 2K2FA 2ZN9A 2LE9B 3JTDB 3VROA 2JPTA 4DUQA 1SPYA 2LVKA 1DT7B 2O5GA 2LLSA 1IRJA 2NXQA 1KQMB 2HQ8A 2JOJA 4PDZA 2E30A 3HCMA 2P6BB 3OB1B 1IH0A 1NSHA 1YVLA 4GPLB 3I5GC 3PLFB 3RM1A 1RECA 4D1EA 1L2OC 1MUXA 1S36A 1TN4A 2FOTA 3LK0A 4C0KA 1AJ5A 1CFFA 4UPGA 3NXAA 1K9UA 1G4YR 4R1EA 1PVBA 1OZSA 1Y1UA 3JTDC 1SL9A 1GGZA 3RLZA 4PHMA 1V1FA 1CDNA 2KFHA 5HKZA 1KQMC 5DKNA 2MLEC 3SG3A 1KK7Z 4NDDA 1G8IA 2JT3A 2H61C 2ZKMX 2PVBA 2M1KB 1FPWA 1CLMA 1N2DA 4Q04A 5HLOA 4CFQA 1A2XA 3I5HB 3I5IB 1QS7A 1YUUA 4N1GA 3PALA 1K90D 3LK1A 4USLA 1FI5A 5JJGA 2LHLA 4MBEA 1S3PA 3AAJA 1L7ZA 1FW4A 1XK4C 1KFXS 3CZTX 2M7LA 1F4OA 2HQWA 3IF7A 5KTYA 1DGUA 2K8MB 3OHMB 2LUXA 1ZMZA 2H61A 3O78A 4BY4A 1F70A 3WXAA 1TCOB 3BUOB 3I5HC 3BUXB 3I5IC 3IQOA 1QX2A 4MZKA 2JWWA 1CFPA 1A4PA 1WY9A 1KFXL 1YX7A 4YI9A 3SIAA 1YURA 2WCEA 1SCMB 2CT9A 2LUCA 2BBNA 2FCDA 2GGZA 2DOQA 1XK4A 2K0JA 3D0YB 4I5LB 4ZCVA 4BY5A 1B1GA 2KYCA 2BCBA 1NX0A 3PFVA 1BR4B 1SL8A 1RWYA 1M46A 4M2PA 5K89A 1KK7Y 1DJYA 2Y1MA 1ODBA 2K7DA 1SCVA 2ISDA 3FIAA 1SCMC 2NCOA 4YGDB 2GGMA 1B9AA 1RROA 2ZFDA 2JQ6A 3CR4X 4JQ0D 2LCPA 3SG6A 2KAXA 1CMGA 1C7WA 2KFFA 4WRIA 4PHJA 2CCMA 2QPTA 3SIBA 3KHEA 1IQ3A 1CFDA 3LL8B 2ZN8A 2MAZA 1C07A 1KCYA 2IS9A 1LVCD 1M39A 1GQMA 1TNPA 2KSPA 2L2EA 2BBMA 2I2RE 1NX1A 5GQQC 1DMOA 4GGFC 3DF0B 1J1DA 1CDMA 3AKBA 4JPZB 4U8DA 1EL4A 5CSJA 1A75B 3D0YA 4OVNF 1K8UA 4PALA 1A29A 2KGRA 3OB2B 4ETOA 5CPVA 1QATA 3CGAA 1OOJA 1YR5A 2BECA 5I2QA 1FBVA 1J7RA 1S6CA 2R2IA 3KEVA 1UHKA 4MZLA 4AOMA 4FQOA 4OV2A 2F2OA 4GBAA 1BF5A 1GGWA 3GK4X 2M97A 2GV5A 1F54A 4GGFA 2LC5A 1TNXA 1DGVA 1EJ3A 4QJ3B 3OX5A 4CPVA 1K96A 1KQVA 1JWDA 2KI4C 3NSOA 2L0PA 5FYXA 2LMTA 3KO0A 2MRDA 1PULA 1B8CA 1TCFA 1KWOB 1QX5B 5DKRA 1CB1A 1JBAA 1NP8A 1S6IA 1SNLA 4FTGA 1K2HA 2I18A 1KK8C 1YRTB 1WLMA 2M49B 2KNEA 3O4YA 1J7OA 2WOSA 3DF0A 1IJ6A 3WHTB 2ZNDA 1UURA 2G2BA 4MSPA 1NX3A 1A75A 2OS8B 5I2LA 1XFUO 1NYAA 1ALVA 2BKIB 1PALA 3A4UB 3BUNB 1WRLA 4WQ2A 1KWOC 4HREE 1BU3A 1UHJA 1U5IB 1EG3A 1RFJA 1SY9A 2KI6D 4PHNA 1B7TZ 1SYMA 1JF0A 1X02A 2OS8C 2EGDA 2LMVA 1CTRA 2E6WA 1QV0A 4CFRA 5HKWA 4DCKA 4MN0A 5HKYA 1N65A 4PE4A 4PE7A 3PM8A 2CXJA 1MF8B 2LP3A 2KBIA 1B47A 1QJTA 1H8BA 3NSIA 2CBLA 2MBXA 2KGBC 2JTTA 4AQJA 1SBJA 3TDIA 1CMFA 4L9MA 1J1EA 5HYDA 2L4IA 4GUKA 4CIDA 2MA2A 1PRWA 1BODA 1LXFC 3AAKA 3M0WA 2KDHA 1DTLA 3OX6A 4YI8A 1LA3A 1Y0VH 1SW8A 3DD4A 3DVJA 5AEQA 2F8PA 1GJYA 3PN7B 1UWOA 1M45A 4MLWA 1CDLA 1U5IA 3O6BA 3VGOA 5D69A 1G33A 4MEWA 3FWBA 1SMGA 5KSZA 2LLUA 1J7PA 2KAVA 2WC8A 2BKHB 4HRGA 2BCXA 2B1UA 4C0JA 1TNWA 1W7IB 1XFZO 4M2OA 3VRNA 2WCBA 2COLB 1NUBA 1B7TY 3PN7C 4NDCA 2K61A 2FJUB 4E68A 1PK0D 2WORA 1LA0A 3BQ3A 1PVAA 2LNKA 2KFGA 3QRXA 4A4BA 2JZIA 5I8NA 2JNFA 2KOTA 1QIWA 4AQIA 3SG7A 1FI6A 2BE6A 3EKHA 1DJWA 1MQ1A 2H2KA 4YGAA 1DJXA 3WHUB 1F55A 4OKHA 4DIRA 3BXKA 4QJ4B 1RTP1 4NDBA 1AJ4A 4MVFA 1Y1AA 1YUTA 3GOFA 3BUWB 2KHNA 2HF5A 2ZRTA 1QXPA 2JXCA 3CS1A 2F3YA 2CNPA 2L50A 3HX4A 4GGNA 1QLKA 2EHBA 3JVTB 2K2AA 3LLEA 5CSFA 4F0ZB 3FS7A 1CKKA 2LVJA 1C7VA 2TN4A 1QTXA 2D8NA 1AP4A 1SL7A 2PASA 1A03A 1BOCA 1KFUS 2MHHA 1TTXA 2V53A 4YBHB 4PHKA 1MXLC 4MRYA 1J55A 1AVSA 2F2PA 2Y5IA 3AKAA 4GNKB 3K21A 3JVTC 1BR1B 3BUMB 4YGEB 2M3WA 4P5OE 1OMRA 1KFUL 2OPOA 4I5NB 2F3ZA 4IL1A 2LMUA 2KBMA 1BG1A 2AAOA 1K9PA 1JFJA 3VRPA 2AMIA 2LP2A 2NLNA 2RGIA 2M0RA 4GAOA 1W7JB 5CSIA 4A4CA 1RK9A 3EVUA 3PSRA 5J3XA 1XVJA 3TZ1A 1HQVA 2BE4A 4PE0A 1QX7A 3EVVA 1UHNA 5AFPA 2LVVA 3ZNIA 1TIZA 4OCIA 5IBWA 3H4SE 1K9KA 5B8IB 2L5XB 2KQ6A 1CLLA 4ORBB 5CSNA 1EH2A 1IKUA 3ZWHA 1OZOA 4C0LA 1OQPA 2PMYA 2JXLA 1UHIA 5JOLA 1UHHA 1R2UA 4DRWA 1DVIA 1SK6D 3GK1A 4QJ5B 5AANA 4ICBA 2LV7A 3LCPC 2LANA 3SG4A 1WRKA 2LHIA 1OMDA 1S26D 2M29A 3CWGA 1IQ5A 4OR9B 3VRQA 2JNXA 3EVRA 3D10A 1ALWA 3CR2A 2JTZA 2O60A 2PALA 3DVEA 1K94A 1XFYO 1YRUB 2A4JA 3EK4A 1QVIZ 2LLTA 3EK8A 