1F71A

Refined solution structure of calmodulin c-terminal domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords CALMODULIN
publication title Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings.
pubmed doi rcsb
source organism Xenopus laevis
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f71A00
3AKBA 4PHNA 1BR1B 1TTXA 4ZCUA 4BY5A 1JFKA 1KQMB 1G4YR 1RK9A 2MHHA 1DJGA 2F33A 1ZUZA 1KQMC 2B1UA 2JTZA 2CCMA 2HPSA 2D8NA 4YI8A 4C0KA 1TNPA 1ALWA 1M63B 3NSLA 3TS5B 1C7VA 2JULA 1MUXA 3NSIA 1YR5A 4GBAA 2Q4UA 2M97A 1A03A 3TS5C 1LINA 4XJKB 3A8RA 1K94A 1SCVA 1YX8A 1JC2A 2WNDA 1JUOA 1SCMB 1Y0VH 4MN0A 3CR5X 3OB2B 2NZ0A 3EVRA 1Y1XA 3TDUA 2LMUA 2M8UA 4YGDB 2MRDA 4I5NB 2ZNEA 2BCBA 1CB1A 1SYMA 2F3ZA 4OCIA 3CWGA 2JQ6A 3BQ3A 5ER5A 1YUTA 1F54A 1S5GZ 1QV0A 1UHIA 2KI6C 3TZ1A 3EK7A 2WC8A 2H61A 2Y5IA 3IQQA 4ORBB 3SG6A 2JTTA 3O78A 5FYXA 1F4QA 1WRLA 1J1EA 1TN4A 1QVIZ 1N0YA 3DVJA 1JSAA 4ETOA 2LHLA 1XK4C 4NQGA 1AK8A 2JWWA 4MZJA 1B9AA 2BE4A 2O60A 5JJGA 2LVJA 1AVSA 3CLNA 1NX0A 1BODA 1DJHA 1NCXA 2K0JA 1A29A 2KAYA 1FW4A 1F4OA 1K9KA 1TCFA 1YURA 2PRUA 4JWQA 2CXJA 2EHBA 2CT9A 2L2EA 1WRKA 3SJSA 2M1KB 1DF0A 2ZRSA 1GGZA 1LKJA 1SKTA 3I5GB 1TNXA 2LP2A 5D69A 1K9PA 1Y1AA 2LANA 1NCYA 4N5XA 1MXLC 2KDHA 3I5GC 1AUIB 1AHRA 4HREE 4MRXA 3D0YA 3VRPA 1QLSA 3I5FC 1DGUA 2K2FA 1JF2A 4QJ3B 2M29A 1K93D 1QX5B 3WHUB 1YX7A 3SG5A 5D7FA 3VGOA 1AJ5A 4MZKA 5AANA 4FTGA 1DF0B 3IF7A 4I5LB 4FQOA 2G2BA 2WORA 1UURA 5G08A 1DMOA 1CM1A 1IWQA 1DGVA 1XVJA 1WLMA 2BL0C 2HETA 3BUNB 4AQIA 2LLTA 1ZFSA 1BLQA 2ISDA 1J7PA 2MJWB 3CGAA 1F55A 2KYCA 2AMIA 3M0WA 1OQPA 1BMOA 2LVKA 3PSRA 1TNQA 2L51A 2KHNA 3SIAA 2L50A 3KEVA 1KSMA 2LMVA 3FIAA 1H4BA 3CTNA 3E3RA 1W7IB 3GK4X 3PM8A 1SY9A 1U5IA 3AAJA 1YTZC 3LCPC 4YGCB 1LXFC 4OKHA 4GPLB 1PVAA 1SPYA 2F2OA 1FF1A 4PE1A 4Q04A 2K61A 1CDLA 1M39A 1S3PA 3A4UB 2M1UA 4I5KA 4OR9B 3VROA 3PN7B 5IBWA 1U5IB 2LMTA 1CFCA 2Q91A 1FBVA 1B8LA 1K95A 4DS7A 1LA0A 1OMRA 2AUCA 4GFTA 1SL8A 3GOFA 1K2HA 2LC5A 1JBAA 1MXEA 4GGNA 2BKIB 2VRGA 5KSZA 1M45A 1CFDA 1VRKA 1H8BA 1KK8B 4BY4A 2GGZA 1NSHA 3LL8B 4NDDA 1TIZA 1KK8C 1SRAA 1K90D 1XO5A 3IQOA 2K7BA 3O6BA 2PMYA 4DIRA 1Y6WA 4PALA 2GV5A 2TN4A 3RM1A 1CTRA 4PE4A 3PLFB 3AKAA 1FPWA 4ZCVA 2KYFA 1CFPA 2LM5A 2LP3A 4UPGA 1UWOA 1SNLA 1XK4A 3ZWHA 5I2QA 4USLA 1BR4B 1M46A 1M31A 2BECA 1KSOA 4MRYA 1B8RA 3SG3A 5F6TA 2KGBC 1EL4A 2EGDA 5TNCA 5HLOA 3SG2A 1CNPA 3LK1A 3CZTX 1OZOA 1PK0D 1S36A 2KGRA 4MEWA 5AFPA 2L0PA 2EC6B 1B7TZ 1KCYA 2BE6A 3PATA 4YBHB 2LVVA 5I8NA 2EC6C 1DJXA 1K96A 1LVCD 1XFUO 3KO0A 2V53A 3CR2A 3BUOB 3AAKA 2BKHB 1S6IA 1A2XA 1DJZA 1SMGA 1ZOTB 3CS1A 2FJUB 3BUXB 1KK7Y 1XFVO 2I94A 1S6JA 2QPTA 2KSPA 5BPJA 2BCAA 5GQQC 3SG7A 4D1EA 1K9UA 5KTYA 1WLZA 1QIWA 2K7CA 5HKYA 1Y1UA 1EXRA 2M9GA 1CFFA 1XFZO 1CLMA 3I5FB 5JOLA 4YRUA 1YRTB 1KFXL 1NP8A 2WCEA 5HLVA 1QX2A 1EG3A 1J7QA 4E68A 2FCDA 3CR4X 5CSIA 3VRRA 3O4YA 1DJYA 1CM4A 1PALA 2AAOA 2HF5A 1B8CA 2WCFA 4A4CA 1J7OA 3D10A 2BL0B 3KPXA 1EG4A 4PHKA 4CFRA 1UHKA 2DOQA 2GGMA 4PCWA 2Y4QA 2H2KA 4TNCA 1KFUL 1XFWO 1QIVA 2R2IA 1XA5A 1QS7A 1ZACA 1N2DA 3O2PA 2JZIA 1KFUS 1UUSA 3JVTB 1V1GA 4YGEB 4NDCA 4M2OA 4MBEA 1DVIA 4CIDA 2KBIA 3DVMA 1X02A 3JVTC 4ORAB 1SL7A 1NIWA 1NX3A 1IG5A 4CFQA 5AERA 1AJ4A 2G9BA 1DTLA 5KU1A 2MLFC 3JTDB 5DKRA 2JT0A 4GGFC 4YGAA 4I5JA 3JTDC 3GK2A 1MR8A 1S1EA 1Q80A 1TOPA 1WY9A 1ALVA 1B47A 1ODBA 2K8MB 1CDNA 1EH2A 1C7WA 2PALA 2ZFDA 2NCPA 2NLNA 1JFJA 2LUXA 1QV1A 2ZKMX 2HQ8A 1PVBA 1QVIY 1XFYO 3EK8A 4PHMA 1CLLA 2M7LA 3WHTB 1TRFA 1MWNA 2SASA 2M0RA 2LNKA 2LV7A 1RROA 3TDZA 1TNWA 4PE0A 1D1OA 4DRWA 2F8PA 1NUBA 2OS8B 2ZNDA 1KK7Z 4DUQA 1QXPA 3KHEA 1IH0A 2KQYA 4N1GA 4AQJA 2OS8C 3OX5A 4P5OE 3LLEA 5CSJA 4N1FA 1FI6A 2OTGB 2LHIA 1LA3A 3OP0A 2CBLA 2L4IA 3I5IB 2P6BB 3HX4A 2OTGC 4XYNA 1KQVA 2PVBA 3I5IC 1B4CA 2JPTA 5AEQA 1PSRA 1J1DA 2HQWA 1G33A 3DF0B 4HRGA 2JT8A 2Y1MA 4MZLA 1PRWA 1KWOB 3NSKA 2JNFA 3DVKA 1PSBA 1IJ5A 2KQ6A 2NXQA 2PASA 5CSNA 2JU0A 3BYAA 1KWOC 4ICBA 4PHJA 1RECA 1G8IA 3KF9A 2M3WA 1SBJA 4R1EA 4CLNA 1V1FA 2LLSA 2LVIA 3K21A 1QJTA 4QJ5B 1EJ3A 2SCPA 5B8IB 3VRQA 1YUSA 4IL1A 1SK6D 1SR6B 2BBNA 1XFXO 2ZN9A 1CMFA 2JC2A 1SR6C 3PALA 1L7ZA 1S26D 1BF5A 2OPOA 1BG1A 1XYDA 1DJIA 2KI4B 2LLUA 1IKUA 3I5HB 2KAXA 4WRIA 2KI4C 2LUCA 1YVHA 4YI9A 3I5HC 1RJVA 4OVNF 3F45A 1OSAA 1OMVA 4C0JA 1SCMC 3QRXA 1DJWA 2FOTA 1WDCB 1F71A 2WOSA 3EK4A 1UHJA 3FS7A 1N65A 2RGIA 1GJYA 2K7OA 3BOWA 3OB1B 4F0ZB 1WDCC 2KFFA 1IGVA 2JT3A 5PALA 1RFJA 1B1GA 4GUKA 2ZRTA 2COLB 3EVUA 3OHMB 2K7DA 2F3YA 2JOJA 4YGBB 4ORCB 3BXKA 2M49B 4JPZB 1CKKA 1F8HA 4P2YB 4HSZA 2L4HA 2O5GA 1NCZA 2CTNA 2LE9B 3MSEB 4PE7A 3BOWB 1F70A 4MLWA 4M2QA 1JWDA 4NDBA 1NX1A 1QTXA 3ZNIA 1YRUB 1A4PA 2MBXA 3VRNA 3SG4A 1KFXS 2I2RE 2NCOA 3HCMA 1SW8A 2L5XB 2H61C 5CSFA 2ZN8A 1R2UA 5AXIA 2WCBA 1OE9B 3H4SE 3OX6A 1NWDA 3LK0A 1ZMZA 1BU3A 1CDMA 1AP4A 5DKQA 1CLBA 1TCOB 1OMDA 4QJ4B 4GGFA 4A4BA 4MSPA 1CDPA 3FWBA 1SL9A 2BBMA 3EKHA 2QACA 2BCXA 1J55A 3NXAA 3WNXB 4MVFA 1OOJA 1UHNA 1DT7B 2MAZA 2KFHA 2IS9A 1MQ1A 4L9MA 5ER4X 1GQMA 1QASA 5HKZA 1OZSA 2MLEC 2JXLA 3TDIA 1BT6A 2E30A 1A75A 5HYDA 2JRFA 2Y1NA 1BOCA 4OV2A 4WQ2A 3GK1A 3BUWB 3SIBA 2M7NA 5HKWA 1W7JB 1RTP1 3ICBA 5K89A 1BJFA 3RLZA 3D0YB 3BUMB 1L2OB 1MF8B 3DVEA 4M2PA 1CMGA 1YVLA 2E6WA 1S5GY 1FI5A 2JXCA 1NX2A 2F2PA 1L2OC 2KOTA 2MA2A 2I7AA 5DKNA 3WXAA 2CNPA 3DD4A 2PSRA 1QATA 1QLKA 4JQ0D 1QX7A 5J3XA 1E8AA 2LCPA 2KFGA 1A75B 4PDZA 1B7TY 4GNKB 2KAVA 1JF0A 3TUYB 3DF0A 2L98A 1IQ5A 1UP5A 4AOMA 2FCEA 3TUYC 3NSOA 1J7RA 1RWYA 3FWCA 2A4JA 3EVVA 1R6PA 1IRJA 1NYAA 1S6CA 2KBMA 1IJ6A 4CPVA 1GGWA 5I2LA 5CPVA 2KNEA 3EKJA 4C0LA 1YUUA 1PULA 3PN7C 4WQ3A 2KI6D 1K8UA 2I18A 4GAOA 1IQ3A 1NPQA 1MHOA 3C1VA 1HQVA 4HRHA 1UHHA 4U8DA 2JNXA 2LAPA 2K2AA 3PFVA 1C07A 1WRZA 4DCKA 5I2OA 1HT9A 4XJKA
