1F71A

Refined solution structure of calmodulin c-terminal domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALMODULIN
publication title Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transport protein
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f71A00
1NX2A 1Y0VH 2ZN9A 4GAOA 1C07A 1MUXA 1XA5A 1SKTA 2LANA 2KQYA 3EKHA 4MZKA 1J7RA 3I5HB 4U8DA 3ZWHA 4UPGA 1KCYA 1BLQA 2LP3A 2Q4UA 3HCMA 3CZTX 1JWDA 1UHIA 1QATA 1CLBA 4GBAA 2MJWB 3TS5B 1RROA 4N1FA 1ZMZA 5KSZA 2NCPA 1OMDA 1RFJA 4CFQA 1EG3A 1DJYA 1QXPA 2GGZA 3TUYB 4AQIA 2BE6A 3KF9A 1CKKA 1PSBA 3JTDB 1TTXA 4QJ5B 1B7TZ 3D10A 2KSPA 1OMRA 4D1EA 1QLSA 1JBAA 1FF1A 2AAOA 1K95A 1SNLA 4I5JA 5HLVA 1CMGA 1S5GZ 2JOJA 4WQ3A 4USLA 1LVCD 1TNXA 2JNFA 1J7PA 1KQMB 3TDIA 2I2RE 1QVIY 3TDZA 2Y4QA 3WHUB 3CS1A 2L98A 2MLFC 3I5FC 1EG4A 1SR6C 1N2DA 2RGIA 1MWNA 2KI6C 2P6BB 3EK4A 4MLWA 3BUMB 1YVLA 3IF7A 3OHMB 2LC5A 2K7CA 3VGOA 4P5OE 1E8AA 3BQ3A 1NPQA 3EVRA 1CFCA 1S6CA 2K0JA 1AK8A 3HX4A 1CLMA 3CR5X 1B9AA 2WC8A 5ER5A 5HKWA 2BKHB 2KBMA 1SCVA 1UWOA 4L9MA 4R1EA 1QIWA 2KGRA 1XFYO 1PRWA 1TIZA 2KNEA 2M97A 2PRUA 3KEVA 2HQWA 3I5IC 2FOTA 1A2XA 1K90D 3SG2A 5D69A 1TOPA 2CTNA 2GV5A 4FQOA 4HSZA 1B8LA 1BJFA 2JRFA 3WHTB 1M39A 1CFPA 2HF5A 5HKYA 4JQ0D 1KK7Z 2QPTA 1UHJA 2KOTA 4GNKB 2L51A 3PALA 2DOQA 1BMOA 3QRXA 1M63B 1NUBA 1OSAA 1ZACA 1XYDA 4YGAA 1M46A 2I18A 2VRGA 4GPLB 5KTYA 1WY9A 4M2PA 2SASA 2KYCA 4PDZA 1CFFA 2BBMA 3O4YA 1SL7A 5CPVA 5IBWA 1RK9A 5CSFA 3D0YA 4TNCA 2LHLA 2BCBA 1CDPA 2O60A 4NDCA 4Q04A 5AANA 1F55A 1DJHA 1KFUS 3PN7C 1EH2A 1C7WA 2WCEA 4QJ3B 5ER4X 1F8HA 1JFKA 2LVVA 1PALA 4PCWA 2EC6B 4PALA 1SW8A 1KFUL 1LXFC 1CDNA 1KWOC 3LK1A 3ICBA 1NIWA 1CFDA 2LVKA 1N0YA 2LM5A 1CLLA 1YVHA 1DTLA 2JWWA 4A4CA 2KFHA 4PHMA 2WNDA 1B7TY 2F2OA 2ZRSA 3I5GB 3LK0A 1V1FA 3AKBA 1S5GY 2D8NA 2ZNDA 3PSRA 3VRQA 3IQQA 1DJGA 5HLOA 5PALA 3BUOB 4JWQA 1YRTB 2LE9B 3GK1A 2K61A 1SYMA 1XVJA 1MXLC 1H8BA 1SBJA 1AVSA 1PULA 3NSOA 5D7FA 1J1EA 3WNXB 4M2QA 5AXIA 1QTXA 1W7IB 1MQ1A 1A29A 1H4BA 2FCEA 4DCKA 2JT8A 2M7NA 2KAYA 4MN0A 3JVTC 4BY5A 5JOLA 2WOSA 1DGVA 1CB1A 2CBLA 1CM1A 5CSJA 2K7OA 1LA0A 1Y1AA 4XJKA 4ETOA 2LLUA 4XYNA 2BL0C 3FS7A 1EXRA 2KDHA 1CDMA 1OMVA 2JT3A 1TNWA 4ZCVA 1CTRA 2BECA 2L4IA 1NCXA 2E30A 2Q91A 4C0JA 1QV0A 1SL8A 4DRWA 1K9UA 1RWYA 2WCBA 2H61A 4N1GA 4HREE 1YUUA 3I5HC 5CSNA 5HYDA 3BXKA 2O5GA 3GOFA 2LVIA 1BU3A 1MXEA 2JT0A 3VROA 3CTNA 4BY4A 3E3RA 1SY9A 1L7ZA 2F3ZA 1KK7Y 1SR6B 3TS5C 5G08A 2LNKA 1SCMC 4ORBB 2LHIA 1M45A 3D0YB 4YBHB 3TUYC 1MHOA 1UP5A 2M8UA 3K21A 3MSEB 3M0WA 1XK4C 4OV2A 2FJUB 2CNPA 1ZFSA 4AQJA 1YX7A 1KK8C 4ORAB 4N5XA 1QJTA 1M31A 3TDUA 1GGWA 3OP0A 3ZNIA 2F8PA 2LMTA 1BT6A 4GGFC 3OB2B 1DJWA 1DF0A 2NXQA 3PATA 2NCOA 5AERA 1JF0A 2OTGC 1A75A 2OPOA 4PE0A 3FIAA 2HETA 3EVUA 5AEQA 4QJ4B 1NX1A 1TN4A 1CDLA 2JXCA 5CSIA 1L2OC 2ZKMX 3CWGA 3F45A 1FBVA 3A8RA 1WRZA 2WORA 1YURA 1GJYA 1CM4A 4MEWA 2MBXA 2ZRTA 3A4UB 3C1VA 3TZ1A 4CLNA 4MSPA 2G9BA 4YGBB 1MR8A 1OZOA 1S6JA 4F0ZB 1IH0A 1IJ6A 5I2OA 2M29A 3OX5A 1QX5B 1QS7A 1QX7A 1TRFA 3O78A 1ALVA 3AAJA 3NSLA 2CCMA 4PHJA 1R6PA 2CXJA 3SG5A 4PHKA 2LMUA 3IQOA 4PE4A 2OS8C 2EGDA 1RECA 1QX2A 1G4YR 2L50A 1GGZA 5TNCA 2K8MB 4YGCB 4XJKB 2Y1MA 3CGAA 2Y5IA 4MZLA 1UHKA 1J55A 1S3PA 2M49B 3SIBA 1LA3A 3KPXA 1B8CA 2JZIA 3EKJA 3LCPC 4GGFA 3SIAA 4AOMA 1D1OA 1OZSA 1N65A 1FI6A 3NSIA 4YI8A 4YGDB 2ISDA 2KAVA 4IL1A 5B8IB 1IWQA 4YI9A 1Y1UA 2JULA 1K9PA 3DF0A 1WDCC 3VRNA 1DMOA 5JJGA 2BE4A 2KI4B 3PM8A 2L0PA 5I2LA 4GUKA 2ZN8A 3EVVA 1ZUZA 3AAKA 4NQGA 2PALA 1C7VA 1K93D 3SJSA 4MZJA 4GFTA 1K9KA 5BPJA 3CR4X 2KGBC 1IQ3A 3OX6A 3BUNB 4PHNA 3DD4A 4MRYA 4GGNA 5DKQA 1JFJA 4JPZB 4I5LB 4I5NB 1W7JB 1PK0D 2KI6D 2E6WA 5I2QA 2PASA 1G33A 3NSKA 2AUCA 3CLNA 2K2AA 3DVEA 2LCPA 1JF2A 1KSOA 4CFRA 1DJXA 1DF0B 1LINA 3VRPA 2MHHA 2JC2A 1A75B 5DKRA 1IGVA 2JQ6A 4C0KA 4PE7A 3GK2A 5HKZA 1YR5A 3KO0A 1YRUB 3O6BA 4MBEA 1EL4A 1S1EA 1TCFA 2LV7A 1F54A 1KQVA 4WRIA 1Y6WA 5DKNA 1XFZO 1B1GA 1ALWA 1BOCA 2SCPA 1J1DA 2G2BA 4ICBA 1BR4B 2L4HA 3I5FB 1HQVA 1V1GA 2ZFDA 2L2EA 2AMIA 2PSRA 2F3YA 5I8NA 1SCMB 1K8UA 5K89A 2K7DA 1K94A 5KU1A 1QV1A 1B8RA 1U5IB 2M1UA 3JTDC 3RM1A 1HT9A 3BOWA 3OB1B 1B47A 2CT9A 4A4BA 1CMFA 2KHNA 4MVFA 3DVJA 3CR2A 2JTZA 1AUIB 1OOJA 2MLEC 1UHNA 1XFUO 1F4QA 2MRDA 1SMGA 4NDBA 1GQMA 1IRJA 2KFGA 3BUXB 1KK8B 3SG3A 2F2PA 2HPSA 1KQMC 1TNPA 2LUCA 1LKJA 2M3WA 3EK8A 1AP4A 1CNPA 1RJVA 5J3XA 1A03A 2PMYA 3I5IB 3PLFB 1DT7B 1PVBA 1S6IA 1S36A 2LMVA 1RTP1 3WXAA 1UURA 2HQ8A 1YX8A 2M0RA 2OTGB 2R2IA 1SPYA 1XFVO 4ZCUA 4HRGA 2EHBA 2PVBA 1FW4A 1NCYA 3SG6A 1VRKA 1TCOB 2F33A 2WCFA 2I7AA 1NX0A 3DF0B 1B4CA 1L2OB 2M9GA 1UUSA 3DVKA 1AJ4A 4DUQA 1DJIA 1YTZC 2JTTA 2ZNEA 1A4PA 1SL9A 4CPVA 1J7QA 1IKUA 3FWCA 4DIRA 1ZOTB 4NDDA 4YGEB 2FCDA 1J7OA 2M7LA 1UHHA 1DGUA 2LAPA 2BCXA 3RLZA 3AKAA 2JXLA 2LLTA 2K2FA 1QIVA 1NWDA 2JPTA 1IQ5A 1U5IA 2I94A 2MAZA 3DVMA 1BODA 1KSMA 1XK4A 1QVIZ 1OQPA 2OS8B 1IJ5A 3GK4X 1YUTA 1DVIA 1S26D 2K7BA 3PN7B 1R2UA 4HRHA 1K2HA 2JNXA 2IS9A 4YRUA 3LL8B 2KBIA 2GGMA 3SG4A 1WLZA 3H4SE 4E68A 2MA2A 1EJ3A 2M1KB 2NLNA 1NP8A 1AJ5A 5F6TA 1G8IA 2V53A 1KFXS 1TNQA 1KWOB 2Y1NA 2QACA 2LLSA 1QLKA 3LLEA 1FI5A 2KAXA 1PSRA 1DJZA 1NCZA 1MF8B 2KQ6A 1F70A 1F4OA 1FPWA 1NSHA 1BG1A 1AHRA 1KFXL 3BYAA 2JU0A 3VRRA 2B1UA 1ODBA 1Y1XA 2NZ0A 1WDCB 4M2OA 1WRLA 4CIDA 1XO5A 4OR9B 2LUXA 4P2YB 1X02A 2BBNA 1XFXO 2KFFA 4OKHA 4C0LA 3FWBA 1IG5A 1XFWO 2EC6C 1BF5A 1Q80A 1SK6D 2A4JA 4OVNF 2TN4A 2KYFA 2LVJA 3BOWB 2L5XB 4PE1A 5AFPA 5FYXA 2H61C 4DS7A 5GQQC 4FTGA 1NYAA 1F71A 1JUOA 1NX3A 3I5GC 1K96A 2BKIB 3JVTB 4I5KA 4OCIA 1WRKA 1WLMA 1BR1B 2COLB 2KI4C 1OE9B 1JC2A 3PFVA 2BCAA 4WQ2A 4ORCB 1JSAA 2H2KA 1PVAA 3O2PA 1SRAA 2BL0B 4MRXA 3BUWB 1YUSA 3EK7A 1QASA 3KHEA 2LP2A 3SG7A 3NXAA
