1F71A

Refined solution structure of calmodulin c-terminal domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALMODULIN
publication title Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transport protein
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f71A00
1S5GZ 3JTDC 4PHNA 4CPVA 2KYCA 1CM4A 1YR5A 1UHJA 4PE7A 5HKZA 4MRYA 2LVJA 2KSPA 3DF0A 3LLEA 3JVTB 1QV0A 3NSKA 3CGAA 2BKHB 2V53A 3IF7A 1W7JB 1ZUZA 2L4HA 3FWBA 2G9BA 1K2HA 2K2AA 2LHLA 2GV5A 1TCFA 4GNKB 3IQQA 1D1OA 1DJXA 1KK7Z 5CSFA 3VROA 1KWOB 5IBWA 1GGZA 1SPYA 4GGNA 2AUCA 5AEQA 5HKWA 1AVSA 2MRDA 1OSAA 2LVKA 1DVIA 1WY9A 2KI6D 1KCYA 5CPVA 1BU3A 1MXLC 2H61C 2KGBC 1RROA 1XFXO 1B1GA 1AP4A 1WRKA 1A2XA 4DUQA 4USLA 2K61A 1K94A 4QJ3B 1CFCA 3SIAA 5DKRA 1YRUB 4N1FA 4AOMA 3HCMA 3ZWHA 1RJVA 4YI9A 5AFPA 2JC2A 2SASA 4BY5A 3EK8A 4IL1A 1C07A 1F8HA 1DJIA 3CZTX 3VRNA 4DIRA 5F6TA 1RECA 3EK7A 2QPTA 2MA2A 1DJGA 1DJHA 3ZNIA 2K7CA 1F71A 1PK0D 2BCBA 5CSNA 1FF1A 1QATA 1NIWA 5HLOA 2JPTA 3TS5C 1M46A 1L2OC 4GPLB 1H8BA 3OP0A 4CLNA 1DMOA 4HRGA 2ISDA 5D7FA 1K96A 1A4PA 2LE9B 1C7VA 1WDCB 4N5XA 4MVFA 3EVUA 1IH0A 2HQWA 1NX1A 4MZKA 1Y1AA 2MHHA 4GGFC 2KAXA 4ICBA 3JVTC 4E68A 4OR9B 2HF5A 2ZKMX 3KO0A 1TN4A 1YUSA 1B9AA 1FPWA 1S6CA 2LM5A 2Q4UA 2I7AA 1QX2A 2NXQA 1SK6D 2L98A 1A75A 2KBIA 4OVNF 1AUIB 1JSAA 2KI6C 2K7BA 1DF0A 2SCPA 3CR2A 4MLWA 4ORCB 1YRTB 1SRAA 1RWYA 2MLFC 2NCOA 1KFXS 4NDBA 5I2QA 1TNWA 3IQOA 1B7TY 1Y6WA 1QX7A 5KU1A 1QASA 2JULA 1CMFA 1CLMA 1UUSA 2ZFDA 1KSMA 1KFXL 2M1KB 2OPOA 3D0YB 1SY9A 1NCYA 1GJYA 1RTP1 1KK8B 3DF0B 1PALA 1S36A 5AANA 3AAKA 1ODBA 1IQ5A 1CDMA 3BQ3A 3I5HB 1XYDA 2K0JA 1CFFA 3PFVA 4I5LB 1K95A 1J55A 1YUUA 1B8LA 1MQ1A 3WHTB 1JWDA 1UHKA 1N0YA 4ORAB 2FJUB 4YGAA 2L4IA 2LMUA 1WRZA 1TOPA 4PE0A 4I5JA 4L9MA 2OTGB 1PULA 1UWOA 2CTNA 2B1UA 3SG5A 2ZN9A 2F2PA 2BBNA 2D8NA 4YGDB 3FWCA 3FIAA 5I2OA 5JJGA 4D1EA 1GQMA 3NSLA 5D69A 1SCMC 2MLEC 4NQGA 2L50A 2K7OA 2E30A 1EG4A 2OS8B 1M45A 1XK4C 4ETOA 2BE4A 2PALA 1GGWA 4C0KA 2LMTA 1JUOA 2HQ8A 5G08A 1XVJA 1KK7Y 1Y1XA 1BODA 1LA3A 3PN7C 1QJTA 3TDZA 3CLNA 3WHUB 3MSEB 1IGVA 1BJFA 1OQPA 1OZSA 1QS7A 3D0YA 3VRPA 1S3PA 1XA5A 3C1VA 2E6WA 3I5IB 5HYDA 1DT7B 5AERA 1YURA 1BT6A 1TNPA 1WLMA 2ZNDA 2KQ6A 2MBXA 3M0WA 2JT3A 1SL9A 3GK2A 5GQQC 1CKKA 4PDZA 5PALA 3K21A 4AQIA 2WCBA 4PALA 1ZACA 2KQYA 5ER4X 2JOJA 2PVBA 1YVLA 1BMOA 1OZOA 2Y1MA 1DJYA 4P5OE 4PHKA 1KK8C 1K93D 2WNDA 2HPSA 1LXFC 1RK9A 3GK1A 2LUXA 1CFDA 2F3ZA 2NLNA 3BOWA 3SG7A 4XJKB 2CNPA 3NSOA 1HQVA 2KBMA 4I5KA 1QV1A 3RLZA 1A75B 2I2RE 1TCOB 1V1FA 1YX8A 3FS7A 5HLVA 1KQMB 3QRXA 1J7RA 2JNXA 1DF0B 1CM1A 1QVIZ 1XFZO 4M2PA 5HKYA 1AK8A 2OTGC 1SR6C 1K8UA 3CR4X 3KEVA 3A8RA 2H2KA 2EHBA 1OMDA 2NZ0A 3BYAA 1CLBA 2M3WA 3SJSA 1U5IA 2BE6A 1QLSA 2KAYA 4HRHA 1B8CA 2JU0A 2COLB 2RGIA 3OX6A 3TUYC 2K7DA 2LP3A 5I8NA 2K8MB 1QTXA 1XFUO 2L5XB 3PLFB 1DJWA 2Y1NA 5AXIA 1FI6A 5CSJA 3GK4X 1TRFA 4YGEB 1K90D 1FW4A 2ZRTA 1JFJA 5TNCA 1IKUA 1ZOTB 3BUXB 2LNKA 1SBJA 4C0LA 2M97A 4HREE 5I2LA 2PASA 1B47A 1QXPA 1V1GA 1ZMZA 2LVVA 4M2QA 4OCIA 4PHJA 2CXJA 3EVVA 2F2OA 3PATA 4PE4A 1IG5A 1NYAA 2HETA 2F8PA 4TNCA 1CTRA 4HSZA 2FCDA 2M29A 2R2IA 4XJKA 3LK0A 4JWQA 1JBAA 1NP8A 2BKIB 4PE1A 1M63B 1EJ3A 2KHNA 3EKHA 1G4YR 1OMVA 1KWOC 1J7PA 1JF0A 3ICBA 2O5GA 1QIVA 1N65A 4MBEA 2M49B 1MHOA 2BL0B 4PCWA 3EKJA 4GUKA 4R1EA 1NCXA 2PRUA 2KI4B 4CIDA 4BY4A 1F70A 3JTDB 1YTZC 2WCEA 3HX4A 4CFQA 2AMIA 2LAPA 2BCXA 1KQVA 3CTNA 3O6BA 5KSZA 1TNXA 3BUOB 1IQ3A 2JTTA 1DTLA 4NDCA 3LK1A 3VRRA 3SG2A 3WXAA 1MR8A 1LKJA 2KGRA 2A4JA 4U8DA 2LANA 1S5GY 5DKQA 2JT8A 4ZCVA 2PSRA 1YX7A 2KDHA 5FYXA 1F4OA 4Q04A 1B4CA 3PALA 4OV2A 3BOWB 1J7OA 3EVRA 2M0RA 1K9PA 1WDCC 1S1EA 3O2PA 1F4QA 4QJ4B 4YRUA 1KSOA 1IRJA 2BBMA 1IJ5A 2KFFA 2Q91A 3H4SE 4YI8A 3TZ1A 2F33A 3AKAA 4I5NB 1N2DA 4P2YB 1SW8A 4YGCB 1UHNA 5J3XA 2JXLA 1SNLA 1U5IB 4NDDA 2JQ6A 3OB2B 2KAVA 1J1EA 1PSBA 3F45A 4CFRA 1CMGA 2WOSA 2O60A 1CDPA 3O78A 4ORBB 2ZRSA 3CS1A 1WRLA 1EXRA 1ZFSA 2BL0C 1CB1A 1JF2A 1UURA 1CDNA 1SL7A 1QVIY 3DVMA 2LP2A 4F0ZB 3LL8B 1X02A 2KI4C 1NWDA 1XFWO 2LLSA 4OKHA 4M2OA 2JZIA 1M31A 1PRWA 2MJWB 2Y4QA 3VGOA 3DVJA 1SYMA 1IWQA 1TTXA 2FOTA 3I5HC 1PSRA 3LCPC 3WNXB 1BLQA 2L0PA 2EC6B 1YVHA 5CSIA 2H61A 3E3RA 1AHRA 2LHIA 3I5GB 4MZLA 1W7IB 2NCPA 5KTYA 4C0JA 1EG3A 2I18A 2WCFA 2WORA 1C7WA 2M1UA 1CFPA 1MF8B 2PMYA 1AJ5A 3RM1A 4DS7A 2GGMA 1J7QA 2ZNEA 4PHMA 1IJ6A 1EL4A 1NUBA 4WRIA 2L51A 2LV7A 2OS8C 3CR5X 3PSRA 4XYNA 2LCPA 2WC8A 1CNPA 3NSIA 1G8IA 2JWWA 4AQJA 1S6IA 1MUXA 3D10A 3AKBA 2LUCA 1LINA 3OHMB 1NSHA 1TNQA 1Y1UA 3SIBA 3I5FB 1LVCD 3AAJA 3PM8A 1HT9A 1OMRA 4GGFA 3I5IC 4GFTA 2VRGA 4MN0A 1S26D 3KF9A 2KYFA 4GBAA 2KFGA 4JQ0D 5B8IB 1R2UA 4A4BA 1B8RA 3DD4A 1A03A 1JC2A 3KPXA 1NPQA 2QACA 4YGBB 1UHIA 1MXEA 4N1GA 1SCMB 1ALWA 2CT9A 3OX5A 1A29A 1CDLA 3CWGA 1XO5A 1JFKA 3O4YA 3KHEA 4MRXA 3VRQA 1F54A 1QLKA 1NX2A 1EH2A 3EK4A 1DGUA 1SCVA 1NX3A 3BUNB 2KFHA 2EC6C 2F3YA 5DKNA 3I5GC 3PN7B 1K9UA 2JXCA 2ZN8A 2AAOA 2M7NA 1KQMC 4MEWA 2GGZA 4ZCUA 1BR1B 5ER5A 1F55A 1AJ4A 2CBLA 1BOCA 1PVAA 3SG6A 4FQOA 4JPZB 3DVEA 2IS9A 3BUWB 2EGDA 1DJZA 4DRWA 3DVKA 1BR4B 1K9KA 2BECA 2LMVA 3BUMB 2DOQA 2LLUA 4UPGA 1SMGA 1FI5A 1WLZA 1YUTA 1DGVA 1LA0A 1TIZA 1UP5A 2I94A 1Y0VH 2MAZA 1H4BA 2Y5IA 2M9GA 2M8UA 1S6JA 3OB1B 1NCZA 1XFVO 1NX0A 2L2EA 1QIWA 1M39A 4MZJA 3SG3A 1XK4A 3I5FC 3NXAA 2CCMA 1B7TZ 3BXKA 2G2BA 1E8AA 4QJ5B 1CLLA 1UHHA 2FCEA 2BCAA 2K2FA 1SKTA 2JT0A 1SR6B 1BG1A 2JTZA 5BPJA 1Q80A 4GAOA 2KOTA 4A4CA 3TDUA 1R6PA 1VRKA 1MWNA 2KNEA 2P6BB 5K89A 2LC5A 2JNFA 1ALVA 1OOJA 1QX5B 3TUYB 1G33A 1XFYO 3SG4A 2LLTA 1OE9B 1KFUS 4FTGA 4WQ3A 1SL8A 4MSPA 1FBVA 2M7LA 1L2OB 3TDIA 3TS5B 2TN4A 5JOLA 4DCKA 1BF5A 1J1DA 2LVIA 1L7ZA 3A4UB 1PVBA 4WQ2A 3GOFA 4YBHB 1KFUL 1RFJA 2JRFA
