1UP5A

Chicken calmodulin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
145
structure length
144
Chain Sequence
b'LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGELTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Crystallization and Preliminary X-Ray Analysis of Two New Crystal Forms of Calmodulin
pubmed doi rcsb
molecule tags Signalling protein
total genus 55
structure length 144
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1up5A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1up5A02
1F54A 3NSOA 1ALVA 1TCOB 1IGVA 3OP0A 1K9PA 3SG5A 2BCBA 1V1GA 1YRUB 2WNDA 1RECA 3SIAA 1XVJA 2M0RA 3BUMB 1PVBA 1IG5A 4MSPA 1SPYA 2K61A 1FF1A 1DJGA 4P2YB 3WHTB 2MJWB 5J3XA 3VRPA 2AAOA 2JXLA 2LLTA 1FI6A 3D0YA 5PALA 4PE7A 2A4JA 1F4OA 1AP4A 2KBIA 2KAXA 2K7DA 2K7CA 2LM5A 1BU3A 2ZKMX 1M63B 1OE9B 2LC5A 1J7RA 4C0KA 4PE0A 4ZCUA 1AHRA 1F71A 2JT8A 1SR6C 1UHJA 1CDMA 1WRZA 4MLWA 1KK8B 3JTDC 1S26D 2KBMA 1DF0B 2LCPA 1QJTA 2O5GA 3BUOB 3EVUA 2M7LA 1QVIY 4FTGA 4YGCB 2BE6A 3GOFA 3PM8A 1UHHA 3PN7B 4AQIA 4HSZA 1LXFC 1DGUA 3I5IC 3TDIA 1PALA 1WRLA 1B8LA 3CGAA 3PALA 1X02A 2M49B 1Y0VH 1WLZA 3MSEB 5CPVA 1GQMA 2JWWA 1GGWA 1SL9A 1W7IB 3WNXB 1CFDA 4XYNA 3FS7A 1QIWA 1TRFA 1IQ3A 5DKQA 1CTRA 1PSRA 2KQYA 2KYCA 2K8MB 2CTNA 3EK4A 2FCEA 1GJYA 3C1VA 1V1FA 1B9AA 1QATA 4I5NB 4USLA 3O4YA 5JOLA 1CKKA 2Q91A 2WCFA 1NYAA 1CM4A 3AKAA 1KQVA 4GPLB 1A03A 2EGDA 2NZ0A 2K2FA 3GK4X 1SK6D 5CSNA 3TZ1A 1B47A 4MVFA 1TCFA 1JSAA 3D0YB 2Y1NA 2I2RE 3LCPC 5F6TA 4WQ2A 4M2QA 1BOCA 2LVKA 3DVKA 1RROA 1CB1A 3SG4A 2LVJA 1LKJA 4WRIA 5B8IB 1S36A 1LVCD 3O78A 1E8AA 4GGFC 2F3YA 1L2OC 2ZNDA 3HX4A 2VRGA 3ZNIA 3FWBA 2M3WA 2AMIA 3EVRA 3EKJA 3SG3A 4GGFA 2JPTA 5AANA 1SKTA 3LK0A 4A4BA 1A29A 1RTP1 1SR6B 1QASA 2PVBA 3RLZA 1DVIA 3E3RA 3JTDB 3NXAA 3WHUB 1KK8C 1ZUZA 1PRWA 3LK1A 1NX2A 1XO5A 3TDZA 2K7BA 1F55A 1SYMA 1B7TZ 2WCBA 2Y4QA 2JNXA 1MF8B 1KSOA 3I5IB 4FQOA 4NQGA 1YURA 2JU0A 2LHLA 2HQWA 1M31A 1C7VA 1TOPA 2JT0A 4OKHA 4BY5A 1K8UA 1MWNA 1G8IA 1QX5B 1NWDA 1MHOA 1VRKA 4CFRA 1F70A 2LVIA 4ORCB 1BR4B 1F4QA 4N1FA 1JFKA 3CLNA 1YX8A 4GUKA 2KAVA 2L50A 3PLFB 1TNWA 2EHBA 3EVVA 4BY4A 1WY9A 4GBAA 2KHNA 1NUBA 2Q4UA 1HT9A 3DVEA 4QJ3B 4YGDB 3OHMB 2JNFA 1AK8A 2M8UA 5HKZA 2OS8C 1JC2A 2LLUA 1DJZA 3VRNA 4CLNA 4NDBA 4AOMA 2KI4C 4YGAA 1YX7A 4YBHB 3EK7A 3VROA 1SBJA 2LNKA 3CR5X 4U8DA 1CLBA 1CDLA 4DRWA 2M1UA 1IJ5A 1BR1B 1EJ3A 1LINA 2SCPA 3BYAA 3IQOA 1DT7B 3H4SE 1KCYA 3SG2A 4I5KA 3O2PA 2KFHA 1L2OB 1AJ4A 1A2XA 1OSAA 3CS1A 3CTNA 2RGIA 4N5XA 1BJFA 3PATA 2E30A 2AUCA 4GGNA 1NCYA 3DD4A 4OV2A 1TNPA 4M2PA 1WRKA 4PHNA 2F33A 4IL1A 4WQ3A 2LMUA 5AEQA 4GNKB 1CDPA 4HREE 1DJIA 4DS7A 1H4BA 3VRRA 4ORAB 4UPGA 1SCVA 1L7ZA 2L4IA 5KTYA 3CR4X 4OR9B 3DF0A 3GK1A 1XA5A 2F2PA 2OPOA 2ISDA 1B1GA 4M2OA 2MA2A 4GFTA 2PRUA 1M45A 3SJSA 2B1UA 1S6CA 2FOTA 1B7TY 3KF9A 1BODA 4MN0A 5KU1A 1K96A 2BL0C 3I5HC 4C0JA 2KI6D 1UP5A 4I5LB 3SIBA 2MRDA 4CPVA 1JUOA 2G2BA 2JTTA 4NDCA 1KK7Z 1XK4C 4MZJA 4YGEB 1YRTB 2JXCA 2LHIA 1EG4A 2ZRSA 1KFUS 1XK4A 2JOJA 1CLLA 2MLEC 2KGRA 1G33A 1JF2A 4PALA 2I7AA 5HLVA 2D8NA 2WORA 2LP2A 2OS8B 1QV1A 2FCDA 2I94A 1RK9A 2KI4B 3JVTC 3D10A 2M9GA 1S1EA 1IWQA 2E6WA 2F8PA 2NCOA 3WXAA 1YVHA 1H8BA 3EKHA 4CFQA 2JRFA 1A75A 1C07A 1OQPA 3AAJA 3IQQA 4I5JA 4YI8A 1TTXA 1QLSA 1K9UA 3BOWA 3EK8A 1S3PA 1WLMA 4ZCVA 2IS9A 3NSLA 1S6JA 1DJWA 4ICBA 1J55A 1ODBA 1ZFSA 1TNXA 1BMOA 1SCMB 2KYFA 1DGVA 1K94A 1UWOA 2R2IA 1BF5A 2LAPA 1QX7A 2MBXA 4TNCA 2K7OA 3RM1A 1OZOA 2KDHA 2KFGA 1FBVA 2HPSA 3DF0B 5K89A 1JWDA 4JQ0D 2LP3A 3SG6A 1K2HA 3BUWB 1HQVA 2CCMA 4QJ4B 1N65A 3O6BA 1SL8A 3VRQA 1S5GZ 4XJKA 1QV0A 4MZLA 4DCKA 1CFCA 1MQ1A 3KPXA 2MAZA 1IRJA 2NLNA 1NSHA 1MXLC 2NXQA 1Q80A 1KFXS 1YTZC 2BL0B 3I5HB 1UURA 4PCWA 2QACA 2HQ8A 5D69A 1JFJA 1CFPA 1YR5A 2M1KB 2KAYA 2LANA 2F2OA 2L0PA 1PULA 1RWYA 4OCIA 4MRXA 1U5IA 3F45A 1TN4A 2HF5A 1XFWO 4OVNF 4YGBB 1PSBA 1TIZA 2CBLA 1R6PA 2P6BB 1DJXA 5I2OA 2M7NA 3PFVA 1D1OA 1OOJA 2BE4A 2K0JA 1K9KA 2KNEA 1DTLA 1J7PA 1M39A 1BT6A 1WDCC 1GGZA 2M29A 1AUIB 3CZTX 3JVTB 2PASA 3CR2A 1A75B 1J1EA 2WCEA 1RFJA 3FWCA 3BQ3A 3BOWB 2ZN8A 1K95A 2TN4A 1DJYA 2GGZA 2LMTA 3OX5A 4N1GA 2BKIB 3BUXB 4P5OE 2ZN9A 3A8RA 3NSKA 5I8NA 1SL7A 1YVLA 2I18A 5TNCA 1PVAA 1EXRA 2NCPA 5DKRA 1KQMC 1OMRA 1DJHA 1YUTA 2GV5A 2M97A 3GK2A 3LL8B 4MBEA 4Q04A 1IJ6A 3TDUA 1SCMC 1FW4A 3OB2B 1M46A 5BPJA 5HLOA 1NX3A 5ER4X 5IBWA 2OTGC 1FPWA 2H2KA 2BCXA 1XFXO 3K21A 2LLSA 3FIAA 1IKUA 4QJ5B 1ZOTB 2ZRTA 1J7QA 4C0LA 1JBAA 1XYDA 2BCAA 3I5FC 5CSJA 4XJKB 1XFZO 1IQ5A 3OB1B 1QS7A 1MUXA 1CDNA 1EL4A 2BKHB 3OX6A 2MLFC 2LE9B 1B8CA 3BXKA 4PHJA 4YI9A 2LUCA 3BUNB 3CWGA 5G08A 3TUYC 2L5XB 3AKBA 1S5GY 1ZACA 1DMOA 2JT3A 5KSZA 3QRXA 1U5IB 4PDZA 5ER5A 1B8RA 1SNLA 2LMVA 2FJUB 1CFFA 1N2DA 1CNPA 4D1EA 2ZNEA 1CM1A 3ZWHA 1EH2A 1XFUO 2BECA 3A4UB 2CNPA 3PSRA 2PSRA 1WDCB 1Y1AA 3I5GC 2L4HA 2JTZA 1F8HA 2EC6C 1W7JB 4E68A 3TS5C 2QPTA 2BBNA 1NPQA 1RJVA 1SMGA 2LV7A 2PALA 1UUSA 1J1DA 1LA0A 5AFPA 2Y1MA 1SW8A 2KFFA 1ALWA 1OMDA 3VGOA 2JULA 1AVSA 2L51A 4JPZB 1KQMB 1UHKA 1OMVA 4PE4A 1N0YA 1Y1XA 2JZIA 2L98A 2V53A 5HYDA 1KWOC 5FYXA 1YUUA 1ZMZA 1C7WA 2OTGB 1J7OA 2H61C 4CIDA 4ETOA 3KEVA 3DVMA 2HETA 1MR8A 1UHIA 1UHNA 2KOTA 4PE1A 3I5FB 5CSIA 1BG1A 2CXJA 2KSPA 3M0WA 1KFUL 2LUXA 2H61A 1CMFA 2O60A 1AJ5A 5HKYA 1R2UA 2KI6C 1TNQA 1YUSA 1KSMA 2JQ6A 3ICBA 3KHEA 4MZKA 4MEWA 1SRAA 2K2AA 1JF0A 2JC2A 3KO0A 1OZSA 4PHKA 4A4CA 3TUYB 2MHHA 1XFVO 4HRGA 4R1EA 1QTXA 2L2EA 4L9MA 1QVIZ 5D7FA 4DIRA 5HKWA 1XFYO 3SG7A 3IF7A 2SASA 2ZFDA 1NX0A 2LVVA 2Y5IA 5CSFA 2DOQA 3AAKA 3PN7C 1DF0A 1K93D 1SY9A 5DKNA 3LLEA 1QX2A 1KK7Y 5AXIA 4AQJA 2F3ZA 1CLMA 1NIWA 3DVJA 5JJGA 3I5GB 5AERA 2EC6B 1LA3A 2GGMA 3TS5B 4YRUA 4NDDA 2KQ6A 1NCZA 1G4YR 2G9BA 2KGBC 2BBMA 1K90D 1S6IA 2COLB 1Y6WA 3HCMA 5I2LA 1Y1UA 1IH0A 1CMGA 1PK0D 4ORBB 2CT9A 1MXEA 1NX1A 5I2QA 1FI5A 1QLKA 5GQQC 2WOSA 4MRYA 1NCXA 1QIVA 4JWQA 4GAOA 1KFXL 2WC8A 3NSIA 4HRHA 4F0ZB 1A4PA 1B4CA 1KWOB 2PMYA 4DUQA 4PHMA 1BLQA 1EG3A 1QXPA 1NP8A