chains in the Genus database with same CATH superfamily
1NX2A 1Y0VH 2ZN9A 4GAOA 1C07A 1MUXA 1XA5A 1SKTA 1OW4A 2KQYA 2LANA 3EKHA 4MZKA 5DICA 1J7RA 3I5HB 4U8DA 3ZWHA 4UPGA 1KCYA 1BLQA 2LP3A 2Q4UA 3HCMA 3CZTX 1JWDA 1UHIA 1QATA 1CLBA 2QEBA 4GBAA 4FQTA 2MJWB 2WC6A 3TS5B 1RROA 4N1FA 1ZMZA 5KSZA 3S0DA 2NCPA 1OMDA 1RFJA 4CFQA 1EG3A 1DJYA 2WCJA 1QXPA 2GGZA 3B87A 3TUYB 1DQEA 4AQIA 2BE6A 1TUJA 3KF9A 1CKKA 1PSBA 3JTDB 1TTXA 3Q8IA 1B7TZ 4QJ5B 3D10A 2KSPA 1OMRA 4D1EA 1QLSA 1JBAA 1FF1A 2AAOA 1K95A 1SNLA 4I5JA 5HLVA 1CMGA 1S5GZ 2JOJA 4WQ3A 4USLA 1LVCD 1TNXA 2JNFA 1J7PA 1KQMB 1OOHA 3TDIA 2I2RE 1QVIY 3NHIA 2Y4QA 3TDZA 3WHUB 3CS1A 1C3YA 2L98A 2QEHA 2MLFC 3I5FC 1EG4A 1SR6C 1N2DA 2RGIA 3UNWA 1MWNA 2KI6C 1DELA 2P6BB 3EK4A 4MLWA 3L4AA 3BUMB 1YVLA 3IF7A 3OHMB 2LC5A 2K7CA 3VGOA 3OGNA 1E8AA 2WCHA 4P5OE 3DY9A 3BQ3A 1NPQA 3EVRA 2QDIA 1CFCA 1S6CA 2K0JA 1AK8A 3HX4A 1CLMA 3CR5X 1B9AA 2WC8A 5ER5A 5HKWA 2BKHB 2KBMA 3FE6A 1SCVA 1UWOA 4L9MA 4R1EA 1QIWA 2KGRA 1XFYO 1PRWA 1TIZA 2KNEA 2M97A 2PRUA 3KEVA 2HQWA 3I5IC 2FOTA 1A2XA 3S0AA 3R1OA 2K60A 1K90D 3SG2A 3CDNA 5D69A 1TOPA 2CTNA 2GV5A 3BFAA 4FQOA 4HSZA 1B8LA 1BJFA 2JRFA 4INXA 1M39A 3WHTB 2HF5A 3PJIA 1CFPA 3D78A 5HKYA 4JQ0D 1KK7Z 2QPTA 1UHJA 2KOTA 4GNKB 2L51A 3PALA 2DOQA 1BMOA 3QRXA 1M63B 1NUBA 1OSAA 1ZACA 1XYDA 4YGAA 1M46A 2I18A 2VRGA 4GPLB 3D77A 5KTYA 1WY9A 4M2PA 2SASA 2KYCA 4PDZA 1CFFA 2BBMA 3O4YA 1SL7A 5CPVA 5IBWA 1RK9A 5CSFA 3D0YA 4TNCA 2LHLA 2BCBA 1CDPA 2O60A 4NDCA 4Q04A 5AANA 2WCLA 1DJHA 1F55A 1KFUS 3PN7C 1EH2A 1C7WA 2WCEA 4QJ3B 5ER4X 3B7AA 1F8HA 3IVTA 1JFKA 2LVVA 1PALA 4PCWA 2EC6B 4PALA 1SW8A 1KFUL 1LXFC 3S0FA 1CDNA 2WC5A 3UO9A 2YGUA 5EL2A 1KWOC 3LK1A 3ICBA 1NIWA 1CFDA 2LVKA 1N0YA 2LM5A 1CLLA 1YVHA 1DTLA 2JWWA 4A4CA 2KFHA 2JPOA 4PHMA 1ORGA 2WNDA 1B7TY 2F2OA 2ZRSA 3I5GB 3LK0A 1V1FA 2KLEA 3AKBA 3B6XA 1S5GY 2D8NA 2ZNDA 3PSRA 3VRQA 3IQQA 1DJGA 5HLOA 5PALA 3BUOB 3DXLA 4JWQA 1YRTB 2LE9B 3GK1A 2K61A 5I94A 1SYMA 3L47A 5HL1A 1XVJA 1MXLC 1H8BA 1SBJA 1AVSA 1PULA 3B88A 3NSOA 1J1EA 5D7FA 3WNXB 4M2QA 2KPHA 5AXIA 1QTXA 1W7IB 1MQ1A 2PYQA 1A29A 1H4BA 2FCEA 1Z4HA 4DCKA 2JT8A 2M7NA 3DZTA 2KAYA 4MN0A 3JVTC 4BY5A 5JOLA 2WOSA 1DGVA 1CB1A 1GM0A 2CBLA 1CM1A 5CSJA 2K7OA 1LA0A 1Y1AA 4XJKA 3PM2A 2LLUA 4ETOA 4XYNA 2BL0C 3FS7A 1EXRA 2KDHA 3CZ0A 1CDMA 1OMVA 2JT3A 1TNWA 3FE9A 2QEVA 4ZCVA 1CTRA 2BECA 2L4IA 1NCXA 2E30A 2Q91A 4C0JA 1QV0A 1SL8A 4DRWA 1K9UA 1RWYA 2L5YA 2H61A 2WCBA 4N1GA 4HREE 1YUUA 3RZSA 3I5HC 5CSNA 5HYDA 3BXKA 2O5GA 3GOFA 2LVIA 1BU3A 1MXEA 2JT0A 3VROA 3CTNA 4BY4A 3E3RA 1SY9A 1L7ZA 1OOIX 2F3ZA 1KK7Y 1SR6B 3TS5C 5G08A 2LNKA 1SCMC 4ORBB 2LHIA 1M45A 3D0YB 4YBHB 3TUYC 1MHOA 1UP5A 2M8UA 3K21A 3MSEB 1SSEB 3M0WA 1XK4C 3N7HA 4OV2A 2FJUB 2CNPA 1ZFSA 4AQJA 1YX7A 1KK8C 4ORAB 4N5XA 2FJYA 2WCKA 4KYNA 1QJTA 1M31A 4JKTA 3TDUA 1GGWA 3OP0A 3ZNIA 2F8PA 2LMTA 1BT6A 4GGFC 3OB2B 1DJWA 1DF0A 2NXQA 3PATA 2NCOA 5AERA 3K1EA 1JF0A 2OTGC 1A75A 2OPOA 4INWA 4PE0A 2QEOA 3FIAA 2HETA 3EVUA 5AEQA 4QJ4B 1NX1A 1TN4A 1CDLA 2JXCA 5CSIA 1L2OC 2ZKMX 3CWGA 3F45A 1FBVA 3A8RA 1WRZA 2WORA 1YURA 1GJYA 1CM4A 4MEWA 2MBXA 2ZRTA 3A4UB 3C1VA 3TZ1A 4CLNA 3D73A 4MSPA 2G9BA 4YGBB 1MR8A 1OZOA 1S6JA 4F0ZB 1IH0A 3V2LA 1IJ6A 5I2OA 2M29A 3OX5A 1QX5B 1QS7A 1QX7A 1TRFA 3O78A 1ALVA 3AAJA 3NSLA 2CCMA 4PHJA 1R6PA 2CXJA 3SG5A 2WCMA 4PHKA 2LMUA 3CZ2A 3IQOA 4PE4A 2OS8C 2EGDA 1RECA 1QX2A 1G4YR 2L50A 1GGZA 5TNCA 1XFRA 2K8MB 4YGCB 4XJKB 2Y1MA 3CGAA 2Y5IA 3BFBA 4MZLA 1UHKA 1J55A 1S3PA 3S0EA 2M49B 3SIBA 1LA3A 3KPXA 1B8CA 2JZIA 3EKJA 3LCPC 4GGFA 3SIAA 4AOMA 1D1OA 1OZSA 1N65A 1FI6A 3NSIA 3CABA 3R1VA 4YI8A 3D74A 3SS4A 4YGDB 5FI6A 2ISDA 2KAVA 4IL1A 5B8IB 1IWQA 4YI9A 1Y1UA 2JULA 1K9PA 3D76A 3DF0A 1WDCC 3VRNA 1DMOA 5JJGA 2BE4A 2KI4B 3OBVA 3PM8A 2L0PA 5I2LA 4IJ7A 4GUKA 2ZN8A 3EVVA 1ZUZA 3AAKA 4NQGA 2PALA 1TUZA 1C7VA 1K93D 3SJSA 4MZJA 4GFTA 1K9KA 5BPJA 3CR4X 2KGBC 1IQ3A 3OX6A 3BUNB 4PHNA 3DD4A 4MRYA 4GGNA 5DKQA 1JFJA 4JPZB 4I5LB 4I5NB 1W7JB 1PK0D 2KI6D 2E6WA 5I2QA 2PASA 1G33A 3NSKA 2P70A 2AUCA 3CLNA 2K2AA 3DVEA 2LCPA 3R72A 1JF2A 1KSOA 4CFRA 2BNXA 2BAPA 1DJXA 1DF0B 4PT1A 1LINA 3VRPA 2MHHA 2JC2A 1A75B 5DKRA 1IGVA 2JQ6A 4C0KA 4PE7A 2PQLA 5FI2A 1C3ZA 1LS8A 3GK2A 5HKZA 1YR5A 3KO0A 1YRUB 3O6BA 4MBEA 1EL4A 1S1EA 1TCFA 2LV7A 1F54A 1KQVA 4OZDA 4WRIA 1Y6WA 5DKNA 1XFZO 1B1GA 1DEKA 1ALWA 1BOCA 2SCPA 1J1DA 2G2BA 4ICBA 3SS3A 1BR4B 1TWOA 2L4HA 3D75A 3I5FB 1HQVA 1V1GA 2ZFDA 1OOGA 2L2EA 2AMIA 2PSRA 2F3YA 5I8NA 1SCMB 1K8UA 5K89A 2K7DA 1K94A 5KU1A 1QV1A 1B8RA 1U5IB 2M1UA 3JTDC 3RM1A 3NGVA 1HT9A 3BOWA 3OB1B 1B47A 2CT9A 4A4BA 1CMFA 2KHNA 4MVFA 3DVJA 3CR2A 2JTZA 1AUIB 1OOJA 2MLEC 1UHNA 1XFUO 1F4QA 2MRDA 1SMGA 4NDBA 1GQMA 1IRJA 2KFGA 3BUXB 1KK8B 3SG3A 2F2PA 2HPSA 1KQMC 1TNPA 2LUCA 1LKJA 2M3WA 3EK8A 1AP4A 1CNPA 1RJVA 5J3XA 1A03A 2PMYA 3FE8A 3I5IB 3PLFB 1PVBA 1DT7B 1S6IA 1S36A 2LMVA 1RTP1 3WXAA 1UURA 2HQ8A 1P28A 1W9ZA 1YX8A 2M0RA 2OTGB 2R2IA 1SPYA 1XFVO 3R1PA 4ZCUA 4HRGA 2EHBA 2PVBA 1FW4A 1NCYA 2KLDA 3SG6A 1VRKA 1TCOB 2F33A 2WCFA 2I7AA 1NX0A 3DF0B 1B4CA 1L2OB 2M9GA 1UUSA 3DVKA 1AJ4A 4DUQA 1DJIA 3VB1A 1YTZC 3O4XA 2JTTA 2ZNEA 1A4PA 1SL9A 4CPVA 1J7QA 1IKUA 