chains in the Genus database with same CATH superfamily
1S5GZ 3JTDC 4PHNA 4CPVA 2KYCA 1CM4A 1YR5A 1UHJA 4PE7A 5HKZA 4MRYA 2LVJA 2KSPA 3DF0A 2QDIA 3JVTB 3LLEA 1QV0A 3NSKA 3CGAA 2BKHB 2V53A 3IF7A 1W7JB 1ZUZA 2L4HA 3CZ1A 2G9BA 3FWBA 1K2HA 2K2AA 2LHLA 2GV5A 1TCFA 4GNKB 2K60A 3IQQA 1D1OA 1DJXA 1KK7Z 5CSFA 3VROA 1KWOB 5IBWA 1GGZA 1SPYA 4GGNA 2L2CA 2AUCA 5AEQA 5HKWA 1AVSA 2MRDA 1OSAA 2LVKA 1DVIA 1WY9A 2KI6D 1KCYA 3R1OA 5CPVA 1BU3A 1MXLC 2H61C 2KGBC 1RROA 1XFXO 1B1GA 1AP4A 1WRKA 1A2XA 4DUQA 4USLA 3OBVA 2K61A 1K94A 2WCHA 4QJ3B 1CFCA 3SIAA 5DKRA 1YRUB 4N1FA 4AOMA 3HCMA 3ZWHA 1RJVA 2KPHA 4YI9A 5AFPA 2JC2A 2SASA 4BY5A 3EK8A 4IL1A 1C07A 1F8HA 1DJIA 3VB1A 3CZTX 3VRNA 4DIRA 5F6TA 1RECA 1TUJA 2QPTA 1DELA 1DJGA 1DJHA 2MA2A 2K7CA 3EK7A 3ZNIA 4JKTA 1F71A 1PK0D 2BCBA 5CSNA 1FF1A 1QATA 1TUZA 3B86A 1NIWA 5HLOA 2JPTA 3EG5B 3TS5C 1M46A 1L2OC 4GPLB 1H8BA 3OP0A 4CLNA 1DMOA 4HRGA 2WC6A 3B88A 3N7HA 2ISDA 5D7FA 1LS8A 3L4AA 3NGVA 1K96A 1A4PA 2LE9B 1C7VA 1T14A 1WDCB 4N5XA 3BJHA 4MVFA 3EVUA 1IH0A 2HQWA 1NX1A 4MZKA 1Y1AA 2MHHA 3BFHA 4GGFC 2P71A 2KAXA 4ICBA 3JVTC 4E68A 4OR9B 2HF5A 2ZKMX 3KO0A 1TN4A 1YUSA 3CDNA 1B9AA 1FPWA 2L5YA 1S6CA 2LM5A 2Q4UA 3TDIA 2I7AA 1QX2A 2NXQA 1SK6D 2L98A 1A75A 2KBIA 4OVNF 1AUIB 1JSAA 2KI6C 2K7BA 1DF0A 2SCPA 3CR2A 4MLWA 1SSEB 4ORCB 1YRTB 1SRAA 1RWYA 2MLFC 2NCOA 1KFXS 4NDBA 5I2QA 1TNWA 3IQOA 1B7TY 1Y6WA 1QX7A 5KU1A 1TWOA 1QASA 3D74A 2JULA 1CMFA 1CLMA 1UUSA 2ZFDA 1KSMA 1KFXL 2M1KB 2OPOA 3O4XA 3DYEA 3D0YB 1SY9A 3S0DA 1NCYA 1GJYA 1RTP1 1KK8B 3DF0B 1PALA 1S36A 5AANA 3AAKA 1ODBA 1IQ5A 1CDMA 3BQ3A 3I5HB 1XYDA 2K0JA 1CFFA 3PFVA 4FQTA 4I5LB 1K95A 1J55A 1YUUA 1B8LA 1MQ1A 3WHTB 1JWDA 1UHKA 1N0YA 4ORAB 2FJUB 4YGAA 2L4IA 2LMUA 1WRZA 1TOPA 4PE0A 4I5JA 4L9MA 5EL2A 2OTGB 1PULA 1UWOA 3D78A 2CTNA 2B1UA 3SG5A 2ZN9A 2F2PA 2BBNA 2D8NA 4YGDB 3FWCA 3FIAA 5I2OA 5JJGA 4D1EA 1GQMA 3NSLA 5D69A 1SCMC 2MLEC 4NQGA 2L50A 2K7OA 5FI6A 2E30A 1EG4A 2OS8B 1M45A 3FE9A 1XK4C 3BFAA 4ETOA 2BE4A 2PALA 1GGWA 4C0KA 2LMTA 3K1EA 1JUOA 2HQ8A 5G08A 1XVJA 1KK7Y 1Y1XA 1BODA 1LA3A 3OGNA 3PN7C 1QJTA 3TDZA 3CLNA 3WHUB 3MSEB 1IGVA 1BJFA 1OQPA 1OZSA 1QS7A 3D0YA 3VRPA 1S3PA 1XA5A 3C1VA 2E6WA 3I5IB 4KYNA 5HYDA 1DT7B 5AERA 1YURA 1BT6A 1TNPA 1WLMA 2ZNDA 2KQ6A 2MBXA 3M0WA 2JT3A 1SL9A 3QMEA 3R1PA 5FI2A 3GK2A 5GQQC 4IJ7A 1CKKA 4PDZA 5PALA 1Z4HA 3K21A 2WCBA 4PALA 1ZACA 2KQYA 5ER4X 4AQIA 2JOJA 2PVBA 1YVLA 3S0GA 1BMOA 3CZ2A 1OZOA 2Y1MA 1DJYA 4P5OE 4PHKA 1KK8C 1K93D 2WNDA 5I94A 2HPSA 1LXFC 2P70A 1RK9A 3GK1A 2LUXA 1CFDA 2F3ZA 2NLNA 3BOWA 3SG7A 4INXA 4XJKB 2BAPA 2CNPA 3NSOA 1HQVA 2KBMA 4I5KA 1QV1A 3R72A 3RLZA 1A75B 2I2RE 1TCOB 1V1FA 1YX8A 3FS7A 5HLVA 1KQMB 3QRXA 1J7RA 2JNXA 1DF0B 1CM1A 1QVIZ 1XFZO 4M2PA 5DICA 5HKYA 1AK8A 2WCJA 2OTGC 1QWVA 1SR6C 1K8UA 3CR4X 3KEVA 3A8RA 2H2KA 2EHBA 1OMDA 2NZ0A 3BYAA 1CLBA 2M3WA 3SJSA 1U5IA 2BE6A 1QLSA 2KAYA 4HRHA 1B8CA 2JU0A 2COLB 2RGIA 3OX6A 3TUYC 2K7DA 2LP3A 5I8NA 2K8MB 1QTXA 3BFBA 1XFUO 2L5XB 3PLFB 1DJWA 2Y1NA 5AXIA 1FI6A 5CSJA 3GK4X 1TRFA 4YGEB 1K90D 3SS3A 1FW4A 2ZRTA 1JFJA 5TNCA 1IKUA 1ZOTB 3BUXB 2LNKA 1SBJA 4C0LA 2M97A 4HREE 5I2LA 2PASA 1B47A 1QXPA 1V1GA 1ZMZA 2LVVA 2QEBA 4M2QA 4OCIA 4PHJA 2CXJA 3EVVA 2F2OA 3PATA 4PE4A 1IG5A 1NYAA 2HETA 3IVTA 2F8PA 4TNCA 1CTRA 4HSZA 2FCDA 2M29A 2R2IA 4XJKA 1OOHA 3LK0A 4JWQA 1JBAA 1NP8A 2BKIB 4PE1A 2WC5A 1M63B 2GTEA 1EJ3A 2KHNA 3EKHA 1G4YR 1OMVA 3B7AA 1KWOC 1J7PA 1JF0A 3ICBA 2O5GA 1QIVA 3Q8IA 1N65A 4MBEA 2M49B 1MHOA 2KLDA 2BL0B 4PCWA 3EKJA 2WCLA 4GUKA 4R1EA 1NCXA 2PRUA 2KI4B 4CIDA 4BY4A 1F70A 3JTDB 1YTZC 2WCEA 3HX4A 4CFQA 2AMIA 2LAPA 2BCXA 1KQVA 3CTNA 3O6BA 5KSZA 1TNXA 3BUOB 1IQ3A 2JTTA 1OOGA 1DTLA 4NDCA 3L4LA 3LK1A 3VRRA 3SG2A 3WXAA 1MR8A 3CZ0A 1LKJA 2KGRA 3B87A 4PT1A 2A4JA 4U8DA 3S0FA 2LANA 1S5GY 5DKQA 2JT8A 4ZCVA 3S0AA 2PSRA 1YX7A 2KDHA 3SS4A 5FYXA 1F4OA 1OOFA 4Q04A 1B4CA 3PALA 4OV2A 3BOWB 1J7OA 3EVRA 2M0RA 1K9PA 1WDCC 1S1EA 3O2PA 1F4QA 4QJ4B 4YRUA 1KSOA 1IRJA 4INWA 2BBMA 1IJ5A 1P28A 2KFFA 2ERBA 2Q91A 3FE8A 3H4SE 4YI8A 3TZ1A 2F33A 2QEOA 3AKAA 4I5NB 1N2DA 4P2YB 1SW8A 4YGCB 1UHNA 2PQLA 5J3XA 2JXLA 1SNLA 1U5IB 2WCMA 4NDDA 2JQ6A 3OB2B 2KAVA 1J1EA 1PSBA 3F45A 4CFRA 1CMGA 2WOSA 2O60A 1CDPA 3O78A 4ORBB 2ZRSA 3CS1A 1WRLA 1EXRA 1Z2CB 1ZFSA 2BL0C 1CB1A 1JF2A 1UURA 1CDNA 1SL7A 1QVIY 3DVMA 3D75A 2LP2A 4F0ZB 3LL8B 1X02A 2KI4C 1NWDA 1XFWO 2LLSA 4OKHA 4M2OA 2JZIA 3L47A 1M31A 1PRWA 2MJWB 2Y4QA 3VGOA 3DVJA 1SYMA 1IWQA 1TTXA 2FOTA 3I5HC 1PSRA 3LCPC 3WNXB 1BLQA 2L0PA 2EC6B 1YVHA 5CSIA 2H61A 3E3RA 1AHRA 2LHIA 3I5GB 4MZLA 1W7IB 2NCPA 5KTYA 4C0JA 1EG3A 3D77A 2I18A 2WCFA 2WORA 1C7WA 2M1UA 4OZDA 1CFPA 1MF8B 3RZSA 2PMYA 1AJ5A 1DC1A 3RM1A 4DS7A 2GGMA 1J7QA 2ZNEA 4PHMA 3SS5A 1IJ6A 1GM0A 1EL4A 1NUBA 2QEVA 4WRIA 3DZTA 2L51A 2LV7A 2OS8C 3CR5X 3PSRA 4XYNA 3PM2A 2LCPA 2WC8A 1CNPA 3NSIA 1G8IA 2JWWA 1DQEA 4AQJA 1S6IA 1MUXA 3D10A 3AKBA 2LUCA 1LINA 3OHMB 1NSHA 1TNQA 1Y1UA 3S0EA 3SIBA 3I5FB 1LVCD 3AAJA 3D76A 1DEKA 1HT9A 3PM8A 1OMRA 3UNWA 4GGFA 3I5IC 3UO9A 4GFTA 2VRGA 1ORGA 2WCKA 4MN0A 1S26D 1C3YA 3FE6A 3KF9A 2KYFA 4GBAA 4F7FA 2KFGA 4JQ0D 5B8IB 1R2UA 4A4BA 1B8RA 3DD4A 1A03A 1JC2A 3KPXA 1NPQA 