chains in the Genus database with same CATH superfamily
3AKBA 4PHNA 1BR1B 1TTXA 4ZCUA 4BY5A 1JFKA 3R1OA 1KQMB 3UNWA 1G4YR 1RK9A 3PJIA 2MHHA 1DJGA 3D77A 3B87A 2F33A 5I94A 1IIOA 1ZUZA 1KQMC 2B1UA 2JTZA 2CCMA 2HPSA 2D8NA 4YI8A 4C0KA 1TNPA 1ALWA 1M63B 3NSLA 3TS5B 1C7VA 2JULA 1MUXA 3NSIA 1YR5A 4GBAA 3R1VA 2Q4UA 2M97A 1A03A 3TS5C 1LINA 4XJKB 3A8RA 3OBVA 1K94A 1SCVA 1YX8A 1JC2A 2WNDA 3UO9A 1JUOA 1SCMB 1Y0VH 2PQLA 3CR5X 4MN0A 3OB2B 2NZ0A 3EVRA 1Y1XA 3TDUA 2LMUA 2M8UA 4YGDB 2MRDA 4I5NB 2ZNEA 2BCBA 1CB1A 1SYMA 2F3ZA 4OCIA 3CWGA 2JQ6A 3BQ3A 5ER5A 1SSEB 1YUTA 3BJHA 1S5GZ 1QV0A 1UHIA 2KI6C 3O4XA 4PT1A 3TZ1A 3EK7A 2WC8A 2H61A 2Y5IA 3IQQA 4ORBB 3SG6A 2JTTA 3O78A 5FYXA 1F4QA 1WRLA 1J1EA 3N7HA 1TN4A 4FQTA 1OW4A 1QVIZ 3Q8IA 1N0YA 3FE6A 3DVJA 1Z4HA 1JSAA 4ETOA 2LHLA 1XK4C 4NQGA 1AK8A 2JWWA 4MZJA 1B9AA 2BE4A 2O60A 5JJGA 2LVJA 1AVSA 3CLNA 1NX0A 1BODA 1DJHA 1NCXA 2K0JA 1A29A 2KAYA 1FW4A 3CYZA 1F4OA 1K9KA 1TCFA 1YURA 2PRUA 4JWQA 2CXJA 1Z2CB 2EHBA 2YGUA 2CT9A 2L2EA 1WRKA 1C3ZA 3S0EA 3SJSA 2M1KB 2FJYA 1DF0A 2ZRSA 1GGZA 1LKJA 1SKTA 3I5GB 1TNXA 2LP2A 3NHIA 1K9PA 4JD9A 5D69A 1Y1AA 2LANA 1NCYA 4N5XA 1MXLC 4KYNA 2KDHA 3I5GC 1AUIB 1AHRA 4HREE 4MRXA 3D0YA 3B7AA 3VRPA 1QLSA 2QDIA 3I5FC 1DGUA 2K2FA 1JF2A 4QJ3B 2K60A 2M29A 1K93D 2GTEA 1QX5B 3WHUB 1YX7A 3SG5A 5D7FA 3VGOA 1AJ5A 4MZKA 5AANA 4FTGA 1DF0B 3IF7A 4I5LB 4FQOA 2G2BA 2WORA 1UURA 5G08A 1DMOA 1CM1A 1IWQA 1DGVA 1XVJA 1WLMA 2BL0C 3CABA 2HETA 3BUNB 4AQIA 2LLTA 1ZFSA 1BLQA 3SS5A 2ISDA 1J7PA 2MJWB 3CGAA 1F55A 5D3OA 2KYCA 3VB1A 2AMIA 2WCKA 3M0WA 1OQPA 1BMOA 2LVKA 3PSRA 1TNQA 2L51A 2KHNA 2WCMA 2L50A 3SIAA 3KEVA 1KSMA 2LMVA 3FIAA 1H4BA 3CTNA 3E3RA 1W7IB 3GK4X 3PM8A 1SY9A 1U5IA 3AAJA 1YTZC 3LCPC 4YGCB 1LXFC 2L2CA 4OKHA 4GPLB 1PVAA 1SPYA 2F2OA 1FF1A 4PE1A 4Q04A 2K61A 1CDLA 1M39A 1S3PA 3A4UB 2M1UA 4I5KA 1OOFA 4OR9B 3VROA 3RZSA 3PN7B 3S0FA 5IBWA 1U5IB 2LMTA 1CFCA 2Q91A 1FBVA 1B8LA 1K95A 4DS7A 4JKTA 1LA0A 1OMRA 2AUCA 4GFTA 1SL8A 3BFHA 3GOFA 3K1EA 5FI6A 2KLEA 3D73A 1K2HA 2LC5A 1JBAA 1MXEA 4GGNA 2BKIB 3FE9A 2VRGA 5KSZA 1T14A 1M45A 1CFDA 1VRKA 1GM0A 1H8BA 1KK8B 4BY4A 2GGZA 1NSHA 3LL8B 1C3YA 4NDDA 1TIZA 1KK8C 1SRAA 1K90D 1XO5A 3IQOA 2K7BA 3O6BA 2PMYA 4DIRA 1Y6WA 4PALA 2GV5A 2TN4A 3RM1A 1CTRA 4PE4A 3PLFB 3AKAA 1FPWA 4ZCVA 2KYFA 2WC6A 1CFPA 2QEVA 2LM5A 1F54A 2LP3A 4UPGA 1UWOA 1SNLA 1XK4A 3ZWHA 5I2QA 4USLA 1BR4B 1M46A 1M31A 3OGNA 2WCJA 1DC1A 2BECA 1KSOA 4MRYA 1B8RA 3SG3A 5F6TA 2KGBC 2WCHA 1EL4A 2EGDA 5TNCA 4F7FA 5HLOA 3SG2A 1CNPA 3LK1A 3CZTX 1OZOA 1PK0D 1S36A 2KGRA 4MEWA 5AFPA 2L0PA 2EC6B 1B7TZ 3DXLA 1KCYA 2BE6A 3PATA 1OOIX 4YBHB 2LVVA 3DYEA 3R72A 2EC6C 1DJXA 5I8NA 1K96A 3SS3A 1LVCD 1XFUO 3KO0A 2V53A 3CR2A 3BUOB 3AAKA 2BKHB 1S6IA 1A2XA 1DJZA 1SMGA 1ZOTB 3CS1A 1W9ZA 2FJUB 3B86A 3BUXB 1KK7Y 4INWA 1XFVO 2I94A 1S6JA 2BNXA 2QPTA 3L4LA 2KSPA 5BPJA 2BCAA 5GQQC 3SG7A 4D1EA 1K9UA 2L5YA 5EL2A 5KTYA 1WLZA 1QIWA 2K7CA 5HKYA 1TUZA 1Y1UA 3L47A 1EXRA 2M9GA 1LS8A 1CFFA 1XFZO 1CLMA 3I5FB 5JOLA 4YRUA 1YRTB 1KFXL 1NP8A 2WCEA 5HLVA 1QX2A 1EG3A 1J7QA 4E68A 2FCDA 3CR4X 5CSIA 3VRRA 3O4YA 4IJ7A 1DJYA 1CM4A 1PALA 2AAOA 2HF5A 1B8CA 2WCFA 4A4CA 1J7OA 3D10A 2BL0B 3KPXA 1EG4A 4PHKA 4CFRA 1UHKA 2DOQA 2GGMA 4PCWA 2Y4QA 2H2KA 4TNCA 1KFUL 1XFWO 1QIVA 2R2IA 1XA5A 1QS7A 1ZACA 1N2DA 3O2PA 2JZIA 1KFUS 1UUSA 3JVTB 1V1GA 4YGEB 4NDCA 4M2OA 4MBEA 1DVIA 4CIDA 2KBIA 3DVMA 1X02A 3JVTC 4ORAB 1SL7A 1NIWA 1NX3A 1IG5A 4CFQA 5AERA 3V2LA 1AJ4A 1TUJA 2G9BA 1DTLA 5KU1A 2MLFC 3JTDB 1ORGA 3CZ0A 5DKRA 2JT0A 4GGFC 4YGAA 1OOGA 3JTDC 2JPOA 4I5JA 3GK2A 1MR8A 1S1EA 1Q80A 1TOPA 1WY9A 1ALVA 1B47A 1ODBA 2K8MB 2QEBA 1CDNA 1EH2A 1C7WA 2PALA 3NGVA 2ZFDA 3CZ2A 2NCPA 2NLNA 1JFJA 2LUXA 1QV1A 2ZKMX 2HQ8A 1PVBA 1QVIY 1XFYO 3EK8A 4PHMA 1CLLA 2M7LA 3WHTB 1TRFA 1MWNA 2SASA 2M0RA 2LNKA 2LV7A 1RROA 3TDZA 1TNWA 2QEOA 4PE0A 1D1OA 4DRWA 2F8PA 1NUBA 2OS8B 2ZNDA 1KK7Z 4DUQA 3DY9A 1QXPA 3KHEA 1IH0A 2KQYA 4N1GA 4AQJA 2OS8C 3OX5A 4P5OE 3LLEA 5CSJA 4N1FA 1FI6A 2OTGB 2LHIA 1LA3A 3OP0A 2CBLA 2L4IA 3I5IB 2P6BB 3HX4A 2OTGC 4XYNA 1KQVA 2PVBA 3I5IC 1B4CA 2JPTA 5AEQA 1PSRA 1J1DA 2HQWA 1G33A 3B88A 3DF0B 2JT8A 4HRGA 2Y1MA 4MZLA 1PRWA 3BFAA 1KWOB 3NSKA 2JNFA 3DVKA 1PSBA 1IJ5A 2KQ6A 2NXQA 2PASA 5CSNA 2JU0A 3BYAA 1KWOC 3S0BA 4ICBA 4PHJA 1RECA 1G8IA 3KF9A 2M3WA 1SBJA 4R1EA 4CLNA 1V1FA 2LLSA 2LVIA 3K21A 1QJTA 4QJ5B 3PM2A 1EJ3A 2SCPA 4OZDA 5B8IB 3VRQA 1YUSA 4IL1A 1DQEA 1SK6D 1SR6B 2BBNA 1XFXO 2H8VA 2KLDA 2ZN9A 1CMFA 1XFRA 2JC2A 1SR6C 3PALA 1L7ZA 1S26D 3D74A 1BF5A 2OPOA 1BG1A 1XYDA 1DJIA 2KI4B 2LLUA 1IKUA 3I5HB 2KAXA 4WRIA 2KI4C 2LUCA 1YVHA 4YI9A 2WCLA 3I5HC 1RJVA 4OVNF 3F45A 1OSAA 1OMVA 4C0JA 1SCMC 3D75A 3QRXA 1DJWA 3FE8A 2FOTA 1WDCB 1F71A 2WOSA 3EK4A 1UHJA 3FS7A 1N65A 2RGIA 1GJYA 2K7OA 3BOWA 3OB1B 4F0ZB 1WDCC 2KFFA 1IGVA 2JT3A 5PALA 1RFJA 3CDNA 4GUKA 2ZRTA 1B1GA 2COLB 3EVUA 3OHMB 2K7DA 2F3YA 2JOJA 4YGBB 4ORCB 3BXKA 2M49B 4JPZB 1CKKA 1F8HA 4P2YB 2P71A 4HSZA 5FI2A 2L4HA 2O5GA 1NCZA 2CTNA 2LE9B 3MSEB 4PE7A 3BOWB 1F70A 4MLWA 4M2QA 1JWDA 4NDBA 1NX1A 1QTXA 3ZNIA 1YRUB 1A4PA 2MBXA 3VRNA 3SG4A 1KFXS 2I2RE 2NCOA 3HCMA 1SW8A 3R1PA 3S0AA 2L5XB 5FI7A 1TWOA 2H61C 2ZN8A 5CSFA 1R2UA 5AXIA 2WCBA 1OE9B 3H4SE 3OX6A 1NWDA 3LK0A 1ZMZA 1BU3A 1CDMA 1AP4A 5DKQA 1CLBA 1TCOB 1OMDA 4QJ4B 4GGFA 4A4BA 4MSPA 1OOHA 1CDPA 3FWBA 1SL9A 2BBMA 3EKHA 2QACA 2BCXA 1J55A 3NXAA 3WNXB 4MVFA 1OOJA 1UHNA 1DT7B 2MAZA 2KFHA 2IS9A 1MQ1A 4L9MA 5ER4X 1GQMA 1QASA 5HKZA 1OZSA 2WC5A 2MLEC 2JXLA 3TDIA 2P70A 1BT6A 2E30A 1A75A 5HYDA 2JRFA 2Y1NA 1BOCA 4OV2A 4WQ2A 2BAPA 3GK1A 3BUWB 4INXA 2M7NA 3SIBA 3D76A 1W7JB 1RTP1 3ICBA 5HKWA 5K89A 3SS4A 1BJFA 3RLZA 3D0YB 2ERBA 3BUMB 1L2OB 1MF8B 3DVEA 4M2PA 1CMGA 1YVLA 2E6WA 1S5GY 1DEKA 2JXCA 1NX2A 1FI5A 2PYQA 2F2PA 1L2OC 2KOTA 3BFBA 2MA2A 2I7AA 5DKNA 3WXAA 2CNPA 3DD4A 2PSRA 3S0GA 1QATA 1QLKA 4JQ0D 1QX7A 5J3XA 1E8AA 2LCPA 3QMEA 2KFGA 1A75B 4PDZA 5HL1A 5DICA 1B7TY 4GNKB 2KAVA 1JF0A 3B6XA 3TUYB 3DF0A 3L4AA 3CZ1A 2L98A 1IQ5A 1P28A 1UP5A 4AOMA 2FCEA 3EG5B 3TUYC 3IVTA 3NHTA 3NSOA 1J7RA 1RWYA 3DZTA 3FWCA 2A4JA 3EVVA 1R6PA 3D78A 1IRJA 1NYAA 1QWVA 1DELA 1S6CA 2KBMA 1IJ6A 2QEHA 4CPVA 1GGWA 5I2LA 5CPVA 2KNEA 3EKJA 4C0LA 1YUUA 3S0DA 1PULA 3PN7C 4WQ3A 2KI6D 1K8UA 2KPHA 2I18A 4GAOA 1IQ3A 1NPQA 1MHOA 3C1VA 1HQVA 4HRHA 1UHHA 4U8DA 2JNXA 2LAPA 2K2AA 3PFVA 1C07A 1WRZA 4DCKA 5I2OA 1HT9A 4XJKA
chains in the Genus database with same CATH topology
3AKBA 4PHNA 1BR1B 1TTXA 4ZCUA 4BY5A 1JFKA 1KQMB 1G4YR 1RK9A 2MHHA 1DJGA 2F33A 1ZUZA 1KQMC 2B1UA 2JTZA 2CCMA 2HPSA 2D8NA 4YI8A 4C0KA 1TNPA 1ALWA 1M63B 3NSLA 3TS5B 1C7VA 2JULA 1MUXA 3NSIA 1YR5A 4GBAA 2Q4UA 2M97A 1A03A 3TS5C 1LINA 4XJKB 3A8RA 1K94A 1SCVA 1YX8A 1JC2A 2WNDA 1JUOA 1SCMB 1Y0VH 4MN0A 3CR5X 3OB2B 2NZ0A 3EVRA 1Y1XA 3TDUA 2LMUA 2M8UA 4YGDB 2MRDA 4I5NB 2ZNEA 2BCBA 1CB1A 1SYMA 2F3ZA 4OCIA 3CWGA 2JQ6A 3BQ3A 5ER5A 1YUTA 1F54A 1S5GZ 1QV0A 1UHIA 2KI6C 3TZ1A 3EK7A 2WC8A 2H61A 2Y5IA 3IQQA 4ORBB 3SG6A 2JTTA 3O78A 5FYXA 1F4QA 1WRLA 1J1EA 1TN4A 1QVIZ 1N0YA 3DVJA 1JSAA 4ETOA 2LHLA 1XK4C 4NQGA 1AK8A 2JWWA 4MZJA 1B9AA 2BE4A 2O60A 5JJGA 2LVJA 1AVSA 3CLNA 1NX0A 1BODA 1DJHA 1NCXA 2K0JA 1A29A 2KAYA 1FW4A 1F4OA 1K9KA 1TCFA 1YURA 2PRUA 4JWQA 2CXJA 2EHBA 2CT9A 2L2EA 1WRKA 3SJSA 2M1KB 1DF0A 2ZRSA 1GGZA 1LKJA 1SKTA 3I5GB 1TNXA 2LP2A 5D69A 1K9PA 1Y1AA 2LANA 1NCYA 4N5XA 1MXLC 2KDHA 3I5GC 1AUIB 1AHRA 4HREE 4MRXA 3D0YA 3VRPA 1QLSA 3I5FC 1DGUA 2K2FA 1JF2A 4QJ3B 2M29A 1K93D 1QX5B 3WHUB 1YX7A 3SG5A 5D7FA 3VGOA 1AJ5A 4MZKA 5AANA 4FTGA 1DF0B 3IF7A 4I5LB 4FQOA 2G2BA 2WORA 1UURA 5G08A 1DMOA 1CM1A 1IWQA 1DGVA 1XVJA 1WLMA 2BL0C 2HETA 3BUNB 4AQIA 2LLTA 1ZFSA 1BLQA 2ISDA 1J7PA 2MJWB 3CGAA 1F55A 2KYCA 2AMIA 3M0WA 1OQPA 1BMOA 2LVKA 3PSRA 1TNQA 2L51A 2KHNA 3SIAA 2L50A 3KEVA 1KSMA 2LMVA 3FIAA 1H4BA 3CTNA 3E3RA 1W7IB 3GK4X 3PM8A 1SY9A 1U5IA 3AAJA 1YTZC 3LCPC 4YGCB 1LXFC 4OKHA 4GPLB 1PVAA 1SPYA 2F2OA 1FF1A 4PE1A 4Q04A 2K61A 1CDLA 1M39A 1S3PA 3A4UB 2M1UA 4I5KA 4OR9B 3VROA 3PN7B 5IBWA 1U5IB 2LMTA 1CFCA 2Q91A 1FBVA 1B8LA 1K95A 4DS7A 1LA0A 1OMRA 2AUCA 4GFTA 1SL8A 3GOFA 1K2HA 2LC5A 1JBAA 1MXEA 4GGNA 2BKIB 2VRGA 5KSZA 1M45A 1CFDA 1VRKA 1H8BA 1KK8B 4BY4A 2GGZA 1NSHA 3LL8B 4NDDA 1TIZA 1KK8C 1SRAA 1K90D 1XO5A 3IQOA 2K7BA 3O6BA 2PMYA 4DIRA 1Y6WA 4PALA 2GV5A 2TN4A 3RM1A 1CTRA 4PE4A 3PLFB 3AKAA 1FPWA 4ZCVA 2KYFA 1CFPA 2LM5A 2LP3A 4UPGA 1UWOA 1SNLA 1XK4A 3ZWHA 5I2QA 4USLA 1BR4B 1M46A 1M31A 2BECA 1KSOA 4MRYA 1B8RA 3SG3A 5F6TA 2KGBC 1EL4A 2EGDA 5TNCA 5HLOA 3SG2A 1CNPA 3LK1A 3CZTX 1OZOA 1PK0D 1S36A 2KGRA 4MEWA 5AFPA 2L0PA 2EC6B 1B7TZ 1KCYA 2BE6A 3PATA 4YBHB 2LVVA 5I8NA 2EC6C 1DJXA 1K96A 1LVCD 1XFUO 3KO0A 2V53A 3CR2A 3BUOB 3AAKA 2BKHB 1S6IA 1A2XA 1DJZA 1SMGA 1ZOTB 3CS1A 2FJUB 3BUXB 1KK7Y 1XFVO 2I94A 1S6JA 2QPTA 2KSPA 5BPJA 2BCAA 5GQQC 3SG7A 4D1EA 1K9UA 5KTYA 1WLZA 1QIWA 2K7CA 5HKYA 1Y1UA 1EXRA 2M9GA 1CFFA 1XFZO 1CLMA 3I5FB 5JOLA 4YRUA 1YRTB 1KFXL 1NP8A 2WCEA 5HLVA 1QX2A 1EG3A 1J7QA 4E68A 2FCDA 3CR4X 5CSIA 3VRRA 3O4YA 1DJYA 1CM4A 1PALA 2AAOA 2HF5A 1B8CA 2WCFA 4A4CA 1J7OA 3D10A 2BL0B 3KPXA 1EG4A 4PHKA 4CFRA 1UHKA 2DOQA 2GGMA 4PCWA 2Y4QA 2H2KA 4TNCA 1KFUL 1XFWO 1QIVA 2R2IA 1XA5A 1QS7A 1ZACA 1N2DA 3O2PA 2JZIA 1KFUS 1UUSA 3JVTB 1V1GA 4YGEB 4NDCA 4M2OA 4MBEA 1DVIA 4CIDA 2KBIA 3DVMA 1X02A 3JVTC 4ORAB 1SL7A 1NIWA 1NX3A 1IG5A 4CFQA 5AERA 1AJ4A 2G9BA 1DTLA 5KU1A 2MLFC 3JTDB 5DKRA 2JT0A 4GGFC 4YGAA 4I5JA 3JTDC 3GK2A 1MR8A 1S1EA 1Q80A 1TOPA 1WY9A 1ALVA 1B47A 1ODBA 2K8MB 1CDNA 1EH2A 1C7WA 2PALA 2ZFDA 2NCPA 2NLNA 1JFJA 2LUXA 1QV1A 2ZKMX 2HQ8A 1PVBA 1QVIY 1XFYO 3EK8A 4PHMA 1CLLA 2M7LA 3WHTB 1TRFA 1MWNA 2SASA 2M0RA 2LNKA 2LV7A 1RROA 3TDZA 1TNWA 4PE0A 1D1OA 4DRWA 2F8PA 1NUBA 2OS8B 2ZNDA 1KK7Z 4DUQA 1QXPA 3KHEA 1IH0A 2KQYA 4N1GA 4AQJA 2OS8C 3OX5A 4P5OE 3LLEA 5CSJA 4N1FA 1FI6A 2OTGB 2LHIA 1LA3A 3OP0A 2CBLA 2L4IA 3I5IB 2P6BB 3HX4A 2OTGC 4XYNA 1KQVA 2PVBA 3I5IC 1B4CA 2JPTA 5AEQA 1PSRA 1J1DA 2HQWA 1G33A 3DF0B 4HRGA 2JT8A 2Y1MA 4MZLA 1PRWA 1KWOB 3NSKA 2JNFA 3DVKA 1PSBA 1IJ5A 2KQ6A 2NXQA 2PASA 5CSNA 2JU0A 3BYAA 1KWOC 4ICBA 4PHJA 1RECA 1G8IA 3KF9A 2M3WA 1SBJA 4R1EA 4CLNA 1V1FA 2LLSA 2LVIA 3K21A 1QJTA 4QJ5B 1EJ3A 2SCPA 5B8IB 3VRQA 1YUSA 4IL1A 1SK6D 1SR6B 2BBNA 1XFXO 2ZN9A 1CMFA 2JC2A 1SR6C 3PALA 1L7ZA 1S26D 1BF5A 2OPOA 1BG1A 1XYDA 1DJIA 2KI4B 2LLUA 1IKUA 3I5HB 2KAXA 4WRIA 2KI4C 2LUCA 1YVHA 4YI9A 3I5HC 1RJVA 4OVNF 3F45A 1OSAA 1OMVA 4C0JA 1SCMC 3QRXA 1DJWA 2FOTA 1WDCB 1F71A 2WOSA 3EK4A 1UHJA 3FS7A 1N65A 2RGIA 1GJYA 2K7OA 3BOWA 3OB1B 4F0ZB 1WDCC 2KFFA 1IGVA 2JT3A 5PALA 1RFJA 1B1GA 4GUKA 2ZRTA 2COLB 3EVUA 3OHMB 