1QASA 1S5GZ 2PRUA 1NX2A 3DVKA 4WQ3A 4P2YB 1BMOA 3KF9A 1CM1A 1NPQA 5ER4X 2LAPA 1JFKA 4HRHA 5I2OA 1XFXO 5TNCA 4ORAB 1IJ5A 1QLSA 2FCEA 1B8RA 3DVMA 1B8LA 1IWQA 2JU0A 2NCPA 1IG5A 2JC2A 4CLNA 2Q91A 2Y1NA 1KSOA 2NZ0A 3TS5B 3EK7A 1DF0B 1ZFSA 1MWNA 1AHRA 2L98A 3KPXA 1EG4A 2WNDA 1TOPA 2KAYA 2M7NA 1M63B 3CLNA 1JUOA 2G9BA 4I5JA 1S1EA 2ZNEA 1XO5A 4GFTA 2L4HA 4YGCB 2ZRSA 1VRKA 3TUYB 1WRZA 2VRGA 3TS5C 2MJWB 1YUSA 2JRFA 3BOWB 1BLQA 3NSKA 3BYAA 1PSBA 5ER5A 4ZCUA 3NSLA 5F6TA 2EC6B 1OE9B 3O2PA 4XJKB 5DKQA 2BCAA 1NCYA 1SR6B 1IGVA 1K93D 3CTNA 1QVIY 1PSRA 3SG5A 1CFCA 3F45A 1S5GY 3IQQA 2JT0A 3TUYC 1XFWO 2L51A 1DJZA 1BJFA 1Y6WA 3CR5X 3EKJA 1B4CA 2BL0B 1J7QA 2LM5A 4MRXA 1FF1A 1CM4A 2QACA 2EC6C 2I7AA 4NQGA 1DF0A 1YTZC 1OSAA 4YRUA 2F33A 1R6PA 1SR6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSE B;  1UP5 A;  1BT6 A;  2AUC A;  5AER A;  1S6J A;  1XFV O;  3ICB A;  4N1F A;  5D7F A;  1RJV A;  1V1G A;  1JSA A;  1Y1X A;  2KI6 C;  1UUS A;  1ZUZ A;  2BL0 C;  1JF2 A;  3I5F B;  5PAL A;  3BOW A;  1EXR A;  2MLF C;  1K95 A;  1KSM A;  1OMV A;  3SG2 A;  2WCF A;  1MHO A;  1DJH A;  4XJK A;  1NWD A;  3GK2 A;  1F8H A;  5G08 A;  2K7C A;  1YVH A;  1DJI A;  4PE1 A;  4DS7 A;  1NCX A;  2HPS A;  4HSZ A;  1XA5 A;  2PSR A;  3C1V A;  2Y4Q A;  4YGB B;  1CNP A;  3SJS A;  2OTG B;  4ORC B;  1SRA A;  1CLB A;  1TRF A;  1F4Q A;  2SCP A;  5BPJ A;  3I5F C;  1YX8 A;  1LKJ A;  1DJG A;  1WDC B;  2KI4 B;  3OP0 A;  2M1U A;  1CDP A;  2KQY A;  2KYF A;  4I5K A;  1QV1 A;  2CTN A;  4TNC A;  3VRR A;  1LIN A;  2K7B A;  1ZOT B;  1N0Y A;  1QIV A;  3FWC A;  1KK8 B;  1AK8 A;  4N5X A;  1XYD A;  5AXI A;  1MXE A;  1WLZ A;  5KU1 A;  2SAS A;  2M8U A;  4PCW A;  1D1O A;  2OTG C;  2HET A;  3WNX B;  1F71 A;  1WDC C;  2M9G A;  1JC2 A;  2LVI A;  1E8A A;  1HT9 A;  3E3R A;  3I5G B;  3PAT A;  4M2Q A;  4MZJ A;  5HLV A;  1M31 A;  4JWQ A;  1MR8 A;  3TDZ A;  2K7O A;  2I94 A;  1NCZ A;  1L2O B;  2JUL A;  2JT8 A;  3TDU A;  4XYN A;  1NIW A;  1H4B A;  3A8R A;  1SKT A;  2Q4U A;  1TNQ A;  1AUI B;  1ZAC A;  1Q80 A;  2K2F A;  2ZN9 A;  2LE9 B;  3JTD B;  3VRO A;  2JPT A;  4DUQ A;  1SPY A;  2LVK A;  1DT7 B;  2O5G A;  2LLS A;  1IRJ A;  2NXQ A;  1KQM B;  2HQ8 A;  2JOJ A;  4PDZ A;  2E30 A;  3HCM A;  2P6B B;  3OB1 B;  1IH0 A;  1NSH A;  1YVL A;  4GPL B;  3I5G C;  3PLF B;  3RM1 A;  1REC A;  4D1E A;  1L2O C;  1MUX A;  1S36 A;  1TN4 A;  2FOT A;  3LK0 A;  4C0K A;  1AJ5 A;  1CFF A;  4UPG A;  3NXA A;  1K9U A;  1G4Y R;  4R1E A;  1PVB A;  1OZS A;  1Y1U A;  3JTD C;  1SL9 A;  1GGZ A;  3RLZ A;  4PHM A;  1V1F A;  1CDN A;  2KFH A;  5HKZ A;  1KQM C;  5DKN A;  2MLE C;  3SG3 A;  1KK7 Z;  4NDD A;  1G8I A;  2JT3 A;  2H61 C;  2ZKM X;  2PVB A;  2M1K B;  1FPW A;  1CLM A;  1N2D A;  4Q04 A;  5HLO A;  4CFQ A;  1A2X A;  3I5H B;  3I5I B;  1QS7 A;  1YUU A;  4N1G A;  3PAL A;  1K90 D;  3LK1 A;  4USL A;  1FI5 A;  5JJG A;  2LHL A;  4MBE A;  1S3P A;  3AAJ A;  1L7Z A;  1FW4 A;  1XK4 C;  1KFX S;  3CZT X;  2M7L A;  1F4O A;  2HQW A;  3IF7 A;  5KTY A;  1DGU A;  2K8M B;  3OHM B;  2LUX A;  1ZMZ A;  2H61 A;  3O78 A;  4BY4 A;  1F70 A;  3WXA A;  1TCO B;  3BUO B;  3I5H C;  3BUX B;  3I5I C;  3IQO A;  1QX2 A;  4MZK A;  2JWW A;  1CFP A;  1A4P A;  1WY9 A;  1KFX L;  1YX7 A;  4YI9 A;  3SIA A;  1YUR A;  2WCE A;  1SCM B;  2CT9 A;  2LUC A;  2BBN A;  2FCD A;  2GGZ A;  2DOQ A;  1XK4 A;  2K0J A;  3D0Y B;  4I5L B;  4ZCV A;  4BY5 A;  1B1G A;  2KYC A;  2BCB A;  1NX0 A;  3PFV A;  1BR4 B;  1SL8 A;  1RWY A;  1M46 A;  4M2P A;  5K89 A;  1KK7 Y;  1DJY A;  2Y1M A;  1ODB A;  2K7D A;  1SCV A;  2ISD A;  3FIA A;  1SCM C;  2NCO A;  4YGD B;  2GGM A;  1B9A A;  1RRO A;  2ZFD A;  2JQ6 A;  3CR4 X;  4JQ0 D;  2LCP A;  3SG6 A;  2KAX A;  1CMG A;  1C7W A;  2KFF A;  4WRI A;  4PHJ A;  2CCM A;  2QPT A;  3SIB A;  