5HL1A 2FJYA 2QACA 1UHIA 4YGBB 1MXEA 4N1GA 3DY9A 1SCMB 1ALWA 2CT9A 3OX5A 1A29A 1CDLA 3CWGA 1XO5A 1JFKA 3CABA 3O4YA 3KHEA 4MRXA 3VRQA 2H8VA 1QLKA 1NX2A 5FI7A 1XFRA 3EK4A 1EH2A 1F54A 1DGUA 1SCVA 1NX3A 3BUNB 2KFHA 2EC6C 2F3YA 3B6XA 3I5GC 3PN7B 5DKNA 1K9UA 1C3ZA 2JXCA 3NHIA 2ZN8A 2AAOA 2M7NA 1KQMC 4MEWA 2GGZA 4ZCUA 1BR1B 5ER5A 1F55A 1AJ4A 2CBLA 1BOCA 3V2LA 1PVAA 3SG6A 2JPOA 4FQOA 4JPZB 3DVEA 2IS9A 3BUWB 2EGDA 1DJZA 4DRWA 3DVKA 1BR4B 1OOIX 1K9KA 2BECA 2LMVA 3BUMB 3DXLA 2DOQA 2LLUA 4UPGA 1SMGA 1FI5A 1WLZA 1YUTA 3D73A 3PJIA 1DGVA 5D3OA 1LA0A 1TIZA 1UP5A 2I94A 1Y0VH 2MAZA 1H4BA 2Y5IA 2M9GA 2PYQA 2BNXA 2M8UA 1S6JA 3OB1B 1NCZA 1XFVO 3NHTA 1NX0A 2L2EA 1QIWA 1M39A 4MZJA 3SG3A 1XK4A 3I5FC 3NXAA 2CCMA 1B7TZ 3BXKA 2G2BA 1OW4A 1E8AA 4QJ5B 1CLLA 1UHHA 2QEHA 2FCEA 2BCAA 2K2FA 1SKTA 2JT0A 1SR6B 1BG1A 2JTZA 5BPJA 1Q80A 2KLEA 4GAOA 2KOTA 4A4CA 3TDUA 1R6PA 1VRKA 1MWNA 2KNEA 2P6BB 3R1VA 2LC5A 2JNFA 1W9ZA 3CYZA 5K89A 1ALVA 1OOJA 1QX5B 1IIOA 3TUYB 1G33A 1XFYO 3SG4A 4JD9A 2LLTA 1OE9B 1KFUS 4FTGA 4WQ3A 1SL8A 4MSPA 1FBVA 2M7LA 1L2OB 3S0BA 3TS5B 2TN4A 5JOLA 4DCKA 1BF5A 1J1DA 2LVIA 1L7ZA 3A4UB 1PVBA 4WQ2A 3GOFA 2YGUA 4YBHB 1KFUL 1RFJA 2JRFA
chains in the Genus database with same CATH topology
1S5GZ 3JTDC 4PHNA 4CPVA 2KYCA 1CM4A 1YR5A 1UHJA 4PE7A 5HKZA 4MRYA 2LVJA 2KSPA 3DF0A 3LLEA 3JVTB 1QV0A 3NSKA 3CGAA 2BKHB 2V53A 3IF7A 1W7JB 1ZUZA 2L4HA 3FWBA 2G9BA 1K2HA 2K2AA 2LHLA 2GV5A 1TCFA 4GNKB 3IQQA 1D1OA 1DJXA 1KK7Z 5CSFA 3VROA 1KWOB 5IBWA 1GGZA 1SPYA 4GGNA 2AUCA 5AEQA 5HKWA 1AVSA 2MRDA 1OSAA 2LVKA 1DVIA 1WY9A 2KI6D 1KCYA 5CPVA 1BU3A 1MXLC 2H61C 2KGBC 1RROA 1XFXO 1B1GA 1AP4A 1WRKA 1A2XA 4DUQA 4USLA 2K61A 1K94A 4QJ3B 1CFCA 3SIAA 5DKRA 1YRUB 4N1FA 4AOMA 3HCMA 3ZWHA 1RJVA 4YI9A 5AFPA 2JC2A 2SASA 4BY5A 3EK8A 4IL1A 1C07A 1F8HA 1DJIA 3CZTX 3VRNA 4DIRA 5F6TA 1RECA 3EK7A 2QPTA 2MA2A 1DJGA 1DJHA 3ZNIA 2K7CA 1F71A 1PK0D 2BCBA 5CSNA 1FF1A 1QATA 1NIWA 5HLOA 2JPTA 3TS5C 1M46A 1L2OC 4GPLB 1H8BA 3OP0A 4CLNA 1DMOA 4HRGA 2ISDA 5D7FA 1K96A 1A4PA 2LE9B 1C7VA 1WDCB 4N5XA 4MVFA 3EVUA 1IH0A 2HQWA 1NX1A 4MZKA 1Y1AA 2MHHA 4GGFC 2KAXA 4ICBA 3JVTC 4E68A 4OR9B 2HF5A 2ZKMX 3KO0A 1TN4A 1YUSA 1B9AA 1FPWA 1S6CA 2LM5A 2Q4UA 2I7AA 1QX2A 2NXQA 1SK6D 2L98A 1A75A 2KBIA 4OVNF 1AUIB 1JSAA 2KI6C 2K7BA 1DF0A 2SCPA 3CR2A 4MLWA 4ORCB 1YRTB 1SRAA 1RWYA 2MLFC 2NCOA 1KFXS 4NDBA 5I2QA 1TNWA 3IQOA 1B7TY 1Y6WA 1QX7A 5KU1A 1QASA 2JULA 1CMFA 1CLMA 1UUSA 2ZFDA 1KSMA 1KFXL 2M1KB 2OPOA 3D0YB 1SY9A 1NCYA 1GJYA 1RTP1 1KK8B 3DF0B 1PALA 1S36A 5AANA 3AAKA 1ODBA 1IQ5A 1CDMA 3BQ3A 3I5HB 1XYDA 2K0JA 1CFFA 3PFVA 4I5LB 1K95A 1J55A 1YUUA 1B8LA 1MQ1A 3WHTB 1JWDA 1UHKA 1N0YA 4ORAB 2FJUB 4YGAA 2L4IA 2LMUA 1WRZA 1TOPA 4PE0A 4I5JA 4L9MA 2OTGB 1PULA 1UWOA 2CTNA 2B1UA 3SG5A 2ZN9A 2F2PA 2BBNA 2D8NA 4YGDB 3FWCA 3FIAA 5I2OA 5JJGA 4D1EA 1GQMA 3NSLA 5D69A 1SCMC 2MLEC 4NQGA 2L50A 2K7OA 2E30A 1EG4A 2OS8B 1M45A 1XK4C 4ETOA 2BE4A 2PALA 1GGWA 4C0KA 2LMTA 1JUOA 2HQ8A 5G08A 1XVJA 1KK7Y 1Y1XA 1BODA 1LA3A 3PN7C 1QJTA 3TDZA 3CLNA 3WHUB 3MSEB 1IGVA 1BJFA 1OQPA 1OZSA 1QS7A 3D0YA 3VRPA 1S3PA 1XA5A 3C1VA 2E6WA 3I5IB 5HYDA 1DT7B 5AERA 1YURA 1BT6A 1TNPA 1WLMA 2ZNDA 2KQ6A 2MBXA 3M0WA 2JT3A 1SL9A 3GK2A 5GQQC 1CKKA 4PDZA 5PALA 3K21A 4AQIA 2WCBA 4PALA 1ZACA 2KQYA 5ER4X 2JOJA 2PVBA 1YVLA 1BMOA 1OZOA 2Y1MA 1DJYA 4P5OE 4PHKA 1KK8C 1K93D 2WNDA 2HPSA 1LXFC 1RK9A 3GK1A 2LUXA 1CFDA 2F3ZA 2NLNA 3BOWA 3SG7A 4XJKB 2CNPA 3NSOA 1HQVA 2KBMA 4I5KA 1QV1A 3RLZA 1A75B 2I2RE 1TCOB 1V1FA 1YX8A 3FS7A 5HLVA 1KQMB 3QRXA 1J7RA 2JNXA 1DF0B 1CM1A 1QVIZ 1XFZO 4M2PA 5HKYA 1AK8A 2OTGC 1SR6C 1K8UA 3CR4X 3KEVA 3A8RA 2H2KA 2EHBA 1OMDA 2NZ0A 3BYAA 1CLBA 2M3WA 3SJSA 1U5IA 2BE6A 1QLSA 2KAYA 4HRHA 1B8CA 2JU0A 2COLB 2RGIA 3OX6A 3TUYC 2K7DA 2LP3A 5I8NA 2K8MB 1QTXA 1XFUO 2L5XB 3PLFB 1DJWA 2Y1NA 5AXIA 1FI6A 5CSJA 3GK4X 1TRFA 4YGEB 1K90D 1FW4A 2ZRTA 1JFJA 5TNCA 1IKUA 1ZOTB 3BUXB 2LNKA 1SBJA 4C0LA 2M97A 4HREE 5I2LA 2PASA 1B47A 1QXPA 1V1GA 1ZMZA 2LVVA 4M2QA 4OCIA 4PHJA 2CXJA 3EVVA 2F2OA 3PATA 4PE4A 1IG5A 1NYAA 2HETA 2F8PA 4TNCA 1CTRA 4HSZA 2FCDA 2M29A 2R2IA 4XJKA 3LK0A 4JWQA 1JBAA 1NP8A 2BKIB 4PE1A 1M63B 1EJ3A 2KHNA 3EKHA 1G4YR 1OMVA 1KWOC 1J7PA 1JF0A 3ICBA 2O5GA 1QIVA 1N65A 4MBEA 2M49B 1MHOA 2BL0B 4PCWA 3EKJA 4GUKA 4R1EA 1NCXA 2PRUA 2KI4B 4CIDA 4BY4A 1F70A 3JTDB 1YTZC 2WCEA 3HX4A 4CFQA 2AMIA 2LAPA 2BCXA 1KQVA 3CTNA 3O6BA 5KSZA 1TNXA 3BUOB 1IQ3A 2JTTA 1DTLA 4NDCA 3LK1A 3VRRA 3SG2A 3WXAA 1MR8A 1LKJA 2KGRA 2A4JA 4U8DA 2LANA 1S5GY 5DKQA 2JT8A 4ZCVA 2PSRA 1YX7A 2KDHA 5FYXA 1F4OA 4Q04A 1B4CA 3PALA 4OV2A 3BOWB 1J7OA 3EVRA 2M0RA 1K9PA 1WDCC 1S1EA 3O2PA 1F4QA 4QJ4B 4YRUA 1KSOA 1IRJA 2BBMA 1IJ5A 2KFFA 2Q91A 3H4SE 4YI8A 3TZ1A 2F33A 3AKAA 4I5NB 1N2DA 4P2YB 1SW8A 4YGCB 1UHNA 5J3XA 2JXLA 1SNLA 1U5IB 4NDDA 2JQ6A 3OB2B 2KAVA 1J1EA 1PSBA 3F45A 4CFRA 1CMGA 2WOSA 2O60A 1CDPA 3O78A 4ORBB 2ZRSA 3CS1A 1WRLA 1EXRA 1ZFSA 2BL0C 1CB1A 1JF2A 1UURA 1CDNA 1SL7A 1QVIY 3DVMA 2LP2A 4F0ZB 3LL8B 1X02A 2KI4C 1NWDA 1XFWO 2LLSA 4OKHA 4M2OA 2JZIA 1M31A 1PRWA 2MJWB 2Y4QA 3VGOA 3DVJA 1SYMA 1IWQA 1TTXA 2FOTA 3I5HC 1PSRA 3LCPC 3WNXB 1BLQA 2L0PA 2EC6B 1YVHA 5CSIA 2H61A 3E3RA 1AHRA 2LHIA 3I5GB 4MZLA 1W7IB 2NCPA 5KTYA 4C0JA 1EG3A 2I18A 2WCFA 2WORA 1C7WA 2M1UA 1CFPA 1MF8B 2PMYA 1AJ5A 3RM1A 4DS7A 2GGMA 1J7QA 2ZNEA 4PHMA 1IJ6A 1EL4A 1NUBA 4WRIA 2L51A 2LV7A 2OS8C 3CR5X 3PSRA 4XYNA 2LCPA 2WC8A 1CNPA 3NSIA 1G8IA 2JWWA 4AQJA 1S6IA 