chains in the Genus database with same CATH superfamily
1F54A 3NSOA 1ALVA 1TCOB 1IGVA 3OP0A 1K9PA 3SG5A 2BCBA 1V1GA 1YRUB 2WNDA 1RECA 3SIAA 1XVJA 2M0RA 3BUMB 1PVBA 3PJIA 1IG5A 4MSPA 3SS3A 1SPYA 2K61A 3Q8IA 1FF1A 1DJGA 4P2YB 3UO9A 3WHTB 2MJWB 5J3XA 3VRPA 2AAOA 2JXLA 2LLTA 1FI6A 3D0YA 5PALA 1J7PA 4PE7A 2A4JA 1F4OA 1AP4A 2KBIA 3CABA 2KAXA 4KYNA 2K7DA 2K7CA 2LM5A 1BU3A 2ZKMX 1M63B 3OGNA 1OE9B 2LC5A 1J7RA 4C0KA 4PE0A 4ZCUA 1AHRA 1F71A 2JT8A 1SR6C 1UHJA 1CDMA 1WRZA 4MLWA 1KK8B 3JTDC 1S26D 2KBMA 1DF0B 2LCPA 1QJTA 2O5GA 3BUOB 3SS5A 3EVUA 2M7LA 1QVIY 4FTGA 4YGCB 2BE6A 3GOFA 3PM8A 1UHHA 3PN7B 4AQIA 4HSZA 1LXFC 3B7AA 1DGUA 3I5IC 3TDIA 1PALA 1WRLA 1B8LA 3CGAA 3PALA 3FE9A 1X02A 2M49B 1Y0VH 1WLZA 3MSEB 5CPVA 1GQMA 4IJ7A 2JWWA 1GGWA 1LS8A 2WCKA 1SL9A 1W7IB 3WNXB 1CFDA 3CYZA 4XYNA 3FS7A 2QEBA 1QIWA 1TRFA 1IQ3A 5DKQA 1CTRA 1PSRA 2KQYA 2KYCA 2K8MB 2QEHA 2CTNA 3BFBA 2FCEA 2H8VA 3EK4A 1GJYA 3C1VA 1T14A 1V1FA 2PQLA 1B9AA 1QATA 4I5NB 4USLA 3DZTA 3O4YA 5JOLA 2Q91A 2WCFA 1NYAA 1CKKA 1CM4A 3AKAA 1KQVA 4GPLB 1A03A 2EGDA 2NZ0A 2K2FA 3GK4X 1SK6D 5CSNA 3TZ1A 1B47A 3B6XA 4MVFA 1TCFA 1JSAA 3D0YB 2Y1NA 2I2RE 3LCPC 5F6TA 4WQ2A 4M2QA 1BOCA 2LVKA 3DVKA 1RROA 3S0BA 1CB1A 3SG4A 1W9ZA 2LVJA 1LKJA 4WRIA 5B8IB 1S36A 1LVCD 3O78A 1E8AA 4GGFC 2F3YA 1L2OC 2ZNDA 3HX4A 2VRGA 3ZNIA 3SS4A 3FWBA 2M3WA 2AMIA 3EVRA 3EKJA 2FJYA 3SG3A 4GGFA 2JPTA 5AANA 1SKTA 3LK0A 4A4BA 1A29A 1RTP1 1SR6B 1QASA 2PVBA 3RLZA 1DVIA 3E3RA 3JTDB 3NXAA 3S0GA 3WHUB 1KK8C 1ZUZA 1PRWA 3LK1A 1NX2A 1XO5A 3TDZA 2K7BA 4F7FA 1F55A 1SYMA 1B7TZ 3S0EA 3BFHA 2BNXA 2WCBA 2JNXA 2Y4QA 1MF8B 1KSOA 2WCMA 3I5IB 4FQOA 4NQGA 1YURA 2JU0A 2LHLA 2HQWA 1M31A 1C7VA 1TOPA 2JT0A 4OKHA 4BY5A 1K8UA 1MWNA 1G8IA 1QX5B 5EL2A 1NWDA 1MHOA 1VRKA 4CFRA 1F70A 2LVIA 4ORCB 1BR4B 1F4QA 4N1FA 1JFKA 3DY9A 3CLNA 1YX8A 4GUKA 2KAVA 2L50A 3R1OA 3PLFB 1TNWA 2EHBA 3EVVA 4BY4A 1WY9A 4GBAA 2KHNA 1NUBA 2Q4UA 1HT9A 3DVEA 3FE8A 4QJ3B 4YGDB 3EG5B 3OHMB 2JNFA 1AK8A 2M8UA 5HKZA 2OS8C 1JC2A 2LLUA 1DJZA 3VRNA 4CLNA 4NDBA 4AOMA 2KI4C 4YGAA 1YX7A 4YBHB 3EK7A 3VROA 1SBJA 2LNKA 3CZ1A 3CR5X 4U8DA 1CLBA 1CDLA 4DRWA 2M1UA 1IJ5A 1BR1B 1EJ3A 1LINA 2SCPA 3BYAA 3IQOA 1DT7B 3H4SE 1KCYA 3SG2A 4I5KA 3O2PA 2KFHA 1L2OB 1AJ4A 1A2XA 1OSAA 3CS1A 3CTNA 3L4AA 5D3OA 2RGIA 4N5XA 5FI7A 1BJFA 2QDIA 2E30A 3PATA 2AUCA 4GGNA 1NCYA 3DD4A 4OV2A 1TNPA 4M2PA 1WRKA 4PHNA 2F33A 4IL1A 4WQ3A 2LMUA 5AEQA 1SSEB 4GNKB 4FQTA 1CDPA 1OOGA 2QEOA 3B87A 4HREE 1DJIA 4DS7A 1H4BA 3VRRA 4ORAB 3R1VA 4UPGA 1SCVA 1L7ZA 2L4IA 5KTYA 3CR4X 4OR9B 3DF0A 3GK1A 1XA5A 2F2PA 2OPOA 3NHIA 1TUZA 2ISDA 1B1GA 4M2OA 2MA2A 4GFTA 2PRUA 3NGVA 1M45A 3SJSA 2B1UA 1S6CA 2FOTA 1B7TY 3KF9A 1BODA 4MN0A 1OOFA 5KU1A 1K96A 2BL0C 3I5HC 4C0JA 2KI6D 1UP5A 4I5LB 2YGUA 3SIBA 2MRDA 4CPVA 1JUOA 2G2BA 2JTTA 4NDCA 1KK7Z 1XK4C 4MZJA 4YGEB 1YRTB 2JXCA 2LHIA 1EG4A 2ZRSA 1KFUS 1XK4A 2JOJA 1CLLA 2MLEC 2KGRA 1G33A 1JF2A 2P70A 2I7AA 3D75A 3IVTA 3R1PA 4JD9A 5HLVA 2D8NA 2WORA 2LP2A 2OS8B 1QV1A 2FCDA 2I94A 1RK9A 2KI4B 3JVTC 3S0FA 1ORGA 3D10A 2M9GA 1S1EA 3R72A 1IWQA 2E6WA 2F8PA 2NCOA 3WXAA 1YVHA 1H8BA 3EKHA 4CFQA 2JRFA 1A75A 1C07A 1OQPA 3AAJA 3IQQA 4I5JA 4YI8A 1TTXA 1QLSA 1K9UA 2WCHA 3BOWA 3EK8A 3VB1A 1S3PA 1WLMA 4ZCVA 2IS9A 3DXLA 1OOIX 3NSLA 1S6JA 3DYEA 1DJWA 4ICBA 1J55A 1ODBA 1ZFSA 1TNXA 1BMOA 1QWVA 1SCMB 1XFRA 1DGVA 1K94A 1UWOA 2KYFA 2R2IA 3D73A 1BF5A 2LAPA 1QX7A 2MBXA 4TNCA 2K7OA 3RM1A 1OZOA 2KDHA 2KFGA 1FBVA 2HPSA 3DF0B 5K89A 1DELA 1JWDA 4JQ0D 2LP3A 3SG6A 1K2HA 3BUWB 1HQVA 2CCMA 4QJ4B 1N65A 1P28A 3O6BA 1SL8A 3VRQA 1S5GZ 4XJKA 1QV0A 2JPOA 3K1EA 4MZLA 4DCKA 1CFCA 1MQ1A 3KPXA 2P71A 2MAZA 1IRJA 2NLNA 1NSHA 1MXLC 2NXQA 1Q80A 3UNWA 1KFXS 1YTZC 2BL0B 3I5HB 1UURA 4PCWA 3D76A 2QACA 2HQ8A 5D69A 1JFJA 1CFPA 1YR5A 3BJHA 2M1KB 2KAYA 2LANA 2F2OA 2L0PA 1PULA 1RWYA 4OCIA 4MRXA 1U5IA 3F45A 1TN4A 2HF5A 1XFWO 4OVNF 4YGBB 1PSBA 1TIZA 2CBLA 1R6PA 2P6BB 1DJXA 5I2OA 2M7NA 3PFVA 3QMEA 3OBVA 1D1OA 1OOJA 2BE4A 2K0JA 1K9KA 2KNEA 1DTLA 3PM2A 1M39A 1BT6A 1WDCC 1GGZA 2KLEA 1AUIB 2M29A 3CZTX 3JVTB 2PASA 4OZDA 3CR2A 1A75B 1J1EA 2WCEA 1GM0A 1RFJA 3FWCA 1OW4A 3BQ3A 3BOWB 2ZN8A 1IIOA 3S0DA 1K95A 2TN4A 1DJYA 2GGZA 2LMTA 3OX5A 4N1GA 2WCJA 5DICA 2BKIB 3BUXB 4P5OE 2ZN9A 3A8RA 3NSKA 3D78A 5I8NA 1OOHA 1SL7A 1YVLA 2I18A 5TNCA 1PVAA 1EXRA 2NCPA 5DKRA 1KQMC 1OMRA 1DJHA 1YUTA 2GV5A 2M97A 2WC6A 2BAPA 3GK2A 3LL8B 4MBEA 4Q04A 1IJ6A 3TDUA 1SCMC 1FW4A 3OB2B 1M46A 5BPJA 5HLOA 1NX3A 5ER4X 5FI2A 2OTGC 4INXA 2H2KA 5IBWA 1FPWA 2BCXA 1XFXO 3K21A 2LLSA 3FIAA 1IKUA 4QJ5B 1ZOTB 2ZRTA 4INWA 4C0LA 1J7QA 1JBAA 1XYDA 2BCAA 3I5FC 5CSJA 4XJKB 1XFZO 1IQ5A 3OB1B 1QS7A 1MUXA 1CDNA 1EL4A 2BKHB 3OX6A 2MLFC 2LE9B 3V2LA 1B8CA 3BXKA 4PHJA 3N7HA 1DQEA 3NHTA 4YI9A 2LUCA 3BUNB 2L5YA 3CWGA 5G08A 3TUYC 2L5XB 3AKBA 1S5GY 1ZACA 1DMOA 2JT3A 3B88A 5KSZA 3QRXA 1U5IB 4PDZA 5ER5A 1B8RA 1SNLA 2PYQA 2LMVA 2FJUB 1CFFA 1N2DA 1CNPA 4D1EA 2ZNEA 3CDNA 1CM1A 3ZWHA 1EH2A 1XFUO 2BECA 4JKTA 