3BJHA 3FWCA 4DIRA 2GTEA 1ZOTB 4NDDA 4YGEB 2FCDA 1J7OA 2M7LA 1UHHA 1DGUA 2LAPA 2BCXA 3RLZA 3BFHA 3AKAA 2JXLA 2LLTA 2K2FA 1QIVA 1NWDA 4JD9A 2ERBA 2P71A 5D3OA 2JPTA 1IQ5A 1U5IA 2I94A 2MAZA 3DVMA 1BODA 1KSMA 1XK4A 1QVIZ 1OQPA 2OS8B 1IJ5A 3GK4X 3EG5B 3NHTA 1YUTA 1DVIA 1S26D 2K7BA 3PN7B 1R2UA 4HRHA 1K2HA 2JNXA 2IS9A 4YRUA 3B86A 3LL8B 2KBIA 2GGMA 3SG4A 3QMEA 1WLZA 3H4SE 4E68A 2MA2A 1EJ3A 2M1KB 2NLNA 1NP8A 1AJ5A 5F6TA 1G8IA 2V53A 1KFXS 1TNQA 1KWOB 2Y1NA 2QACA 2LLSA 1QLKA 3LLEA 1FI5A 2KAXA 1PSRA 1DJZA 1NCZA 1MF8B 2KQ6A 1F70A 1F4OA 1FPWA 1NSHA 1BG1A 1AHRA 1KFXL 3BYAA 1QWVA 2JU0A 1IIOA 1T14A 2B1UA 1ODBA 1Y1XA 2NZ0A 3VRRA 1WDCB 3CYZA 4F7FA 4M2OA 1WRLA 4CIDA 1XO5A 1OOFA 4OR9B 2LUXA 4P2YB 1X02A 2BBNA 1XFXO 2KFFA 4OKHA 3S0BA 4C0LA 3FWBA 1Z2CB 1IG5A 1XFWO 2EC6C 1BF5A 1Q80A 1SK6D 2A4JA 4OVNF 2TN4A 2KYFA 2LVJA 3BOWB 3SS5A 2L5XB 4PE1A 5AFPA 2H8VA 5FYXA 2H61C 4DS7A 3CZ1A 5GQQC 4FTGA 1NYAA 1F71A 1JUOA 1NX3A 3I5GC 1K96A 2BKIB 3JVTB 4I5KA 4OCIA 1WRKA 1WLMA 1BR1B 2COLB 2KI4C 1OE9B 1JC2A 3PFVA 2L2CA 2BCAA 3S0GA 4WQ2A 3L4LA 4ORCB 1JSAA 2H2KA 1PVAA 3O2PA 5FI7A 1DC1A 1SRAA 2BL0B 4MRXA 3BUWB 1YUSA 3EK7A 1QASA 3DYEA 3KHEA 2LP2A 3SG7A 3NXAA
chains in the Genus database with same CATH topology
1NX2A 1Y0VH 2ZN9A 4GAOA 1C07A 1MUXA 1XA5A 1SKTA 2LANA 2KQYA 3EKHA 4MZKA 1J7RA 3I5HB 4U8DA 3ZWHA 4UPGA 1KCYA 1BLQA 2LP3A 2Q4UA 3HCMA 3CZTX 1JWDA 1UHIA 1QATA 1CLBA 4GBAA 2MJWB 3TS5B 1RROA 4N1FA 1ZMZA 5KSZA 2NCPA 1OMDA 1RFJA 4CFQA 1EG3A 1DJYA 1QXPA 2GGZA 3TUYB 4AQIA 2BE6A 3KF9A 1CKKA 1PSBA 3JTDB 1TTXA 4QJ5B 1B7TZ 3D10A 2KSPA 1OMRA 4D1EA 1QLSA 1JBAA 1FF1A 2AAOA 1K95A 1SNLA 4I5JA 5HLVA 1CMGA 1S5GZ 2JOJA 4WQ3A 4USLA 1LVCD 1TNXA 2JNFA 1J7PA 1KQMB 3TDIA 2I2RE 1QVIY 3TDZA 2Y4QA 3WHUB 3CS1A 2L98A 2MLFC 3I5FC 1EG4A 1SR6C 1N2DA 2RGIA 1MWNA 2KI6C 2P6BB 3EK4A 4MLWA 3BUMB 1YVLA 3IF7A 3OHMB 2LC5A 2K7CA 3VGOA 4P5OE 1E8AA 3BQ3A 1NPQA 3EVRA 1CFCA 1S6CA 2K0JA 1AK8A 3HX4A 1CLMA 3CR5X 1B9AA 2WC8A 5ER5A 5HKWA 2BKHB 2KBMA 1SCVA 1UWOA 4L9MA 4R1EA 1QIWA 2KGRA 1XFYO 1PRWA 1TIZA 2KNEA 2M97A 2PRUA 3KEVA 2HQWA 3I5IC 2FOTA 1A2XA 1K90D 3SG2A 5D69A 1TOPA 2CTNA 2GV5A 4FQOA 4HSZA 1B8LA 1BJFA 2JRFA 3WHTB 1M39A 1CFPA 2HF5A 5HKYA 4JQ0D 1KK7Z 2QPTA 1UHJA 2KOTA 4GNKB 2L51A 3PALA 2DOQA 1BMOA 3QRXA 1M63B 1NUBA 1OSAA 1ZACA 1XYDA 4YGAA 1M46A 2I18A 2VRGA 4GPLB 5KTYA 1WY9A 4M2PA 2SASA 2KYCA 4PDZA 1CFFA 2BBMA 3O4YA 1SL7A 5CPVA 5IBWA 1RK9A 5CSFA 3D0YA 4TNCA 2LHLA 2BCBA 1CDPA 2O60A 4NDCA 4Q04A 5AANA 1F55A 1DJHA 1KFUS 3PN7C 1EH2A 1C7WA 2WCEA 4QJ3B 5ER4X 1F8HA 1JFKA 2LVVA 1PALA 4PCWA 2EC6B 4PALA 1SW8A 1KFUL 1LXFC 1CDNA 1KWOC 3LK1A 3ICBA 1NIWA 1CFDA 2LVKA 1N0YA 2LM5A 1CLLA 1YVHA 1DTLA 2JWWA 4A4CA 2KFHA 4PHMA 2WNDA 1B7TY 2F2OA 2ZRSA 3I5GB 3LK0A 1V1FA 3AKBA 1S5GY 2D8NA 2ZNDA 3PSRA 3VRQA 3IQQA 1DJGA 5HLOA 5PALA 3BUOB 4JWQA 1YRTB 2LE9B 3GK1A 2K61A 1SYMA 1XVJA 1MXLC 1H8BA 1SBJA 1AVSA 1PULA 3NSOA 5D7FA 1J1EA 3WNXB 4M2QA 5AXIA 1QTXA 1W7IB 1MQ1A 1A29A 1H4BA 2FCEA 4DCKA 2JT8A 2M7NA 2KAYA 4MN0A 3JVTC 4BY5A 5JOLA 2WOSA 1DGVA 1CB1A 2CBLA 1CM1A 5CSJA 2K7OA 1LA0A 1Y1AA 4XJKA 4ETOA 2LLUA 4XYNA 2BL0C 3FS7A 1EXRA 2KDHA 1CDMA 1OMVA 2JT3A 1TNWA 4ZCVA 1CTRA 2BECA 2L4IA 1NCXA 2E30A 2Q91A 4C0JA 1QV0A 1SL8A 4DRWA 1K9UA 1RWYA 2WCBA 2H61A 4N1GA 4HREE 1YUUA 3I5HC 5CSNA 5HYDA 3BXKA 2O5GA 3GOFA 2LVIA 1BU3A 1MXEA 2JT0A 3VROA 3CTNA 4BY4A 3E3RA 1SY9A 1L7ZA 2F3ZA 1KK7Y 1SR6B 3TS5C 5G08A 2LNKA 1SCMC 4ORBB 2LHIA 1M45A 3D0YB 4YBHB 3TUYC 1MHOA 1UP5A 2M8UA 3K21A 3MSEB 3M0WA 1XK4C 4OV2A 2FJUB 2CNPA 1ZFSA 4AQJA 1YX7A 1KK8C 4ORAB 4N5XA 1QJTA 1M31A 3TDUA 1GGWA 3OP0A 3ZNIA 2F8PA 2LMTA 1BT6A 4GGFC 3OB2B 1DJWA 1DF0A 2NXQA 3PATA 2NCOA 5AERA 1JF0A 2OTGC 1A75A 2OPOA 4PE0A 3FIAA 2HETA 3EVUA 5AEQA 4QJ4B 1NX1A 1TN4A 1CDLA 2JXCA 5CSIA 1L2OC 2ZKMX 3CWGA 3F45A 1FBVA 3A8RA 1WRZA 2WORA 1YURA 1GJYA 1CM4A 4MEWA 2MBXA 2ZRTA 3A4UB 3C1VA 3TZ1A 4CLNA 4MSPA 2G9BA 4YGBB 1MR8A 1OZOA 1S6JA 4F0ZB 1IH0A 1IJ6A 5I2OA 2M29A 3OX5A 1QX5B 1QS7A 1QX7A 1TRFA 3O78A 1ALVA 3AAJA 3NSLA 2CCMA 4PHJA 1R6PA 2CXJA 3SG5A 4PHKA 2LMUA 3IQOA 4PE4A 2OS8C 2EGDA 1RECA 1QX2A 1G4YR 2L50A 1GGZA 5TNCA 2K8MB 4YGCB 4XJKB 2Y1MA 3CGAA 2Y5IA 4MZLA 1UHKA 1J55A 1S3PA 2M49B 3SIBA 1LA3A 3KPXA 1B8CA 2JZIA 3EKJA 3LCPC 4GGFA 3SIAA 4AOMA 1D1OA 1OZSA 1N65A 1FI6A 3NSIA 4YI8A 4YGDB 2ISDA 2KAVA 4IL1A 5B8IB 1IWQA 4YI9A 1Y1UA 2JULA 1K9PA 3DF0A 1WDCC 3VRNA 1DMOA 5JJGA 2BE4A 2KI4B 3PM8A 2L0PA 5I2LA 4GUKA 2ZN8A 3EVVA 1ZUZA 3AAKA 4NQGA 2PALA 1C7VA 1K93D 3SJSA 4MZJA 4GFTA 1K9KA 5BPJA 3CR4X 2KGBC 1IQ3A 3OX6A 3BUNB 4PHNA 3DD4A 4MRYA 4GGNA 5DKQA 1JFJA 4JPZB 4I5LB 4I5NB 1W7JB 1PK0D 2KI6D 2E6WA 5I2QA 2PASA 1G33A 3NSKA 2AUCA 3CLNA 2K2AA 3DVEA 2LCPA 1JF2A 1KSOA 4CFRA 1DJXA 1DF0B 1LINA 3VRPA 2MHHA 2JC2A 1A75B 5DKRA 1IGVA 2JQ6A 4C0KA 4PE7A 3GK2A 5HKZA 1YR5A 3KO0A 1YRUB 3O6BA 4MBEA 1EL4A 1S1EA 1TCFA 2LV7A 1F54A 1KQVA 4WRIA 1Y6WA 5DKNA 1XFZO 1B1GA 1ALWA 1BOCA 2SCPA 1J1DA 2G2BA 4ICBA 1BR4B 2L4HA 3I5FB 1HQVA 1V1GA 2ZFDA 2L2EA 2AMIA 2PSRA 2F3YA 5I8NA 1SCMB 1K8UA 5K89A 2K7DA 1K94A 5KU1A 1QV1A 1B8RA 1U5IB 2M1UA 3JTDC 3RM1A 1HT9A 3BOWA 3OB1B 1B47A 2CT9A 4A4BA 1CMFA 2KHNA 4MVFA 3DVJA 3CR2A 2JTZA 1AUIB 1OOJA 2MLEC 1UHNA 1XFUO 1F4QA 2MRDA 1SMGA 4NDBA 1GQMA 1IRJA 2KFGA 3BUXB 1KK8B 3SG3A 2F2PA 2HPSA 1KQMC 1TNPA 2LUCA 1LKJA 2M3WA 3EK8A 1AP4A 1CNPA 1RJVA 5J3XA 1A03A 2PMYA 3I5IB 3PLFB 1DT7B 1PVBA 1S6IA 1S36A 2LMVA 1RTP1 3WXAA 1UURA 2HQ8A 1YX8A 