1MUXA 3D10A 3AKBA 2LUCA 1LINA 3OHMB 1NSHA 1TNQA 1Y1UA 3SIBA 3I5FB 1LVCD 3AAJA 3PM8A 1HT9A 1OMRA 4GGFA 3I5IC 4GFTA 2VRGA 4MN0A 1S26D 3KF9A 2KYFA 4GBAA 2KFGA 4JQ0D 5B8IB 1R2UA 4A4BA 1B8RA 3DD4A 1A03A 1JC2A 3KPXA 1NPQA 2QACA 4YGBB 1UHIA 1MXEA 4N1GA 1SCMB 1ALWA 2CT9A 3OX5A 1A29A 1CDLA 3CWGA 1XO5A 1JFKA 3O4YA 3KHEA 4MRXA 3VRQA 1F54A 1QLKA 1NX2A 1EH2A 3EK4A 1DGUA 1SCVA 1NX3A 3BUNB 2KFHA 2EC6C 2F3YA 5DKNA 3I5GC 3PN7B 1K9UA 2JXCA 2ZN8A 2AAOA 2M7NA 1KQMC 4MEWA 2GGZA 4ZCUA 1BR1B 5ER5A 1F55A 1AJ4A 2CBLA 1BOCA 1PVAA 3SG6A 4FQOA 4JPZB 3DVEA 2IS9A 3BUWB 2EGDA 1DJZA 4DRWA 3DVKA 1BR4B 1K9KA 2BECA 2LMVA 3BUMB 2DOQA 2LLUA 4UPGA 1SMGA 1FI5A 1WLZA 1YUTA 1DGVA 1LA0A 1TIZA 1UP5A 2I94A 1Y0VH 2MAZA 1H4BA 2Y5IA 2M9GA 2M8UA 1S6JA 3OB1B 1NCZA 1XFVO 1NX0A 2L2EA 1QIWA 1M39A 4MZJA 3SG3A 1XK4A 3I5FC 3NXAA 2CCMA 1B7TZ 3BXKA 2G2BA 1E8AA 4QJ5B 1CLLA 1UHHA 2FCEA 2BCAA 2K2FA 1SKTA 2JT0A 1SR6B 1BG1A 2JTZA 5BPJA 1Q80A 4GAOA 2KOTA 4A4CA 3TDUA 1R6PA 1VRKA 1MWNA 2KNEA 2P6BB 5K89A 2LC5A 2JNFA 1ALVA 1OOJA 1QX5B 3TUYB 1G33A 1XFYO 3SG4A 2LLTA 1OE9B 1KFUS 4FTGA 4WQ3A 1SL8A 4MSPA 1FBVA 2M7LA 1L2OB 3TDIA 3TS5B 2TN4A 5JOLA 4DCKA 1BF5A 1J1DA 2LVIA 1L7ZA 3A4UB 1PVBA 4WQ2A 3GOFA 4YBHB 1KFUL 1RFJA 2JRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5G Z;  3JTD C;  4PHN A;  4CPV A;  2KYC A;  1CM4 A;  1YR5 A;  1UHJ A;  4PE7 A;  5HKZ A;  4MRY A;  2LVJ A;  2KSP A;  3DF0 A;  3LLE A;  3JVT B;  1QV0 A;  3NSK A;  3CGA A;  2BKH B;  2V53 A;  3IF7 A;  1W7J B;  1ZUZ A;  2L4H A;  3FWB A;  2G9B A;  1K2H A;  2K2A A;  2LHL A;  2GV5 A;  1TCF A;  4GNK B;  3IQQ A;  1D1O A;  1DJX A;  1KK7 Z;  5CSF A;  3VRO A;  1KWO B;  5IBW A;  1GGZ A;  1SPY A;  4GGN A;  2AUC A;  5AEQ A;  5HKW A;  1AVS A;  2MRD A;  1OSA A;  2LVK A;  1DVI A;  1WY9 A;  2KI6 D;  1KCY A;  5CPV A;  1BU3 A;  1MXL C;  2H61 C;  2KGB C;  1RRO A;  1XFX O;  1B1G A;  1AP4 A;  1WRK A;  1A2X A;  4DUQ A;  4USL A;  2K61 A;  1K94 A;  4QJ3 B;  1CFC A;  3SIA A;  5DKR A;  1YRU B;  4N1F A;  4AOM A;  3HCM A;  3ZWH A;  1RJV A;  4YI9 A;  5AFP A;  2JC2 A;  2SAS A;  4BY5 A;  3EK8 A;  4IL1 A;  1C07 A;  1F8H A;  1DJI A;  3CZT X;  3VRN A;  4DIR A;  5F6T A;  1REC A;  3EK7 A;  2QPT A;  2MA2 A;  1DJG A;  1DJH A;  3ZNI A;  2K7C A;  1F71 A;  1PK0 D;  2BCB A;  5CSN A;  1FF1 A;  1QAT A;  1NIW A;  5HLO A;  2JPT A;  3TS5 C;  1M46 A;  1L2O C;  4GPL B;  1H8B A;  3OP0 A;  4CLN A;  1DMO A;  4HRG A;  2ISD A;  5D7F A;  1K96 A;  1A4P A;  2LE9 B;  1C7V A;  1WDC B;  4N5X A;  4MVF A;  3EVU A;  1IH0 A;  2HQW A;  1NX1 A;  4MZK A;  1Y1A A;  2MHH A;  4GGF C;  2KAX A;  4ICB A;  3JVT C;  4E68 A;  4OR9 B;  2HF5 A;  2ZKM X;  3KO0 A;  1TN4 A;  1YUS A;  1B9A A;  1FPW A;  1S6C A;  2LM5 A;  2Q4U A;  2I7A A;  1QX2 A;  2NXQ A;  1SK6 D;  2L98 A;  1A75 A;  2KBI A;  4OVN F;  1AUI B;  1JSA A;  2KI6 C;  2K7B A;  1DF0 A;  2SCP A;  3CR2 A;  4MLW A;  4ORC B;  1YRT B;  1SRA A;  1RWY A;  2MLF C;  2NCO A;  1KFX S;  4NDB A;  5I2Q A;  1TNW A;  3IQO A;  1B7T Y;  1Y6W A;  1QX7 A;  5KU1 A;  1QAS A;  2JUL A;  1CMF A;  1CLM A;  1UUS A;  2ZFD A;  1KSM A;  1KFX L;  2M1K B;  2OPO A;  3D0Y B;  1SY9 A;  1NCY A;  1GJY A;  1RTP 1;  1KK8 B;  3DF0 B;  1PAL A;  1S36 A;  5AAN A;  3AAK A;  1ODB A;  1IQ5 A;  1CDM A;  3BQ3 A;  3I5H B;  1XYD A;  2K0J A;  1CFF A;  3PFV A;  4I5L B;  1K95 A;  1J55 A;  1YUU A;  1B8L A;  1MQ1 A;  3WHT B;  1JWD A;  1UHK A;  1N0Y A;  4ORA B;  2FJU B;  4YGA A;  2L4I A;  2LMU A;  1WRZ A;  1TOP A;  4PE0 A;  4I5J A;  4L9M A;  2OTG B;  1PUL A;  1UWO A;  2CTN A;  2B1U A;  3SG5 A;  2ZN9 A;  2F2P A;  2BBN A;  2D8N A;  4YGD B;  3FWC A;  3FIA A;  5I2O A;  5JJG A;  4D1E A;  1GQM A;  3NSL A;  5D69 A;  1SCM C;  2MLE C;  4NQG A;  2L50 A;  2K7O A;  2E30 A;  1EG4 A;  2OS8 B;  1M45 A;  1XK4 C;  4ETO A;  2BE4 A;  2PAL A;  1GGW A;  4C0K A;  2LMT A;  1JUO A;  2HQ8 A;  5G08 A;  1XVJ A;  1KK7 Y;  1Y1X A;  1BOD A;  1LA3 A;  3PN7 C;  1QJT A;  3TDZ A;  3CLN A;  3WHU B;  3MSE B;  1IGV A;  1BJF A;  1OQP A;  1OZS A;  1QS7 A;  3D0Y A;  3VRP A;  1S3P A;  1XA5 A;  3C1V A;  2E6W A;  3I5I B;  5HYD A;  1DT7 B;  5AER A;  1YUR A;  1BT6 A;  1TNP A;  1WLM A;  2ZND A;  2KQ6 A;  2MBX A;  3M0W A;  2JT3 A;  1SL9 A;  3GK2 A;  5GQQ C;  1CKK A;  4PDZ A;  5PAL A;  3K21 A;  4AQI A;  2WCB A;  4PAL A;  1ZAC A;  2KQY A;  5ER4 X;  2JOJ A;  2PVB A;  1YVL A;  1BMO A;  1OZO A;  2Y1M A;  1DJY A;  4P5O E;  4PHK A;  1KK8 C;  1K93 D;  2WND A;  2HPS A;  1LXF C;  1RK9 A;  3GK1 A;  2LUX A;  1CFD A;  2F3Z A;  2NLN A;  3BOW A;  3SG7 A;  4XJK B;  2CNP A;  3NSO A;  1HQV A;  2KBM A;  4I5K A;  1QV1 A;  3RLZ A;  1A75 B;  2I2R E;  1TCO B;  1V1F A;  1YX8 A;  3FS7 A;  5HLV A;  1KQM B;  3QRX A;  1J7R A;  2JNX A;  1DF0 B;  1CM1 A;  1QVI Z;  1XFZ O;  4M2P A;  5HKY A;  1AK8 A;  2OTG C;  1SR6 C;  1K8U A;  3CR4 X;  3KEV A;  3A8R A;  2H2K A;  2EHB A;  1OMD A;  2NZ0 A;  3BYA A;  1CLB A;  2M3W A;  3SJS A;  1U5I A;  2BE6 A;  1QLS A;  2KAY A;  4HRH A;  1B8C A;  2JU0 A;  2COL B;  2RGI A;  3OX6 A;  3TUY C;  2K7D A;  2LP3 A;  5I8N A;  2K8M B;  1QTX A;  1XFU O;  2L5X B;  3PLF B;  1DJW A;  2Y1N A;  5AXI A;  1FI6 A;  5CSJ A;  3GK4 X;  1TRF A;  4YGE B;  1K90 D;  1FW4 A;  2ZRT A;  1JFJ A;  5TNC A;  1IKU A;  1ZOT B;  3BUX B;  2LNK A;  1SBJ A;  4C0L A;  2M97 A;  4HRE E;  5I2L A;  2PAS A;  1B47 A;  1QXP A;  1V1G A;  1ZMZ A;  2LVV A;  4M2Q A;  4OCI A;  4PHJ A;  2CXJ A;  3EVV