3A4UB 2CNPA 3PSRA 2PSRA 1WDCB 1Y1AA 3I5GC 2KLDA 2JTZA 2L4HA 2EC6C 1W7JB 4E68A 1F8HA 3TS5C 2ERBA 2QPTA 2BBNA 1NPQA 1RJVA 1SMGA 2LV7A 2PALA 1UUSA 1J1DA 1LA0A 5AFPA 2Y1MA 3L4LA 1SW8A 2KFFA 1ALWA 1OMDA 3VGOA 2JULA 1AVSA 3FE6A 2WCLA 2L51A 4JPZB 5I94A 1KQMB 1UHKA 1OMVA 4PE4A 1N0YA 1Y1XA 2JZIA 2L98A 2V53A 5HYDA 4PALA 1C3ZA 1KWOC 5FYXA 1YUUA 1ZMZA 3O4XA 1C7WA 2OTGB 5HL1A 1J7OA 2H61C 4CIDA 4ETOA 3KEVA 3DVMA 2HETA 1MR8A 1UHIA 1UHNA 2KOTA 4PE1A 3I5FB 3CZ0A 5CSIA 2CXJA 2KSPA 3M0WA 2L2CA 1KFUL 1BG1A 2LUXA 2H61A 1CMFA 4PT1A 2O60A 1AJ5A 5HKYA 1R2UA 2KI6C 1TNQA 1YUSA 3CZ2A 1KSMA 2JQ6A 1Z2CB 2K60A 3ICBA 3KHEA 4MZKA 1DC1A 4MEWA 1SRAA 2K2AA 1JF0A 2JC2A 3KO0A 1OZSA 1TWOA 4PHKA 4A4CA 3TUYB 2MHHA 1XFVO 4HRGA 4R1EA 3D77A 1QTXA 2L2EA 4L9MA 1QVIZ 5D7FA 4DIRA 5HKWA 1XFYO 3D74A 3SG7A 3IF7A 3L47A 5FI6A 2SASA 2ZFDA 1NX0A 2KPHA 2LVVA 2Y5IA 5CSFA 2DOQA 3AAKA 3PN7C 1DF0A 1K93D 1SY9A 5DKNA 3LLEA 1QX2A 1KK7Y 5AXIA 4AQJA 2F3ZA 1CLMA 1NIWA 2QEVA 1DEKA 3DVJA 5JJGA 3I5GB 5AERA 2EC6B 1LA3A 2GGMA 3TS5B 4YRUA 4NDDA 1C3YA 2KQ6A 1NCZA 1G4YR 2G9BA 2KGBC 1Z4HA 3BFAA 2BBMA 1K90D 1S6IA 2COLB 2GTEA 1Y6WA 3HCMA 5I2LA 1Y1UA 3B86A 1CMGA 1IH0A 1PK0D 4ORBB 2CT9A 1MXEA 1NX1A 5I2QA 1FI5A 1QLKA 3S0AA 5GQQC 2WC5A 2WOSA 1NCXA 4MRYA 1TUJA 1QIVA 4JWQA 4GAOA 3RZSA 1KFXL 2WC8A 3NSIA 4HRHA 4F0ZB 1A4PA 1B4CA 1KWOB 2PMYA 4DUQA 4PHMA 1BLQA 1EG3A 1QXPA 1NP8A
chains in the Genus database with same CATH topology
1F54A 3NSOA 1ALVA 1TCOB 1IGVA 3OP0A 1K9PA 3SG5A 2BCBA 1V1GA 1YRUB 2WNDA 1RECA 3SIAA 1XVJA 2M0RA 3BUMB 1PVBA 1IG5A 4MSPA 1SPYA 2K61A 1FF1A 1DJGA 4P2YB 3WHTB 2MJWB 5J3XA 3VRPA 2AAOA 2JXLA 2LLTA 1FI6A 3D0YA 5PALA 4PE7A 2A4JA 1F4OA 1AP4A 2KBIA 2KAXA 2K7DA 2K7CA 2LM5A 1BU3A 2ZKMX 1M63B 1OE9B 2LC5A 1J7RA 4C0KA 4PE0A 4ZCUA 1AHRA 1F71A 2JT8A 1SR6C 1UHJA 1CDMA 1WRZA 4MLWA 1KK8B 3JTDC 1S26D 2KBMA 1DF0B 2LCPA 1QJTA 2O5GA 3BUOB 3EVUA 2M7LA 1QVIY 4FTGA 4YGCB 2BE6A 3GOFA 3PM8A 1UHHA 3PN7B 4AQIA 4HSZA 1LXFC 1DGUA 3I5IC 3TDIA 1PALA 1WRLA 1B8LA 3CGAA 3PALA 1X02A 2M49B 1Y0VH 1WLZA 3MSEB 5CPVA 1GQMA 2JWWA 1GGWA 1SL9A 1W7IB 3WNXB 1CFDA 4XYNA 3FS7A 1QIWA 1TRFA 1IQ3A 5DKQA 1CTRA 1PSRA 2KQYA 2KYCA 2K8MB 2CTNA 3EK4A 2FCEA 1GJYA 3C1VA 1V1FA 1B9AA 1QATA 4I5NB 4USLA 3O4YA 5JOLA 1CKKA 2Q91A 2WCFA 1NYAA 1CM4A 3AKAA 1KQVA 4GPLB 1A03A 2EGDA 2NZ0A 2K2FA 3GK4X 1SK6D 5CSNA 3TZ1A 1B47A 4MVFA 1TCFA 1JSAA 3D0YB 2Y1NA 2I2RE 3LCPC 5F6TA 4WQ2A 4M2QA 1BOCA 2LVKA 3DVKA 1RROA 1CB1A 3SG4A 2LVJA 1LKJA 4WRIA 5B8IB 1S36A 1LVCD 3O78A 1E8AA 4GGFC 2F3YA 1L2OC 2ZNDA 3HX4A 2VRGA 3ZNIA 3FWBA 2M3WA 2AMIA 3EVRA 3EKJA 3SG3A 4GGFA 2JPTA 5AANA 1SKTA 3LK0A 4A4BA 1A29A 1RTP1 1SR6B 1QASA 2PVBA 3RLZA 1DVIA 3E3RA 3JTDB 3NXAA 3WHUB 1KK8C 1ZUZA 1PRWA 3LK1A 1NX2A 1XO5A 3TDZA 2K7BA 1F55A 1SYMA 1B7TZ 2WCBA 2Y4QA 2JNXA 1MF8B 1KSOA 3I5IB 4FQOA 4NQGA 1YURA 2JU0A 2LHLA 2HQWA 1M31A 1C7VA 1TOPA 2JT0A 4OKHA 4BY5A 1K8UA 1MWNA 1G8IA 1QX5B 1NWDA 1MHOA 1VRKA 4CFRA 1F70A 2LVIA 4ORCB 1BR4B 1F4QA 4N1FA 1JFKA 3CLNA 1YX8A 4GUKA 2KAVA 2L50A 3PLFB 1TNWA 2EHBA 3EVVA 4BY4A 1WY9A 4GBAA 2KHNA 1NUBA 2Q4UA 1HT9A 3DVEA 4QJ3B 4YGDB 3OHMB 2JNFA 1AK8A 2M8UA 5HKZA 2OS8C 1JC2A 2LLUA 1DJZA 3VRNA 4CLNA 4NDBA 4AOMA 2KI4C 4YGAA 1YX7A 4YBHB 3EK7A 3VROA 1SBJA 2LNKA 3CR5X 4U8DA 1CLBA 1CDLA 4DRWA 2M1UA 1IJ5A 1BR1B 1EJ3A 1LINA 2SCPA 3BYAA 3IQOA 1DT7B 3H4SE 1KCYA 3SG2A 4I5KA 3O2PA 2KFHA 1L2OB 1AJ4A 1A2XA 1OSAA 3CS1A 3CTNA 2RGIA 4N5XA 1BJFA 3PATA 2E30A 2AUCA 4GGNA 1NCYA 3DD4A 4OV2A 1TNPA 4M2PA 1WRKA 4PHNA 2F33A 4IL1A 4WQ3A 2LMUA 5AEQA 4GNKB 1CDPA 4HREE 1DJIA 4DS7A 1H4BA 3VRRA 4ORAB 4UPGA 1SCVA 1L7ZA 2L4IA 5KTYA 3CR4X 4OR9B 3DF0A 3GK1A 1XA5A 2F2PA 2OPOA 2ISDA 1B1GA 4M2OA 2MA2A 4GFTA 2PRUA 1M45A 3SJSA 2B1UA 1S6CA 2FOTA 1B7TY 3KF9A 1BODA 4MN0A 5KU1A 1K96A 2BL0C 3I5HC 4C0JA 2KI6D 1UP5A 4I5LB 3SIBA 2MRDA 4CPVA 1JUOA 2G2BA 2JTTA 4NDCA 1KK7Z 1XK4C 4MZJA 4YGEB 1YRTB 2JXCA 2LHIA 1EG4A 2ZRSA 1KFUS 1XK4A 2JOJA 1CLLA 2MLEC 2KGRA 1G33A 1JF2A 4PALA 2I7AA 5HLVA 2D8NA 2WORA 2LP2A 2OS8B 1QV1A 2FCDA 2I94A 1RK9A 2KI4B 3JVTC 3D10A 2M9GA 1S1EA 1IWQA 2E6WA 2F8PA 2NCOA 3WXAA 1YVHA 1H8BA 3EKHA 4CFQA 2JRFA 1A75A 1C07A 1OQPA 3AAJA 3IQQA 4I5JA 4YI8A 1TTXA 1QLSA 1K9UA 3BOWA 3EK8A 1S3PA 1WLMA 4ZCVA 2IS9A 3NSLA 1S6JA 1DJWA 4ICBA 1J55A 1ODBA 1ZFSA 1TNXA 1BMOA 1SCMB 2KYFA 1DGVA 1K94A 1UWOA 2R2IA 1BF5A 2LAPA 1QX7A 2MBXA 4TNCA 2K7OA 3RM1A 1OZOA 2KDHA 2KFGA 1FBVA 2HPSA 3DF0B 5K89A 1JWDA 4JQ0D 2LP3A 3SG6A 1K2HA 3BUWB 1HQVA 2CCMA 4QJ4B 1N65A 3O6BA 1SL8A 3VRQA 1S5GZ 4XJKA 1QV0A 4MZLA 4DCKA 1CFCA 1MQ1A 3KPXA 2MAZA 1IRJA 2NLNA 1NSHA 1MXLC 2NXQA 1Q80A 1KFXS 1YTZC 2BL0B 3I5HB 1UURA 4PCWA 2QACA 2HQ8A 5D69A 1JFJA 1CFPA 1YR5A 2M1KB 2KAYA 2LANA 2F2OA 2L0PA 1PULA 1RWYA 4OCIA 4MRXA 1U5IA 3F45A 1TN4A 2HF5A 1XFWO 4OVNF 4YGBB 1PSBA 1TIZA 2CBLA 1R6PA 2P6BB 1DJXA 5I2OA 2M7NA 3PFVA 1D1OA 1OOJA 2BE4A 2K0JA 1K9KA 2KNEA 1DTLA 1J7PA 1M39A 1BT6A 1WDCC 1GGZA 2M29A 1AUIB 3CZTX 3JVTB 2PASA 3CR2A 1A75B 1J1EA 2WCEA 1RFJA 3FWCA 3BQ3A 3BOWB 2ZN8A 1K95A 2TN4A 1DJYA 2GGZA 2LMTA 3OX5A 4N1GA 2BKIB 3BUXB 4P5OE 2ZN9A 3A8RA 3NSKA 5I8NA 1SL7A 1YVLA 2I18A 5TNCA 1PVAA 1EXRA 2NCPA 5DKRA 1KQMC 1OMRA 1DJHA 1YUTA 2GV5A 2M97A 3GK2A 3LL8B 4MBEA 4Q04A 1IJ6A 3TDUA 1SCMC 1FW4A 3OB2B 1M46A 5BPJA 5HLOA 1NX3A 5ER4X 5IBWA 2OTGC 1FPWA 2H2KA 2BCXA 1XFXO 3K21A 2LLSA 3FIAA 1IKUA 4QJ5B 1ZOTB 2ZRTA 1J7QA 4C0LA 1JBAA 1XYDA 2BCAA 3I5FC 5CSJA 4XJKB 1XFZO 1IQ5A 3OB1B 1QS7A 1MUXA 1CDNA 1EL4A 2BKHB 3OX6A 2MLFC 