2M0RA 2OTGB 2R2IA 1SPYA 1XFVO 4ZCUA 4HRGA 2EHBA 2PVBA 1FW4A 1NCYA 3SG6A 1VRKA 1TCOB 2F33A 2WCFA 2I7AA 1NX0A 3DF0B 1B4CA 1L2OB 2M9GA 1UUSA 3DVKA 1AJ4A 4DUQA 1DJIA 1YTZC 2JTTA 2ZNEA 1A4PA 1SL9A 4CPVA 1J7QA 1IKUA 3FWCA 4DIRA 1ZOTB 4NDDA 4YGEB 2FCDA 1J7OA 2M7LA 1UHHA 1DGUA 2LAPA 2BCXA 3RLZA 3AKAA 2JXLA 2LLTA 2K2FA 1QIVA 1NWDA 2JPTA 1IQ5A 1U5IA 2I94A 2MAZA 3DVMA 1BODA 1KSMA 1XK4A 1QVIZ 1OQPA 2OS8B 1IJ5A 3GK4X 1YUTA 1DVIA 1S26D 2K7BA 3PN7B 1R2UA 4HRHA 1K2HA 2JNXA 2IS9A 4YRUA 3LL8B 2KBIA 2GGMA 3SG4A 1WLZA 3H4SE 4E68A 2MA2A 1EJ3A 2M1KB 2NLNA 1NP8A 1AJ5A 5F6TA 1G8IA 2V53A 1KFXS 1TNQA 1KWOB 2Y1NA 2QACA 2LLSA 1QLKA 3LLEA 1FI5A 2KAXA 1PSRA 1DJZA 1NCZA 1MF8B 2KQ6A 1F70A 1F4OA 1FPWA 1NSHA 1BG1A 1AHRA 1KFXL 3BYAA 2JU0A 3VRRA 2B1UA 1ODBA 1Y1XA 2NZ0A 1WDCB 4M2OA 1WRLA 4CIDA 1XO5A 4OR9B 2LUXA 4P2YB 1X02A 2BBNA 1XFXO 2KFFA 4OKHA 4C0LA 3FWBA 1IG5A 1XFWO 2EC6C 1BF5A 1Q80A 1SK6D 2A4JA 4OVNF 2TN4A 2KYFA 2LVJA 3BOWB 2L5XB 4PE1A 5AFPA 5FYXA 2H61C 4DS7A 5GQQC 4FTGA 1NYAA 1F71A 1JUOA 1NX3A 3I5GC 1K96A 2BKIB 3JVTB 4I5KA 4OCIA 1WRKA 1WLMA 1BR1B 2COLB 2KI4C 1OE9B 1JC2A 3PFVA 2BCAA 4WQ2A 4ORCB 1JSAA 2H2KA 1PVAA 3O2PA 1SRAA 2BL0B 4MRXA 3BUWB 1YUSA 3EK7A 1QASA 3KHEA 2LP2A 3SG7A 3NXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX2 A;  1Y0V H;  2ZN9 A;  4GAO A;  1C07 A;  1MUX A;  1XA5 A;  1SKT A;  2LAN A;  2KQY A;  3EKH A;  4MZK A;  1J7R A;  3I5H B;  4U8D A;  3ZWH A;  4UPG A;  1KCY A;  1BLQ A;  2LP3 A;  2Q4U A;  3HCM A;  3CZT X;  1JWD A;  1UHI A;  1QAT A;  1CLB A;  4GBA A;  2MJW B;  3TS5 B;  1RRO A;  4N1F A;  1ZMZ A;  5KSZ A;  2NCP A;  1OMD A;  1RFJ A;  4CFQ A;  1EG3 A;  1DJY A;  1QXP A;  2GGZ A;  3TUY B;  4AQI A;  2BE6 A;  3KF9 A;  1CKK A;  1PSB A;  3JTD B;  1TTX A;  4QJ5 B;  1B7T Z;  3D10 A;  2KSP A;  1OMR A;  4D1E A;  1QLS A;  1JBA A;  1FF1 A;  2AAO A;  1K95 A;  1SNL A;  4I5J A;  5HLV A;  1CMG A;  1S5G Z;  2JOJ A;  4WQ3 A;  4USL A;  1LVC D;  1TNX A;  2JNF A;  1J7P A;  1KQM B;  3TDI A;  2I2R E;  1QVI Y;  3TDZ A;  2Y4Q A;  3WHU B;  3CS1 A;  2L98 A;  2MLF C;  3I5F C;  1EG4 A;  1SR6 C;  1N2D A;  2RGI A;  1MWN A;  2KI6 C;  2P6B B;  3EK4 A;  4MLW A;  3BUM B;  1YVL A;  3IF7 A;  3OHM B;  2LC5 A;  2K7C A;  3VGO A;  4P5O E;  1E8A A;  3BQ3 A;  1NPQ A;  3EVR A;  1CFC A;  1S6C A;  2K0J A;  1AK8 A;  3HX4 A;  1CLM A;  3CR5 X;  1B9A A;  2WC8 A;  5ER5 A;  5HKW A;  2BKH B;  2KBM A;  1SCV A;  1UWO A;  4L9M A;  4R1E A;  1QIW A;  2KGR A;  1XFY O;  1PRW A;  1TIZ A;  2KNE A;  2M97 A;  2PRU A;  3KEV A;  2HQW A;  3I5I C;  2FOT A;  1A2X A;  1K90 D;  3SG2 A;  5D69 A;  1TOP A;  2CTN A;  2GV5 A;  4FQO A;  4HSZ A;  1B8L A;  1BJF A;  2JRF A;  3WHT B;  1M39 A;  1CFP A;  2HF5 A;  5HKY A;  4JQ0 D;  1KK7 Z;  2QPT A;  1UHJ A;  2KOT A;  4GNK B;  2L51 A;  3PAL A;  2DOQ A;  1BMO A;  3QRX A;  1M63 B;  1NUB A;  1OSA A;  1ZAC A;  1XYD A;  4YGA A;  1M46 A;  2I18 A;  2VRG A;  4GPL B;  5KTY A;  1WY9 A;  4M2P A;  2SAS A;  2KYC A;  4PDZ A;  1CFF A;  2BBM A;  3O4Y A;  1SL7 A;  5CPV A;  5IBW A;  1RK9 A;  5CSF A;  3D0Y A;  4TNC A;  2LHL A;  2BCB A;  1CDP A;  2O60 A;  4NDC A;  4Q04 A;  5AAN A;  1F55 A;  1DJH A;  1KFU S;  3PN7 C;  1EH2 A;  1C7W A;  2WCE A;  4QJ3 B;  5ER4 X;  1F8H A;  1JFK A;  2LVV A;  1PAL A;  4PCW A;  2EC6 B;  4PAL A;  1SW8 A;  1KFU L;  1LXF C;  1CDN A;  1KWO C;  3LK1 A;  3ICB A;  1NIW A;  1CFD A;  2LVK A;  1N0Y A;  2LM5 A;  1CLL A;  1YVH A;  1DTL A;  2JWW A;  4A4C A;  2KFH A;  4PHM A;  2WND A;  1B7T Y;  2F2O A;  2ZRS A;  3I5G B;  3LK0 A;  1V1F A;  3AKB A;  1S5G Y;  2D8N A;  2ZND A;  3PSR A;  3VRQ A;  3IQQ A;  1DJG A;  5HLO A;  5PAL A;  3BUO B;  4JWQ A;  1YRT B;  2LE9 B;  3GK1 A;  2K61 A;  1SYM A;  1XVJ A;  1MXL C;  1H8B A;  1SBJ A;  1AVS A;  1PUL A;  3NSO A;  5D7F A;  1J1E A;  3WNX B;  4M2Q A;  5AXI A;  1QTX A;  1W7I B;  1MQ1 A;  1A29 A;  1H4B A;  2FCE A;  4DCK A;  2JT8 A;  2M7N A;  2KAY A;  4MN0 A;  3JVT C;  4BY5 A;  5JOL A;  2WOS A;  1DGV A;  1CB1 A;  2CBL A;  1CM1 A;  5CSJ A;  2K7O A;  1LA0 A;  1Y1A A;  4XJK A;  4ETO A;  2LLU A;  4XYN A;  2BL0 C;  3FS7 A;  1EXR A;  2KDH A;  1CDM A;  1OMV A;  2JT3 A;  1TNW A;  4ZCV A;  1CTR A;  2BEC A;  2L4I A;  1NCX A;  2E30 A;  2Q91 A;  4C0J A;  1QV0 A;  1SL8 A;  4DRW A;  1K9U A;  1RWY A;  2WCB A;  2H61 A;  4N1G A;  4HRE E;  1YUU A;  3I5H C;  5CSN A;  5HYD A;  3BXK A;  2O5G A;  3GOF A;  2LVI A;  1BU3 A;  1MXE A;  2JT0 A;  3VRO A;  3CTN A;  4BY4 A;  3E3R A;  1SY9 A;  1L7Z A;  2F3Z A;  1KK7 Y;  1SR6 B;  3TS5 C;  5G08 A;  2LNK A;  1SCM C;  4ORB B;  2LHI A;  1M45 A;  3D0Y B;  4YBH B;  3TUY C;  1MHO A;  1UP5 A;  2M8U A;  3K21 A;  3MSE B;  3M0W A;  1XK4 C;  4OV2 A;  2FJU B;  2CNP A;  1ZFS A;  4AQJ A;  1YX7 A;  1KK8 C;  4ORA B;  4N5X A;  1QJT A;  1M31 A;  3TDU A;  1GGW A;  3OP0 A;  3ZNI A;  2F8P A;  2LMT A;  1BT6 A;  4GGF C;  3OB2 B;  1DJW A;  1DF0 A;  2NXQ A;  3PAT A;  2NCO A;  5AER A;  1JF0 A;  2OTG C;  1A75 A;  2OPO A;  4PE0 A;  3FIA A;  2HET A;  3EVU A;  5AEQ A;  4QJ4 B;  1NX1 A;  1TN4 A;  1CDL A;  2JXC A;  5CSI A;  1L2O C;  2ZKM X;  3CWG A;  3F45 A;  1FBV A;  3A8R A;  1WRZ A;  2WOR A;  1YUR A;  1GJY A;  1CM4 A;  4MEW A;  2MBX A;  2ZRT A;  3A4U B;  3C1V A;  3TZ1 A;  4CLN A;  4MSP A;  2G9B A;  4YGB B;  1MR8 A;  1OZO A;  1S6J A;  4F0Z B;  1IH0 A;  1IJ6 A;  5I2O A;  2M29 A;  3OX5 A;  1QX5 B;  1QS7 A;  1QX7 A;  1TRF A;  3O78 A;  1ALV A;  3AAJ A;  3NSL A;  2CCM A;  4PHJ A;  1R6P A;  2CXJ A;  3SG5 A;  4PHK A;  2LMU A;  3IQO A;  4PE4 A;  2OS8 C;  2EGD A;  1REC A;  1QX2 A;  1G4Y R;  2L50 A;  1GGZ A;  5TNC A;  2K8M B;  4YGC B;  4XJK B;  2Y1M A;  3CGA A;  2Y5I A;  4MZL A;  1UHK A;  1J55 A;  1S3P A;  2M49 B;  3SIB A;  1LA3 A;  3KPX A;  1B8C A;  2JZI A;  3EKJ A;  3LCP C;  4GGF A;  3SIA A;  4AOM A;  1D1O A;  1OZS A;  1N65 A;  1FI6 A;  3NSI A;  4YI8 A;  4YGD B;  2ISD A;  2KAV A;  4IL1 A;  5B8I B;  1IWQ A;  4YI9 A;  1Y1U A;  2JUL A;  1K9P A;  3DF0 A;  1WDC C;  3VRN A;  1DMO A;  5JJG A;  2BE4 A;  2KI4 B;  3PM8 A;  2L0P A;  5I2L A;  4GUK A;  2ZN8 A;  3EVV A;  1ZUZ A;  3AAK A;  4NQG A;  2PAL A;  1C7V A;  1K93 D;  3SJS A;  4MZJ A;  4GFT A;  1K9K A;  5BPJ A;  3CR4 X;  2KGB C;  1IQ3 A;  3OX6 A;  3BUN B;  4PHN A;  3DD4 A;  4MRY A;  4GGN A;  5DKQ A;  1JFJ A;  4JPZ B;  4I5L B;  4I5N B;  1W7J B;  1PK0 D;  2KI6 D;  2E6W A;  5I2Q A;  2PAS A;  1G33 A;  3NSK A;  2AUC A;  3CLN A;  2K2A A;  3DVE A;  2LCP A;  1JF2 A;  1KSO A;  4CFR A;  1DJX A;  1DF0 B;  1LIN A;  3VRP A;  2MHH A;  2JC2 A;  1A75 B;  5DKR A;  1IGV A;  2JQ6 A;  4C0K A;  4PE7 A;  3GK2 A;  5HKZ A;  1YR5 A;  3KO0 A;  1YRU B;  3O6B A;  4MBE A;  1EL4 A;  1S1E A;  1TCF A;  2LV7 A;  1F54 A;  1KQV A;  4WRI A;  1Y6W A;  5DKN A;  1XFZ O;  1B1G A;  1ALW A;  1BOC A;  2SCP A;  1J1D A;  2G2B A;  4ICB A;  1BR4 B;  2L4H A;  3I5F B;  1HQV A;  1V1G A;  2ZFD A;  2L2E A;  2AMI A;  2PSR A;  2F3Y A;  5I8N A;  1SCM B;  1K8U A;  5K89 A;  2K7D A;  1K94 A;  5KU1 A;  1QV1 A;  1B8R A;  1U5I B;  2M1U A;  3JTD C;  3RM1 A;  1HT9 A;  3BOW A;  3OB1 B;  1B47 A;  2CT9 A;  4A4B A;  1CMF A;  2KHN A;  4MVF A;  3DVJ A;  3CR2 A;  2JTZ A;  1AUI B;  1OOJ A;  2MLE C;  1UHN A;  1XFU O;  1F4Q A;  2MRD A;  1SMG A;  4NDB A;  1GQM A;  1IRJ A;  2KFG A;  3BUX B;  1KK8 B;  3SG3 A;  2F2P A;  2HPS A;  1KQM C;  1TNP A;  2LUC A;  1LKJ A;  2M3W A;  3EK8 A;  1AP4 A;  1CNP A;  1RJV A;  5J3X A;  1A03 A;  2PMY A;  3I5I B;  3PLF B;  1DT7 B;  1PVB A;  1S6I A;  1S36 A;  2LMV A;  1RTP 1;  3WXA A;  1UUR A;  2HQ8 A;  1YX8 A;  2M0R A;  2OTG B;  2R2I A;  1SPY A;  1XFV O;  4ZCU A;  4HRG A;  2EHB A;  2PVB A;  1FW4 A;  1NCY A;  3SG6 A;  1VRK A;  1TCO B;  2F33 A;  2WCF A;  2I7A A;  1NX0 A;  3DF0 B;  1B4C A;  1L2O B;  2M9G A;  1UUS A;  3DVK A;  1AJ4 A;  4DUQ A;  1DJI A;  1YTZ C;  2JTT A;  2ZNE A;  1A4P A;  1SL9 A;  4CPV A;  1J7Q A;  1IKU A;  3FWC A;  4DIR A;  1ZOT B;  4NDD A;  4YGE B;  2FCD A;  1J7O A;  2M7L A;  1UHH A;  1DGU A;  2LAP A;  2BCX A;  3RLZ A;  3AKA A;  2JXL A;  2LLT A;  2K2F A;  1QIV A;  1NWD A;  2JPT A;  1IQ5 A;  1U5I A;  2I94 A;  2MAZ A;  3DVM A;  1BOD A;  1KSM A;  1XK4 A;  1QVI Z;  1OQP A;  2OS8 B;  1IJ5 A;  3GK4 X;  1YUT A;  1DVI A;  1S26 D;  2K7B A;  3PN7 B;  1R2U A;  4HRH A;  1K2H A;  2JNX A;  2IS9 A;  4YRU A;  3LL8 B;  2KBI A;  2GGM A;  3SG4 A;  1WLZ A;  3H4S E;  4E68 A;  2MA2 A;  1EJ3 A;  2M1K B;  2NLN A;  1NP8 A;  1AJ5 A;  5F6T A;  1G8I A;  2V53 A;  1KFX S;  1TNQ A;  1KWO B;  2Y1N A;  2QAC A;  2LLS A;  1QLK A;  3LLE A;  1FI5 A;  2KAX A;  1PSR A;  1DJZ A;  1NCZ A;  1MF8 B;  2KQ6 A;  1F70 A;  1F4O A;  1FPW A;  1NSH A;  1BG1 A;  1AHR A;  1KFX L;  3BYA A;  2JU0 A;  3VRR A;  2B1U A;  1ODB A;  1Y1X A;  2NZ0 A;  1WDC B;  4M2O A;  1WRL A;  4CID A;  1XO5 A;  4OR9 B;  2LUX A;  4P2Y B;  1X02 A;  2BBN A;  1XFX O;  2KFF A;  4OKH A;  4C0L A;  3FWB A;  1IG5 A;  1XFW O;  2EC6 C;  1BF5 A;  1Q80 A;  1SK6 D;  2A4J A;  4OVN F;  2TN4 A;  2KYF A;  2LVJ A;  3BOW B;  2L5X B;  4PE1 A;  5AFP A;  5FYX A;  2H61 C;  4DS7 A;  5GQQ C;  4FTG A;  1NYA A;  1F71 A;  1JUO A;  1NX3 A;  3I5G C;  1K96 A;  2BKI B;  3JVT B;  4I5K A;  4OCI A;  1WRK A;  1WLM A;  1BR1 B;  2COL B;  2KI4 C;  1OE9 B;  1JC2 A;  3PFV A;  2BCA A;  4WQ2 A;  4ORC B;  1JSA A;  2H2K A;  1PVA A;  3O2P A;  1SRA A;  2BL0 B;  4MRX A;  3BUW B;  1YUS A;  3EK7 A;  1QAS A;  3KHE A;  2LP2 A;  3SG7 A;  3NXA A; 
#chains in the Genus database with same CATH topology
 1NX2 A;  1Y0V H;  2ZN9 A;  4GAO A;  1C07 A;  1MUX A;  1XA5 A;  1SKT A;  1OW4 A;  2KQY A;  2LAN A;  3EKH A;  4MZK A;  5DIC A;  1J7R A;  3I5H B;  4U8D A;  3ZWH A;  4UPG A;  1KCY A;  1BLQ A;  2LP3 A;  2Q4U A;  3HCM A;  3CZT X;  1JWD A;  1UHI A;  1QAT A;  1CLB A;  2QEB A;  4GBA A;  4FQT A;  2MJW B;  2WC6 A;  3TS5 B;  1RRO A;  4N1F A;  1ZMZ A;  5KSZ A;  3S0D A;  2NCP A;  1OMD A;  1RFJ A;  4CFQ A;  1EG3 A;  1DJY A;  2WCJ A;  1QXP A;  2GGZ A;  3B87 A;  3TUY B;  1DQE A;  4AQI A;  2BE6 A;  1TUJ A;  3KF9 A;  1CKK A;  1PSB A;  3JTD B;  1TTX A;  3Q8I A;  1B7T Z;  4QJ5 B;  3D10 A;  2KSP A;  1OMR A;  4D1E A;  1QLS A;  1JBA A;  1FF1 A;  2AAO A;  1K95 A;  1SNL A;  4I5J A;  5HLV A;  1CMG A;  1S5G Z;  2JOJ A;  4WQ3 A;  4USL A;  1LVC D;  1TNX A;  2JNF A;  1J7P A;  1KQM B;  1OOH A;  3TDI A;  2I2R E;  1QVI Y;  3NHI A;  2Y4Q A;  3TDZ A;  3WHU B;  3CS1 A;  1C3Y A;  2L98 A;  2QEH A;  2MLF C;  3I5F C;  1EG4 A;  1SR6 C;  1N2D A;  2RGI A;  3UNW A;  1MWN A;  2KI6 C;  1DEL A;  2P6B B;  3EK4 A;  4MLW A;  3L4A A;  3BUM B;  1YVL A;  3IF7 A;  3OHM B;  2LC5 A;  2K7C A;  3VGO A;  3OGN A;  1E8A A;  2WCH A;  4P5O E;  3DY9 A;  3BQ3 A;  1NPQ A;  3EVR A;  2QDI A;  1CFC A;  1S6C A;  2K0J A;  1AK8 A;  3HX4 A;  1CLM A;  3CR5 X;  1B9A A;  2WC8 A;  5ER5 A;  5HKW A;  2BKH B;  2KBM A;  3FE6 A;  1SCV A;  1UWO A;  4L9M A;  4R1E