A;  2F2O A;  3PAT A;  4PE4 A;  1IG5 A;  1NYA A;  2HET A;  2F8P A;  4TNC A;  1CTR A;  4HSZ A;  2FCD A;  2M29 A;  2R2I A;  4XJK A;  3LK0 A;  4JWQ A;  1JBA A;  1NP8 A;  2BKI B;  4PE1 A;  1M63 B;  1EJ3 A;  2KHN A;  3EKH A;  1G4Y R;  1OMV A;  1KWO C;  1J7P A;  1JF0 A;  3ICB A;  2O5G A;  1QIV A;  1N65 A;  4MBE A;  2M49 B;  1MHO A;  2BL0 B;  4PCW A;  3EKJ A;  4GUK A;  4R1E A;  1NCX A;  2PRU A;  2KI4 B;  4CID A;  4BY4 A;  1F70 A;  3JTD B;  1YTZ C;  2WCE A;  3HX4 A;  4CFQ A;  2AMI A;  2LAP A;  2BCX A;  1KQV A;  3CTN A;  3O6B A;  5KSZ A;  1TNX A;  3BUO B;  1IQ3 A;  2JTT A;  1DTL A;  4NDC A;  3LK1 A;  3VRR A;  3SG2 A;  3WXA A;  1MR8 A;  1LKJ A;  2KGR A;  2A4J A;  4U8D A;  2LAN A;  1S5G Y;  5DKQ A;  2JT8 A;  4ZCV A;  2PSR A;  1YX7 A;  2KDH A;  5FYX A;  1F4O A;  4Q04 A;  1B4C A;  3PAL A;  4OV2 A;  3BOW B;  1J7O A;  3EVR A;  2M0R A;  1K9P A;  1WDC C;  1S1E A;  3O2P A;  1F4Q A;  4QJ4 B;  4YRU A;  1KSO A;  1IRJ A;  2BBM A;  1IJ5 A;  2KFF A;  2Q91 A;  3H4S E;  4YI8 A;  3TZ1 A;  2F33 A;  3AKA A;  4I5N B;  1N2D A;  4P2Y B;  1SW8 A;  4YGC B;  1UHN A;  5J3X A;  2JXL A;  1SNL A;  1U5I B;  4NDD A;  2JQ6 A;  3OB2 B;  2KAV A;  1J1E A;  1PSB A;  3F45 A;  4CFR A;  1CMG A;  2WOS A;  2O60 A;  1CDP A;  3O78 A;  4ORB B;  2ZRS A;  3CS1 A;  1WRL A;  1EXR A;  1ZFS A;  2BL0 C;  1CB1 A;  1JF2 A;  1UUR A;  1CDN A;  1SL7 A;  1QVI Y;  3DVM A;  2LP2 A;  4F0Z B;  3LL8 B;  1X02 A;  2KI4 C;  1NWD A;  1XFW O;  2LLS A;  4OKH A;  4M2O A;  2JZI A;  1M31 A;  1PRW A;  2MJW B;  2Y4Q A;  3VGO A;  3DVJ A;  1SYM A;  1IWQ A;  1TTX A;  2FOT A;  3I5H C;  1PSR A;  3LCP C;  3WNX B;  1BLQ A;  2L0P A;  2EC6 B;  1YVH A;  5CSI A;  2H61 A;  3E3R A;  1AHR A;  2LHI A;  3I5G B;  4MZL A;  1W7I B;  2NCP A;  5KTY A;  4C0J A;  1EG3 A;  2I18 A;  2WCF A;  2WOR A;  1C7W A;  2M1U A;  1CFP A;  1MF8 B;  2PMY A;  1AJ5 A;  3RM1 A;  4DS7 A;  2GGM A;  1J7Q A;  2ZNE A;  4PHM A;  1IJ6 A;  1EL4 A;  1NUB A;  4WRI A;  2L51 A;  2LV7 A;  2OS8 C;  3CR5 X;  3PSR A;  4XYN A;  2LCP A;  2WC8 A;  1CNP A;  3NSI A;  1G8I A;  2JWW A;  4AQJ A;  1S6I A;  1MUX A;  3D10 A;  3AKB A;  2LUC A;  1LIN A;  3OHM B;  1NSH A;  1TNQ A;  1Y1U A;  3SIB A;  3I5F B;  1LVC D;  3AAJ A;  3PM8 A;  1HT9 A;  1OMR A;  4GGF A;  3I5I C;  4GFT A;  2VRG A;  4MN0 A;  1S26 D;  3KF9 A;  2KYF A;  4GBA A;  2KFG A;  4JQ0 D;  5B8I B;  1R2U A;  4A4B A;  1B8R A;  3DD4 A;  1A03 A;  1JC2 A;  3KPX A;  1NPQ A;  2QAC A;  4YGB B;  1UHI A;  1MXE A;  4N1G A;  1SCM B;  1ALW A;  2CT9 A;  3OX5 A;  1A29 A;  1CDL A;  3CWG A;  1XO5 A;  1JFK A;  3O4Y A;  3KHE A;  4MRX A;  3VRQ A;  1F54 A;  1QLK A;  1NX2 A;  1EH2 A;  3EK4 A;  1DGU A;  1SCV A;  1NX3 A;  3BUN B;  2KFH A;  2EC6 C;  2F3Y A;  5DKN A;  3I5G C;  3PN7 B;  1K9U A;  2JXC A;  2ZN8 A;  2AAO A;  2M7N A;  1KQM C;  4MEW A;  2GGZ A;  4ZCU A;  1BR1 B;  5ER5 A;  1F55 A;  1AJ4 A;  2CBL A;  1BOC A;  1PVA A;  3SG6 A;  4FQO A;  4JPZ B;  3DVE A;  2IS9 A;  3BUW B;  2EGD A;  1DJZ A;  4DRW A;  3DVK A;  1BR4 B;  1K9K A;  2BEC A;  2LMV A;  3BUM B;  2DOQ A;  2LLU A;  4UPG A;  1SMG A;  1FI5 A;  1WLZ A;  1YUT A;  1DGV A;  1LA0 A;  1TIZ A;  1UP5 A;  2I94 A;  1Y0V H;  2MAZ A;  1H4B A;  2Y5I A;  2M9G A;  2M8U A;  1S6J A;  3OB1 B;  1NCZ A;  1XFV O;  1NX0 A;  2L2E A;  1QIW A;  1M39 A;  4MZJ A;  3SG3 A;  1XK4 A;  3I5F C;  3NXA A;  2CCM A;  1B7T Z;  3BXK A;  2G2B A;  1E8A A;  4QJ5 B;  1CLL A;  1UHH A;  2FCE A;  2BCA A;  2K2F A;  1SKT A;  2JT0 A;  1SR6 B;  1BG1 A;  2JTZ A;  5BPJ A;  1Q80 A;  4GAO A;  2KOT A;  4A4C A;  3TDU A;  1R6P A;  1VRK A;  1MWN A;  2KNE A;  2P6B B;  5K89 A;  2LC5 A;  2JNF A;  1ALV A;  1OOJ A;  1QX5 B;  3TUY B;  1G33 A;  1XFY O;  3SG4 A;  2LLT A;  1OE9 B;  1KFU S;  4FTG A;  4WQ3 A;  1SL8 A;  4MSP A;  1FBV A;  2M7L A;  1L2O B;  3TDI A;  3TS5 B;  2TN4 A;  5JOL A;  4DCK A;  1BF5 A;  1J1D A;  2LVI A;  1L7Z A;  3A4U B;  1PVB A;  4WQ2 A;  3GOF A;  4YBH B;  1KFU L;  1RFJ A;  2JRF A; 
#chains in the Genus database with same CATH topology
 1S5G Z;  3JTD C;  4PHN A;  4CPV A;  2KYC A;  1CM4 A;  1YR5 A;  1UHJ A;  4PE7 A;  5HKZ A;  4MRY A;  2LVJ A;  2KSP A;  3DF0 A;  2QDI A;  3JVT B;  3LLE A;  1QV0 A;  3NSK A;  3CGA A;  2BKH B;  2V53 A;  3IF7 A;  1W7J B;  1ZUZ A;  2L4H A;  3CZ1 A;  2G9B A;  3FWB A;  1K2H A;  2K2A A;  2LHL A;  2GV5 A;  1TCF A;  4GNK B;  2K60 A;  3IQQ A;  1D1O A;  1DJX A;  1KK7 Z;  5CSF A;  3VRO A;  1KWO B;  5IBW A;  1GGZ A;  1SPY A;  4GGN A;  2L2C A;  2AUC A;  5AEQ A;  5HKW A;  1AVS A;  2MRD A;  1OSA A;  2LVK A;  1DVI A;  1WY9 A;  2KI6 D;  1KCY A;  3R1O A;  5CPV A;  1BU3 A;  1MXL C;  2H61 C;  2KGB C;  1RRO A;  1XFX O;  1B1G A;  1AP4 A;  1WRK A;  1A2X A;  4DUQ A;  4USL A;  3OBV A;  2K61 A;  1K94 A;  2WCH A;  4QJ3 B;  1CFC A;  3SIA A;  5DKR A;  1YRU B;  4N1F A;  4AOM A;  3HCM A;  3ZWH A;  1RJV A;  2KPH A;  4YI9 A;  5AFP A;  2JC2 A;  2SAS A;  4BY5 A;  3EK8 A;  4IL1 A;  1C07 A;  1F8H A;  1DJI A;  3VB1 A;  3CZT X;  3VRN A;  4DIR A;  5F6T A;  1REC A;  1TUJ A;  2QPT A;  1DEL A;  1DJG A;  1DJH A;  2MA2 A;  2K7C A;  3EK7 A;  3ZNI A;  4JKT A;  1F71 A;  1PK0 D;  2BCB A;  5CSN A;  1FF1 A;  1QAT A;  1TUZ A;  3B86 A;  1NIW A;  5HLO A;  2JPT A;  3EG5 B;  3TS5 C;  1M46 A;  1L2O C;  4GPL B;  1H8B A;  3OP0 A;  4CLN A;  1DMO A;  4HRG A;  2WC6 A;  3B88 A;  3N7H A;  2ISD A;  5D7F A;  1LS8 A;  3L4A A;  3NGV A;  1K96 A;  1A4P A;  2LE9 B;  1C7V A;  1T14 A;  1WDC B;  4N5X A;  3BJH A;  4MVF A;  3EVU A;  1IH0 A;  2HQW A;  1NX1 A;  4MZK A;  1Y1A A;  2MHH A;  3BFH A;  4GGF C;  2P71 A;  2KAX A;  4ICB A;  3JVT C;  4E68 A;  4OR9 B;  2HF5 A;  2ZKM X;  3KO0 A;  1TN4 A;  1YUS A;  3CDN A;  1B9A A;  1FPW A;  2L5Y A;  1S6C A;  2LM5 A;  2Q4U A;  3TDI A;  2I7A A;  1QX2 A;  2NXQ A;  1SK6 D;  2L98 A;  1A75 A;  2KBI A;  4OVN F;  1AUI B;  1JSA A;  2KI6 C;  2K7B A;  1DF0 A;  2SCP A;  3CR2 A;  4MLW A;  1SSE B;  4ORC B;  1YRT B;  1SRA A;  1RWY A;  2MLF C;  2NCO A;  1KFX S;  4NDB A;  5I2Q A;  1TNW A;  3IQO A;  1B7T Y;  1Y6W A;  1QX7 A;  5KU1 A;  1TWO A;  1QAS A;  3D74 A;  2JUL A;  1CMF A;  1CLM A;  1UUS A;  2ZFD A;  1KSM A;  1KFX L;  2M1K B;  2OPO A;  3O4X A;  3DYE A;  3D0Y B;  1SY9 A;  3S0D A;  1NCY A;  1GJY A;  1RTP 1;  1KK8 B;  3DF0 B;  1PAL A;  1S36 A;  5AAN A;  3AAK A;  1ODB A;  1IQ5 A;  1CDM A;  3BQ3 A;  3I5H B;  1XYD A;  2K0J A;  1CFF A;  3PFV A;  4FQT A;  4I5L B;  1K95 A;  1J55 A;  1YUU A;  1B8L A;  1MQ1 A;  3WHT B;  1JWD A;  1UHK A;  1N0Y A;  4ORA B;  2FJU B;  4YGA A;  2L4I A;  2LMU A;  1WRZ A;  1TOP A;  4PE0 A;  4I5J A;  4L9M A;  5EL2 A;  2OTG B;  1PUL A;  1UWO A;  3D78 A;  2CTN A;  2B1U A;  3SG5 A;  2ZN9 A;  2F2P A;  2BBN A;  2D8N A;  4YGD B;  3FWC A;  3FIA A;  5I2O A;  5JJG A;  4D1E A;  1GQM A;  3NSL A;  5D69 A;  1SCM C;  2MLE C;  4NQG A;  2L50 A;  2K7O A;  5FI6 A;  2E30 A;  1EG4 A;  2OS8 B;  1M45 A;  3FE9 A;  1XK4 C;  3BFA A;  4ETO A;  2BE4 A;  2PAL A;  1GGW A;  4C0K A;  2LMT A;  3K1E A;  1JUO A;  2HQ8 A;  5G08 A;  1XVJ A;  1KK7 Y;  1Y1X A;  1BOD A;  1LA3 A;  3OGN A;  3PN7 C;  1QJT A;  3TDZ A;  3CLN A;  3WHU B;  3MSE B;  1IGV A;  1BJF A;  1OQP A;  1OZS A;  1QS7 A;  3D0Y A;  3VRP A;  1S3P A;  1XA5 A;  3C1V A;  2E6W A;  3I5I B;  4KYN A;  5HYD A;  1DT7 B;  5AER A;  1YUR A;  1BT6 A;  1TNP A;  1WLM A;  2ZND A;  2KQ6 A;  2MBX A;  3M0W A;  2JT3 A;  1SL9 A;  3QME A;  3R1P A;  5FI2 A;  3GK2 A;  5GQQ C;  4IJ7 A;  1CKK A;  4PDZ A;  5PAL A;  1Z4H A;  3K21 A;  2WCB A;  4PAL A;  1ZAC A;  2KQY A;  5ER4 X;  4AQI A;  2JOJ A;  2PVB A;  1YVL A;  3S0G A;  1BMO A;  3CZ2 A;  1OZO A;  2Y1M A;  1DJY A;  4P5O E;  4PHK A;  1KK8 C;  1K93 D;  2WND A;  5I94 A;  2HPS A;  1LXF C;  2P70 A;  1RK9 A;  3GK1 A;  2LUX A;  1CFD A;  2F3Z A;  2NLN A;  3BOW A;  3SG7 A;  4INX A;  4XJK B;  2BAP A;  2CNP A;  3NSO A;  1HQV A;  2KBM A;  4I5K A;  1QV1 A;  3R72 A;  3RLZ A;  1A75 B;  2I2R E;  1TCO B;  1V1F A;  1YX8 A;  3FS7 A;  5HLV A;  1KQM B;  3QRX A;  1J7R A;  2JNX A;  1DF0 B;  1CM1 A;  1QVI Z;  1XFZ O;  4M2P A;  5DIC A;  5HKY A;  1AK8 A;  2WCJ A;  2OTG C;  1QWV A;  1SR6 C;  1K8U A;  3CR4 X;  3KEV A;  3A8R A;  2H2K A;  2EHB A;  1OMD A;  2NZ0 A;  3BYA A;  1CLB A;  2M3W A;  3SJS A;  1U5I A;  2BE6 A;  1QLS A;  2KAY A;  4HRH A;  1B8C A;  2JU0 A;  2COL B;  2RGI A;  3OX6 A;  3TUY C;  2K7D A;  2LP3 A;  5I8N A;  2K8M B;  1QTX A;  3BFB A;  1XFU O;  2L5X B;  3PLF B;  1DJW A;  2Y1N A;  5AXI A;  1FI6 A;  5CSJ A;  3GK4 X;  1TRF A;  4YGE B;  1K90 D;  3SS3 A;  1FW4 A;  2ZRT A;  1JFJ A;  5TNC A;  1IKU A;  1ZOT B;  3BUX B;  2LNK A;  1SBJ A;  4C0L A;  2M97 A;  4HRE E;  5I2L A;  2PAS A;  1B47 A;  1QXP A;  1V1G A;  1ZMZ A;  2LVV A;  2QEB A;  4M2Q A;  4OCI A;  4PHJ A;  2CXJ A;  3EVV A;  2F2O A;  3PAT A;  4PE4 A;  1IG5 A;  1NYA A;  2HET A;  3IVT A;  2F8P A;  4TNC A;  1CTR A;  4HSZ A;  2FCD A;  2M29 A;  2R2I A;  4XJK A;  1OOH A;  3LK0 A;  4JWQ A;  1JBA A;  1NP8 A;  2BKI B;  4PE1 A;  2WC5 A;  1M63 B;  2GTE A;  1EJ3 A;  2KHN A;  3EKH A;  1G4Y R;  1OMV A;  3B7A A;  1KWO C;  1J7P A;  1JF0 A;  3ICB A;  2O5G A;  1QIV A;  3Q8I A;  1N65 A;  4MBE A;  2M49 B;  1MHO A;  2KLD A;  2BL0 B;  4PCW A;  3EKJ A;  2WCL A;  4GUK A;  4R1E A;  1NCX A;  2PRU A;  2KI4 B;  4CID A;  4BY4 A;  1F70 A;  3JTD B;  1YTZ C;  2WCE A;  3HX4 A;  4CFQ A;  2AMI A;  2LAP A;  2BCX A;  1KQV A;  3CTN A;  3O6B A;  5KSZ A;  1TNX A;  3BUO B;  1IQ3 A;  2JTT A;  1OOG A;  1DTL A;  4NDC A;  3L4L A;  3LK1 A;  3VRR A;  3SG2 A;  3WXA A;  1MR8 A;  3CZ0 A;  1LKJ A;  2KGR A;  3B87 A;  4PT1 A;  2A4J A;  4U8D A;  3S0F A;  2LAN A;  1S5G Y;  5DKQ A;  2JT8 A;  4ZCV A;  3S0A A;  2PSR A;  1YX7 A;  2KDH A;  3SS4 A;  5FYX A;  1F4O A;  1OOF A;  4Q04 A;  1B4C A;  3PAL A;  4OV2 A;  3BOW B;  1J7O A;  3EVR A;  2M0R A;  1K9P A;  1WDC C;  1S1E A;  3O2P A;  1F4Q A;  4QJ4 B;  4YRU A;  1KSO A;  1IRJ A;  4INW A;  2BBM A;  1IJ5 A;  1P28 A;  2KFF A;  2ERB A;  2Q91 A;  3FE8 A;  3H4S E;  4YI8 A;  3TZ1 A;  2F33 A;  2QEO A;  3AKA A;  4I5N B;  1N2D A;  4P2Y B;  1SW8 A;  4YGC B;  1UHN A;  2PQL A;  5J3X A;  2JXL A;  1SNL A;  1U5I B;  2WCM A;  4NDD A;  2JQ6 A;  3OB2 B;  2KAV A;  1J1E A;  1PSB A;  3F45 A;  4CFR A;  1CMG A;  2WOS A;  2O60 A;  1CDP A;  3O78 A;  4ORB B;  2ZRS A;  3CS1 A;  1WRL A;  1EXR A;  1Z2C B;  1ZFS A;  2BL0 C;  1CB1 A;  1JF2 A;  1UUR A;  1CDN A;  1SL7 A;  1QVI Y;  3DVM A;  3D75 A;  2LP2 A;  4F0Z B;  3LL8 B;  1X02 A;  2KI4 C;  1NWD A;  1XFW O;  2LLS A;  4OKH A;  4M2O A;  2JZI A;  3L47 A;  1M31 A;  1PRW A;  2MJW B;  2Y4Q A;  3VGO A;  3DVJ A;  1SYM A;  1IWQ A;  1TTX A;  2FOT A;  3I5H C;  1PSR A;  3LCP C;  3WNX B;  1BLQ A;  2L0P A;  2EC6 B;  1YVH A;  5CSI A;  2H61 A;  3E3R A;  1AHR A;  2LHI A;  3I5G B;  4MZL A;  1W7I B;  2NCP A;  5KTY A;  4C0J A;  1EG3 A;  3D77 A;  2I18 A;  2WCF A;  