2LE9B 1B8CA 3BXKA 4PHJA 4YI9A 2LUCA 3BUNB 3CWGA 5G08A 3TUYC 2L5XB 3AKBA 1S5GY 1ZACA 1DMOA 2JT3A 5KSZA 3QRXA 1U5IB 4PDZA 5ER5A 1B8RA 1SNLA 2LMVA 2FJUB 1CFFA 1N2DA 1CNPA 4D1EA 2ZNEA 1CM1A 3ZWHA 1EH2A 1XFUO 2BECA 3A4UB 2CNPA 3PSRA 2PSRA 1WDCB 1Y1AA 3I5GC 2L4HA 2JTZA 1F8HA 2EC6C 1W7JB 4E68A 3TS5C 2QPTA 2BBNA 1NPQA 1RJVA 1SMGA 2LV7A 2PALA 1UUSA 1J1DA 1LA0A 5AFPA 2Y1MA 1SW8A 2KFFA 1ALWA 1OMDA 3VGOA 2JULA 1AVSA 2L51A 4JPZB 1KQMB 1UHKA 1OMVA 4PE4A 1N0YA 1Y1XA 2JZIA 2L98A 2V53A 5HYDA 1KWOC 5FYXA 1YUUA 1ZMZA 1C7WA 2OTGB 1J7OA 2H61C 4CIDA 4ETOA 3KEVA 3DVMA 2HETA 1MR8A 1UHIA 1UHNA 2KOTA 4PE1A 3I5FB 5CSIA 1BG1A 2CXJA 2KSPA 3M0WA 1KFUL 2LUXA 2H61A 1CMFA 2O60A 1AJ5A 5HKYA 1R2UA 2KI6C 1TNQA 1YUSA 1KSMA 2JQ6A 3ICBA 3KHEA 4MZKA 4MEWA 1SRAA 2K2AA 1JF0A 2JC2A 3KO0A 1OZSA 4PHKA 4A4CA 3TUYB 2MHHA 1XFVO 4HRGA 4R1EA 1QTXA 2L2EA 4L9MA 1QVIZ 5D7FA 4DIRA 5HKWA 1XFYO 3SG7A 3IF7A 2SASA 2ZFDA 1NX0A 2LVVA 2Y5IA 5CSFA 2DOQA 3AAKA 3PN7C 1DF0A 1K93D 1SY9A 5DKNA 3LLEA 1QX2A 1KK7Y 5AXIA 4AQJA 2F3ZA 1CLMA 1NIWA 3DVJA 5JJGA 3I5GB 5AERA 2EC6B 1LA3A 2GGMA 3TS5B 4YRUA 4NDDA 2KQ6A 1NCZA 1G4YR 2G9BA 2KGBC 2BBMA 1K90D 1S6IA 2COLB 1Y6WA 3HCMA 5I2LA 1Y1UA 1IH0A 1CMGA 1PK0D 4ORBB 2CT9A 1MXEA 1NX1A 5I2QA 1FI5A 1QLKA 5GQQC 2WOSA 4MRYA 1NCXA 1QIVA 4JWQA 4GAOA 1KFXL 2WC8A 3NSIA 4HRHA 4F0ZB 1A4PA 1B4CA 1KWOB 2PMYA 4DUQA 4PHMA 1BLQA 1EG3A 1QXPA 1NP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F54 A;  3NSO A;  1ALV A;  1TCO B;  1IGV A;  3OP0 A;  1K9P A;  3SG5 A;  2BCB A;  1V1G A;  1YRU B;  2WND A;  1REC A;  3SIA A;  1XVJ A;  2M0R A;  3BUM B;  1PVB A;  1IG5 A;  4MSP A;  1SPY A;  2K61 A;  1FF1 A;  1DJG A;  4P2Y B;  3WHT B;  2MJW B;  5J3X A;  3VRP A;  2AAO A;  2JXL A;  2LLT A;  1FI6 A;  3D0Y A;  5PAL A;  4PE7 A;  2A4J A;  1F4O A;  1AP4 A;  2KBI A;  2KAX A;  2K7D A;  2K7C A;  2LM5 A;  1BU3 A;  2ZKM X;  1M63 B;  1OE9 B;  2LC5 A;  1J7R A;  4C0K A;  4PE0 A;  4ZCU A;  1AHR A;  1F71 A;  2JT8 A;  1SR6 C;  1UHJ A;  1CDM A;  1WRZ A;  4MLW A;  1KK8 B;  3JTD C;  1S26 D;  2KBM A;  1DF0 B;  2LCP A;  1QJT A;  2O5G A;  3BUO B;  3EVU A;  2M7L A;  1QVI Y;  4FTG A;  4YGC B;  2BE6 A;  3GOF A;  3PM8 A;  1UHH A;  3PN7 B;  4AQI A;  4HSZ A;  1LXF C;  1DGU A;  3I5I C;  3TDI A;  1PAL A;  1WRL A;  1B8L A;  3CGA A;  3PAL A;  1X02 A;  2M49 B;  1Y0V H;  1WLZ A;  3MSE B;  5CPV A;  1GQM A;  2JWW A;  1GGW A;  1SL9 A;  1W7I B;  3WNX B;  1CFD A;  4XYN A;  3FS7 A;  1QIW A;  1TRF A;  1IQ3 A;  5DKQ A;  1CTR A;  1PSR A;  2KQY A;  2KYC A;  2K8M B;  2CTN A;  3EK4 A;  2FCE A;  1GJY A;  3C1V A;  1V1F A;  1B9A A;  1QAT A;  4I5N B;  4USL A;  3O4Y A;  5JOL A;  1CKK A;  2Q91 A;  2WCF A;  1NYA A;  1CM4 A;  3AKA A;  1KQV A;  4GPL B;  1A03 A;  2EGD A;  2NZ0 A;  2K2F A;  3GK4 X;  1SK6 D;  5CSN A;  3TZ1 A;  1B47 A;  4MVF A;  1TCF A;  1JSA A;  3D0Y B;  2Y1N A;  2I2R E;  3LCP C;  5F6T A;  4WQ2 A;  4M2Q A;  1BOC A;  2LVK A;  3DVK A;  1RRO A;  1CB1 A;  3SG4 A;  2LVJ A;  1LKJ A;  4WRI A;  5B8I B;  1S36 A;  1LVC D;  3O78 A;  1E8A A;  4GGF C;  2F3Y A;  1L2O C;  2ZND A;  3HX4 A;  2VRG A;  3ZNI A;  3FWB A;  2M3W A;  2AMI A;  3EVR A;  3EKJ A;  3SG3 A;  4GGF A;  2JPT A;  5AAN A;  1SKT A;  3LK0 A;  4A4B A;  1A29 A;  1RTP 1;  1SR6 B;  1QAS A;  2PVB A;  3RLZ A;  1DVI A;  3E3R A;  3JTD B;  3NXA A;  3WHU B;  1KK8 C;  1ZUZ A;  1PRW A;  3LK1 A;  1NX2 A;  1XO5 A;  3TDZ A;  2K7B A;  1F55 A;  1SYM A;  1B7T Z;  2WCB A;  2Y4Q A;  2JNX A;  1MF8 B;  1KSO A;  3I5I B;  4FQO A;  4NQG A;  1YUR A;  2JU0 A;  2LHL A;  2HQW A;  1M31 A;  1C7V A;  1TOP A;  2JT0 A;  4OKH A;  4BY5 A;  1K8U A;  1MWN A;  1G8I A;  1QX5 B;  1NWD A;  1MHO A;  1VRK A;  4CFR A;  1F70 A;  2LVI A;  4ORC B;  1BR4 B;  1F4Q A;  4N1F A;  1JFK A;  3CLN A;  1YX8 A;  4GUK A;  2KAV A;  2L50 A;  3PLF B;  1TNW A;  2EHB A;  3EVV A;  4BY4 A;  1WY9 A;  4GBA A;  2KHN A;  1NUB A;  2Q4U A;  1HT9 A;  3DVE A;  4QJ3 B;  4YGD B;  3OHM B;  2JNF A;  1AK8 A;  2M8U A;  5HKZ A;  2OS8 C;  1JC2 A;  2LLU A;  1DJZ A;  3VRN A;  4CLN A;  4NDB A;  4AOM A;  2KI4 C;  4YGA A;  1YX7 A;  4YBH B;  3EK7 A;  3VRO A;  1SBJ A;  2LNK A;  3CR5 X;  4U8D A;  1CLB A;  1CDL A;  4DRW A;  2M1U A;  1IJ5 A;  1BR1 B;  1EJ3 A;  1LIN A;  2SCP A;  3BYA A;  3IQO A;  1DT7 B;  3H4S E;  1KCY A;  3SG2 A;  4I5K A;  3O2P A;  2KFH A;  1L2O B;  1AJ4 A;  1A2X A;  1OSA A;  3CS1 A;  3CTN A;  2RGI A;  4N5X A;  1BJF A;  3PAT A;  2E30 A;  2AUC A;  4GGN A;  1NCY A;  3DD4 A;  4OV2 A;  1TNP A;  4M2P A;  1WRK A;  4PHN A;  2F33 A;  4IL1 A;  4WQ3 A;  2LMU A;  5AEQ A;  4GNK B;  1CDP A;  4HRE E;  1DJI A;  4DS7 A;  1H4B A;  3VRR A;  4ORA B;  4UPG A;  1SCV A;  1L7Z A;  2L4I A;  5KTY A;  3CR4 X;  4OR9 B;  3DF0 A;  3GK1 A;  1XA5 A;  2F2P A;  2OPO A;  2ISD A;  1B1G A;  4M2O A;  2MA2 A;  4GFT A;  2PRU A;  1M45 A;  3SJS A;  2B1U A;  1S6C A;  2FOT A;  1B7T Y;  3KF9 A;  1BOD A;  4MN0 A;  5KU1 A;  1K96 A;  2BL0 C;  3I5H C;  4C0J A;  2KI6 D;  1UP5 A;  4I5L B;  3SIB A;  2MRD A;  4CPV A;  1JUO A;  2G2B A;  2JTT A;  4NDC A;  1KK7 Z;  1XK4 C;  4MZJ A;  4YGE B;  1YRT B;  2JXC A;  2LHI A;  1EG4 A;  2ZRS A;  1KFU S;  1XK4 A;  2JOJ A;  1CLL A;  2MLE C;  2KGR A;  1G33 A;  1JF2 A;  4PAL A;  2I7A A;  5HLV A;  2D8N A;  2WOR A;  2LP2 A;  2OS8 B;  1QV1 A;  2FCD A;  2I94 A;  1RK9 A;  2KI4 B;  3JVT C;  3D10 A;  2M9G A;  1S1E A;  1IWQ A;  2E6W A;  2F8P A;  2NCO A;  3WXA A;  1YVH A;  1H8B A;  3EKH A;  4CFQ A;  2JRF A;  1A75 A;  1C07 A;  1OQP A;  3AAJ A;  3IQQ A;  4I5J A;  4YI8 A;  1TTX A;  1QLS A;  1K9U A;  3BOW A;  3EK8 A;  1S3P A;  1WLM A;  4ZCV A;  2IS9 A;  3NSL A;  1S6J A;  1DJW A;  4ICB A;  1J55 A;  1ODB A;  1ZFS A;  1TNX A;  1BMO A;  1SCM B;  2KYF A;  1DGV A;  1K94 A;  1UWO A;  2R2I A;  1BF5 A;  2LAP A;  1QX7 A;  2MBX A;  4TNC A;  2K7O A;  3RM1 A;  1OZO A;  2KDH A;  2KFG A;  1FBV A;  2HPS A;  3DF0 B;  5K89 A;  1JWD A;  4JQ0 D;  2LP3 A;  3SG6 A;  1K2H A;  3BUW B;  1HQV A;  2CCM A;  4QJ4 B;  1N65 A;  3O6B A;  1SL8 A;  3VRQ A;  1S5G Z;  4XJK A;  1QV0 A;  4MZL A;  4DCK A;  1CFC A;  1MQ1 A;  3KPX A;  2MAZ A;  1IRJ A;  2NLN A;  1NSH A;  1MXL C;  2NXQ A;  1Q80 A;  1KFX S;  1YTZ C;  2BL0 B;  3I5H B;  1UUR A;  4PCW A;  2QAC A;  2HQ8 A;  5D69 A;  1JFJ A;  1CFP A;  1YR5 A;  2M1K B;  2KAY A;  2LAN A;  2F2O A;  2L0P A;  1PUL A;  1RWY A;  4OCI A;  4MRX A;  1U5I A;  3F45 A;  1TN4 A;  2HF5 A;  1XFW O;  4OVN F;  4YGB B;  1PSB A;  1TIZ A;  2CBL A;  1R6P A;  2P6B B;  1DJX A;  5I2O A;  2M7N A;  3PFV A;  1D1O A;  1OOJ A;  2BE4 A;  2K0J A;  1K9K A;  2KNE A;  1DTL A;  1J7P A;  1M39 A;  1BT6 A;  1WDC C;  1GGZ A;  2M29 A;  1AUI B;  3CZT X;  3JVT B;  2PAS A;  3CR2 A;  1A75 B;  1J1E A;  2WCE A;  1RFJ A;  3FWC A;  3BQ3 A;  3BOW B;  2ZN8 A;  1K95 A;  2TN4 A;  1DJY A;  2GGZ A;  2LMT A;  3OX5 A;  4N1G A;  2BKI B;  3BUX B;  4P5O E;  2ZN9 A;  3A8R A;  3NSK A;  5I8N A;  1SL7 A;  1YVL A;  2I18 A;  5TNC A;  1PVA A;  1EXR A;  2NCP A;  5DKR A;  1KQM C;  1OMR A;  1DJH A;  1YUT A;  2GV5 A;  2M97 A;  3GK2 A;  3LL8 B;  4MBE A;  4Q04 A;  1IJ6 A;  3TDU A;  1SCM C;  1FW4 A;  3OB2 B;  1M46 A;  5BPJ A;  5HLO A;  1NX3 A;  5ER4 X;  5IBW A;  2OTG C;  1FPW A;  2H2K A;  2BCX A;  1XFX O;  3K21 A;  2LLS A;  3FIA A;  1IKU A;  4QJ5 B;  1ZOT B;  2ZRT A;  1J7Q A;  4C0L A;  1JBA A;  1XYD A;  2BCA A;  3I5F C;  5CSJ A;  4XJK B;  1XFZ O;  1IQ5 A;  3OB1 B;  1QS7 A;  1MUX A;  1CDN A;  1EL4 A;  2BKH B;  3OX6 A;  2MLF C;  2LE9 B;  1B8C A;  3BXK A;  4PHJ A;  4YI9 A;  2LUC A;  3BUN B;  3CWG A;  5G08 A;  3TUY C;  2L5X B;  3AKB A;  1S5G Y;  1ZAC A;  1DMO A;  2JT3 A;  5KSZ A;  3QRX A;  1U5I B;  4PDZ A;  5ER5 A;  1B8R A;  1SNL A;  2LMV A;  2FJU B;  1CFF A;  1N2D A;  1CNP A;  4D1E A;  2ZNE A;  1CM1 A;  3ZWH A;  1EH2 A;  1XFU O;  2BEC A;  3A4U B;  2CNP A;  3PSR A;  2PSR A;  1WDC B;  1Y1A A;  3I5G C;  2L4H A;  2JTZ A;  1F8H A;  2EC6 C;  1W7J B;  4E68 A;  3TS5 C;  2QPT A;  2BBN A;  1NPQ A;  1RJV A;  1SMG A;  2LV7 A;  2PAL A;  1UUS A;  1J1D A;  1LA0 A;  5AFP A;  2Y1M A;  1SW8 A;  2KFF A;  1ALW A;  1OMD A;  3VGO A;  2JUL A;  1AVS A;  2L51 A;  4JPZ B;  1KQM B;  1UHK A;  1OMV A;  4PE4 A;  1N0Y A;  1Y1X A;  2JZI A;  2L98 A;  2V53 A;  5HYD A;  1KWO C;  5FYX A;  1YUU A;  1ZMZ A;  1C7W A;  2OTG B;  1J7O A;  2H61 C;  4CID A;  4ETO A;  3KEV A;  3DVM A;  2HET A;  1MR8 A;  1UHI A;  1UHN A;  2KOT A;  4PE1 A;  3I5F B;  5CSI A;  1BG1 A;  2CXJ A;  2KSP A;  3M0W A;  1KFU L;  2LUX A;  2H61 A;  1CMF A;  2O60 A;  1AJ5 A;  5HKY A;  1R2U A;  2KI6 C;  1TNQ A;  1YUS A;  1KSM A;  2JQ6 A;  3ICB A;  3KHE A;  4MZK A;  4MEW A;  1SRA A;  2K2A A;  1JF0 A;  2JC2 A;  3KO0 A;  1OZS A;  4PHK A;  4A4C A;  3TUY B;  2MHH A;  1XFV O;  4HRG A;  4R1E A;  1QTX A;  2L2E A;  4L9M A;  1QVI Z;  5D7F A;  4DIR A;  5HKW A;  1XFY O;  3SG7 A;  3IF7 A;  2SAS A;  2ZFD A;  1NX0 A;  2LVV A;  2Y5I A;  5CSF A;  2DOQ A;  3AAK A;  3PN7 C;  1DF0 A;  1K93 D;  1SY9 A;  5DKN A;  3LLE A;  1QX2 A;  1KK7 Y;  5AXI A;  4AQJ A;  2F3Z A;  1CLM A;  1NIW A;  3DVJ A;  5JJG A;  3I5G B;  5AER A;  2EC6 B;  1LA3 A;  2GGM A;  3TS5 B;  4YRU A;  4NDD A;  2KQ6 A;  1NCZ A;  1G4Y R;  2G9B A;  2KGB C;  2BBM A;  1K90 D;  1S6I A;  2COL B;  1Y6W A;  3HCM A;  5I2L A;  1Y1U A;  1IH0 A;  1CMG A;  1PK0 D;  4ORB B;  2CT9 A;  1MXE A;  1NX1 A;  5I2Q A;  1FI5 A;  1QLK A;  5GQQ C;  2WOS A;  4MRY A;  1NCX A;  1QIV A;  4JWQ A;  4GAO A;  1KFX L;  2WC8 A;  3NSI A;  4HRH A;  4F0Z B;  1A4P A;  1B4C A;  1KWO B;  2PMY A;  4DUQ A;  4PHM A;  1BLQ A;  1EG3 A;  1QXP A;  1NP8 A; 
#chains in the Genus database with same CATH topology
 1F54 A;  3NSO A;  1ALV A;  1TCO B;  1IGV A;  3OP0 A;  1K9P A;  3SG5 A;  2BCB A;  1V1G A;  1YRU B;  2WND A;  1REC A;  3SIA A;  1XVJ A;  2M0R A;  3BUM B;  1PVB A;  3PJI A;  1IG5 A;  4MSP A;  3SS3 A;  1SPY A;  2K61 A;  3Q8I A;  1FF1 A;  1DJG A;  4P2Y B;  3UO9 A;  3WHT B;  2MJW B;  5J3X A;  3VRP A;  2AAO A;  2JXL A;  2LLT A;  1FI6 A;  3D0Y A;  5PAL A;  1J7P A;  4PE7 A;  2A4J A;  1F4O A;  1AP4 A;  2KBI A;  3CAB A;  2KAX A;  4KYN A;  2K7D A;  2K7C A;  2LM5 A;  1BU3 A;  2ZKM X;  1M63 B;  3OGN A;  1OE9 B;  2LC5 A;  1J7R A;  4C0K A;  4PE0 A;  4ZCU A;  1AHR A;  1F71 A;  2JT8 A;  1SR6 C;  1UHJ A;  1CDM A;  1WRZ A;  4MLW A;  1KK8 B;  3JTD C;  1S26 D;  2KBM A;  1DF0 B;  2LCP A;  1QJT A;  2O5G A;  3BUO B;  3SS5 A;  3EVU A;  2M7L A;  1QVI Y;  4FTG A;  4YGC B;  2BE6 A;  3GOF A;  3PM8 A;  1UHH A;  3PN7 B;  4AQI A;  4HSZ A;  1LXF C;  3B7A A;  1DGU A;  3I5I C;  3TDI A;  1PAL A;  1WRL A;  1B8L A;  3CGA A;  3PAL A;  3FE9 A;  1X02 A;  2M49 B;  1Y0V H;  1WLZ A;  3MSE B;  5CPV A;  1GQM A;  4IJ7 A;  2JWW A;  1GGW A;  1LS8 A;  2WCK A;  1SL9 A;  1W7I B;  3WNX B;  1CFD A;  3CYZ A;  4XYN A;  3FS7 A;  2QEB A;  1QIW A;  1TRF A;  1IQ3 A;  5DKQ A;  1CTR A;  1PSR A;  2KQY A;  2KYC A;  2K8M B;  2QEH A;  2CTN A;  3BFB A;  