A;  1QIW A;  2KGR A;  1XFY O;  1PRW A;  1TIZ A;  2KNE A;  2M97 A;  2PRU A;  3KEV A;  2HQW A;  3I5I C;  2FOT A;  1A2X A;  3S0A A;  3R1O A;  2K60 A;  1K90 D;  3SG2 A;  3CDN A;  5D69 A;  1TOP A;  2CTN A;  2GV5 A;  3BFA A;  4FQO A;  4HSZ A;  1B8L A;  1BJF A;  2JRF A;  4INX A;  1M39 A;  3WHT B;  2HF5 A;  3PJI A;  1CFP A;  3D78 A;  5HKY A;  4JQ0 D;  1KK7 Z;  2QPT A;  1UHJ A;  2KOT A;  4GNK B;  2L51 A;  3PAL A;  2DOQ A;  1BMO A;  3QRX A;  1M63 B;  1NUB A;  1OSA A;  1ZAC A;  1XYD A;  4YGA A;  1M46 A;  2I18 A;  2VRG A;  4GPL B;  3D77 A;  5KTY A;  1WY9 A;  4M2P A;  2SAS A;  2KYC A;  4PDZ A;  1CFF A;  2BBM A;  3O4Y A;  1SL7 A;  5CPV A;  5IBW A;  1RK9 A;  5CSF A;  3D0Y A;  4TNC A;  2LHL A;  2BCB A;  1CDP A;  2O60 A;  4NDC A;  4Q04 A;  5AAN A;  2WCL A;  1DJH A;  1F55 A;  1KFU S;  3PN7 C;  1EH2 A;  1C7W A;  2WCE A;  4QJ3 B;  5ER4 X;  3B7A A;  1F8H A;  3IVT A;  1JFK A;  2LVV A;  1PAL A;  4PCW A;  2EC6 B;  4PAL A;  1SW8 A;  1KFU L;  1LXF C;  3S0F A;  1CDN A;  2WC5 A;  3UO9 A;  2YGU A;  5EL2 A;  1KWO C;  3LK1 A;  3ICB A;  1NIW A;  1CFD A;  2LVK A;  1N0Y A;  2LM5 A;  1CLL A;  1YVH A;  1DTL A;  2JWW A;  4A4C A;  2KFH A;  2JPO A;  4PHM A;  1ORG A;  2WND A;  1B7T Y;  2F2O A;  2ZRS A;  3I5G B;  3LK0 A;  1V1F A;  2KLE A;  3AKB A;  3B6X A;  1S5G Y;  2D8N A;  2ZND A;  3PSR A;  3VRQ A;  3IQQ A;  1DJG A;  5HLO A;  5PAL A;  3BUO B;  3DXL A;  4JWQ A;  1YRT B;  2LE9 B;  3GK1 A;  2K61 A;  5I94 A;  1SYM A;  3L47 A;  5HL1 A;  1XVJ A;  1MXL C;  1H8B A;  1SBJ A;  1AVS A;  1PUL A;  3B88 A;  3NSO A;  1J1E A;  5D7F A;  3WNX B;  4M2Q A;  2KPH A;  5AXI A;  1QTX A;  1W7I B;  1MQ1 A;  2PYQ A;  1A29 A;  1H4B A;  2FCE A;  1Z4H A;  4DCK A;  2JT8 A;  2M7N A;  3DZT A;  2KAY A;  4MN0 A;  3JVT C;  4BY5 A;  5JOL A;  2WOS A;  1DGV A;  1CB1 A;  1GM0 A;  2CBL A;  1CM1 A;  5CSJ A;  2K7O A;  1LA0 A;  1Y1A A;  4XJK A;  3PM2 A;  2LLU A;  4ETO A;  4XYN A;  2BL0 C;  3FS7 A;  1EXR A;  2KDH A;  3CZ0 A;  1CDM A;  1OMV A;  2JT3 A;  1TNW A;  3FE9 A;  2QEV A;  4ZCV A;  1CTR A;  2BEC A;  2L4I A;  1NCX A;  2E30 A;  2Q91 A;  4C0J A;  1QV0 A;  1SL8 A;  4DRW A;  1K9U A;  1RWY A;  2L5Y A;  2H61 A;  2WCB A;  4N1G A;  4HRE E;  1YUU A;  3RZS A;  3I5H C;  5CSN A;  5HYD A;  3BXK A;  2O5G A;  3GOF A;  2LVI A;  1BU3 A;  1MXE A;  2JT0 A;  3VRO A;  3CTN A;  4BY4 A;  3E3R A;  1SY9 A;  1L7Z A;  1OOI X;  2F3Z A;  1KK7 Y;  1SR6 B;  3TS5 C;  5G08 A;  2LNK A;  1SCM C;  4ORB B;  2LHI A;  1M45 A;  3D0Y B;  4YBH B;  3TUY C;  1MHO A;  1UP5 A;  2M8U A;  3K21 A;  3MSE B;  1SSE B;  3M0W A;  1XK4 C;  3N7H A;  4OV2 A;  2FJU B;  2CNP A;  1ZFS A;  4AQJ A;  1YX7 A;  1KK8 C;  4ORA B;  4N5X A;  2FJY A;  2WCK A;  4KYN A;  1QJT A;  1M31 A;  4JKT A;  3TDU A;  1GGW A;  3OP0 A;  3ZNI A;  2F8P A;  2LMT A;  1BT6 A;  4GGF C;  3OB2 B;  1DJW A;  1DF0 A;  2NXQ A;  3PAT A;  2NCO A;  5AER A;  3K1E A;  1JF0 A;  2OTG C;  1A75 A;  2OPO A;  4INW A;  4PE0 A;  2QEO A;  3FIA A;  2HET A;  3EVU A;  5AEQ A;  4QJ4 B;  1NX1 A;  1TN4 A;  1CDL A;  2JXC A;  5CSI A;  1L2O C;  2ZKM X;  3CWG A;  3F45 A;  1FBV A;  3A8R A;  1WRZ A;  2WOR A;  1YUR A;  1GJY A;  1CM4 A;  4MEW A;  2MBX A;  2ZRT A;  3A4U B;  3C1V A;  3TZ1 A;  4CLN A;  3D73 A;  4MSP A;  2G9B A;  4YGB B;  1MR8 A;  1OZO A;  1S6J A;  4F0Z B;  1IH0 A;  3V2L A;  1IJ6 A;  5I2O A;  2M29 A;  3OX5 A;  1QX5 B;  1QS7 A;  1QX7 A;  1TRF A;  3O78 A;  1ALV A;  3AAJ A;  3NSL A;  2CCM A;  4PHJ A;  1R6P A;  2CXJ A;  3SG5 A;  2WCM A;  4PHK A;  2LMU A;  3CZ2 A;  3IQO A;  4PE4 A;  2OS8 C;  2EGD A;  1REC A;  1QX2 A;  1G4Y R;  2L50 A;  1GGZ A;  5TNC A;  1XFR A;  2K8M B;  4YGC B;  4XJK B;  2Y1M A;  3CGA A;  2Y5I A;  3BFB A;  4MZL A;  1UHK A;  1J55 A;  1S3P A;  3S0E A;  2M49 B;  3SIB A;  1LA3 A;  3KPX A;  1B8C A;  2JZI A;  3EKJ A;  3LCP C;  4GGF A;  3SIA A;  4AOM A;  1D1O A;  1OZS A;  1N65 A;  1FI6 A;  3NSI A;  3CAB A;  3R1V A;  4YI8 A;  3D74 A;  3SS4 A;  4YGD B;  5FI6 A;  2ISD A;  2KAV A;  4IL1 A;  5B8I B;  1IWQ A;  4YI9 A;  1Y1U A;  2JUL A;  1K9P A;  3D76 A;  3DF0 A;  1WDC C;  3VRN A;  1DMO A;  5JJG A;  2BE4 A;  2KI4 B;  3OBV A;  3PM8 A;  2L0P A;  5I2L A;  4IJ7 A;  4GUK A;  2ZN8 A;  3EVV A;  1ZUZ A;  3AAK A;  4NQG A;  2PAL A;  1TUZ A;  1C7V A;  1K93 D;  3SJS A;  4MZJ A;  4GFT A;  1K9K A;  5BPJ A;  3CR4 X;  2KGB C;  1IQ3 A;  3OX6 A;  3BUN B;  4PHN A;  3DD4 A;  4MRY A;  4GGN A;  5DKQ A;  1JFJ A;  4JPZ B;  4I5L B;  4I5N B;  1W7J B;  1PK0 D;  2KI6 D;  2E6W A;  5I2Q A;  2PAS A;  1G33 A;  3NSK A;  2P70 A;  2AUC A;  3CLN A;  2K2A A;  3DVE A;  2LCP A;  3R72 A;  1JF2 A;  1KSO A;  4CFR A;  2BNX A;  2BAP A;  1DJX A;  1DF0 B;  4PT1 A;  1LIN A;  3VRP A;  2MHH A;  2JC2 A;  1A75 B;  5DKR A;  1IGV A;  2JQ6 A;  4C0K A;  4PE7 A;  2PQL A;  5FI2 A;  1C3Z A;  1LS8 A;  3GK2 A;  5HKZ A;  1YR5 A;  3KO0 A;  1YRU B;  3O6B A;  4MBE A;  1EL4 A;  1S1E A;  1TCF A;  2LV7 A;  1F54 A;  1KQV A;  4OZD A;  4WRI A;  1Y6W A;  5DKN A;  1XFZ O;  1B1G A;  1DEK A;  1ALW A;  1BOC A;  2SCP A;  1J1D A;  2G2B A;  4ICB A;  3SS3 A;  1BR4 B;  1TWO A;  2L4H A;  3D75 A;  3I5F B;  1HQV A;  1V1G A;  2ZFD A;  1OOG A;  2L2E A;  2AMI A;  2PSR A;  2F3Y A;  5I8N A;  1SCM B;  1K8U A;  5K89 A;  2K7D A;  1K94 A;  5KU1 A;  1QV1 A;  1B8R A;  1U5I B;  2M1U A;  3JTD C;  3RM1 A;  3NGV A;  1HT9 A;  3BOW A;  3OB1 B;  1B47 A;  2CT9 A;  4A4B A;  1CMF A;  2KHN A;  4MVF A;  