2WOR A;  1C7W A;  2M1U A;  4OZD A;  1CFP A;  1MF8 B;  3RZS A;  2PMY A;  1AJ5 A;  1DC1 A;  3RM1 A;  4DS7 A;  2GGM A;  1J7Q A;  2ZNE A;  4PHM A;  3SS5 A;  1IJ6 A;  1GM0 A;  1EL4 A;  1NUB A;  2QEV A;  4WRI A;  3DZT A;  2L51 A;  2LV7 A;  2OS8 C;  3CR5 X;  3PSR A;  4XYN A;  3PM2 A;  2LCP A;  2WC8 A;  1CNP A;  3NSI A;  1G8I A;  2JWW A;  1DQE A;  4AQJ A;  1S6I A;  1MUX A;  3D10 A;  3AKB A;  2LUC A;  1LIN A;  3OHM B;  1NSH A;  1TNQ A;  1Y1U A;  3S0E A;  3SIB A;  3I5F B;  1LVC D;  3AAJ A;  3D76 A;  1DEK A;  1HT9 A;  3PM8 A;  1OMR A;  3UNW A;  4GGF A;  3I5I C;  3UO9 A;  4GFT A;  2VRG A;  1ORG A;  2WCK A;  4MN0 A;  1S26 D;  1C3Y A;  3FE6 A;  3KF9 A;  2KYF A;  4GBA A;  4F7F A;  2KFG A;  4JQ0 D;  5B8I B;  1R2U A;  4A4B A;  1B8R A;  3DD4 A;  1A03 A;  1JC2 A;  3KPX A;  1NPQ A;  5HL1 A;  2FJY A;  2QAC A;  1UHI A;  4YGB B;  1MXE A;  4N1G A;  3DY9 A;  1SCM B;  1ALW A;  2CT9 A;  3OX5 A;  1A29 A;  1CDL A;  3CWG A;  1XO5 A;  1JFK A;  3CAB A;  3O4Y A;  3KHE A;  4MRX A;  3VRQ A;  2H8V A;  1QLK A;  1NX2 A;  5FI7 A;  1XFR A;  3EK4 A;  1EH2 A;  1F54 A;  1DGU A;  1SCV A;  1NX3 A;  3BUN B;  2KFH A;  2EC6 C;  2F3Y A;  3B6X A;  3I5G C;  3PN7 B;  5DKN A;  1K9U A;  1C3Z A;  2JXC A;  3NHI A;  2ZN8 A;  2AAO A;  2M7N A;  1KQM C;  4MEW A;  2GGZ A;  4ZCU A;  1BR1 B;  5ER5 A;  1F55 A;  1AJ4 A;  2CBL A;  1BOC A;  3V2L A;  1PVA A;  3SG6 A;  2JPO A;  4FQO A;  4JPZ B;  3DVE A;  2IS9 A;  3BUW B;  2EGD A;  1DJZ A;  4DRW A;  3DVK A;  1BR4 B;  1OOI X;  1K9K A;  2BEC A;  2LMV A;  3BUM B;  3DXL A;  2DOQ A;  2LLU A;  4UPG A;  1SMG A;  1FI5 A;  1WLZ A;  1YUT A;  3D73 A;  3PJI A;  1DGV A;  5D3O A;  1LA0 A;  1TIZ A;  1UP5 A;  2I94 A;  1Y0V H;  2MAZ A;  1H4B A;  2Y5I A;  2M9G A;  2PYQ A;  2BNX A;  2M8U A;  1S6J A;  3OB1 B;  1NCZ A;  1XFV O;  3NHT A;  1NX0 A;  2L2E A;  1QIW A;  1M39 A;  4MZJ A;  3SG3 A;  1XK4 A;  3I5F C;  3NXA A;  2CCM A;  1B7T Z;  3BXK A;  2G2B A;  1OW4 A;  1E8A A;  4QJ5 B;  1CLL A;  1UHH A;  2QEH A;  2FCE A;  2BCA A;  2K2F A;  1SKT A;  2JT0 A;  1SR6 B;  1BG1 A;  2JTZ A;  5BPJ A;  1Q80 A;  2KLE A;  4GAO A;  2KOT A;  4A4C A;  3TDU A;  1R6P A;  1VRK A;  1MWN A;  2KNE A;  2P6B B;  3R1V A;  2LC5 A;  2JNF A;  1W9Z A;  3CYZ A;  5K89 A;  1ALV A;  1OOJ A;  1QX5 B;  1IIO A;  3TUY B;  1G33 A;  1XFY O;  3SG4 A;  4JD9 A;  2LLT A;  1OE9 B;  1KFU S;  4FTG A;  4WQ3 A;  1SL8 A;  4MSP A;  1FBV A;  2M7L A;  1L2O B;  3S0B A;  3TS5 B;  2TN4 A;  5JOL A;  4DCK A;  1BF5 A;  1J1D A;  2LVI A;  1L7Z A;  3A4U B;  1PVB A;  4WQ2 A;  3GOF A;  2YGU A;  4YBH B;  1KFU L;  1RFJ A;  2JRF A; 
#chains in the Genus database with same CATH homology
 1S5G Z;  3JTD C;  4PHN A;  4CPV A;  2KYC A;  1CM4 A;  1YR5 A;  1UHJ A;  4PE7 A;  5HKZ A;  4MRY A;  2LVJ A;  2KSP A;  3DF0 A;  3LLE A;  3JVT B;  1QV0 A;  3NSK A;  3CGA A;  2BKH B;  2V53 A;  3IF7 A;  1W7J B;  1ZUZ A;  2L4H A;  3FWB A;  2G9B A;  1K2H A;  2K2A A;  2LHL A;  2GV5 A;  1TCF A;  4GNK B;  3IQQ A;  1D1O A;  1DJX A;  1KK7 Z;  5CSF A;  3VRO A;  1KWO B;  5IBW A;  1GGZ A;  1SPY A;  4GGN A;  2AUC A;  5AEQ A;  5HKW A;  1AVS A;  2MRD A;  1OSA A;  2LVK A;  1DVI A;  1WY9 A;  2KI6 D;  1KCY A;  5CPV A;  1BU3 A;  1MXL C;  2H61 C;  2KGB C;  1RRO A;  1XFX O;  1B1G A;  1AP4 A;  1WRK A;  1A2X A;  4DUQ A;  4USL A;  2K61 A;  1K94 A;  4QJ3 B;  1CFC A;  3SIA A;  5DKR A;  1YRU B;  4N1F A;  4AOM A;  3HCM A;  3ZWH A;  1RJV A;  4YI9 A;  5AFP A;  2JC2 A;  2SAS A;  4BY5 A;  3EK8 A;  4IL1 A;  1C07 A;  1F8H A;  1DJI A;  3CZT X;  3VRN A;  4DIR A;  5F6T A;  1REC A;  3EK7 A;  2QPT A;  2MA2 A;  1DJG A;  1DJH A;  3ZNI A;  2K7C A;  1F71 A;  1PK0 D;  2BCB A;  5CSN A;  1FF1 A;  1QAT A;  1NIW A;  5HLO A;  2JPT A;  3TS5 C;  1M46 A;  1L2O C;  4GPL B;  1H8B A;  3OP0 A;  4CLN A;  1DMO A;  4HRG A;  2ISD A;  5D7F A;  1K96 A;  1A4P A;  2LE9 B;  1C7V A;  1WDC B;  4N5X A;  4MVF A;  3EVU A;  1IH0 A;  2HQW A;  1NX1 A;  4MZK A;  1Y1A A;  2MHH A;  4GGF C;  2KAX A;  4ICB A;  3JVT C;  4E68 A;  4OR9 B;  2HF5 A;  2ZKM X;  3KO0 A;  1TN4 A;  1YUS A;  1B9A A;  1FPW A;  1S6C A;  2LM5 A;  2Q4U A;  2I7A A;  1QX2 A;  2NXQ A;  1SK6 D;  2L98 A;  1A75 A;  2KBI A;  4OVN F;  1AUI B;  1JSA A;  2KI6 C;  2K7B A;  1DF0 A;  2SCP A;  3CR2 A;  4MLW A;  4ORC B;  1YRT B;  1SRA A;  1RWY A;  2MLF C;  2NCO A;  1KFX S;  4NDB A;  5I2Q A;  1TNW A;  3IQO A;  1B7T Y;  1Y6W A;  1QX7 A;  5KU1 A;  1QAS A;  2JUL A;  1CMF A;  1CLM A;  1UUS A;  2ZFD A;  1KSM A;  1KFX L;  2M1K B;  2OPO A;  3D0Y B;  1SY9 A;  1NCY A;  1GJY A;  1RTP 1;  1KK8 B;  3DF0 B;  1PAL A;  1S36 A;  5AAN A;  3AAK A;  1ODB A;  1IQ5 A;  1CDM A;  3BQ3 A;  3I5H B;  1XYD A;  2K0J A;  1CFF A;  3PFV A;  4I5L B;  1K95 A;  1J55 A;  1YUU A;  1B8L A;  1MQ1 A;  3WHT B;  1JWD A;  1UHK A;  1N0Y A;  4ORA B;  2FJU B;  4YGA A;  2L4I A;  2LMU A;  1WRZ A;  1TOP A;  4PE0 A;  4I5J A;  4L9M A;  2OTG B;  1PUL A;  1UWO A;  2CTN A;  2B1U A;  3SG5 A;  2ZN9 A;  2F2P A;  2BBN A;  2D8N A;  4YGD B;  3FWC A;  3FIA A;  5I2O A;  5JJG A;  4D1E A;  1GQM A;  3NSL A;  5D69 A;  1SCM C;  2MLE C;  4NQG A;  2L50 A;  2K7O A;  2E30 A;  1EG4 A;  2OS8 B;  1M45 A;  1XK4 C;  4ETO A;  2BE4 A;  2PAL A;  1GGW A;  4C0K A;  2LMT A;  1JUO A;  2HQ8 A;  5G08 A;  1XVJ A;  1KK7 Y;  1Y1X A;  1BOD A;  1LA3 A;  3PN7 C;  1QJT A;  3TDZ A;  3CLN A;  3WHU B;  3MSE B;  1IGV A;  1BJF A;  1OQP A;  1OZS A;  1QS7 A;  