3KHE A;  1IQ3 A;  1CFD A;  3LL8 B;  2ZN8 A;  2MAZ A;  1C07 A;  1KCY A;  2IS9 A;  1LVC D;  1M39 A;  1GQM A;  1TNP A;  2KSP A;  2L2E A;  2BBM A;  2I2R E;  1NX1 A;  5GQQ C;  1DMO A;  4GGF C;  3DF0 B;  1J1D A;  1CDM A;  3AKB A;  4JPZ B;  4U8D A;  1EL4 A;  5CSJ A;  1A75 B;  3D0Y A;  4OVN F;  1K8U A;  4PAL A;  1A29 A;  2KGR A;  3OB2 B;  4ETO A;  5CPV A;  1QAT A;  3CGA A;  1OOJ A;  1YR5 A;  2BEC A;  5I2Q A;  1FBV A;  1J7R A;  1S6C A;  2R2I A;  3KEV A;  1UHK A;  4MZL A;  4AOM A;  4FQO A;  4OV2 A;  2F2O A;  4GBA A;  1BF5 A;  1GGW A;  3GK4 X;  2M97 A;  2GV5 A;  1F54 A;  4GGF A;  2LC5 A;  1TNX A;  1DGV A;  1EJ3 A;  4QJ3 B;  3OX5 A;  4CPV A;  1K96 A;  1KQV A;  1JWD A;  2KI4 C;  3NSO A;  2L0P A;  5FYX A;  2LMT A;  3KO0 A;  2MRD A;  1PUL A;  1B8C A;  1TCF A;  1KWO B;  1QX5 B;  5DKR A;  1CB1 A;  1JBA A;  1NP8 A;  1S6I A;  1SNL A;  4FTG A;  1K2H A;  2I18 A;  1KK8 C;  1YRT B;  1WLM A;  2M49 B;  2KNE A;  3O4Y A;  1J7O A;  2WOS A;  3DF0 A;  1IJ6 A;  3WHT B;  2ZND A;  1UUR A;  2G2B A;  4MSP A;  1NX3 A;  1A75 A;  2OS8 B;  5I2L A;  1XFU O;  1NYA A;  1ALV A;  2BKI B;  1PAL A;  3A4U B;  3BUN B;  1WRL A;  4WQ2 A;  1KWO C;  4HRE E;  1BU3 A;  1UHJ A;  1U5I B;  1EG3 A;  1RFJ A;  1SY9 A;  2KI6 D;  4PHN A;  1B7T Z;  1SYM A;  1JF0 A;  1X02 A;  2OS8 C;  2EGD A;  2LMV A;  1CTR A;  2E6W A;  1QV0 A;  4CFR A;  5HKW A;  4DCK A;  4MN0 A;  5HKY A;  1N65 A;  4PE4 A;  4PE7 A;  3PM8 A;  2CXJ A;  1MF8 B;  2LP3 A;  2KBI A;  1B47 A;  1QJT A;  1H8B A;  3NSI A;  2CBL A;  2MBX A;  2KGB C;  2JTT A;  4AQJ A;  1SBJ A;  3TDI A;  1CMF A;  4L9M A;  1J1E A;  5HYD A;  2L4I A;  4GUK A;  4CID A;  2MA2 A;  1PRW A;  1BOD A;  1LXF C;  3AAK A;  3M0W A;  2KDH A;  1DTL A;  3OX6 A;  4YI8 A;  1LA3 A;  1Y0V H;  1SW8 A;  3DD4 A;  3DVJ A;  5AEQ A;  2F8P A;  1GJY A;  3PN7 B;  1UWO A;  1M45 A;  4MLW A;  1CDL A;  1U5I A;  3O6B A;  3VGO A;  5D69 A;  1G33 A;  4MEW A;  3FWB A;  1SMG A;  5KSZ A;  2LLU A;  1J7P A;  2KAV A;  2WC8 A;  2BKH B;  4HRG A;  2BCX A;  2B1U A;  4C0J A;  1TNW A;  1W7I B;  1XFZ O;  4M2O A;  3VRN A;  2WCB A;  2COL B;  1NUB A;  1B7T Y;  3PN7 C;  4NDC A;  2K61 A;  2FJU B;  4E68 A;  1PK0 D;  2WOR A;  1LA0 A;  3BQ3 A;  1PVA A;  2LNK A;  2KFG A;  3QRX A;  4A4B A;  2JZI A;  5I8N A;  2JNF A;  2KOT A;  1QIW A;  4AQI A;  3SG7 A;  1FI6 A;  2BE6 A;  3EKH A;  1DJW A;  1MQ1 A;  2H2K A;  4YGA A;  1DJX A;  3WHU B;  1F55 A;  4OKH A;  4DIR A;  3BXK A;  4QJ4 B;  1RTP 1;  4NDB A;  1AJ4 A;  4MVF A;  1Y1A A;  1YUT A;  3GOF A;  3BUW B;  2KHN A;  2HF5 A;  2ZRT A;  1QXP A;  2JXC A;  3CS1 A;  2F3Y A;  2CNP A;  2L50 A;  3HX4 A;  4GGN A;  1QLK A;  2EHB A;  3JVT B;  2K2A A;  3LLE A;  5CSF A;  4F0Z B;  3FS7 A;  1CKK A;  2LVJ A;  1C7V A;  2TN4 A;  1QTX A;  2D8N A;  1AP4 A;  1SL7 A;  2PAS A;  1A03 A;  1BOC A;  1KFU S;  2MHH A;  1TTX A;  2V53 A;  4YBH B;  4PHK A;  1MXL C;  4MRY A;  1J55 A;  1AVS A;  2F2P A;  2Y5I A;  3AKA A;  4GNK B;  3K21 A;  3JVT C;  1BR1 B;  3BUM B;  4YGE B;  2M3W A;  4P5O E;  1OMR A;  1KFU L;  2OPO A;  4I5N B;  2F3Z A;  4IL1 A;  2LMU A;  2KBM A;  1BG1 A;  2AAO A;  1K9P A;  1JFJ A;  3VRP A;  2AMI A;  2LP2 A;  2NLN A;  2RGI A;  2M0R A;  4GAO A;  1W7J B;  5CSI A;  4A4C A;  1RK9 A;  3EVU A;  3PSR A;  5J3X A;  1XVJ A;  3TZ1 A;  1HQV A;  2BE4 A;  4PE0 A;  1QX7 A;  3EVV A;  1UHN A;  5AFP A;  2LVV A;  3ZNI A;  1TIZ A;  4OCI A;  5IBW A;  3H4S E;  1K9K A;  5B8I B;  2L5X B;  2KQ6 A;  1CLL A;  4ORB B;  5CSN A;  1EH2 A;  1IKU A;  3ZWH A;  1OZO A;  4C0L A;  1OQP A;  2PMY A;  2JXL A;  1UHI A;  5JOL A;  1UHH A;  1R2U A;  4DRW A;  1DVI A;  1SK6 D;  3GK1 A;  4QJ5 B;  5AAN A;  4ICB A;  2LV7 A;  3LCP C;  2LAN A;  3SG4 A;  1WRK A;  2LHI A;  1OMD A;  1S26 D;  2M29 A;  3CWG A;  1IQ5 A;  4OR9 B;  3VRQ A;  