2K7DA 2F3YA 2JOJA 4YGBB 4ORCB 3BXKA 2M49B 4JPZB 1CKKA 1F8HA 4P2YB 4HSZA 2L4HA 2O5GA 1NCZA 2CTNA 2LE9B 3MSEB 4PE7A 3BOWB 1F70A 4MLWA 4M2QA 1JWDA 4NDBA 1NX1A 1QTXA 3ZNIA 1YRUB 1A4PA 2MBXA 3VRNA 3SG4A 1KFXS 2I2RE 2NCOA 3HCMA 1SW8A 2L5XB 2H61C 5CSFA 2ZN8A 1R2UA 5AXIA 2WCBA 1OE9B 3H4SE 3OX6A 1NWDA 3LK0A 1ZMZA 1BU3A 1CDMA 1AP4A 5DKQA 1CLBA 1TCOB 1OMDA 4QJ4B 4GGFA 4A4BA 4MSPA 1CDPA 3FWBA 1SL9A 2BBMA 3EKHA 2QACA 2BCXA 1J55A 3NXAA 3WNXB 4MVFA 1OOJA 1UHNA 1DT7B 2MAZA 2KFHA 2IS9A 1MQ1A 4L9MA 5ER4X 1GQMA 1QASA 5HKZA 1OZSA 2MLEC 2JXLA 3TDIA 1BT6A 2E30A 1A75A 5HYDA 2JRFA 2Y1NA 1BOCA 4OV2A 4WQ2A 3GK1A 3BUWB 3SIBA 2M7NA 5HKWA 1W7JB 1RTP1 3ICBA 5K89A 1BJFA 3RLZA 3D0YB 3BUMB 1L2OB 1MF8B 3DVEA 4M2PA 1CMGA 1YVLA 2E6WA 1S5GY 1FI5A 2JXCA 1NX2A 2F2PA 1L2OC 2KOTA 2MA2A 2I7AA 5DKNA 3WXAA 2CNPA 3DD4A 2PSRA 1QATA 1QLKA 4JQ0D 1QX7A 5J3XA 1E8AA 2LCPA 2KFGA 1A75B 4PDZA 1B7TY 4GNKB 2KAVA 1JF0A 3TUYB 3DF0A 2L98A 1IQ5A 1UP5A 4AOMA 2FCEA 3TUYC 3NSOA 1J7RA 1RWYA 3FWCA 2A4JA 3EVVA 1R6PA 1IRJA 1NYAA 1S6CA 2KBMA 1IJ6A 4CPVA 1GGWA 5I2LA 5CPVA 2KNEA 3EKJA 4C0LA 1YUUA 1PULA 3PN7C 4WQ3A 2KI6D 1K8UA 2I18A 4GAOA 1IQ3A 1NPQA 1MHOA 3C1VA 1HQVA 4HRHA 1UHHA 4U8DA 2JNXA 2LAPA 2K2AA 3PFVA 1C07A 1WRZA 4DCKA 5I2OA 1HT9A 4XJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKB A;  4PHN A;  1BR1 B;  1TTX A;  4ZCU A;  4BY5 A;  1JFK A;  1KQM B;  1G4Y R;  1RK9 A;  2MHH A;  1DJG A;  2F33 A;  1ZUZ A;  1KQM C;  2B1U A;  2JTZ A;  2CCM A;  2HPS A;  2D8N A;  4YI8 A;  4C0K A;  1TNP A;  1ALW A;  1M63 B;  3NSL A;  3TS5 B;  1C7V A;  2JUL A;  1MUX A;  3NSI A;  1YR5 A;  4GBA A;  2Q4U A;  2M97 A;  1A03 A;  3TS5 C;  1LIN A;  4XJK B;  3A8R A;  1K94 A;  1SCV A;  1YX8 A;  1JC2 A;  2WND A;  1JUO A;  1SCM B;  1Y0V H;  4MN0 A;  3CR5 X;  3OB2 B;  2NZ0 A;  3EVR A;  1Y1X A;  3TDU A;  2LMU A;  2M8U A;  4YGD B;  2MRD A;  4I5N B;  2ZNE A;  2BCB A;  1CB1 A;  1SYM A;  2F3Z A;  4OCI A;  3CWG A;  2JQ6 A;  3BQ3 A;  5ER5 A;  1YUT A;  1F54 A;  1S5G Z;  1QV0 A;  1UHI A;  2KI6 C;  3TZ1 A;  3EK7 A;  2WC8 A;  2H61 A;  2Y5I A;  3IQQ A;  4ORB B;  3SG6 A;  2JTT A;  3O78 A;  5FYX A;  1F4Q A;  1WRL A;  1J1E A;  1TN4 A;  1QVI Z;  1N0Y A;  3DVJ A;  1JSA A;  4ETO A;  2LHL A;  1XK4 C;  4NQG A;  1AK8 A;  2JWW A;  4MZJ A;  1B9A A;  2BE4 A;  2O60 A;  5JJG A;  2LVJ A;  1AVS A;  3CLN A;  1NX0 A;  1BOD A;  1DJH A;  1NCX A;  2K0J A;  1A29 A;  2KAY A;  1FW4 A;  1F4O A;  1K9K A;  1TCF A;  1YUR A;  2PRU A;  4JWQ A;  2CXJ A;  2EHB A;  2CT9 A;  2L2E A;  1WRK A;  3SJS A;  2M1K B;  1DF0 A;  2ZRS A;  1GGZ A;  1LKJ A;  1SKT A;  3I5G B;  1TNX A;  2LP2 A;  5D69 A;  1K9P A;  1Y1A A;  2LAN A;  1NCY A;  4N5X A;  1MXL C;  2KDH A;  3I5G C;  1AUI B;  1AHR A;  4HRE E;  4MRX A;  3D0Y A;  3VRP A;  1QLS A;  3I5F C;  1DGU A;  2K2F A;  1JF2 A;  4QJ3 B;  2M29 A;  1K93 D;  1QX5 B;  3WHU B;  1YX7 A;  3SG5 A;  5D7F A;  3VGO A;  1AJ5 A;  4MZK A;  5AAN A;  4FTG A;  1DF0 B;  3IF7 A;  4I5L B;  4FQO A;  2G2B A;  2WOR A;  1UUR A;  5G08 A;  1DMO A;  1CM1 A;  1IWQ A;  1DGV A;  1XVJ A;  1WLM A;  2BL0 C;  2HET A;  3BUN B;  4AQI A;  2LLT A;  1ZFS A;  1BLQ A;  2ISD A;  1J7P A;  2MJW B;  3CGA A;  1F55 A;  2KYC A;  2AMI A;  3M0W A;  1OQP A;  1BMO A;  2LVK A;  3PSR A;  1TNQ A;  2L51 A;  2KHN A;  3SIA A;  2L50 A;  3KEV A;  1KSM A;  2LMV A;  3FIA A;  1H4B A;  3CTN A;  3E3R A;  1W7I B;  3GK4 X;  3PM8 A;  1SY9 A;  1U5I A;  3AAJ A;  1YTZ C;  3LCP C;  4YGC B;  1LXF C;  4OKH A;  4GPL B;  1PVA A;  1SPY A;  2F2O A;  1FF1 A;  4PE1 A;  4Q04 A;  2K61 A;  1CDL A;  1M39 A;  1S3P A;  3A4U B;  2M1U A;  4I5K A;  4OR9 B;  3VRO A;  3PN7 B;  5IBW A;  1U5I B;  2LMT A;  1CFC A;  2Q91 A;  1FBV A;  1B8L A;  1K95 A;  4DS7 A;  1LA0 A;  1OMR A;  2AUC A;  4GFT A;  1SL8 A;  3GOF A;  1K2H A;  2LC5 A;  1JBA A;  1MXE A;  4GGN A;  2BKI B;  2VRG A;  5KSZ A;  1M45 A;  1CFD A;  1VRK A;  1H8B A;  1KK8 B;  4BY4 A;  2GGZ A;  1NSH A;  3LL8 B;  4NDD A;  1TIZ A;  1KK8 C;  1SRA A;  1K90 D;  1XO5 A;  3IQO A;  2K7B A;  3O6B A;  2PMY A;  4DIR A;  1Y6W A;  4PAL A;  2GV5 A;  2TN4 A;  3RM1 A;  1CTR A;  4PE4 A;  3PLF B;  3AKA A;  1FPW A;  4ZCV A;  2KYF A;  1CFP A;  2LM5 A;  2LP3 A;  4UPG A;  1UWO A;  1SNL A;  1XK4 A;  3ZWH A;  5I2Q A;  4USL A;  1BR4 B;  1M46 A;  1M31 A;  2BEC A;  1KSO A;  4MRY A;  1B8R A;  3SG3 A;  5F6T A;  2KGB C;  1EL4 A;  2EGD A;  5TNC A;  5HLO A;  3SG2 A;  1CNP A;  3LK1 A;  3CZT X;  1OZO A;  1PK0 D;  1S36 A;  2KGR A;  4MEW A;  5AFP A;  2L0P A;  2EC6 B;  1B7T Z;  1KCY A;  2BE6 A;  3PAT A;  4YBH B;  2LVV A;  5I8N A;  2EC6 C;  1DJX A;  1K96 A;  1LVC D;  1XFU O;  3KO0 A;  2V53 A;  3CR2 A;  3BUO B;  3AAK A;  2BKH B;  1S6I A;  1A2X A;  1DJZ A;  1SMG A;  1ZOT B;  3CS1 A;  2FJU B;  3BUX B;  1KK7 Y;  1XFV O;  2I94 A;  1S6J A;  2QPT A;  2KSP A;  5BPJ A;  2BCA A;  5GQQ C;  3SG7 A;  4D1E A;  1K9U A;  5KTY A;  1WLZ A;  1QIW A;  2K7C A;  5HKY A;  1Y1U A;  1EXR A;  2M9G A;  1CFF A;  1XFZ O;  1CLM A;  3I5F B;  5JOL A;  4YRU A;  1YRT B;  1KFX L;  1NP8 A;  2WCE A;  5HLV A;  1QX2 A;  1EG3 A;  1J7Q A;  4E68 A;  2FCD A;  3CR4 X;  5CSI A;  3VRR A;  3O4Y A;  1DJY A;  1CM4 A;  1PAL A;  2AAO A;  2HF5 A;  1B8C A;  2WCF A;  4A4C A;  1J7O A;  3D10 A;  2BL0 B;  3KPX A;  1EG4 A;  4PHK A;  4CFR A;  1UHK A;  2DOQ A;  2GGM A;  4PCW A;  2Y4Q A;  2H2K A;  4TNC A;  1KFU L;  1XFW O;  1QIV A;  2R2I A;  1XA5 A;  1QS7 A;  1ZAC A;  