3D0Y A;  3VRP A;  1S3P A;  1XA5 A;  3C1V A;  2E6W A;  3I5I B;  5HYD A;  1DT7 B;  5AER A;  1YUR A;  1BT6 A;  1TNP A;  1WLM A;  2ZND A;  2KQ6 A;  2MBX A;  3M0W A;  2JT3 A;  1SL9 A;  3GK2 A;  5GQQ C;  1CKK A;  4PDZ A;  5PAL A;  3K21 A;  4AQI A;  2WCB A;  4PAL A;  1ZAC A;  2KQY A;  5ER4 X;  2JOJ A;  2PVB A;  1YVL A;  1BMO A;  1OZO A;  2Y1M A;  1DJY A;  4P5O E;  4PHK A;  1KK8 C;  1K93 D;  2WND A;  2HPS A;  1LXF C;  1RK9 A;  3GK1 A;  2LUX A;  1CFD A;  2F3Z A;  2NLN A;  3BOW A;  3SG7 A;  4XJK B;  2CNP A;  3NSO A;  1HQV A;  2KBM A;  4I5K A;  1QV1 A;  3RLZ A;  1A75 B;  2I2R E;  1TCO B;  1V1F A;  1YX8 A;  3FS7 A;  5HLV A;  1KQM B;  3QRX A;  1J7R A;  2JNX A;  1DF0 B;  1CM1 A;  1QVI Z;  1XFZ O;  4M2P A;  5HKY A;  1AK8 A;  2OTG C;  1SR6 C;  1K8U A;  3CR4 X;  3KEV A;  3A8R A;  2H2K A;  2EHB A;  1OMD A;  2NZ0 A;  3BYA A;  1CLB A;  2M3W A;  3SJS A;  1U5I A;  2BE6 A;  1QLS A;  2KAY A;  4HRH A;  1B8C A;  2JU0 A;  2COL B;  2RGI A;  3OX6 A;  3TUY C;  2K7D A;  2LP3 A;  5I8N A;  2K8M B;  1QTX A;  1XFU O;  2L5X B;  3PLF B;  1DJW A;  2Y1N A;  5AXI A;  1FI6 A;  5CSJ A;  3GK4 X;  1TRF A;  4YGE B;  1K90 D;  1FW4 A;  2ZRT A;  1JFJ A;  5TNC A;  1IKU A;  1ZOT B;  3BUX B;  2LNK A;  1SBJ A;  4C0L A;  2M97 A;  4HRE E;  5I2L A;  2PAS A;  1B47 A;  1QXP A;  1V1G A;  1ZMZ A;  2LVV A;  4M2Q A;  4OCI A;  4PHJ A;  2CXJ A;  3EVV A;  2F2O A;  3PAT A;  4PE4 A;  1IG5 A;  1NYA A;  2HET A;  2F8P A;  4TNC A;  1CTR A;  4HSZ A;  2FCD A;  2M29 A;  2R2I A;  4XJK A;  3LK0 A;  4JWQ A;  1JBA A;  1NP8 A;  2BKI B;  4PE1 A;  1M63 B;  1EJ3 A;  2KHN A;  3EKH A;  1G4Y R;  1OMV A;  1KWO C;  1J7P A;  1JF0 A;  3ICB A;  2O5G A;  1QIV A;  1N65 A;  4MBE A;  2M49 B;  1MHO A;  2BL0 B;  4PCW A;  3EKJ A;  4GUK A;  4R1E A;  1NCX A;  2PRU A;  2KI4 B;  4CID A;  4BY4 A;  1F70 A;  3JTD B;  1YTZ C;  2WCE A;  3HX4 A;  4CFQ A;  2AMI A;  2LAP A;  2BCX A;  1KQV A;  3CTN A;  3O6B A;  5KSZ A;  1TNX A;  3BUO B;  1IQ3 A;  2JTT A;  1DTL A;  4NDC A;  3LK1 A;  3VRR A;  3SG2 A;  3WXA A;  1MR8 A;  1LKJ A;  2KGR A;  2A4J A;  4U8D A;  2LAN A;  1S5G Y;  5DKQ A;  2JT8 A;  4ZCV A;  2PSR A;  1YX7 A;  2KDH A;  5FYX A;  1F4O A;  4Q04 A;  1B4C A;  3PAL A;  4OV2 A;  3BOW B;  1J7O A;  3EVR A;  2M0R A;  1K9P A;  1WDC C;  1S1E A;  3O2P A;  1F4Q A;  4QJ4 B;  4YRU A;  1KSO A;  1IRJ A;  2BBM A;  1IJ5 A;  2KFF A;  2Q91 A;  3H4S E;  4YI8 A;  3TZ1 A;  2F33 A;  3AKA A;  4I5N B;  1N2D A;  4P2Y B;  1SW8 A;  4YGC B;  1UHN A;  5J3X A;  2JXL A;  1SNL A;  1U5I B;  4NDD A;  2JQ6 A;  3OB2 B;  2KAV A;  1J1E A;  1PSB A;  3F45 A;  4CFR A;  1CMG A;  2WOS A;  2O60 A;  1CDP A;  3O78 A;  4ORB B;  2ZRS A;  3CS1 A;  1WRL A;  1EXR A;  1ZFS A;  2BL0 C;  1CB1 A;  1JF2 A;  1UUR A;  1CDN A;  1SL7 A;  1QVI Y;  3DVM A;  2LP2 A;  4F0Z B;  3LL8 B;  1X02 A;  2KI4 C;  1NWD A;  1XFW O;  2LLS A;  4OKH A;  4M2O A;  2JZI A;  1M31 A;  1PRW A;  2MJW B;  2Y4Q A;  3VGO A;  3DVJ A;  1SYM A;  1IWQ A;  1TTX A;  2FOT A;  3I5H C;  1PSR A;  3LCP C;  3WNX B;  1BLQ A;  2L0P A;  2EC6 B;  1YVH A;  5CSI A;  2H61 A;  3E3R A;  1AHR A;  2LHI A;  3I5G B;  4MZL A;  1W7I B;  2NCP A;  5KTY A;  4C0J A;  1EG3 A;  2I18 A;  2WCF A;  2WOR A;  1C7W A;  2M1U A;  1CFP A;  1MF8 B;  2PMY A;  1AJ5 A;  3RM1 A;  4DS7 A;  2GGM A;  1J7Q A;  2ZNE A;  4PHM A;  1IJ6 A;  1EL4 A;  1NUB A;  4WRI A;  2L51 A;  2LV7 A;  2OS8 C;  3CR5 X;  3PSR A;  4XYN A;  2LCP A;  2WC8 A;  1CNP A;  3NSI A;  1G8I A;  2JWW A;  4AQJ A;  1S6I A;  1MUX A;  3D10 A;  3AKB A;  2LUC A;  1LIN A;  3OHM B;  1NSH A;  1TNQ A;  1Y1U A;  3SIB A;  3I5F B;  1LVC D;  3AAJ A;  3PM8 A;  1HT9 A;  1OMR A;  4GGF A;  3I5I C;  4GFT A;  2VRG A;  4MN0 A;  1S26 D;  3KF9 A;  2KYF A;  4GBA A;  2KFG A;  4JQ0 D;  5B8I B;  1R2U A;  4A4B A;  1B8R A;  3DD4 A;  1A03 A;  1JC2 A;  3KPX A;  1NPQ A;  2QAC A;  4YGB B;  1UHI A;  1MXE A;  4N1G A;  1SCM B;  1ALW A;  2CT9 A;  3OX5 A;  1A29 A;  1CDL A;  3CWG A;  1XO5 A;  1JFK A;  3O4Y A;  3KHE A;  4MRX A;  3VRQ A;  1F54 A;  1QLK A;  1NX2 A;  1EH2 A;  3EK4 A;  1DGU A;  1SCV A;  1NX3 A;  3BUN B;  2KFH A;  2EC6 C;  2F3Y A;  5DKN A;  3I5G C;  3PN7 B;  1K9U A;  2JXC A;  2ZN8 A;  2AAO A;  2M7N A;  1KQM C;  4MEW A;  2GGZ A;  4ZCU A;  1BR1 B;  5ER5 A;  1F55 A;  1AJ4 A;  2CBL A;  1BOC A;  1PVA A;  3SG6 A;  4FQO A;  4JPZ B;  3DVE A;  2IS9 A;  3BUW B;  2EGD A;  1DJZ A;  4DRW A;  3DVK A;  1BR4 B;  1K9K A;  2BEC A;  2LMV A;  3BUM B;  2DOQ A;  2LLU A;  4UPG A;  1SMG A;  1FI5 A;  1WLZ A;  1YUT A;  1DGV A;  1LA0 A;  1TIZ A;  1UP5 A;  2I94 A;  1Y0V H;  2MAZ A;  1H4B A;  2Y5I A;  2M9G A;  2M8U A;  1S6J A;  3OB1 B;  1NCZ A;  1XFV O;  1NX0 A;  2L2E A;  1QIW A;  1M39 A;  4MZJ A;  3SG3 A;  1XK4 A;  3I5F C;  3NXA A;  2CCM A;  1B7T Z;  3BXK A;  2G2B A;  1E8A A;  4QJ5 B;  1CLL A;  1UHH A;  2FCE A;  2BCA A;  2K2F A;  1SKT A;  2JT0 A;  1SR6 B;  1BG1 A;  2JTZ A;  5BPJ A;  1Q80 A;  4GAO A;  2KOT A;  4A4C A;  3TDU A;  1R6P A;  1VRK A;  1MWN A;  2KNE A;  2P6B B;  5K89 A;  2LC5 A;  2JNF A;  1ALV A;  1OOJ A;  1QX5 B;  3TUY B;  1G33 A;  1XFY O;  3SG4 A;  2LLT A;  1OE9 B;  1KFU S;  4FTG A;  4WQ3 A;  1SL8 A;  4MSP A;  1FBV A;  2M7L A;  1L2O B;  3TDI A;  3TS5 B;  2TN4 A;  5JOL A;  4DCK A;  1BF5 A;  1J1D A;  2LVI A;  1L7Z A;  3A4U B;  1PVB A;  4WQ2 A;  3GOF A;  4YBH B;  1KFU L;  1RFJ A;  2JRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...