2JNX A;  3EVR A;  3D10 A;  1ALW A;  3CR2 A;  2JTZ A;  2O60 A;  2PAL A;  3DVE A;  1K94 A;  1XFY O;  1YRU B;  2A4J A;  3EK4 A;  1QVI Z;  2LLT A;  3EK8 A;  1QAS A;  1S5G Z;  2PRU A;  1NX2 A;  3DVK A;  4WQ3 A;  4P2Y B;  1BMO A;  3KF9 A;  1CM1 A;  1NPQ A;  5ER4 X;  2LAP A;  1JFK A;  4HRH A;  5I2O A;  1XFX O;  5TNC A;  4ORA B;  1IJ5 A;  1QLS A;  2FCE A;  1B8R A;  3DVM A;  1B8L A;  1IWQ A;  2JU0 A;  2NCP A;  1IG5 A;  2JC2 A;  4CLN A;  2Q91 A;  2Y1N A;  1KSO A;  2NZ0 A;  3TS5 B;  3EK7 A;  1DF0 B;  1ZFS A;  1MWN A;  1AHR A;  2L98 A;  3KPX A;  1EG4 A;  2WND A;  1TOP A;  2KAY A;  2M7N A;  1M63 B;  3CLN A;  1JUO A;  2G9B A;  4I5J A;  1S1E A;  2ZNE A;  1XO5 A;  4GFT A;  2L4H A;  4YGC B;  2ZRS A;  1VRK A;  3TUY B;  1WRZ A;  2VRG A;  3TS5 C;  2MJW B;  1YUS A;  2JRF A;  3BOW B;  1BLQ A;  3NSK A;  3BYA A;  1PSB A;  5ER5 A;  4ZCU A;  3NSL A;  5F6T A;  2EC6 B;  1OE9 B;  3O2P A;  4XJK B;  5DKQ A;  2BCA A;  1NCY A;  1SR6 B;  1IGV A;  1K93 D;  3CTN A;  1QVI Y;  1PSR A;  3SG5 A;  1CFC A;  3F45 A;  1S5G Y;  3IQQ A;  2JT0 A;  3TUY C;  1XFW O;  2L51 A;  1DJZ A;  1BJF A;  1Y6W A;  3CR5 X;  3EKJ A;  1B4C A;  2BL0 B;  1J7Q A;  2LM5 A;  4MRX A;  1FF1 A;  1CM4 A;  2QAC A;  2EC6 C;  2I7A A;  4NQG A;  1DF0 A;  1YTZ C;  1OSA A;  4YRU A;  2F33 A;  1R6P A;  1SR6 C; 
#chains in the Genus database with same CATH topology
 3MSE B;  1UP5 A;  1BT6 A;  2AUC A;  3IVT A;  2KLE A;  3R1O A;  5AER A;  1S6J A;  1XFV O;  3FE9 A;  3ICB A;  4N1F A;  5D7F A;  1RJV A;  1V1G A;  1JSA A;  1Y1X A;  2KI6 C;  1UUS A;  1ZUZ A;  3DXL A;  2BL0 C;  1JF2 A;  3I5F B;  5PAL A;  3BOW A;  1EXR A;  2MLF C;  1K95 A;  3S0F A;  1KSM A;  1OMV A;  3SG2 A;  2WC6 A;  2WCF A;  1MHO A;  1DJH A;  4XJK A;  1NWD A;  3GK2 A;  4FQT A;  2QDI A;  1F8H A;  2KLD A;  5G08 A;  2K7C A;  1YVH A;  1DJI A;  4PE1 A;  4DS7 A;  1DC1 A;  1NCX A;  2HPS A;  4HSZ A;  1XA5 A;  2PSR A;  3C1V A;  1DEL A;  2WCJ A;  2Y4Q A;  3B87 A;  4YGB B;  3SJS A;  1CNP A;  2OTG B;  4ORC B;  1SRA A;  1CLB A;  1TRF A;  1F4Q A;  2SCP A;  5BPJ A;  3I5F C;  1YX8 A;  1LKJ A;  1DJG A;  1WDC B;  1OOI X;  2KI4 B;  3DY9 A;  3OP0 A;  2M1U A;  1CDP A;  2KQY A;  2KYF A;  4I5K A;  1P28 A;  1QV1 A;  2CTN A;  2FJY A;  4TNC A;  3VRR A;  1LIN A;  2K7B A;  1ZOT B;  1N0Y A;  2QEV A;  3CDN A;  1QIV A;  3FWC A;  1KK8 B;  1AK8 A;  4N5X A;  3R1V A;  1XYD A;  5AXI A;  1MXE A;  1WLZ A;  5KU1 A;  2SAS A;  2M8U A;  4PCW A;  1D1O A;  2OTG C;  2HET A;  3WNX B;  1F71 A;  1WDC C;  2M9G A;  1JC2 A;  2LVI A;  1E8A A;  1HT9 A;  1XFR A;  3E3R A;  3EG5 B;  3I5G B;  3PAT A;  4M2Q A;  4MZJ A;  5HLV A;  1M31 A;  4JWQ A;  1MR8 A;  3TDZ A;  2K7O A;  2I94 A;  1NCZ A;  1L2O B;  2JUL A;  2JT8 A;  3CZ1 A;  3TDU A;  4XYN A;  1NIW A;  1H4B A;  3A8R A;  5FI6 A;  1SKT A;  2Q4U A;  1TNQ A;  1AUI B;  1ZAC A;  1Q80 A;  2K2F A;  2QEB A;  2LE9 B;  2ZN9 A;  3JTD B;  3VRO A;  2JPT A;  4DUQ A;  1SPY A;  2LVK A;  1DT7 B;  2O5G A;  2LLS A;  1IRJ A;  2NXQ A;  1KQM B;  2HQ8 A;  2JOJ A;  3NHT A;  1OOH A;  2E30 A;  2P6B B;  3HCM A;  3OB1 B;  1NSH A;  1YVL A;  4GPL B;  3I5G C;  3PLF B;  3RM1 A;  1REC A;  4D1E A;  1L2O C;  1MUX A;  1S36 A;  1TN4 A;  2FOT A;  3LK0 A;  4PDZ A;  1AJ5 A;  4PT1 A;  4C0K A;  1CFF A;  4UPG A;  3NXA A;  1K9U A;  1G4Y R;  4R1E A;  1PVB A;  1OZS A;  1Y1U A;  3JTD C;  1SL9 A;  1GGZ A;  3RLZ A;  4PHM A;  1V1F A;  1CDN A;  2KFH A;  5HKZ A;  1KQM C;  5DKN A;  2MLE C;  3SG3 A;  1KK7 Z;  4NDD A;  1G8I A;  2JT3 A;  2H61 C;  2ZKM X;  2PVB A;  1SSE B;  4JKT A;  2M1K B;  1FPW A;  1CLM A;  1N2D A;  4Q04 A;  5HLO A;  4CFQ A;  1A2X A;  3I5H B;  3I5I B;  1QS7 A;  1YUU A;  4N1G A;  3PAL A;  1K90 D;  3LK1 A;  4USL A;  1FI5 A;  5JJG A;  2LHL A;  4MBE A;  1S3P A;  3AAJ A;  3BFB A;  1L7Z A;  1FW4 