2FCE A;  2H8V A;  3EK4 A;  1GJY A;  3C1V A;  1T14 A;  1V1F A;  2PQL A;  1B9A A;  1QAT A;  4I5N B;  4USL A;  3DZT A;  3O4Y A;  5JOL A;  2Q91 A;  2WCF A;  1NYA A;  1CKK A;  1CM4 A;  3AKA A;  1KQV A;  4GPL B;  1A03 A;  2EGD A;  2NZ0 A;  2K2F A;  3GK4 X;  1SK6 D;  5CSN A;  3TZ1 A;  1B47 A;  3B6X A;  4MVF A;  1TCF A;  1JSA A;  3D0Y B;  2Y1N A;  2I2R E;  3LCP C;  5F6T A;  4WQ2 A;  4M2Q A;  1BOC A;  2LVK A;  3DVK A;  1RRO A;  3S0B A;  1CB1 A;  3SG4 A;  1W9Z A;  2LVJ A;  1LKJ A;  4WRI A;  5B8I B;  1S36 A;  1LVC D;  3O78 A;  1E8A A;  4GGF C;  2F3Y A;  1L2O C;  2ZND A;  3HX4 A;  2VRG A;  3ZNI A;  3SS4 A;  3FWB A;  2M3W A;  2AMI A;  3EVR A;  3EKJ A;  2FJY A;  3SG3 A;  4GGF A;  2JPT A;  5AAN A;  1SKT A;  3LK0 A;  4A4B A;  1A29 A;  1RTP 1;  1SR6 B;  1QAS A;  2PVB A;  3RLZ A;  1DVI A;  3E3R A;  3JTD B;  3NXA A;  3S0G A;  3WHU B;  1KK8 C;  1ZUZ A;  1PRW A;  3LK1 A;  1NX2 A;  1XO5 A;  3TDZ A;  2K7B A;  4F7F A;  1F55 A;  1SYM A;  1B7T Z;  3S0E A;  3BFH A;  2BNX A;  2WCB A;  2JNX A;  2Y4Q A;  1MF8 B;  1KSO A;  2WCM A;  3I5I B;  4FQO A;  4NQG A;  1YUR A;  2JU0 A;  2LHL A;  2HQW A;  1M31 A;  1C7V A;  1TOP A;  2JT0 A;  4OKH A;  4BY5 A;  1K8U A;  1MWN A;  1G8I A;  1QX5 B;  5EL2 A;  1NWD A;  1MHO A;  1VRK A;  4CFR A;  1F70 A;  2LVI A;  4ORC B;  1BR4 B;  1F4Q A;  4N1F A;  1JFK A;  3DY9 A;  3CLN A;  1YX8 A;  4GUK A;  2KAV A;  2L50 A;  3R1O A;  3PLF B;  1TNW A;  2EHB A;  3EVV A;  4BY4 A;  1WY9 A;  4GBA A;  2KHN A;  1NUB A;  2Q4U A;  1HT9 A;  3DVE A;  3FE8 A;  4QJ3 B;  4YGD B;  3EG5 B;  3OHM B;  2JNF A;  1AK8 A;  2M8U A;  5HKZ A;  2OS8 C;  1JC2 A;  2LLU A;  1DJZ A;  3VRN A;  4CLN A;  4NDB A;  4AOM A;  2KI4 C;  4YGA A;  1YX7 A;  4YBH B;  3EK7 A;  3VRO A;  1SBJ A;  2LNK A;  3CZ1 A;  3CR5 X;  4U8D A;  1CLB A;  1CDL A;  4DRW A;  2M1U A;  1IJ5 A;  1BR1 B;  1EJ3 A;  1LIN A;  2SCP A;  3BYA A;  3IQO A;  1DT7 B;  3H4S E;  1KCY A;  3SG2 A;  4I5K A;  3O2P A;  2KFH A;  1L2O B;  1AJ4 A;  1A2X A;  1OSA A;  3CS1 A;  3CTN A;  3L4A A;  5D3O A;  2RGI A;  4N5X A;  5FI7 A;  1BJF A;  2QDI A;  2E30 A;  3PAT A;  2AUC A;  4GGN A;  1NCY A;  3DD4 A;  4OV2 A;  1TNP A;  4M2P A;  1WRK A;  4PHN A;  2F33 A;  4IL1 A;  4WQ3 A;  2LMU A;  5AEQ A;  1SSE B;  4GNK B;  4FQT A;  1CDP A;  1OOG A;  2QEO A;  3B87 A;  4HRE E;  1DJI A;  4DS7 A;  1H4B A;  3VRR A;  4ORA B;  3R1V A;  4UPG A;  1SCV A;  1L7Z A;  2L4I A;  5KTY A;  3CR4 X;  4OR9 B;  3DF0 A;  3GK1 A;  1XA5 A;  2F2P A;  2OPO A;  3NHI A;  1TUZ A;  2ISD A;  1B1G A;  4M2O A;  2MA2 A;  4GFT A;  2PRU A;  3NGV A;  1M45 A;  3SJS A;  2B1U A;  1S6C A;  2FOT A;  1B7T Y;  3KF9 A;  1BOD A;  4MN0 A;  1OOF A;  5KU1 A;  1K96 A;  2BL0 C;  3I5H C;  4C0J A;  2KI6 D;  1UP5 A;  4I5L B;  2YGU A;  3SIB A;  2MRD A;  4CPV A;  1JUO A;  2G2B A;  2JTT A;  4NDC A;  1KK7 Z;  1XK4 C;  4MZJ A;  4YGE B;  1YRT B;  2JXC A;  2LHI A;  1EG4 A;  2ZRS A;  1KFU S;  1XK4 A;  2JOJ A;  1CLL A;  2MLE C;  2KGR A;  1G33 A;  1JF2 A;  2P70 A;  2I7A A;  3D75 A;  3IVT A;  3R1P A;  4JD9 A;  5HLV A;  2D8N A;  2WOR A;  2LP2 A;  2OS8 B;  1QV1 A;  2FCD A;  2I94 A;  1RK9 A;  2KI4 B;  3JVT C;  3S0F A;  1ORG A;  3D10 A;  2M9G A;  1S1E A;  3R72 A;  1IWQ A;  2E6W A;  2F8P A;  2NCO A;  3WXA A;  1YVH A;  1H8B A;  3EKH A;  4CFQ A;  2JRF A;  1A75 A;  1C07 A;  1OQP A;  3AAJ A;  3IQQ A;  4I5J A;  4YI8 A;  1TTX A;  1QLS A;  1K9U A;  2WCH A;  3BOW A;  3EK8 A;  3VB1 A;  1S3P A;  1WLM A;  4ZCV A;  2IS9 A;  3DXL A;  1OOI X;  3NSL A;  1S6J A;  3DYE A;  1DJW A;  4ICB A;  1J55 A;  1ODB A;  1ZFS A;  1TNX A;  1BMO A;  1QWV A;  1SCM B;  1XFR A;  1DGV A;  1K94 A;  1UWO A;  2KYF A;  2R2I A;  3D73 A;  1BF5 A;  2LAP A;  1QX7 A;  2MBX A;  4TNC A;  2K7O A;  3RM1 A;  1OZO A;  2KDH A;  2KFG A;  1FBV A;  2HPS A;  3DF0 B;  5K89 A;  1DEL A;  1JWD A;  4JQ0 D;  2LP3 A;  3SG6 A;  1K2H A;  3BUW B;  1HQV A;  2CCM A;  4QJ4 B;  1N65 A;  1P28 A;  3O6B A;  1SL8 A;  3VRQ A;  1S5G Z;  4XJK A;  1QV0 A;  2JPO A;  3K1E A;  4MZL A;  4DCK A;  1CFC A;  1MQ1 A;  3KPX A;  2P71 A;  2MAZ A;  1IRJ A;  2NLN A;  1NSH A;  1MXL C;  2NXQ A;  1Q80 A;  3UNW A;  1KFX S;  1YTZ C;  2BL0 B;  3I5H B;  1UUR A;  4PCW A;  3D76 A;  2QAC A;  2HQ8 A;  5D69 A;  1JFJ A;  1CFP A;  1YR5 A;  3BJH A;  2M1K B;  2KAY A;  2LAN A;  2F2O A;  2L0P A;  1PUL A;  1RWY A;  4OCI A;  4MRX A;  1U5I A;  3F45 A;  1TN4 A;  2HF5 A;  1XFW O;  4OVN F;  4YGB B;  1PSB A;  1TIZ A;  2CBL A;  1R6P A;  2P6B B;  1DJX A;  5I2O A;  2M7N A;  3PFV A;  3QME A;  3OBV A;  1D1O A;  1OOJ A;  2BE4 A;  2K0J A;  1K9K A;  2KNE A;  1DTL A;  3PM2 A;  1M39 A;  1BT6 A;  1WDC C;  1GGZ A;  2KLE A;  1AUI B;  2M29 A;  3CZT X;  3JVT B;  2PAS A;  4OZD A;  3CR2 A;  1A75 B;  1J1E A;  2WCE A;  1GM0 A;  1RFJ A;  3FWC A;  1OW4 A;  3BQ3 A;  3BOW B;  2ZN8 A;  1IIO A;  3S0D A;  1K95 A;  2TN4 A;  1DJY A;  2GGZ A;  2LMT A;  3OX5 A;  4N1G A;  2WCJ A;  5DIC A;  2BKI B;  3BUX B;  4P5O E;  2ZN9 A;  3A8R A;  3NSK A;  3D78 A;  5I8N A;  1OOH A;  1SL7 A;  1YVL A;  2I18 A;  5TNC A;  1PVA A;  1EXR A;  2NCP A;  5DKR A;  1KQM C;  1OMR A;  1DJH A;  1YUT A;  2GV5 A;  2M97 A;  2WC6 A;  2BAP A;  3GK2 A;  3LL8 B;  4MBE A;  4Q04 A;  1IJ6 A;  3TDU A;  1SCM C;  1FW4 A;  3OB2 B;  1M46 A;  5BPJ A;  5HLO A;  1NX3 A;  5ER4 X;  5FI2 A;  2OTG C;  4INX A;  2H2K A;  5IBW A;  1FPW A;  2BCX A;  1XFX O;  3K21 A;  2LLS A;  3FIA A;  1IKU A;  4QJ5 B;  1ZOT B;  2ZRT A;  4INW A;  