1N2D A;  3O2P A;  2JZI A;  1KFU S;  1UUS A;  3JVT B;  1V1G A;  4YGE B;  4NDC A;  4M2O A;  4MBE A;  1DVI A;  4CID A;  2KBI A;  3DVM A;  1X02 A;  3JVT C;  4ORA B;  1SL7 A;  1NIW A;  1NX3 A;  1IG5 A;  4CFQ A;  5AER A;  1AJ4 A;  2G9B A;  1DTL A;  5KU1 A;  2MLF C;  3JTD B;  5DKR A;  2JT0 A;  4GGF C;  4YGA A;  4I5J A;  3JTD C;  3GK2 A;  1MR8 A;  1S1E A;  1Q80 A;  1TOP A;  1WY9 A;  1ALV A;  1B47 A;  1ODB A;  2K8M B;  1CDN A;  1EH2 A;  1C7W A;  2PAL A;  2ZFD A;  2NCP A;  2NLN A;  1JFJ A;  2LUX A;  1QV1 A;  2ZKM X;  2HQ8 A;  1PVB A;  1QVI Y;  1XFY O;  3EK8 A;  4PHM A;  1CLL A;  2M7L A;  3WHT B;  1TRF A;  1MWN A;  2SAS A;  2M0R A;  2LNK A;  2LV7 A;  1RRO A;  3TDZ A;  1TNW A;  4PE0 A;  1D1O A;  4DRW A;  2F8P A;  1NUB A;  2OS8 B;  2ZND A;  1KK7 Z;  4DUQ A;  1QXP A;  3KHE A;  1IH0 A;  2KQY A;  4N1G A;  4AQJ A;  2OS8 C;  3OX5 A;  4P5O E;  3LLE A;  5CSJ A;  4N1F A;  1FI6 A;  2OTG B;  2LHI A;  1LA3 A;  3OP0 A;  2CBL A;  2L4I A;  3I5I B;  2P6B B;  3HX4 A;  2OTG C;  4XYN A;  1KQV A;  2PVB A;  3I5I C;  1B4C A;  2JPT A;  5AEQ A;  1PSR A;  1J1D A;  2HQW A;  1G33 A;  3DF0 B;  4HRG A;  2JT8 A;  2Y1M A;  4MZL A;  1PRW A;  1KWO B;  3NSK A;  2JNF A;  3DVK A;  1PSB A;  1IJ5 A;  2KQ6 A;  2NXQ A;  2PAS A;  5CSN A;  2JU0 A;  3BYA A;  1KWO C;  4ICB A;  4PHJ A;  1REC A;  1G8I A;  3KF9 A;  2M3W A;  1SBJ A;  4R1E A;  4CLN A;  1V1F A;  2LLS A;  2LVI A;  3K21 A;  1QJT A;  4QJ5 B;  1EJ3 A;  2SCP A;  5B8I B;  3VRQ A;  1YUS A;  4IL1 A;  1SK6 D;  1SR6 B;  2BBN A;  1XFX O;  2ZN9 A;  1CMF A;  2JC2 A;  1SR6 C;  3PAL A;  1L7Z A;  1S26 D;  1BF5 A;  2OPO A;  1BG1 A;  1XYD A;  1DJI A;  2KI4 B;  2LLU A;  1IKU A;  3I5H B;  2KAX A;  4WRI A;  2KI4 C;  2LUC A;  1YVH A;  4YI9 A;  3I5H C;  1RJV A;  4OVN F;  3F45 A;  1OSA A;  1OMV A;  4C0J A;  1SCM C;  3QRX A;  1DJW A;  2FOT A;  1WDC B;  1F71 A;  2WOS A;  3EK4 A;  1UHJ A;  3FS7 A;  1N65 A;  2RGI A;  1GJY A;  2K7O A;  3BOW A;  3OB1 B;  4F0Z B;  1WDC C;  2KFF A;  1IGV A;  2JT3 A;  5PAL A;  1RFJ A;  1B1G A;  4GUK A;  2ZRT A;  2COL B;  3EVU A;  3OHM B;  2K7D A;  2F3Y A;  2JOJ A;  4YGB B;  4ORC B;  3BXK A;  2M49 B;  4JPZ B;  1CKK A;  1F8H A;  4P2Y B;  4HSZ A;  2L4H A;  2O5G A;  1NCZ A;  2CTN A;  2LE9 B;  3MSE B;  4PE7 A;  3BOW B;  1F70 A;  4MLW A;  4M2Q A;  1JWD A;  4NDB A;  1NX1 A;  1QTX A;  3ZNI A;  1YRU B;  1A4P A;  2MBX A;  3VRN A;  3SG4 A;  1KFX S;  2I2R E;  2NCO A;  3HCM A;  1SW8 A;  2L5X B;  2H61 C;  5CSF A;  2ZN8 A;  1R2U A;  5AXI A;  2WCB A;  1OE9 B;  3H4S E;  3OX6 A;  1NWD A;  3LK0 A;  1ZMZ A;  1BU3 A;  1CDM A;  1AP4 A;  5DKQ A;  1CLB A;  1TCO B;  1OMD A;  4QJ4 B;  4GGF A;  4A4B A;  4MSP A;  1CDP A;  3FWB A;  1SL9 A;  2BBM A;  3EKH A;  2QAC A;  2BCX A;  1J55 A;  3NXA A;  3WNX B;  4MVF A;  1OOJ A;  1UHN A;  1DT7 B;  2MAZ A;  2KFH A;  2IS9 A;  1MQ1 A;  4L9M A;  5ER4 X;  1GQM A;  1QAS A;  5HKZ A;  1OZS A;  2MLE C;  2JXL A;  3TDI A;  1BT6 A;  2E30 A;  1A75 A;  5HYD A;  2JRF A;  2Y1N A;  1BOC A;  4OV2 A;  4WQ2 A;  3GK1 A;  3BUW B;  3SIB A;  2M7N A;  5HKW A;  1W7J B;  1RTP 1;  3ICB A;  5K89 A;  1BJF A;  3RLZ A;  3D0Y B;  3BUM B;  1L2O B;  1MF8 B;  3DVE A;  4M2P A;  1CMG A;  1YVL A;  2E6W A;  1S5G Y;  1FI5 A;  2JXC A;  1NX2 A;  2F2P A;  1L2O C;  2KOT A;  2MA2 A;  2I7A A;  5DKN A;  3WXA A;  2CNP A;  3DD4 A;  2PSR A;  1QAT A;  1QLK A;  4JQ0 D;  1QX7 A;  5J3X A;  1E8A A;  2LCP A;  2KFG A;  1A75 B;  4PDZ A;  1B7T Y;  4GNK B;  2KAV A;  1JF0 A;  3TUY B;  3DF0 A;  2L98 A;  1IQ5 A;  1UP5 A;  4AOM A;  2FCE A;  3TUY C;  3NSO A;  1J7R A;  1RWY A;  3FWC A;  2A4J A;  3EVV A;  1R6P A;  1IRJ A;  1NYA A;  1S6C A;  2KBM A;  1IJ6 A;  4CPV A;  1GGW A;  5I2L A;  5CPV A;  2KNE A;  3EKJ A;  4C0L A;  1YUU A;  1PUL A;  3PN7 C;  4WQ3 A;  2KI6 D;  1K8U A;  2I18 A;  4GAO A;  1IQ3 A;  1NPQ A;  1MHO A;  3C1V A;  1HQV A;  4HRH A;  1UHH A;  4U8D A;  2JNX A;  2LAP A;  2K2A A;  3PFV A;  1C07 A;  1WRZ A;  4DCK A;  5I2O A;  1HT9 A;  4XJK A; 
#chains in the Genus database with same CATH topology
 3AKB A;  4PHN A;  1BR1 B;  1TTX A;  4ZCU A;  4BY5 A;  1JFK A;  3R1O A;  1KQM B;  3UNW A;  1G4Y R;  1RK9 A;  3PJI A;  2MHH A;  1DJG A;  3D77 A;  3B87 A;  2F33 A;  5I94 A;  1IIO A;  1ZUZ A;  1KQM C;  2B1U A;  2JTZ A;  2CCM A;  2HPS A;  2D8N A;  4YI8 A;  4C0K A;  1TNP A;  1ALW A;  1M63 B;  3NSL A;  3TS5 B;  1C7V A;  2JUL A;  1MUX A;  3NSI A;  1YR5 A;  4GBA A;  3R1V A;  2Q4U A;  2M97 A;  1A03 A;  3TS5 C;  1LIN A;  4XJK B;  3A8R A;  3OBV A;  1K94 A;  1SCV A;  1YX8 A;  1JC2 A;  2WND A;  3UO9 A;  1JUO A;  1SCM B;  1Y0V H;  2PQL A;  3CR5 X;  4MN0 A;  3OB2 B;  2NZ0 A;  3EVR A;  1Y1X A;  3TDU A;  2LMU A;  2M8U A;  4YGD B;  2MRD A;  4I5N B;  2ZNE A;  2BCB A;  1CB1 A;  1SYM A;  2F3Z A;  4OCI A;  3CWG A;  2JQ6 A;  3BQ3 A;  5ER5 A;  1SSE B;  1YUT A;  3BJH A;  1S5G Z;  1QV0 A;  1UHI A;  2KI6 C;  3O4X A;  4PT1 A;  3TZ1 A;  3EK7 A;  2WC8 A;  2H61 A;  2Y5I A;  3IQQ A;  4ORB B;  3SG6 A;  2JTT A;  3O78 A;  5FYX A;  1F4Q A;  1WRL A;  1J1E A;  3N7H A;  1TN4 A;  4FQT A;  1OW4 A;  1QVI Z;  3Q8I A;  1N0Y A;  3FE6 A;  3DVJ A;  1Z4H A;  1JSA A;  4ETO A;  2LHL A;  1XK4 C;  4NQG A;  1AK8 A;  2JWW A;  4MZJ A;  1B9A A;  2BE4 A;  2O60 A;  5JJG A;  2LVJ A;  1AVS A;  3CLN A;  1NX0 A;  1BOD A;  1DJH A;  1NCX A;  2K0J A;  1A29 A;  2KAY A;  1FW4 A;  3CYZ A;  1F4O A;  1K9K A;  1TCF A;  1YUR A;  2PRU A;  