A;  1XK4 C;  1KFX S;  2L5Y A;  3CZT X;  2M7L A;  1F4O A;  2HQW A;  3IF7 A;  5KTY A;  1DGU A;  2K8M B;  2WC5 A;  2ERB A;  3OHM B;  2LUX A;  2L2C A;  1ZMZ A;  2H61 A;  3O78 A;  4BY4 A;  1F70 A;  3WXA A;  1TCO B;  3BUO B;  3I5H C;  3BUX B;  3I5I C;  3D74 A;  3IQO A;  1QX2 A;  4MZK A;  2JWW A;  1CFP A;  1A4P A;  1WY9 A;  1KFX L;  1YX7 A;  4YI9 A;  3SIA A;  1YUR A;  2WCE A;  1SCM B;  2CT9 A;  2LUC A;  2BBN A;  2FCD A;  2GGZ A;  2DOQ A;  2H8V A;  1XK4 A;  2K0J A;  3NHI A;  3D0Y B;  4I5L B;  5HL1 A;  4ZCV A;  3SS5 A;  4BY5 A;  1B1G A;  3Q8I A;  2KYC A;  4OZD A;  1TUZ A;  2BCB A;  3B88 A;  3BJH A;  1NX0 A;  3O4X A;  3PFV A;  1BR4 B;  1SL8 A;  1OW4 A;  1RWY A;  1M46 A;  4M2P A;  5K89 A;  1KK7 Y;  1DJY A;  2Y1M A;  1ODB A;  2K7D A;  1SCV A;  2ISD A;  3FIA A;  1SCM C;  2NCO A;  3BFA A;  4YGD B;  2GGM A;  1B9A A;  1RRO A;  2ZFD A;  2JQ6 A;  3CR4 X;  4JQ0 D;  2LCP A;  3SG6 A;  1C3Y A;  2KAX A;  1CMG A;  3QME A;  1C7W A;  2KFF A;  4WRI A;  4PHJ A;  2CCM A;  2QPT A;  3N7H A;  3K1E A;  3SIB A;  3KHE A;  1IQ3 A;  1CFD A;  3LL8 B;  2ZN8 A;  2MAZ A;  1C07 A;  1KCY A;  2IS9 A;  1LVC D;  1M39 A;  1GQM A;  1TNP A;  2BNX A;  3OBV A;  2KSP A;  2L2E A;  2PYQ A;  3L4L A;  2BBM A;  2I2R E;  1NX1 A;  5GQQ C;  1DMO A;  4GGF C;  3DF0 B;  1J1D A;  3PJI A;  1CDM A;  3AKB A;  2GTE A;  4JPZ B;  4U8D A;  1EL4 A;  5CSJ A;  1A75 B;  3CAB A;  3D0Y A;  4OVN F;  1K8U A;  3OGN A;  4PAL A;  1A29 A;  2KGR A;  3OB2 B;  4ETO A;  5CPV A;  1QAT A;  3CGA A;  1OOJ A;  3S0G A;  1YR5 A;  2BEC A;  5I2Q A;  1FBV A;  1J7R A;  1S6C A;  2R2I A;  3KEV A;  1UHK A;  4MZL A;  4AOM A;  4FQO A;  4OV2 A;  2F2O A;  4GBA A;  1BF5 A;  1GGW A;  3GK4 X;  2M97 A;  2GV5 A;  1F54 A;  4GGF A;  2LC5 A;  1TNX A;  3S0B A;  1DGV A;  2K60 A;  1EJ3 A;  4QJ3 B;  3OX5 A;  4CPV A;  1K96 A;  1KQV A;  1JWD A;  2KI4 C;  3SS4 A;  3NSO A;  2L0P A;  5FYX A;  2LMT A;  3KO0 A;  1Z4H A;  2MRD A;  1PUL A;  1B8C A;  1TCF A;  1KWO B;  1QX5 B;  3NGV A;  5DKR A;  1CB1 A;  1JBA A;  1NP8 A;  1S6I A;  1SNL A;  4FTG A;  1K2H A;  2I18 A;  1KK8 C;  1YRT B;  1WLM A;  2M49 B;  2KNE A;  3O4Y A;  1J7O A;  2WOS A;  3DF0 A;  1IJ6 A;  3WHT B;  2ZND A;  1UUR A;  2G2B A;  4MSP A;  1NX3 A;  1A75 A;  2OS8 B;  5I2L A;  1XFU O;  1NYA A;  1ALV A;  2BKI B;  5D3O A;  3L47 A;  1PAL A;  3A4U B;  3BUN B;  1WRL A;  4WQ2 A;  1KWO C;  4HRE E;  2BAP A;  3R72 A;  1BU3 A;  1UHJ A;  4INX A;  5I94 A;  1U5I B;  1W9Z A;  1EG3 A;  1RFJ A;  1SY9 A;  2KI6 D;  4PHN A;  1B7T Z;  1SYM A;  1TWO A;  1JF0 A;  1X02 A;  2YGU A;  2OS8 C;  2EGD A;  3B86 A;  2LMV A;  3PM2 A;  1CTR A;  2E6W A;  1QV0 A;  3S0D A;  5HKW A;  4CFR A;  4DCK A;  4MN0 A;  5HKY A;  1N65 A;  4PE4 A;  4PE7 A;  3PM8 A;  3RZS A;  2CXJ A;  1MF8 B;  1TUJ A;  2LP3 A;  2KBI A;  1B47 A;  1QJT A;  1H8B A;  3NSI A;  2CBL A;  2MBX A;  2KGB C;  2JTT A;  4AQJ A;  1SBJ A;  3TDI A;  1CMF A;  4L9M A;  1J1E A;  5HYD A;  2L4I A;  4GUK A;  4CID A;  3L4A A;  2MA2 A;  1PRW A;  1BOD A;  1LXF C;  3AAK A;  3M0W A;  2KDH A;  1DTL A;  3OX6 A;  4YI8 A;  1LA3 A;  1Y0V H;  3FE6 A;  2P71 A;  3D73 A;  1SW8 A;  3DD4 A;  3DVJ A;  5AEQ A;  2F8P A;  1GJY A;  3UO9 A;  3PN7 B;  1UWO A;  1M45 A;  4MLW A;  1CDL A;  1U5I A;  3O6B A;  1LS8 A;  3VGO A;  4KYN A;  5D69 A;  1G33 A;  4MEW A;  3FWB A;  1SMG A;  5KSZ A;  2LLU A;  1J7P A;  2KAV A;  5EL2 A;  2WC8 A;  2BKH B;  2KPH A;  4HRG A;  1T14 A;  2BCX A;  2B1U A;  4C0J A;  1TNW A;  1W7I B;  1XFZ O;  4M2O A;  3VRN A;  2WCB A;  2COL B;  2WCL A;  1NUB A;  1B7T Y;  3PN7 C;  4NDC A;  2K61 A;  1DQE A;  2FJU B;  4E68 A;  1PK0 D;  2WOR A;  1LA0 A;  3BQ3 A;  1PVA A;  2LNK A;  2KFG A;  3QRX A;  4A4B A;  2JZI A;  5I8N A;  2JNF A;  2KOT A;  3D77 A;  1QIW A;  4AQI A;  3SG7 A;  1OOG A;  1FI6 