4C0L A;  1J7Q A;  1JBA A;  1XYD A;  2BCA A;  3I5F C;  5CSJ A;  4XJK B;  1XFZ O;  1IQ5 A;  3OB1 B;  1QS7 A;  1MUX A;  1CDN A;  1EL4 A;  2BKH B;  3OX6 A;  2MLF C;  2LE9 B;  3V2L A;  1B8C A;  3BXK A;  4PHJ A;  3N7H A;  1DQE A;  3NHT A;  4YI9 A;  2LUC A;  3BUN B;  2L5Y A;  3CWG A;  5G08 A;  3TUY C;  2L5X B;  3AKB A;  1S5G Y;  1ZAC A;  1DMO A;  2JT3 A;  3B88 A;  5KSZ A;  3QRX A;  1U5I B;  4PDZ A;  5ER5 A;  1B8R A;  1SNL A;  2PYQ A;  2LMV A;  2FJU B;  1CFF A;  1N2D A;  1CNP A;  4D1E A;  2ZNE A;  3CDN A;  1CM1 A;  3ZWH A;  1EH2 A;  1XFU O;  2BEC A;  4JKT A;  3A4U B;  2CNP A;  3PSR A;  2PSR A;  1WDC B;  1Y1A A;  3I5G C;  2KLD A;  2JTZ A;  2L4H A;  2EC6 C;  1W7J B;  4E68 A;  1F8H A;  3TS5 C;  2ERB A;  2QPT A;  2BBN A;  1NPQ A;  1RJV A;  1SMG A;  2LV7 A;  2PAL A;  1UUS A;  1J1D A;  1LA0 A;  5AFP A;  2Y1M A;  3L4L A;  1SW8 A;  2KFF A;  1ALW A;  1OMD A;  3VGO A;  2JUL A;  1AVS A;  3FE6 A;  2WCL A;  2L51 A;  4JPZ B;  5I94 A;  1KQM B;  1UHK A;  1OMV A;  4PE4 A;  1N0Y A;  1Y1X A;  2JZI A;  2L98 A;  2V53 A;  5HYD A;  4PAL A;  1C3Z A;  1KWO C;  5FYX A;  1YUU A;  1ZMZ A;  3O4X A;  1C7W A;  2OTG B;  5HL1 A;  1J7O A;  2H61 C;  4CID A;  4ETO A;  3KEV A;  3DVM A;  2HET A;  1MR8 A;  1UHI A;  1UHN A;  2KOT A;  4PE1 A;  3I5F B;  3CZ0 A;  5CSI A;  2CXJ A;  2KSP A;  3M0W A;  2L2C A;  1KFU L;  1BG1 A;  2LUX A;  2H61 A;  1CMF A;  4PT1 A;  2O60 A;  1AJ5 A;  5HKY A;  1R2U A;  2KI6 C;  1TNQ A;  1YUS A;  3CZ2 A;  1KSM A;  2JQ6 A;  1Z2C B;  2K60 A;  3ICB A;  3KHE A;  4MZK A;  1DC1 A;  4MEW A;  1SRA A;  2K2A A;  1JF0 A;  2JC2 A;  3KO0 A;  1OZS A;  1TWO A;  4PHK A;  4A4C A;  3TUY B;  2MHH A;  1XFV O;  4HRG A;  4R1E A;  3D77 A;  1QTX A;  2L2E A;  4L9M A;  1QVI Z;  5D7F A;  4DIR A;  5HKW A;  1XFY O;  3D74 A;  3SG7 A;  3IF7 A;  3L47 A;  5FI6 A;  2SAS A;  2ZFD A;  1NX0 A;  2KPH A;  2LVV A;  2Y5I A;  5CSF A;  2DOQ A;  3AAK A;  3PN7 C;  1DF0 A;  1K93 D;  1SY9 A;  5DKN A;  3LLE A;  1QX2 A;  1KK7 Y;  5AXI A;  4AQJ A;  2F3Z A;  1CLM A;  1NIW A;  2QEV A;  1DEK A;  3DVJ A;  5JJG A;  3I5G B;  5AER A;  2EC6 B;  1LA3 A;  2GGM A;  3TS5 B;  4YRU A;  4NDD A;  1C3Y A;  2KQ6 A;  1NCZ A;  1G4Y R;  2G9B A;  2KGB C;  1Z4H A;  3BFA A;  2BBM A;  1K90 D;  1S6I A;  2COL B;  2GTE A;  1Y6W A;  3HCM A;  5I2L A;  1Y1U A;  3B86 A;  1CMG A;  1IH0 A;  1PK0 D;  4ORB B;  2CT9 A;  1MXE A;  1NX1 A;  5I2Q A;  1FI5 A;  1QLK A;  3S0A A;  5GQQ C;  2WC5 A;  2WOS A;  1NCX A;  4MRY A;  1TUJ A;  1QIV A;  4JWQ A;  4GAO A;  3RZS A;  1KFX L;  2WC8 A;  3NSI A;  4HRH A;  4F0Z B;  1A4P A;  1B4C A;  1KWO B;  2PMY A;  4DUQ A;  4PHM A;  1BLQ A;  1EG3 A;  1QXP A;  1NP8 A; 
#chains in the Genus database with same CATH homology
 1F54 A;  3NSO A;  1ALV A;  1TCO B;  1IGV A;  3OP0 A;  1K9P A;  3SG5 A;  2BCB A;  1V1G A;  1YRU B;  2WND A;  1REC A;  3SIA A;  1XVJ A;  2M0R A;  3BUM B;  1PVB A;  1IG5 A;  4MSP A;  1SPY A;  2K61 A;  1FF1 A;  1DJG A;  4P2Y B;  3WHT B;  2MJW B;  5J3X A;  3VRP A;  2AAO A;  2JXL A;  2LLT A;  1FI6 A;  3D0Y A;  5PAL A;  4PE7 A;  2A4J A;  1F4O A;  1AP4 A;  2KBI A;  2KAX A;  2K7D A;  2K7C A;  2LM5 A;  1BU3 A;  2ZKM X;  1M63 B;  1OE9 B;  2LC5 A;  1J7R A;  4C0K A;  4PE0 A;  4ZCU A;  1AHR A;  1F71 A;  2JT8 A;  1SR6 C;  1UHJ A;  1CDM A;  1WRZ A;  4MLW A;  1KK8 B;  3JTD C;  1S26 D;  2KBM A;  1DF0 B;  2LCP A;  1QJT A;  2O5G A;  3BUO B;  3EVU A;  2M7L A;  1QVI Y;  4FTG A;  4YGC B;  2BE6 A;  3GOF A;  3PM8 A;  1UHH A;  3PN7 B;  4AQI A;  4HSZ A;  1LXF C;  1DGU A;  3I5I C;  3TDI A;  1PAL A;  1WRL A;  1B8L A;  3CGA A;  3PAL A;  1X02 A;  2M49 B;  1Y0V H;  1WLZ A;  3MSE B;  5CPV A;  1GQM A;  2JWW A;  1GGW A;  1SL9 A;  1W7I B;  3WNX B;  1CFD A;  4XYN A;  3FS7 A;  1QIW A;  1TRF A;  1IQ3 A;  5DKQ A;  1CTR A;  1PSR A;  2KQY A;  2KYC A;  2K8M B;  2CTN A;  3EK4 A;  2FCE A;  1GJY A;  3C1V A;  1V1F A;  1B9A A;  1QAT A;  4I5N B;  4USL A;  3O4Y A;  5JOL A;  1CKK A;  2Q91 A;  2WCF A;  1NYA A;  1CM4 A;  3AKA A;  1KQV A;  4GPL B;  1A03 A;  2EGD A;  2NZ0 A;  2K2F A;  3GK4 X;  1SK6 D;  5CSN A;  3TZ1 A;  1B47 A;  4MVF A;  1TCF A;  1JSA A;  3D0Y B;  2Y1N A;  2I2R E;  3LCP C;  5F6T A;  4WQ2 A;  4M2Q A;  1BOC A;  2LVK A;  3DVK A;  1RRO A;  1CB1 A;  3SG4 A;  2LVJ A;  1LKJ A;  4WRI A;  5B8I B;  1S36 A;  1LVC D;  3O78 A;  1E8A A;  4GGF C;  2F3Y A;  1L2O C;  2ZND A;  3HX4 A;  2VRG A;  3ZNI A;  3FWB A;  2M3W A;  2AMI A;  3EVR A;  3EKJ A;  3SG3 A;  4GGF A;  2JPT A;  5AAN A;  1SKT A;  3LK0 A;  4A4B A;  1A29 A;  1RTP 1;  1SR6 B;  1QAS A;  2PVB A;  3RLZ A;  1DVI A;  3E3R A;  3JTD B;  3NXA A;  3WHU B;  1KK8 C;  1ZUZ A;  1PRW A;  3LK1 A;  1NX2 A;  1XO5 A;  3TDZ A;  2K7B A;  1F55 A;  1SYM A;  1B7T Z;  2WCB A;  2Y4Q A;  2JNX A;  1MF8 B;  1KSO A;  3I5I B;  4FQO A;  4NQG A;  1YUR A;  2JU0 A;  2LHL A;  2HQW A;  1M31 A;  1C7V A;  1TOP A;  2JT0 A;  4OKH A;  4BY5 A;  1K8U A;  1MWN A;  1G8I A;  1QX5 B;  1NWD A;  1MHO A;  1VRK A;  4CFR A;  1F70 A;  2LVI A;  4ORC B;  1BR4 B;  1F4Q A;  4N1F A;  1JFK A;  3CLN A;  1YX8 A;  4GUK A;  2KAV A;  2L50 A;  3PLF B;  1TNW A;  2EHB A;  3EVV A;  4BY4 A;  1WY9 A;  4GBA A;  2KHN A;  1NUB A;  2Q4U A;  1HT9 A;  3DVE A;  4QJ3 B;  4YGD B;  3OHM B;  2JNF A;  1AK8 A;  2M8U A;  5HKZ A;  2OS8 C;  1JC2 A;  2LLU A;  1DJZ A;  3VRN A;  4CLN A;  4NDB A;  4AOM A;  2KI4 C;  4YGA A;  1YX7 A;  4YBH B;  3EK7 A;  3VRO A;  1SBJ A;  2LNK A;  3CR5 X;  4U8D