4JWQ A;  2CXJ A;  1Z2C B;  2EHB A;  2YGU A;  2CT9 A;  2L2E A;  1WRK A;  1C3Z A;  3S0E A;  3SJS A;  2M1K B;  2FJY A;  1DF0 A;  2ZRS A;  1GGZ A;  1LKJ A;  1SKT A;  3I5G B;  1TNX A;  2LP2 A;  3NHI A;  1K9P A;  4JD9 A;  5D69 A;  1Y1A A;  2LAN A;  1NCY A;  4N5X A;  1MXL C;  4KYN A;  2KDH A;  3I5G C;  1AUI B;  1AHR A;  4HRE E;  4MRX A;  3D0Y A;  3B7A A;  3VRP A;  1QLS A;  2QDI A;  3I5F C;  1DGU A;  2K2F A;  1JF2 A;  4QJ3 B;  2K60 A;  2M29 A;  1K93 D;  2GTE A;  1QX5 B;  3WHU B;  1YX7 A;  3SG5 A;  5D7F A;  3VGO A;  1AJ5 A;  4MZK A;  5AAN A;  4FTG A;  1DF0 B;  3IF7 A;  4I5L B;  4FQO A;  2G2B A;  2WOR A;  1UUR A;  5G08 A;  1DMO A;  1CM1 A;  1IWQ A;  1DGV A;  1XVJ A;  1WLM A;  2BL0 C;  3CAB A;  2HET A;  3BUN B;  4AQI A;  2LLT A;  1ZFS A;  1BLQ A;  3SS5 A;  2ISD A;  1J7P A;  2MJW B;  3CGA A;  1F55 A;  5D3O A;  2KYC A;  3VB1 A;  2AMI A;  2WCK A;  3M0W A;  1OQP A;  1BMO A;  2LVK A;  3PSR A;  1TNQ A;  2L51 A;  2KHN A;  2WCM A;  2L50 A;  3SIA A;  3KEV A;  1KSM A;  2LMV A;  3FIA A;  1H4B A;  3CTN A;  3E3R A;  1W7I B;  3GK4 X;  3PM8 A;  1SY9 A;  1U5I A;  3AAJ A;  1YTZ C;  3LCP C;  4YGC B;  1LXF C;  2L2C A;  4OKH A;  4GPL B;  1PVA A;  1SPY A;  2F2O A;  1FF1 A;  4PE1 A;  4Q04 A;  2K61 A;  1CDL A;  1M39 A;  1S3P A;  3A4U B;  2M1U A;  4I5K A;  1OOF A;  4OR9 B;  3VRO A;  3RZS A;  3PN7 B;  3S0F A;  5IBW A;  1U5I B;  2LMT A;  1CFC A;  2Q91 A;  1FBV A;  1B8L A;  1K95 A;  4DS7 A;  4JKT A;  1LA0 A;  1OMR A;  2AUC A;  4GFT A;  1SL8 A;  3BFH A;  3GOF A;  3K1E A;  5FI6 A;  2KLE A;  3D73 A;  1K2H A;  2LC5 A;  1JBA A;  1MXE A;  4GGN A;  2BKI B;  3FE9 A;  2VRG A;  5KSZ A;  1T14 A;  1M45 A;  1CFD A;  1VRK A;  1GM0 A;  1H8B A;  1KK8 B;  4BY4 A;  2GGZ A;  1NSH A;  3LL8 B;  1C3Y A;  4NDD A;  1TIZ A;  1KK8 C;  1SRA A;  1K90 D;  1XO5 A;  3IQO A;  2K7B A;  3O6B A;  2PMY A;  4DIR A;  1Y6W A;  4PAL A;  2GV5 A;  2TN4 A;  3RM1 A;  1CTR A;  4PE4 A;  3PLF B;  3AKA A;  1FPW A;  4ZCV A;  2KYF A;  2WC6 A;  1CFP A;  2QEV A;  2LM5 A;  1F54 A;  2LP3 A;  4UPG A;  1UWO A;  1SNL A;  1XK4 A;  3ZWH A;  5I2Q A;  4USL A;  1BR4 B;  1M46 A;  1M31 A;  3OGN A;  2WCJ A;  1DC1 A;  2BEC A;  1KSO A;  4MRY A;  1B8R A;  3SG3 A;  5F6T A;  2KGB C;  2WCH A;  1EL4 A;  2EGD A;  5TNC A;  4F7F A;  5HLO A;  3SG2 A;  1CNP A;  3LK1 A;  3CZT X;  1OZO A;  1PK0 D;  1S36 A;  2KGR A;  4MEW A;  5AFP A;  2L0P A;  2EC6 B;  1B7T Z;  3DXL A;  1KCY A;  2BE6 A;  3PAT A;  1OOI X;  4YBH B;  2LVV A;  3DYE A;  3R72 A;  2EC6 C;  1DJX A;  5I8N A;  1K96 A;  3SS3 A;  1LVC D;  1XFU O;  3KO0 A;  2V53 A;  3CR2 A;  3BUO B;  3AAK A;  2BKH B;  1S6I A;  1A2X A;  1DJZ A;  1SMG A;  1ZOT B;  3CS1 A;  1W9Z A;  2FJU B;  3B86 A;  3BUX B;  1KK7 Y;  4INW A;  1XFV O;  2I94 A;  1S6J A;  2BNX A;  2QPT A;  3L4L A;  2KSP A;  5BPJ A;  2BCA A;  5GQQ C;  3SG7 A;  4D1E A;  1K9U A;  2L5Y A;  5EL2 A;  5KTY A;  1WLZ A;  1QIW A;  2K7C A;  5HKY A;  1TUZ A;  1Y1U A;  3L47 A;  1EXR A;  2M9G A;  1LS8 A;  1CFF A;  1XFZ O;  1CLM A;  3I5F B;  5JOL A;  4YRU A;  1YRT B;  1KFX L;  1NP8 A;  2WCE A;  5HLV A;  1QX2 A;  1EG3 A;  1J7Q A;  4E68 A;  2FCD A;  3CR4 X;  5CSI A;  3VRR A;  3O4Y A;  4IJ7 A;  1DJY A;  1CM4 A;  1PAL A;  2AAO A;  2HF5 A;  1B8C A;  2WCF A;  4A4C A;  1J7O A;  3D10 A;  2BL0 B;  3KPX A;  1EG4 A;  4PHK A;  4CFR A;  1UHK A;  2DOQ A;  2GGM A;  4PCW A;  2Y4Q A;  2H2K A;  4TNC A;  1KFU L;  1XFW O;  1QIV A;  2R2I A;  1XA5 A;  1QS7 A;  1ZAC A;  1N2D A;  3O2P A;  2JZI A;  1KFU S;  1UUS A;  3JVT B;  1V1G A;  4YGE B;  4NDC A;  4M2O A;  4MBE A;  1DVI A;  4CID A;  2KBI A;  3DVM A;  1X02 A;  3JVT C;  4ORA B;  1SL7 A;  1NIW A;  1NX3 A;  1IG5 A;  4CFQ A;  5AER A;  3V2L A;  1AJ4 A;  1TUJ A;  2G9B A;  1DTL A;  5KU1 A;  2MLF C;  3JTD B;  1ORG A;  3CZ0 A;  5DKR A;  2JT0 A;  4GGF C;  4YGA A;  1OOG A;  3JTD C;  2JPO A;  4I5J A;  3GK2 A;  1MR8 A;  1S1E A;  1Q80 A;  1TOP A;  1WY9 A;  1ALV A;  1B47 A;  1ODB A;  2K8M B;  2QEB A;  1CDN A;  1EH2 A;  1C7W A;  2PAL A;  3NGV A;  2ZFD A;  3CZ2 A;  2NCP A;  2NLN A;  1JFJ A;  2LUX A;  1QV1 A;  2ZKM X;  2HQ8 A;  1PVB A;  1QVI Y;  1XFY O;  3EK8 A;  4PHM A;  1CLL A;  2M7L A;  3WHT B;  1TRF A;  1MWN A;  2SAS A;  2M0R A;  2LNK A;  2LV7 A;  1RRO A;  3TDZ A;  1TNW A;  2QEO A;  4PE0 A;  1D1O A;  4DRW A;  2F8P A;  1NUB A;  2OS8 B;  2ZND A;  1KK7 Z;  4DUQ A;  3DY9 A;  1QXP A;  3KHE A;  1IH0 A;  2KQY A;  4N1G A;  4AQJ A;  2OS8 C;  3OX5 A;  4P5O E;  3LLE A;  5CSJ A;  4N1F A;  1FI6 A;  2OTG B;  2LHI A;  1LA3 A;  3OP0 A;  2CBL A;  2L4I A;  3I5I B;  2P6B B;  3HX4 A;  2OTG C;  4XYN A;  1KQV A;  2PVB A;  3I5I C;  1B4C A;  2JPT A;  5AEQ A;  1PSR A;  1J1D A;  2HQW A;  1G33 A;  3B88 A;  3DF0 B;  2JT8 A;  4HRG A;  2Y1M A;  4MZL A;  1PRW A;  3BFA A;  1KWO B;  3NSK A;  2JNF A;  3DVK A;  1PSB A;  1IJ5 A;  2KQ6 A;  2NXQ A;  2PAS A;  5CSN A;  2JU0 A;  3BYA A;  1KWO C;  3S0B A;  4ICB A;  4PHJ A;  1REC A;  1G8I A;  3KF9 A;  2M3W A;  1SBJ A;  4R1E A;  4CLN A;  1V1F A;  2LLS A;  2LVI A;  3K21 A;  1QJT A;  4QJ5 B;  3PM2 A;  1EJ3 A;  2SCP A;  4OZD A;  5B8I B;  3VRQ A;  1YUS A;  4IL1 A;  1DQE A;  1SK6 D;  1SR6 B;  2BBN A;  1XFX O;  2H8V A;  2KLD A;  2ZN9 A;  1CMF A;  1XFR A;  2JC2 A;  1SR6 C;  3PAL A;  1L7Z A;  1S26 D;  3D74 A;  1BF5 A;  2OPO A;  1BG1 A;  1XYD A;  1DJI A;  2KI4 B;  2LLU A;  1IKU A;  3I5H B;  2KAX A;  4WRI A;  2KI4 C;  2LUC A;  1YVH A;  