A;  2BE6 A;  3EKH A;  1DJW A;  1MQ1 A;  2H2K A;  2JPO A;  1DJX A;  4YGA A;  3WHU B;  4OKH A;  4DIR A;  3BXK A;  4QJ4 B;  1F55 A;  1RTP 1;  4NDB A;  1AJ4 A;  3D76 A;  4MVF A;  1Y1A A;  1YUT A;  3GOF A;  3BUW B;  2QEO A;  2KHN A;  2HF5 A;  2ZRT A;  1QXP A;  2JXC A;  3CS1 A;  2F3Y A;  2CNP A;  2L50 A;  3HX4 A;  4GGN A;  1QLK A;  2EHB A;  3JVT B;  2K2A A;  3LLE A;  5CSF A;  4F0Z B;  3FS7 A;  1CKK A;  2LVJ A;  1C7V A;  2TN4 A;  1QTX A;  2D8N A;  1AP4 A;  1SL7 A;  2PAS A;  1A03 A;  1BOC A;  1KFU S;  3CYZ A;  3SS3 A;  4INW A;  2MHH A;  1TTX A;  2V53 A;  4YBH B;  3S0A A;  4PHK A;  1MXL C;  4MRY A;  1J55 A;  1AVS A;  2F2P A;  4IJ7 A;  2Y5I A;  3AKA A;  3UNW A;  3BFH A;  4GNK B;  3K21 A;  3JVT C;  1BR1 B;  3BUM B;  3D75 A;  4YGE B;  2M3W A;  4P5O E;  1OMR A;  1KFU L;  2OPO A;  2PQL A;  4I5N B;  2F3Z A;  1IIO A;  4IL1 A;  1IH0 A;  3R1P A;  2LMU A;  2KBM A;  1BG1 A;  2AAO A;  1K9P A;  1JFJ A;  3VRP A;  2AMI A;  2WCM A;  2LP2 A;  2NLN A;  2RGI A;  2M0R A;  4GAO A;  1W7J B;  5CSI A;  4A4C A;  1RK9 A;  3EVU A;  3PSR A;  5J3X A;  1XVJ A;  3TZ1 A;  1QWV A;  1HQV A;  2BE4 A;  4PE0 A;  1QX7 A;  3EVV A;  1UHN A;  5AFP A;  3B6X A;  3DZT A;  2LVV A;  3ZNI A;  1TIZ A;  4OCI A;  3V2L A;  5IBW A;  1Z2C B;  3H4S E;  1K9K A;  5B8I B;  2WCK A;  2L5X B;  3CZ0 A;  2KQ6 A;  1CLL A;  4ORB B;  5CSN A;  2WCH A;  1EH2 A;  1IKU A;  3ZWH A;  1OZO A;  3CZ2 A;  1OQP A;  4C0L A;  2PMY A;  2JXL A;  1UHI A;  5JOL A;  1UHH A;  1R2U A;  4DRW A;  1DVI A;  2P70 A;  1SK6 D;  3GK1 A;  4QJ5 B;  5AAN A;  5FI2 A;  4ICB A;  2LV7 A;  3LCP C;  2LAN A;  3SG4 A;  1WRK A;  2LHI A;  1OMD A;  1S26 D;  2M29 A;  3CWG A;  1IQ5 A;  4OR9 B;  3VRQ A;  2JNX A;  3EVR A;  3D10 A;  1ALW A;  3CR2 A;  2JTZ A;  3D78 A;  2O60 A;  2PAL A;  3DVE A;  4F7F A;  1K94 A;  1XFY O;  1YRU B;  2A4J A;  3EK4 A;  1QVI Z;  2LLT A;  3EK8 A;  1QAS A;  1S5G Z;  2PRU A;  1NX2 A;  5DIC A;  3DVK A;  4WQ3 A;  4P2Y B;  1BMO A;  3KF9 A;  1CM1 A;  1NPQ A;  1OOF A;  5ER4 X;  3VB1 A;  2LAP A;  1JFK A;  4HRH A;  5I2O A;  1XFX O;  5TNC A;  4ORA B;  1IJ5 A;  1QLS A;  2FCE A;  1B8R A;  3DVM A;  1B8L A;  1IWQ A;  2JU0 A;  2NCP A;  3DYE A;  1IG5 A;  2JC2 A;  4CLN A;  2Q91 A;  2Y1N A;  1KSO A;  2NZ0 A;  3TS5 B;  3EK7 A;  1DF0 B;  1ZFS A;  1MWN A;  1AHR A;  2L98 A;  3KPX A;  1EG4 A;  2WND A;  3FE8 A;  1TOP A;  2KAY A;  2M7N A;  1M63 B;  3CLN A;  3B7A A;  1JUO A;  2G9B A;  4I5J A;  1S1E A;  2ZNE A;  1C3Z A;  3S0E A;  1XO5 A;  4GFT A;  2L4H A;  4YGC B;  2ZRS A;  1GM0 A;  1VRK A;  3TUY B;  1WRZ A;  2VRG A;  3TS5 C;  2MJW B;  1YUS A;  2JRF A;  2QEH A;  3BOW B;  1BLQ A;  3NSK A;  3BYA A;  1PSB A;  5ER5 A;  4ZCU A;  3NSL A;  5F6T A;  2EC6 B;  1OE9 B;  3O2P A;  4XJK B;  1DEK A;  5DKQ A;  1NCY A;  1SR6 B;  2BCA A;  1IGV A;  1K93 D;  3CTN A;  1QVI Y;  1PSR A;  3SG5 A;  5FI7 A;  1CFC A;  3F45 A;  1S5G Y;  3IQQ A;  2JT0 A;  3TUY C;  1XFW O;  2L51 A;  4JD9 A;  1DJZ A;  1BJF A;  1Y6W A;  3CR5 X;  3EKJ A;  1B4C A;  1ORG A;  2BL0 B;  1J7Q A;  2LM5 A;  4MRX A;  1FF1 A;  1CM4 A;  2QAC A;  2EC6 C;  2I7A A;  4NQG A;  1DF0 A;  1YTZ C;  1OSA A;  4YRU A;  2F33 A;  1R6P A;  1SR6 C; 
#chains in the Genus database with same CATH homology