3DVJ A;  3CR2 A;  2JTZ A;  1AUI B;  1OOJ A;  2MLE C;  1UHN A;  1XFU O;  1F4Q A;  2MRD A;  1SMG A;  4NDB A;  1GQM A;  1IRJ A;  2KFG A;  3BUX B;  1KK8 B;  3SG3 A;  2F2P A;  2HPS A;  1KQM C;  1TNP A;  2LUC A;  1LKJ A;  2M3W A;  3EK8 A;  1AP4 A;  1CNP A;  1RJV A;  5J3X A;  1A03 A;  2PMY A;  3FE8 A;  3I5I B;  3PLF B;  1PVB A;  1DT7 B;  1S6I A;  1S36 A;  2LMV A;  1RTP 1;  3WXA A;  1UUR A;  2HQ8 A;  1P28 A;  1W9Z A;  1YX8 A;  2M0R A;  2OTG B;  2R2I A;  1SPY A;  1XFV O;  3R1P A;  4ZCU A;  4HRG A;  2EHB A;  2PVB A;  1FW4 A;  1NCY A;  2KLD A;  3SG6 A;  1VRK A;  1TCO B;  2F33 A;  2WCF A;  2I7A A;  1NX0 A;  3DF0 B;  1B4C A;  1L2O B;  2M9G A;  1UUS A;  3DVK A;  1AJ4 A;  4DUQ A;  1DJI A;  3VB1 A;  1YTZ C;  3O4X A;  2JTT A;  2ZNE A;  1A4P A;  1SL9 A;  4CPV A;  1J7Q A;  1IKU A;  3BJH A;  3FWC A;  4DIR A;  2GTE A;  1ZOT B;  4NDD A;  4YGE B;  2FCD A;  1J7O A;  2M7L A;  1UHH A;  1DGU A;  2LAP A;  2BCX A;  3RLZ A;  3BFH A;  3AKA A;  2JXL A;  2LLT A;  2K2F A;  1QIV A;  1NWD A;  4JD9 A;  2ERB A;  2P71 A;  5D3O A;  2JPT A;  1IQ5 A;  1U5I A;  2I94 A;  2MAZ A;  3DVM A;  1BOD A;  1KSM A;  1XK4 A;  1QVI Z;  1OQP A;  2OS8 B;  1IJ5 A;  3GK4 X;  3EG5 B;  3NHT A;  1YUT A;  1DVI A;  1S26 D;  2K7B A;  3PN7 B;  1R2U A;  4HRH A;  1K2H A;  2JNX A;  2IS9 A;  4YRU A;  3B86 A;  3LL8 B;  2KBI A;  2GGM A;  3SG4 A;  3QME A;  1WLZ A;  3H4S E;  4E68 A;  2MA2 A;  1EJ3 A;  2M1K B;  2NLN A;  1NP8 A;  1AJ5 A;  5F6T A;  1G8I A;  2V53 A;  1KFX S;  1TNQ A;  1KWO B;  2Y1N A;  2QAC A;  2LLS A;  1QLK A;  3LLE A;  1FI5 A;  2KAX A;  1PSR A;  1DJZ A;  1NCZ A;  1MF8 B;  2KQ6 A;  1F70 A;  1F4O A;  1FPW A;  1NSH A;  1BG1 A;  1AHR A;  1KFX L;  3BYA A;  1QWV A;  2JU0 A;  1IIO A;  1T14 A;  2B1U A;  1ODB A;  1Y1X A;  2NZ0 A;  3VRR A;  1WDC B;  3CYZ A;  4F7F A;  4M2O A;  1WRL A;  4CID A;  1XO5 A;  1OOF A;  4OR9 B;  2LUX A;  4P2Y B;  1X02 A;  2BBN A;  1XFX O;  2KFF A;  4OKH A;  3S0B A;  4C0L A;  3FWB A;  1Z2C B;  1IG5 A;  1XFW O;  2EC6 C;  1BF5 A;  1Q80 A;  1SK6 D;  2A4J A;  4OVN F;  2TN4 A;  2KYF A;  2LVJ A;  3BOW B;  3SS5 A;  2L5X B;  4PE1 A;  5AFP A;  2H8V A;  5FYX A;  2H61 C;  4DS7 A;  3CZ1 A;  5GQQ C;  4FTG A;  1NYA A;  1F71 A;  1JUO A;  1NX3 A;  3I5G C;  1K96 A;  2BKI B;  3JVT B;  4I5K A;  4OCI A;  1WRK A;  1WLM A;  1BR1 B;  2COL B;  2KI4 C;  1OE9 B;  1JC2 A;  3PFV A;  2L2C A;  2BCA A;  3S0G A;  4WQ2 A;  3L4L A;  4ORC B;  1JSA A;  2H2K A;  1PVA A;  3O2P A;  5FI7 A;  1DC1 A;  1SRA A;  2BL0 B;  4MRX A;  3BUW B;  1YUS A;  3EK7 A;  1QAS A;  3DYE A;  3KHE A;  2LP2 A;  3SG7 A;  3NXA A; 
#chains in the Genus database with same CATH homology
 1NX2 A;  1Y0V H;  2ZN9 A;  4GAO A;  1C07 A;  1MUX A;  1XA5 A;  1SKT A;  2LAN A;  2KQY A;  3EKH A;  4MZK A;  1J7R A;  3I5H B;  4U8D A;  3ZWH A;  4UPG A;  1KCY A;  1BLQ A;  2LP3 A;  2Q4U A;  3HCM A;  3CZT X;  1JWD A;  1UHI A;  1QAT A;  1CLB A;  4GBA A;  2MJW B;  3TS5 B;  1RRO A;  4N1F A;  1ZMZ A;  5KSZ A;  2NCP A;  1OMD A;  1RFJ A;  4CFQ A;  1EG3 A;  1DJY A;  1QXP A;  2GGZ A;  3TUY B;  4AQI A;  2BE6 A;  3KF9 A;  1CKK A;  1PSB A;  3JTD B;  1TTX A;  4QJ5 B;  1B7T Z;  3D10 A;  2KSP A;  1OMR A;  4D1E A;  1QLS A;  1JBA A;  1FF1 A;  2AAO A;  1K95 A;  1SNL A;  4I5J A;  5HLV A;  1CMG A;  1S5G Z;  2JOJ A;  4WQ3 A;  4USL A;  1LVC D;  1TNX A;  2JNF A;  1J7P A;  1KQM B;  3TDI A;  2I2R E;  1QVI Y;  3TDZ A;  2Y4Q A;  3WHU B;  3CS1 A;  2L98 A;  2MLF C;  3I5F C;  1EG4 A;  1SR6 C;  1N2D A;  2RGI A;  1MWN A;  2KI6 C;  2P6B B;  3EK4 A;  4MLW A;  3BUM B;  1YVL A;  3IF7 A;  3OHM B;  2LC5 A;  2K7C A;  3VGO A;  4P5O E;  1E8A A;  3BQ3 A;  1NPQ A;  3EVR A;  1CFC A;  1S6C A;  2K0J A;  1AK8 A;  3HX4 A;  1CLM A;  3CR5 X;  1B9A A;  2WC8 A;  5ER5 A;  5HKW A;  2BKH B;  2KBM A;  1SCV A;  1UWO A;  4L9M A;  4R1E A;  1QIW A;  2KGR A;  1XFY O;  1PRW A;  1TIZ A;  2KNE A;  2M97 A;  2PRU A;  3KEV A;  2HQW A;  3I5I C;  2FOT A;  1A2X A;  1K90 D;  3SG2 A;  5D69 A;  1TOP A;  2CTN A;  2GV5 A;  4FQO A;  4HSZ A;  1B8L A;  1BJF A;  2JRF A;  3WHT B;  1M39 A;  1CFP A;  2HF5 A;  5HKY A;  4JQ0 D;  1KK7 Z;  2QPT A;  1UHJ A;  2KOT A;  4GNK B;  2L51 A;  3PAL A;  2DOQ A;  1BMO A;  3QRX A;  1M63 B;  1NUB A;  1OSA A;  1ZAC A;  1XYD A;  4YGA A;  1M46 A;  2I18 A;  2VRG A;  4GPL B;  5KTY A;  1WY9 A;  4M2P A;  2SAS A;  2KYC A;  4PDZ A;  1CFF A;  2BBM A;  3O4Y A;  1SL7 A;  5CPV A;  5IBW A;  1RK9 A;  5CSF A;  3D0Y A;  4TNC A;  2LHL A;  2BCB A;  1CDP A;  2O60 A;  4NDC A;  4Q04 A;  5AAN A;  1F55 A;  1DJH A;  1KFU S;  3PN7 C;  1EH2 A;  1C7W A;  2WCE A;  4QJ3 B;  5ER4 X;  1F8H A;  1JFK A;  2LVV A;  1PAL A;  4PCW A;  2EC6 B;  4PAL A;  1SW8 A;  1KFU L;  1LXF C;  1CDN A;  1KWO C;  3LK1 A;  3ICB A;  1NIW A;  1CFD A;  2LVK A;  1N0Y A;  2LM5 A;  1CLL A;  1YVH A;  1DTL A;  2JWW A;  4A4C A;  2KFH A;  4PHM A;  2WND A;  1B7T Y;  2F2O A;  2ZRS A;  3I5G B;  3LK0 A;  1V1F A;  3AKB A;  1S5G Y;  2D8N A;  2ZND A;  3PSR A;  3VRQ A;  3IQQ A;  1DJG A;  5HLO A;  5PAL A;  3BUO B;  4JWQ A;  1YRT B;  2LE9 B;  3GK1 A;  2K61 A;  1SYM A;  1XVJ A;  1MXL C;  1H8B A;  1SBJ A;  1AVS A;  1PUL A;  3NSO A;  5D7F A;  1J1E A;  3WNX B;  4M2Q A;  5AXI A;  1QTX A;  1W7I B;  1MQ1 A;  1A29 A;  1H4B A;  2FCE A;  4DCK A;  2JT8 A;  2M7N A;  2KAY A;  4MN0 A;  3JVT C;  4BY5 A;  5JOL A;  2WOS A;  1DGV A;  1CB1 A;  2CBL A;  1CM1 A;  5CSJ A;  2K7O A;  