4YI9 A;  2WCL A;  3I5H C;  1RJV A;  4OVN F;  3F45 A;  1OSA A;  1OMV A;  4C0J A;  1SCM C;  3D75 A;  3QRX A;  1DJW A;  3FE8 A;  2FOT A;  1WDC B;  1F71 A;  2WOS A;  3EK4 A;  1UHJ A;  3FS7 A;  1N65 A;  2RGI A;  1GJY A;  2K7O A;  3BOW A;  3OB1 B;  4F0Z B;  1WDC C;  2KFF A;  1IGV A;  2JT3 A;  5PAL A;  1RFJ A;  3CDN A;  4GUK A;  2ZRT A;  1B1G A;  2COL B;  3EVU A;  3OHM B;  2K7D A;  2F3Y A;  2JOJ A;  4YGB B;  4ORC B;  3BXK A;  2M49 B;  4JPZ B;  1CKK A;  1F8H A;  4P2Y B;  2P71 A;  4HSZ A;  5FI2 A;  2L4H A;  2O5G A;  1NCZ A;  2CTN A;  2LE9 B;  3MSE B;  4PE7 A;  3BOW B;  1F70 A;  4MLW A;  4M2Q A;  1JWD A;  4NDB A;  1NX1 A;  1QTX A;  3ZNI A;  1YRU B;  1A4P A;  2MBX A;  3VRN A;  3SG4 A;  1KFX S;  2I2R E;  2NCO A;  3HCM A;  1SW8 A;  3R1P A;  3S0A A;  2L5X B;  5FI7 A;  1TWO A;  2H61 C;  2ZN8 A;  5CSF A;  1R2U A;  5AXI A;  2WCB A;  1OE9 B;  3H4S E;  3OX6 A;  1NWD A;  3LK0 A;  1ZMZ A;  1BU3 A;  1CDM A;  1AP4 A;  5DKQ A;  1CLB A;  1TCO B;  1OMD A;  4QJ4 B;  4GGF A;  4A4B A;  4MSP A;  1OOH A;  1CDP A;  3FWB A;  1SL9 A;  2BBM A;  3EKH A;  2QAC A;  2BCX A;  1J55 A;  3NXA A;  3WNX B;  4MVF A;  1OOJ A;  1UHN A;  1DT7 B;  2MAZ A;  2KFH A;  2IS9 A;  1MQ1 A;  4L9M A;  5ER4 X;  1GQM A;  1QAS A;  5HKZ A;  1OZS A;  2WC5 A;  2MLE C;  2JXL A;  3TDI A;  2P70 A;  1BT6 A;  2E30 A;  1A75 A;  5HYD A;  2JRF A;  2Y1N A;  1BOC A;  4OV2 A;  4WQ2 A;  2BAP A;  3GK1 A;  3BUW B;  4INX A;  2M7N A;  3SIB A;  3D76 A;  1W7J B;  1RTP 1;  3ICB A;  5HKW A;  5K89 A;  3SS4 A;  1BJF A;  3RLZ A;  3D0Y B;  2ERB A;  3BUM B;  1L2O B;  1MF8 B;  3DVE A;  4M2P A;  1CMG A;  1YVL A;  2E6W A;  1S5G Y;  1DEK A;  2JXC A;  1NX2 A;  1FI5 A;  2PYQ A;  2F2P A;  1L2O C;  2KOT A;  3BFB A;  2MA2 A;  2I7A A;  5DKN A;  3WXA A;  2CNP A;  3DD4 A;  2PSR A;  3S0G A;  1QAT A;  1QLK A;  4JQ0 D;  1QX7 A;  5J3X A;  1E8A A;  2LCP A;  3QME A;  2KFG A;  1A75 B;  4PDZ A;  5HL1 A;  5DIC A;  1B7T Y;  4GNK B;  2KAV A;  1JF0 A;  3B6X A;  3TUY B;  3DF0 A;  3L4A A;  3CZ1 A;  2L98 A;  1IQ5 A;  1P28 A;  1UP5 A;  4AOM A;  2FCE A;  3EG5 B;  3TUY C;  3IVT A;  3NHT A;  3NSO A;  1J7R A;  1RWY A;  3DZT A;  3FWC A;  2A4J A;  3EVV A;  1R6P A;  3D78 A;  1IRJ A;  1NYA A;  1QWV A;  1DEL A;  1S6C A;  2KBM A;  1IJ6 A;  2QEH A;  4CPV A;  1GGW A;  5I2L A;  5CPV A;  2KNE A;  3EKJ A;  4C0L A;  1YUU A;  3S0D A;  1PUL A;  3PN7 C;  4WQ3 A;  2KI6 D;  1K8U A;  2KPH A;  2I18 A;  4GAO A;  1IQ3 A;  1NPQ A;  1MHO A;  3C1V A;  1HQV A;  4HRH A;  1UHH A;  4U8D A;  2JNX A;  2LAP A;  2K2A A;  3PFV A;  1C07 A;  1WRZ A;  4DCK A;  5I2O A;  1HT9 A;  4XJK A; 
#chains in the Genus database with same CATH homology
 3AKB A;  4PHN A;  1BR1 B;  1TTX A;  4ZCU A;  4BY5 A;  1JFK A;  1KQM B;  1G4Y R;  1RK9 A;  2MHH A;  1DJG A;  2F33 A;  1ZUZ A;  1KQM C;  2B1U A;  2JTZ A;  2CCM A;  2HPS A;  2D8N A;  4YI8 A;  4C0K A;  1TNP A;  1ALW A;  1M63 B;  3NSL A;  3TS5 B;  1C7V A;  2JUL A;  1MUX A;  3NSI A;  1YR5 A;  4GBA A;  2Q4U A;  2M97 A;  1A03 A;  3TS5 C;  1LIN A;  4XJK B;  3A8R A;  1K94 A;  1SCV A;  1YX8 A;  1JC2 A;  2WND A;  1JUO A;  1SCM B;  1Y0V H;  4MN0 A;  3CR5 X;  3OB2 B;  2NZ0 A;  3EVR A;  1Y1X A;  3TDU A;  2LMU A;  2M8U A;  4YGD B;  2MRD A;  4I5N B;  2ZNE A;  2BCB A;  1CB1 A;  1SYM A;  2F3Z A;  4OCI A;  3CWG A;  2JQ6 A;  3BQ3 A;  5ER5 A;  1YUT A;  1F54 A;  1S5G Z;  1QV0 A;  1UHI A;  2KI6 C;  3TZ1 A;  3EK7 A;  2WC8 A;  2H61 A;  2Y5I A;  3IQQ A;  4ORB B;  3SG6 A;  2JTT A;  3O78 A;  5FYX A;  1F4Q A;  1WRL A;  1J1E A;  1TN4 A;  1QVI Z;  1N0Y A;  3DVJ A;  1JSA A;  4ETO A;  2LHL A;  1XK4 C;  4NQG A;  1AK8 A;  2JWW A;  4MZJ A;  1B9A A;  2BE4 A;  2O60 A;  5JJG A;  2LVJ A;  1AVS A;  3CLN A;  1NX0 A;  1BOD A;  1DJH A;  1NCX A;  2K0J A;  1A29 A;  2KAY A;  1FW4 A;  1F4O A;  1K9K A;  1TCF A;  1YUR A;  2PRU A;  4JWQ A;  2CXJ A;  2EHB A;  2CT9 A;  2L2E A;  1WRK A;  3SJS A;  2M1K B;  1DF0 A;  2ZRS A;  1GGZ A;  1LKJ A;  1SKT A;  3I5G B;  1TNX A;  2LP2 A;  5D69 A;  1K9P A;  1Y1A A;  2LAN A;  1NCY A;  4N5X A;  1MXL C;  2KDH A;  3I5G C;  1AUI B;  1AHR A;  4HRE E;  4MRX A;  3D0Y A;  3VRP A;  1QLS A;  3I5F C;  1DGU A;  2K2F A;  1JF2 A;  4QJ3 B;  2M29 A;  1K93 D;  1QX5 B;  3WHU B;  1YX7 A;  3SG5 A;  5D7F A;  3VGO A;  1AJ5 A;  4MZK A;  5AAN A;  4FTG A;  1DF0 B;  3IF7 A;  4I5L B;  4FQO A;  2G2B A;  2WOR A;  1UUR A;  5G08 A;  1DMO A;  1CM1 A;  1IWQ A;  1DGV A;  1XVJ A;  1WLM A;  2BL0 C;  2HET A;  3BUN B;  4AQI A;  2LLT A;  1ZFS A;  1BLQ A;  2ISD A;  1J7P A;  2MJW B;  3CGA A;  1F55 A;  2KYC A;  2AMI A;  3M0W A;  1OQP A;  1BMO A;  2LVK A;  3PSR A;  1TNQ A;  2L51 A;  2KHN A;  3SIA A;  2L50 A;  3KEV A;  1KSM A;  2LMV A;  3FIA A;  1H4B A;  3CTN A;  3E3R A;  1W7I B;  3GK4 X;  3PM8 A;  1SY9 A;  1U5I A;  3AAJ A;  1YTZ C;  3LCP C;  4YGC B;  1LXF C;  4OKH A;  4GPL B;  1PVA A;  1SPY A;  2F2O A;  1FF1 A;  4PE1 A;  4Q04 A;  2K61 A;  1CDL A;  1M39 A;  1S3P A;  3A4U B;  2M1U A;  4I5K A;  4OR9 B;  3VRO A;  3PN7 B;  5IBW A;  1U5I B;  2LMT A;  1CFC A;  2Q91 A;  1FBV A;  1B8L A;  1K95 A;  4DS7 A;  1LA0 A;  1OMR A;  2AUC A;  4GFT A;  1SL8 A;  3GOF A;  1K2H A;  2LC5 A;  1JBA A;  1MXE A;  4GGN A;  2BKI B;  2VRG A;  5KSZ A;  1M45 A;  1CFD A;  1VRK A;  1H8B A;  1KK8 B;  4BY4 A;  2GGZ A;  1NSH A;  3LL8 B;  4NDD A;  1TIZ A;  1KK8 C;  1SRA A;  1K90 D;  1XO5 A;  3IQO A;  2K7B A;  3O6B A;  2PMY A;  4DIR