A;  1CLB A;  1CDL A;  4DRW A;  2M1U A;  1IJ5 A;  1BR1 B;  1EJ3 A;  1LIN A;  2SCP A;  3BYA A;  3IQO A;  1DT7 B;  3H4S E;  1KCY A;  3SG2 A;  4I5K A;  3O2P A;  2KFH A;  1L2O B;  1AJ4 A;  1A2X A;  1OSA A;  3CS1 A;  3CTN A;  2RGI A;  4N5X A;  1BJF A;  3PAT A;  2E30 A;  2AUC A;  4GGN A;  1NCY A;  3DD4 A;  4OV2 A;  1TNP A;  4M2P A;  1WRK A;  4PHN A;  2F33 A;  4IL1 A;  4WQ3 A;  2LMU A;  5AEQ A;  4GNK B;  1CDP A;  4HRE E;  1DJI A;  4DS7 A;  1H4B A;  3VRR A;  4ORA B;  4UPG A;  1SCV A;  1L7Z A;  2L4I A;  5KTY A;  3CR4 X;  4OR9 B;  3DF0 A;  3GK1 A;  1XA5 A;  2F2P A;  2OPO A;  2ISD A;  1B1G A;  4M2O A;  2MA2 A;  4GFT A;  2PRU A;  1M45 A;  3SJS A;  2B1U A;  1S6C A;  2FOT A;  1B7T Y;  3KF9 A;  1BOD A;  4MN0 A;  5KU1 A;  1K96 A;  2BL0 C;  3I5H C;  4C0J A;  2KI6 D;  1UP5 A;  4I5L B;  3SIB A;  2MRD A;  4CPV A;  1JUO A;  2G2B A;  2JTT A;  4NDC A;  1KK7 Z;  1XK4 C;  4MZJ A;  4YGE B;  1YRT B;  2JXC A;  2LHI A;  1EG4 A;  2ZRS A;  1KFU S;  1XK4 A;  2JOJ A;  1CLL A;  2MLE C;  2KGR A;  1G33 A;  1JF2 A;  4PAL A;  2I7A A;  5HLV A;  2D8N A;  2WOR A;  2LP2 A;  2OS8 B;  1QV1 A;  2FCD A;  2I94 A;  1RK9 A;  2KI4 B;  3JVT C;  3D10 A;  2M9G A;  1S1E A;  1IWQ A;  2E6W A;  2F8P A;  2NCO A;  3WXA A;  1YVH A;  1H8B A;  3EKH A;  4CFQ A;  2JRF A;  1A75 A;  1C07 A;  1OQP A;  3AAJ A;  3IQQ A;  4I5J A;  4YI8 A;  1TTX A;  1QLS A;  1K9U A;  3BOW A;  3EK8 A;  1S3P A;  1WLM A;  4ZCV A;  2IS9 A;  3NSL A;  1S6J A;  1DJW A;  4ICB A;  1J55 A;  1ODB A;  1ZFS A;  1TNX A;  1BMO A;  1SCM B;  2KYF A;  1DGV A;  1K94 A;  1UWO A;  2R2I A;  1BF5 A;  2LAP A;  1QX7 A;  2MBX A;  4TNC A;  2K7O A;  3RM1 A;  1OZO A;  2KDH A;  2KFG A;  1FBV A;  2HPS A;  3DF0 B;  5K89 A;  1JWD A;  4JQ0 D;  2LP3 A;  3SG6 A;  1K2H A;  3BUW B;  1HQV A;  2CCM A;  4QJ4 B;  1N65 A;  3O6B A;  1SL8 A;  3VRQ A;  1S5G Z;  4XJK A;  1QV0 A;  4MZL A;  4DCK A;  1CFC A;  1MQ1 A;  3KPX A;  2MAZ A;  1IRJ A;  2NLN A;  1NSH A;  1MXL C;  2NXQ A;  1Q80 A;  1KFX S;  1YTZ C;  2BL0 B;  3I5H B;  1UUR A;  4PCW A;  2QAC A;  2HQ8 A;  5D69 A;  1JFJ A;  1CFP A;  1YR5 A;  2M1K B;  2KAY A;  2LAN A;  2F2O A;  2L0P A;  1PUL A;  1RWY A;  4OCI A;  4MRX A;  1U5I A;  3F45 A;  1TN4 A;  2HF5 A;  1XFW O;  4OVN F;  4YGB B;  1PSB A;  1TIZ A;  2CBL A;  1R6P A;  2P6B B;  1DJX A;  5I2O A;  2M7N A;  3PFV A;  1D1O A;  1OOJ A;  2BE4 A;  2K0J A;  1K9K A;  2KNE A;  1DTL A;  1J7P A;  1M39 A;  1BT6 A;  1WDC C;  1GGZ A;  2M29 A;  1AUI B;  3CZT X;  3JVT B;  2PAS A;  3CR2 A;  1A75 B;  1J1E A;  2WCE A;  1RFJ A;  3FWC A;  3BQ3 A;  3BOW B;  2ZN8 A;  1K95 A;  2TN4 A;  1DJY A;  2GGZ A;  2LMT A;  3OX5 A;  4N1G A;  2BKI B;  3BUX B;  4P5O E;  2ZN9 A;  3A8R A;  3NSK A;  5I8N A;  1SL7 A;  1YVL A;  2I18 A;  5TNC A;  1PVA A;  1EXR A;  2NCP A;  5DKR A;  1KQM C;  1OMR A;  1DJH A;  1YUT A;  2GV5 A;  2M97 A;  3GK2 A;  3LL8 B;  4MBE A;  4Q04 A;  1IJ6 A;  3TDU A;  1SCM C;  1FW4 A;  3OB2 B;  1M46 A;  5BPJ A;  5HLO A;  1NX3 A;  5ER4 X;  5IBW A;  2OTG C;  1FPW A;  2H2K A;  2BCX A;  1XFX O;  3K21 A;  2LLS A;  3FIA A;  1IKU A;  4QJ5 B;  1ZOT B;  2ZRT A;  1J7Q A;  4C0L A;  1JBA A;  1XYD A;  2BCA A;  3I5F C;  5CSJ A;  4XJK B;  1XFZ O;  1IQ5 A;  3OB1 B;  1QS7 A;  1MUX A;  1CDN A;  1EL4 A;  2BKH B;  3OX6 A;  2MLF C;  2LE9 B;  1B8C A;  3BXK A;  4PHJ A;  4YI9 A;  2LUC A;  3BUN B;  3CWG A;  5G08 A;  3TUY C;  2L5X B;  3AKB A;  1S5G Y;  1ZAC A;  1DMO A;  2JT3 A;  5KSZ A;  3QRX A;  1U5I B;  4PDZ A;  5ER5 A;  1B8R A;  1SNL A;  2LMV A;  2FJU B;  1CFF A;  1N2D A;  1CNP A;  4D1E A;  2ZNE A;  1CM1 A;  3ZWH A;  1EH2 A;  1XFU O;  2BEC A;  3A4U B;  2CNP A;  3PSR A;  2PSR A;  1WDC B;  1Y1A A;  3I5G C;  2L4H A;  2JTZ A;  1F8H A;  2EC6 C;  1W7J B;  4E68 A;  3TS5 C;  2QPT A;  2BBN A;  1NPQ A;  1RJV A;  1SMG A;  2LV7 A;  2PAL A;  1UUS A;  1J1D A;  1LA0 A;  5AFP A;  2Y1M A;  1SW8 A;  2KFF A;  1ALW A;  1OMD A;  3VGO A;  2JUL A;  1AVS A;  2L51 A;  4JPZ B;  1KQM B;  1UHK A;  1OMV A;  4PE4 A;  1N0Y A;  1Y1X A;  2JZI A;  2L98 A;  2V53 A;  5HYD A;  1KWO C;  5FYX A;  1YUU A;  1ZMZ A;  1C7W A;  2OTG B;  1J7O A;  2H61 C;  4CID A;  4ETO A;  3KEV A;  3DVM A;  2HET A;  1MR8 A;  1UHI A;  1UHN A;  2KOT A;  4PE1 A;  3I5F B;  5CSI A;  1BG1 A;  2CXJ A;  2KSP A;  3M0W A;  1KFU L;  2LUX A;  2H61 A;  1CMF A;  2O60 A;  1AJ5 A;  5HKY A;  1R2U A;  2KI6 C;  1TNQ A;  1YUS A;  1KSM A;  2JQ6 A;  3ICB A;  3KHE A;  4MZK A;  4MEW A;  1SRA A;  2K2A A;  1JF0 A;  2JC2 A;  3KO0 A;  1OZS A;  4PHK A;  4A4C A;  3TUY B;  2MHH A;  1XFV O;  4HRG A;  4R1E A;  1QTX A;  2L2E A;  4L9M A;  1QVI Z;  5D7F A;  4DIR A;  5HKW A;  1XFY O;  3SG7 A;  3IF7 A;  2SAS A;  2ZFD A;  1NX0 A;  2LVV A;  2Y5I A;  5CSF A;  2DOQ A;  3AAK A;  3PN7 C;  1DF0 A;  1K93 D;  1SY9 A;  5DKN A;  3LLE A;  1QX2 A;  1KK7 Y;  5AXI A;  4AQJ A;  2F3Z A;  1CLM A;  1NIW A;  3DVJ A;  5JJG A;  3I5G B;  5AER A;  2EC6 B;  1LA3 A;  2GGM A;  3TS5 B;  4YRU A;  4NDD A;  2KQ6 A;  1NCZ A;  1G4Y R;  2G9B A;  2KGB C;  2BBM A;  1K90 D;  1S6I A;  2COL B;  1Y6W A;  3HCM A;  5I2L A;  1Y1U A;  1IH0 A;  1CMG A;  1PK0 D;  4ORB B;  2CT9 A;  1MXE A;  1NX1 A;  5I2Q A;  1FI5 A;  1QLK A;  5GQQ C;  2WOS A;  4MRY A;  1NCX A;  1QIV A;  4JWQ A;  4GAO A;  1KFX L;  2WC8 A;  3NSI A;  4HRH A;  4F0Z B;  1A4P A;  1B4C A;  1KWO B;  2PMY A;  4DUQ A;  4PHM A;  1BLQ A;  1EG3 A;  1QXP A;  1NP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...