 3MSE B;  1UP5 A;  1BT6 A;  2AUC A;  5AER A;  1S6J A;  1XFV O;  3ICB A;  4N1F A;  5D7F A;  1RJV A;  1V1G A;  1JSA A;  1Y1X A;  2KI6 C;  1UUS A;  1ZUZ A;  2BL0 C;  1JF2 A;  3I5F B;  5PAL A;  3BOW A;  1EXR A;  2MLF C;  1K95 A;  1KSM A;  1OMV A;  3SG2 A;  2WCF A;  1MHO A;  1DJH A;  4XJK A;  1NWD A;  3GK2 A;  1F8H A;  5G08 A;  2K7C A;  1YVH A;  1DJI A;  4PE1 A;  4DS7 A;  1NCX A;  2HPS A;  4HSZ A;  1XA5 A;  2PSR A;  3C1V A;  2Y4Q A;  4YGB B;  1CNP A;  3SJS A;  2OTG B;  4ORC B;  1SRA A;  1CLB A;  1TRF A;  1F4Q A;  2SCP A;  5BPJ A;  3I5F C;  1YX8 A;  1LKJ A;  1DJG A;  1WDC B;  2KI4 B;  3OP0 A;  2M1U A;  1CDP A;  2KQY A;  2KYF A;  4I5K A;  1QV1 A;  2CTN A;  4TNC A;  3VRR A;  1LIN A;  2K7B A;  1ZOT B;  1N0Y A;  1QIV A;  3FWC A;  1KK8 B;  1AK8 A;  4N5X A;  1XYD A;  5AXI A;  1MXE A;  1WLZ A;  5KU1 A;  2SAS A;  2M8U A;  4PCW A;  1D1O A;  2OTG C;  2HET A;  3WNX B;  1F71 A;  1WDC C;  2M9G A;  1JC2 A;  2LVI A;  1E8A A;  1HT9 A;  3E3R A;  3I5G B;  3PAT A;  4M2Q A;  4MZJ A;  5HLV A;  1M31 A;  4JWQ A;  1MR8 A;  3TDZ A;  2K7O A;  2I94 A;  1NCZ A;  1L2O B;  2JUL A;  2JT8 A;  3TDU A;  4XYN A;  1NIW A;  1H4B A;  3A8R A;  1SKT A;  2Q4U A;  1TNQ A;  1AUI B;  1ZAC A;  1Q80 A;  2K2F A;  2ZN9 A;  2LE9 B;  3JTD B;  3VRO A;  2JPT A;  4DUQ A;  1SPY A;  2LVK A;  1DT7 B;  2O5G A;  2LLS A;  1IRJ A;  2NXQ A;  1KQM B;  2HQ8 A;  2JOJ A;  4PDZ A;  2E30 A;  3HCM A;  2P6B B;  3OB1 B;  1IH0 A;  1NSH A;  1YVL A;  4GPL B;  3I5G C;  3PLF B;  3RM1 A;  1REC A;  4D1E A;  1L2O C;  1MUX A;  1S36 A;  1TN4 A;  2FOT A;  3LK0 A;  4C0K A;  1AJ5 A;  1CFF A;  4UPG A;  3NXA A;  1K9U A;  1G4Y R;  4R1E A;  1PVB A;  1OZS A;  1Y1U A;  3JTD C;  1SL9 A;  1GGZ A;  3RLZ A;  4PHM A;  1V1F A;  1CDN A;  2KFH A;  5HKZ A;  1KQM C;  5DKN A;  2MLE C;  3SG3 A;  1KK7 Z;  4NDD A;  1G8I A;  2JT3 A;  2H61 C;  2ZKM X;  2PVB A;  2M1K B;  1FPW A;  1CLM A;  1N2D A;  4Q04 A;  5HLO A;  4CFQ A;  1A2X A;  3I5H B;  3I5I B;  1QS7 A;  1YUU A;  4N1G A;  3PAL A;  1K90 D;  3LK1 A;  4USL A;  1FI5 A;  5JJG A;  2LHL A;  4MBE A;  1S3P A;  3AAJ A;  1L7Z A;  1FW4 A;  1XK4 C;  1KFX S;  3CZT X;  2M7L A;  1F4O A;  2HQW A;  3IF7 A;  5KTY A;  1DGU A;  2K8M B;  3OHM B;  2LUX A;  1ZMZ A;  2H61 A;  3O78 A;  4BY4 A;  1F70 A;  3WXA A;  1TCO B;  3BUO B;  3I5H C;  3BUX B;  3I5I C;  3IQO A;  1QX2 A;  4MZK A;  2JWW A;  1CFP A;  1A4P A;  1WY9 A;  1KFX L;  1YX7 A;  4YI9 A;  3SIA A;  1YUR A;  2WCE A;  1SCM B;  2CT9 A;  2LUC A;  2BBN A;  2FCD A;  2GGZ A;  2DOQ A;  1XK4 A;  2K0J A;  3D0Y B;  4I5L B;  4ZCV A;  4BY5 A;  1B1G A;  2KYC A;  2BCB A;  1NX0 A;  3PFV A;  1BR4 B;  1SL8 A;  1RWY A;  1M46 A;  4M2P A;  5K89 A;  1KK7 Y;  1DJY A;  2Y1M A;  1ODB A;  2K7D A;  1SCV A;  2ISD A;  3FIA A;  1SCM C;  2NCO A;  4YGD B;  2GGM A;  1B9A A;  1RRO A;  2ZFD A;  2JQ6 A;  3CR4 X;  4JQ0 D;  2LCP A;  3SG6 A;  2KAX A;  1CMG A;  1C7W A;  2KFF A;  4WRI A;  4PHJ A;  2CCM A;  2QPT A;  3SIB A;  3KHE A;  1IQ3 A;  1CFD A;  3LL8 B;  2ZN8 A;  2MAZ A;  1C07 A;  1KCY A;  2IS9 A;  1LVC D;  1M39 A;  1GQM A;  1TNP A;  2KSP A;  2L2E A;  2BBM A;  2I2R E;  1NX1 A;  5GQQ C;  1DMO A;  4GGF C;  3DF0 B;  1J1D A;  1CDM A;  3AKB A;  4JPZ B;  4U8D A;  1EL4 A;  5CSJ A;  1A75 B;  3D0Y A;  4OVN F;  1K8U A;  4PAL A;  1A29 A;  2KGR A;  3OB2 B;  4ETO A;  5CPV A;  1QAT A;  3CGA A;  1OOJ A;  1YR5 A;  2BEC A;  5I2Q A;  1FBV A;  1J7R A;  1S6C A;  2R2I A;  3KEV A;  1UHK A;  4MZL A;  4AOM A;  4FQO A;  4OV2 A;  2F2O A;  4GBA A;  1BF5 A;  1GGW A;  3GK4 X;  2M97 A;  2GV5 A;  1F54 A;  4GGF A;  2LC5 A;  1TNX A;  1DGV A;  1EJ3 A;  4QJ3 B;  3OX5 A;  4CPV A;  1K96 A;  1KQV A;  1JWD A;  2KI4 C;  3NSO A;  2L0P A;  5FYX A;  2LMT A;  3KO0 A;  2MRD A;  1PUL A;  1B8C A;  1TCF A;  1KWO B;  1QX5 B;  5DKR A;  1CB1 A;  1JBA A;  1NP8 A;  1S6I A;  1SNL A;  4FTG A;  1K2H A;  2I18 A;  1KK8 C;  1YRT B;  1WLM A;  2M49 B;  2KNE A;  3O4Y A;  1J7O A;  2WOS A;  3DF0 A;  1IJ6 A;  3WHT B;  2ZND A;  1UUR A;  2G2B A;  4MSP A;  1NX3 A;  1A75 A;  2OS8 B;  5I2L A;  1XFU O;  1NYA A;  1ALV A;  2BKI B;  1PAL A;  3A4U B;  3BUN B;  1WRL A;  4WQ2 A;  1KWO C;  4HRE E;  1BU3 A;  1UHJ A;  1U5I B;  1EG3 A;  1RFJ A;  1SY9 A;  2KI6 D;  4PHN A;  1B7T Z;  1SYM A;  1JF0 A;  1X02 A;  2OS8 C;  2EGD A;  2LMV A;  1CTR A;  2E6W A;  1QV0 A;  4CFR A;  5HKW