A;  1Y6W A;  4PAL A;  2GV5 A;  2TN4 A;  3RM1 A;  1CTR A;  4PE4 A;  3PLF B;  3AKA A;  1FPW A;  4ZCV A;  2KYF A;  1CFP A;  2LM5 A;  2LP3 A;  4UPG A;  1UWO A;  1SNL A;  1XK4 A;  3ZWH A;  5I2Q A;  4USL A;  1BR4 B;  1M46 A;  1M31 A;  2BEC A;  1KSO A;  4MRY A;  1B8R A;  3SG3 A;  5F6T A;  2KGB C;  1EL4 A;  2EGD A;  5TNC A;  5HLO A;  3SG2 A;  1CNP A;  3LK1 A;  3CZT X;  1OZO A;  1PK0 D;  1S36 A;  2KGR A;  4MEW A;  5AFP A;  2L0P A;  2EC6 B;  1B7T Z;  1KCY A;  2BE6 A;  3PAT A;  4YBH B;  2LVV A;  5I8N A;  2EC6 C;  1DJX A;  1K96 A;  1LVC D;  1XFU O;  3KO0 A;  2V53 A;  3CR2 A;  3BUO B;  3AAK A;  2BKH B;  1S6I A;  1A2X A;  1DJZ A;  1SMG A;  1ZOT B;  3CS1 A;  2FJU B;  3BUX B;  1KK7 Y;  1XFV O;  2I94 A;  1S6J A;  2QPT A;  2KSP A;  5BPJ A;  2BCA A;  5GQQ C;  3SG7 A;  4D1E A;  1K9U A;  5KTY A;  1WLZ A;  1QIW A;  2K7C A;  5HKY A;  1Y1U A;  1EXR A;  2M9G A;  1CFF A;  1XFZ O;  1CLM A;  3I5F B;  5JOL A;  4YRU A;  1YRT B;  1KFX L;  1NP8 A;  2WCE A;  5HLV A;  1QX2 A;  1EG3 A;  1J7Q A;  4E68 A;  2FCD A;  3CR4 X;  5CSI A;  3VRR A;  3O4Y A;  1DJY A;  1CM4 A;  1PAL A;  2AAO A;  2HF5 A;  1B8C A;  2WCF A;  4A4C A;  1J7O A;  3D10 A;  2BL0 B;  3KPX A;  1EG4 A;  4PHK A;  4CFR A;  1UHK A;  2DOQ A;  2GGM A;  4PCW A;  2Y4Q A;  2H2K A;  4TNC A;  1KFU L;  1XFW O;  1QIV A;  2R2I A;  1XA5 A;  1QS7 A;  1ZAC A;  1N2D A;  3O2P A;  2JZI A;  1KFU S;  1UUS A;  3JVT B;  1V1G A;  4YGE B;  4NDC A;  4M2O A;  4MBE A;  1DVI A;  4CID A;  2KBI A;  3DVM A;  1X02 A;  3JVT C;  4ORA B;  1SL7 A;  1NIW A;  1NX3 A;  1IG5 A;  4CFQ A;  5AER A;  1AJ4 A;  2G9B A;  1DTL A;  5KU1 A;  2MLF C;  3JTD B;  5DKR A;  2JT0 A;  4GGF C;  4YGA A;  4I5J A;  3JTD C;  3GK2 A;  1MR8 A;  1S1E A;  1Q80 A;  1TOP A;  1WY9 A;  1ALV A;  1B47 A;  1ODB A;  2K8M B;  1CDN A;  1EH2 A;  1C7W A;  2PAL A;  2ZFD A;  2NCP A;  2NLN A;  1JFJ A;  2LUX A;  1QV1 A;  2ZKM X;  2HQ8 A;  1PVB A;  1QVI Y;  1XFY O;  3EK8 A;  4PHM A;  1CLL A;  2M7L A;  3WHT B;  1TRF A;  1MWN A;  2SAS A;  2M0R A;  2LNK A;  2LV7 A;  1RRO A;  3TDZ A;  1TNW A;  4PE0 A;  1D1O A;  4DRW A;  2F8P A;  1NUB A;  2OS8 B;  2ZND A;  1KK7 Z;  4DUQ A;  1QXP A;  3KHE A;  1IH0 A;  2KQY A;  4N1G A;  4AQJ A;  2OS8 C;  3OX5 A;  4P5O E;  3LLE A;  5CSJ A;  4N1F A;  1FI6 A;  2OTG B;  2LHI A;  1LA3 A;  3OP0 A;  2CBL A;  2L4I A;  3I5I B;  2P6B B;  3HX4 A;  2OTG C;  4XYN A;  1KQV A;  2PVB A;  3I5I C;  1B4C A;  2JPT A;  5AEQ A;  1PSR A;  1J1D A;  2HQW A;  1G33 A;  3DF0 B;  4HRG A;  2JT8 A;  2Y1M A;  4MZL A;  1PRW A;  1KWO B;  3NSK A;  2JNF A;  3DVK A;  1PSB A;  1IJ5 A;  2KQ6 A;  2NXQ A;  2PAS A;  5CSN A;  2JU0 A;  3BYA A;  1KWO C;  4ICB A;  4PHJ A;  1REC A;  1G8I A;  3KF9 A;  2M3W A;  1SBJ A;  4R1E A;  4CLN A;  1V1F A;  2LLS A;  2LVI A;  3K21 A;  1QJT A;  4QJ5 B;  1EJ3 A;  2SCP A;  5B8I B;  3VRQ A;  1YUS A;  4IL1 A;  1SK6 D;  1SR6 B;  2BBN A;  1XFX O;  2ZN9 A;  1CMF A;  2JC2 A;  1SR6 C;  3PAL A;  1L7Z A;  1S26 D;  1BF5 A;  2OPO A;  1BG1 A;  1XYD A;  1DJI A;  2KI4 B;  2LLU A;  1IKU A;  3I5H B;  2KAX A;  4WRI A;  2KI4 C;  2LUC A;  1YVH A;  4YI9 A;  3I5H C;  1RJV A;  4OVN F;  3F45 A;  1OSA A;  1OMV A;  4C0J A;  1SCM C;  3QRX A;  1DJW A;  2FOT A;  1WDC B;  1F71 A;  2WOS A;  3EK4 A;  1UHJ A;  3FS7 A;  1N65 A;  2RGI A;  1GJY A;  2K7O A;  3BOW A;  3OB1 B;  4F0Z B;  1WDC C;  2KFF A;  1IGV A;  2JT3 A;  5PAL A;  1RFJ A;  1B1G A;  4GUK A;  2ZRT A;  2COL B;  3EVU A;  3OHM B;  2K7D A;  2F3Y A;  2JOJ A;  4YGB B;  4ORC B;  3BXK A;  2M49 B;  4JPZ B;  1CKK A;  1F8H A;  4P2Y B;  4HSZ A;  2L4H A;  2O5G A;  1NCZ A;  2CTN A;  2LE9 B;  3MSE B;  4PE7 A;  3BOW B;  1F70 A;  4MLW A;  4M2Q A;  1JWD A;  4NDB A;  1NX1 A;  1QTX A;  3ZNI A;  1YRU B;  1A4P A;  2MBX A;  3VRN A;  3SG4 A;  1KFX S;  2I2R E;  2NCO A;  3HCM A;  1SW8 A;  2L5X B;  2H61 C;  5CSF A;  2ZN8 A;  1R2U A;  5AXI A;  2WCB A;  1OE9 B;  3H4S E;  3OX6 A;  1NWD A;  3LK0 A;  1ZMZ A;  1BU3 A;  1CDM A;  1AP4 A;  5DKQ A;  1CLB A;  1TCO B;  1OMD A;  4QJ4 B;  4GGF A;  4A4B A;  4MSP A;  1CDP A;  3FWB A;  1SL9 A;  2BBM A;  3EKH A;  2QAC A;  2BCX A;  1J55 A;  3NXA A;  3WNX B;  4MVF A;  1OOJ A;  1UHN A;  1DT7 B;  2MAZ A;  2KFH A;  2IS9 A;  1MQ1 A;  4L9M A;  5ER4 X;  1GQM A;  1QAS A;  5HKZ A;  1OZS A;  2MLE C;  2JXL A;  3TDI A;  1BT6 A;  2E30 A;  1A75 A;  5HYD A;  2JRF A;  2Y1N A;  1BOC A;  4OV2 A;  4WQ2 A;  3GK1 A;  3BUW B;  3SIB A;  2M7N A;  5HKW A;  1W7J B;  1RTP 1;  3ICB A;  5K89 A;  1BJF A;  3RLZ A;  3D0Y B;  3BUM B;  1L2O B;  1MF8 B;  3DVE A;  4M2P A;  1CMG A;  1YVL A;  2E6W A;  1S5G Y;  1FI5 A;  2JXC A;  1NX2 A;  2F2P A;  1L2O C;  2KOT A;  2MA2 A;  2I7A A;  5DKN A;  3WXA A;  2CNP A;  3DD4 A;  2PSR A;  1QAT A;  1QLK A;  4JQ0 D;  1QX7 A;  5J3X A;  1E8A A;  2LCP A;  2KFG A;  1A75 B;  4PDZ A;  1B7T Y;  4GNK B;  2KAV A;  1JF0 A;  3TUY B;  3DF0 A;  2L98 A;  1IQ5 A;  1UP5 A;  4AOM A;  2FCE A;  3TUY C;  3NSO A;  1J7R A;  1RWY A;  3FWC A;  2A4J A;  3EVV A;  1R6P A;  1IRJ A;  1NYA A;  1S6C A;  2KBM A;  1IJ6 A;  4CPV A;  1GGW A;  5I2L A;  5CPV A;  2KNE A;  3EKJ A;  4C0L A;  1YUU A;  1PUL A;  3PN7 C;  4WQ3 A;  2KI6 D;  1K8U A;  2I18 A;  4GAO A;  1IQ3 A;  1NPQ A;  1MHO A;  3C1V A;  1HQV A;  4HRH A;  1UHH A;  4U8D A;  2JNX A;  2LAP A;  2K2A A;  3PFV A;  1C07 A;  1WRZ A;  4DCK A;  5I2O A;  1HT9 A;  4XJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...