1LA0 A;  1Y1A A;  4XJK A;  4ETO A;  2LLU A;  4XYN A;  2BL0 C;  3FS7 A;  1EXR A;  2KDH A;  1CDM A;  1OMV A;  2JT3 A;  1TNW A;  4ZCV A;  1CTR A;  2BEC A;  2L4I A;  1NCX A;  2E30 A;  2Q91 A;  4C0J A;  1QV0 A;  1SL8 A;  4DRW A;  1K9U A;  1RWY A;  2WCB A;  2H61 A;  4N1G A;  4HRE E;  1YUU A;  3I5H C;  5CSN A;  5HYD A;  3BXK A;  2O5G A;  3GOF A;  2LVI A;  1BU3 A;  1MXE A;  2JT0 A;  3VRO A;  3CTN A;  4BY4 A;  3E3R A;  1SY9 A;  1L7Z A;  2F3Z A;  1KK7 Y;  1SR6 B;  3TS5 C;  5G08 A;  2LNK A;  1SCM C;  4ORB B;  2LHI A;  1M45 A;  3D0Y B;  4YBH B;  3TUY C;  1MHO A;  1UP5 A;  2M8U A;  3K21 A;  3MSE B;  3M0W A;  1XK4 C;  4OV2 A;  2FJU B;  2CNP A;  1ZFS A;  4AQJ A;  1YX7 A;  1KK8 C;  4ORA B;  4N5X A;  1QJT A;  1M31 A;  3TDU A;  1GGW A;  3OP0 A;  3ZNI A;  2F8P A;  2LMT A;  1BT6 A;  4GGF C;  3OB2 B;  1DJW A;  1DF0 A;  2NXQ A;  3PAT A;  2NCO A;  5AER A;  1JF0 A;  2OTG C;  1A75 A;  2OPO A;  4PE0 A;  3FIA A;  2HET A;  3EVU A;  5AEQ A;  4QJ4 B;  1NX1 A;  1TN4 A;  1CDL A;  2JXC A;  5CSI A;  1L2O C;  2ZKM X;  3CWG A;  3F45 A;  1FBV A;  3A8R A;  1WRZ A;  2WOR A;  1YUR A;  1GJY A;  1CM4 A;  4MEW A;  2MBX A;  2ZRT A;  3A4U B;  3C1V A;  3TZ1 A;  4CLN A;  4MSP A;  2G9B A;  4YGB B;  1MR8 A;  1OZO A;  1S6J A;  4F0Z B;  1IH0 A;  1IJ6 A;  5I2O A;  2M29 A;  3OX5 A;  1QX5 B;  1QS7 A;  1QX7 A;  1TRF A;  3O78 A;  1ALV A;  3AAJ A;  3NSL A;  2CCM A;  4PHJ A;  1R6P A;  2CXJ A;  3SG5 A;  4PHK A;  2LMU A;  3IQO A;  4PE4 A;  2OS8 C;  2EGD A;  1REC A;  1QX2 A;  1G4Y R;  2L50 A;  1GGZ A;  5TNC A;  2K8M B;  4YGC B;  4XJK B;  2Y1M A;  3CGA A;  2Y5I A;  4MZL A;  1UHK A;  1J55 A;  1S3P A;  2M49 B;  3SIB A;  1LA3 A;  3KPX A;  1B8C A;  2JZI A;  3EKJ A;  3LCP C;  4GGF A;  3SIA A;  4AOM A;  1D1O A;  1OZS A;  1N65 A;  1FI6 A;  3NSI A;  4YI8 A;  4YGD B;  2ISD A;  2KAV A;  4IL1 A;  5B8I B;  1IWQ A;  4YI9 A;  1Y1U A;  2JUL A;  1K9P A;  3DF0 A;  1WDC C;  3VRN A;  1DMO A;  5JJG A;  2BE4 A;  2KI4 B;  3PM8 A;  2L0P A;  5I2L A;  4GUK A;  2ZN8 A;  3EVV A;  1ZUZ A;  3AAK A;  4NQG A;  2PAL A;  1C7V A;  1K93 D;  3SJS A;  4MZJ A;  4GFT A;  1K9K A;  5BPJ A;  3CR4 X;  2KGB C;  1IQ3 A;  3OX6 A;  3BUN B;  4PHN A;  3DD4 A;  4MRY A;  4GGN A;  5DKQ A;  1JFJ A;  4JPZ B;  4I5L B;  4I5N B;  1W7J B;  1PK0 D;  2KI6 D;  2E6W A;  5I2Q A;  2PAS A;  1G33 A;  3NSK A;  2AUC A;  3CLN A;  2K2A A;  3DVE A;  2LCP A;  1JF2 A;  1KSO A;  4CFR A;  1DJX A;  1DF0 B;  1LIN A;  3VRP A;  2MHH A;  2JC2 A;  1A75 B;  5DKR A;  1IGV A;  2JQ6 A;  4C0K A;  4PE7 A;  3GK2 A;  5HKZ A;  1YR5 A;  3KO0 A;  1YRU B;  3O6B A;  4MBE A;  1EL4 A;  1S1E A;  1TCF A;  2LV7 A;  1F54 A;  1KQV A;  4WRI A;  1Y6W A;  5DKN A;  1XFZ O;  1B1G A;  1ALW A;  1BOC A;  2SCP A;  1J1D A;  2G2B A;  4ICB A;  1BR4 B;  2L4H A;  3I5F B;  1HQV A;  1V1G A;  2ZFD A;  2L2E A;  2AMI A;  2PSR A;  2F3Y A;  5I8N A;  1SCM B;  1K8U A;  5K89 A;  2K7D A;  1K94 A;  5KU1 A;  1QV1 A;  1B8R A;  1U5I B;  2M1U A;  3JTD C;  3RM1 A;  1HT9 A;  3BOW A;  3OB1 B;  1B47 A;  2CT9 A;  4A4B A;  1CMF A;  2KHN A;  4MVF A;  3DVJ A;  3CR2 A;  2JTZ A;  1AUI B;  1OOJ A;  2MLE C;  1UHN A;  1XFU O;  1F4Q A;  2MRD A;  1SMG A;  4NDB A;  1GQM A;  1IRJ A;  2KFG A;  3BUX B;  1KK8 B;  3SG3 A;  2F2P A;  2HPS A;  1KQM C;  1TNP A;  2LUC A;  1LKJ A;  2M3W A;  3EK8 A;  1AP4 A;  1CNP A;  1RJV A;  5J3X A;  1A03 A;  2PMY A;  3I5I B;  3PLF B;  1DT7 B;  1PVB A;  1S6I A;  1S36 A;  2LMV A;  1RTP 1;  3WXA A;  1UUR A;  2HQ8 A;  1YX8 A;  2M0R A;  2OTG B;  2R2I A;  1SPY A;  1XFV O;  4ZCU A;  4HRG A;  2EHB A;  2PVB A;  1FW4 A;  1NCY A;  3SG6 A;  1VRK A;  1TCO B;  2F33 A;  2WCF A;  2I7A A;  1NX0 A;  3DF0 B;  1B4C A;  1L2O B;  2M9G A;  1UUS A;  3DVK A;  1AJ4 A;  4DUQ A;  1DJI A;  1YTZ C;  2JTT A;  2ZNE A;  1A4P A;  1SL9 A;  4CPV A;  1J7Q A;  1IKU A;  3FWC A;  4DIR A;  1ZOT B;  4NDD A;  4YGE B;  2FCD A;  1J7O A;  2M7L A;  1UHH A;  1DGU A;  2LAP A;  2BCX A;  3RLZ A;  3AKA A;  2JXL A;  2LLT A;  2K2F A;  1QIV A;  1NWD A;  2JPT A;  1IQ5 A;  1U5I A;  2I94 A;  2MAZ A;  3DVM A;  1BOD A;  1KSM A;  1XK4 A;  1QVI Z;  1OQP A;  2OS8 B;  1IJ5 A;  3GK4 X;  1YUT A;  1DVI A;  1S26 D;  2K7B A;  3PN7 B;  1R2U A;  4HRH A;  1K2H A;  2JNX A;  2IS9 A;  4YRU A;  3LL8 B;  2KBI A;  2GGM A;  3SG4 A;  1WLZ A;  3H4S E;  4E68 A;  2MA2 A;  1EJ3 A;  2M1K B;  2NLN A;  1NP8 A;  1AJ5 A;  5F6T A;  1G8I A;  2V53 A;  1KFX S;  1TNQ A;  1KWO B;  2Y1N A;  2QAC A;  2LLS A;  1QLK A;  3LLE A;  1FI5 A;  2KAX A;  1PSR A;  1DJZ A;  1NCZ A;  1MF8 B;  2KQ6 A;  1F70 A;  1F4O A;  1FPW A;  1NSH A;  1BG1 A;  1AHR A;  1KFX L;  3BYA A;  2JU0 A;  3VRR A;  2B1U A;  1ODB A;  1Y1X A;  2NZ0 A;  1WDC B;  4M2O A;  1WRL A;  4CID A;  1XO5 A;  4OR9 B;  2LUX A;  4P2Y B;  1X02 A;  2BBN A;  1XFX O;  2KFF A;  4OKH A;  4C0L A;  3FWB A;  1IG5 A;  1XFW O;  2EC6 C;  1BF5 A;  1Q80 A;  1SK6 D;  2A4J A;  4OVN F;  2TN4 A;  2KYF A;  2LVJ A;  3BOW B;  2L5X B;  4PE1 A;  5AFP A;  5FYX A;  2H61 C;  4DS7 A;  5GQQ C;  4FTG A;  1NYA A;  1F71 A;  1JUO A;  1NX3 A;  3I5G C;  1K96 A;  2BKI B;  3JVT B;  4I5K A;  4OCI A;  1WRK A;  1WLM A;  1BR1 B;  2COL B;  2KI4 C;  1OE9 B;  1JC2 A;  3PFV A;  2BCA A;  4WQ2 A;  4ORC B;  1JSA A;  2H2K A;  1PVA A;  3O2P A;  1SRA A;  2BL0 B;  4MRX A;  3BUW B;  1YUS A;  3EK7 A;  1QAS A;  3KHE A;  2LP2 A;  3SG7 A;  3NXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...