A;  4DCK A;  4MN0 A;  5HKY A;  1N65 A;  4PE4 A;  4PE7 A;  3PM8 A;  2CXJ A;  1MF8 B;  2LP3 A;  2KBI A;  1B47 A;  1QJT A;  1H8B A;  3NSI A;  2CBL A;  2MBX A;  2KGB C;  2JTT A;  4AQJ A;  1SBJ A;  3TDI A;  1CMF A;  4L9M A;  1J1E A;  5HYD A;  2L4I A;  4GUK A;  4CID A;  2MA2 A;  1PRW A;  1BOD A;  1LXF C;  3AAK A;  3M0W A;  2KDH A;  1DTL A;  3OX6 A;  4YI8 A;  1LA3 A;  1Y0V H;  1SW8 A;  3DD4 A;  3DVJ A;  5AEQ A;  2F8P A;  1GJY A;  3PN7 B;  1UWO A;  1M45 A;  4MLW A;  1CDL A;  1U5I A;  3O6B A;  3VGO A;  5D69 A;  1G33 A;  4MEW A;  3FWB A;  1SMG A;  5KSZ A;  2LLU A;  1J7P A;  2KAV A;  2WC8 A;  2BKH B;  4HRG A;  2BCX A;  2B1U A;  4C0J A;  1TNW A;  1W7I B;  1XFZ O;  4M2O A;  3VRN A;  2WCB A;  2COL B;  1NUB A;  1B7T Y;  3PN7 C;  4NDC A;  2K61 A;  2FJU B;  4E68 A;  1PK0 D;  2WOR A;  1LA0 A;  3BQ3 A;  1PVA A;  2LNK A;  2KFG A;  3QRX A;  4A4B A;  2JZI A;  5I8N A;  2JNF A;  2KOT A;  1QIW A;  4AQI A;  3SG7 A;  1FI6 A;  2BE6 A;  3EKH A;  1DJW A;  1MQ1 A;  2H2K A;  4YGA A;  1DJX A;  3WHU B;  1F55 A;  4OKH A;  4DIR A;  3BXK A;  4QJ4 B;  1RTP 1;  4NDB A;  1AJ4 A;  4MVF A;  1Y1A A;  1YUT A;  3GOF A;  3BUW B;  2KHN A;  2HF5 A;  2ZRT A;  1QXP A;  2JXC A;  3CS1 A;  2F3Y A;  2CNP A;  2L50 A;  3HX4 A;  4GGN A;  1QLK A;  2EHB A;  3JVT B;  2K2A A;  3LLE A;  5CSF A;  4F0Z B;  3FS7 A;  1CKK A;  2LVJ A;  1C7V A;  2TN4 A;  1QTX A;  2D8N A;  1AP4 A;  1SL7 A;  2PAS A;  1A03 A;  1BOC A;  1KFU S;  2MHH A;  1TTX A;  2V53 A;  4YBH B;  4PHK A;  1MXL C;  4MRY A;  1J55 A;  1AVS A;  2F2P A;  2Y5I A;  3AKA A;  4GNK B;  3K21 A;  3JVT C;  1BR1 B;  3BUM B;  4YGE B;  2M3W A;  4P5O E;  1OMR A;  1KFU L;  2OPO A;  4I5N B;  2F3Z A;  4IL1 A;  2LMU A;  2KBM A;  1BG1 A;  2AAO A;  1K9P A;  1JFJ A;  3VRP A;  2AMI A;  2LP2 A;  2NLN A;  2RGI A;  2M0R A;  4GAO A;  1W7J B;  5CSI A;  4A4C A;  1RK9 A;  3EVU A;  3PSR A;  5J3X A;  1XVJ A;  3TZ1 A;  1HQV A;  2BE4 A;  4PE0 A;  1QX7 A;  3EVV A;  1UHN A;  5AFP A;  2LVV A;  3ZNI A;  1TIZ A;  4OCI A;  5IBW A;  3H4S E;  1K9K A;  5B8I B;  2L5X B;  2KQ6 A;  1CLL A;  4ORB B;  5CSN A;  1EH2 A;  1IKU A;  3ZWH A;  1OZO A;  4C0L A;  1OQP A;  2PMY A;  2JXL A;  1UHI A;  5JOL A;  1UHH A;  1R2U A;  4DRW A;  1DVI A;  1SK6 D;  3GK1 A;  4QJ5 B;  5AAN A;  4ICB A;  2LV7 A;  3LCP C;  2LAN A;  3SG4 A;  1WRK A;  2LHI A;  1OMD A;  1S26 D;  2M29 A;  3CWG A;  1IQ5 A;  4OR9 B;  3VRQ A;  2JNX A;  3EVR A;  3D10 A;  1ALW A;  3CR2 A;  2JTZ A;  2O60 A;  2PAL A;  3DVE A;  1K94 A;  1XFY O;  1YRU B;  2A4J A;  3EK4 A;  1QVI Z;  2LLT A;  3EK8 A;  1QAS A;  1S5G Z;  2PRU A;  1NX2 A;  3DVK A;  4WQ3 A;  4P2Y B;  1BMO A;  3KF9 A;  1CM1 A;  1NPQ A;  5ER4 X;  2LAP A;  1JFK A;  4HRH A;  5I2O A;  1XFX O;  5TNC A;  4ORA B;  1IJ5 A;  1QLS A;  2FCE A;  1B8R A;  3DVM A;  1B8L A;  1IWQ A;  2JU0 A;  2NCP A;  1IG5 A;  2JC2 A;  4CLN A;  2Q91 A;  2Y1N A;  1KSO A;  2NZ0 A;  3TS5 B;  3EK7 A;  1DF0 B;  1ZFS A;  1MWN A;  1AHR A;  2L98 A;  3KPX A;  1EG4 A;  2WND A;  1TOP A;  2KAY A;  2M7N A;  1M63 B;  3CLN A;  1JUO A;  2G9B A;  4I5J A;  1S1E A;  2ZNE A;  1XO5 A;  4GFT A;  2L4H A;  4YGC B;  2ZRS A;  1VRK A;  3TUY B;  1WRZ A;  2VRG A;  3TS5 C;  2MJW B;  1YUS A;  2JRF A;  3BOW B;  1BLQ A;  3NSK A;  3BYA A;  1PSB A;  5ER5 A;  4ZCU A;  3NSL A;  5F6T A;  2EC6 B;  1OE9 B;  3O2P A;  4XJK B;  5DKQ A;  2BCA A;  1NCY A;  1SR6 B;  1IGV A;  1K93 D;  3CTN A;  1QVI Y;  1PSR A;  3SG5 A;  1CFC A;  3F45 A;  1S5G Y;  3IQQ A;  2JT0 A;  3TUY C;  1XFW O;  2L51 A;  1DJZ A;  1BJF A;  1Y6W A;  3CR5 X;  3EKJ A;  1B4C A;  2BL0 B;  1J7Q A;  2LM5 A;  4MRX A;  1FF1 A;  1CM4 A;  2QAC A;  2EC6 C;  2I7A A;  4NQG A;  1DF0 A;  1YTZ C;  1OSA A;  4YRU A;  2F33 A;  1R6P A;  1SR6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...