2KAXA

Solution structure and dynamics of s100a5 in the apo and ca2+ -bound states
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
b'METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A5
publication title Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 32
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kaxA00
1TTXA 1XK4A 2HPSA 5AERA 2L5XB 1U5IB 2LLUA 2JTZA 2KGRA 2F8PA 2M49B 2ZFDA 3GK1A 3PALA 4MZLA 4XJKB 3GK4X 2PALA 1BLQA 5HKYA 2KYCA 1A2XA 1GQMA 1GGZA 2K2FA 1MWNA 3FWBA 3OP0A 3D10A 2L51A 3OX5A 1KSOA 1KK8B 1B7TZ 1TOPA 4P2YB 5G08A 1KSMA 1AVSA 3IQQA 4A4BA 2BL0C 1U5IA 1C7WA 4XJKA 1S26D 2OS8B 1CTRA 2BCAA 2G2BA 3I5IB 3D0YA 2L98A 2M97A 1DGVA 2L4HA 1SBJA 1K93D 1MUXA 2JT8A 1CB1A 4CFQA 3FWCA 3A4UB 2BKHB 4PHJA 2SCPA 1FW4A 2M1UA 3VRNA 4YRUA 1K9KA 1TRFA 2K7DA 1SL8A 3I5FC 1QV1A 3NSIA 1FI5A 2BKIB 5I2OA 3CWGA 1FF1A 4U8DA 3ZNIA 1B47A 1BMOA 1OMDA 4GGFA 3JTDC 1J7RA 2Y5IA 2F2PA 1YX8A 2LV7A 1UP5A 2JPTA 2FJUB 1SW8A 3M0WA 3VGOA 2JT3A 2LE9B 1JFKA 1LA0A 1BODA 2L2EA 3HCMA 3SIBA 1FBVA 2LP2A 1LINA 4YGEB 2JNXA 3NSOA 1KFUL 3PN7B 4HSZA 1PVAA 2F3ZA 1NYAA 1DF0A 3EVVA 1NX0A 1DJGA 3BUXB 4MEWA 2GGZA 1J7OA 1IRJA 1LKJA 3ICBA 3SG7A 1MXLC 3O2PA 2JTTA 4PE0A 1B9AA 1DMOA 4XYNA 2WCBA 3IQOA 4CLNA 4C0JA 2JC2A 4CFRA 1XFVO 3BYAA 5D69A 1N65A 1HQVA 1LXFC 2FCEA 2LANA 1IQ3A 2F3YA 4C0LA 1BR4B 2L0PA 1SKTA 1OZOA 4ORCB 1ALVA 1V1GA 4PE7A 1CLMA 2K8MB 4USLA 1MQ1A 2NZ0A 3CR5X 1NCZA 2LUXA 2PSRA 1J1EA 1F4OA 5ER5A 4OKHA 5HKZA 1JF2A 2LMUA 3DF0B 3BQ3A 1ALWA 1DJYA 5TNCA 2BL0B 5KU1A 2LMVA 3CR4X 2BE4A 3TDZA 5HYDA 3SJSA 1YUTA 3VRQA 4DS7A 1SR6C 4MZKA 4GFTA 1BT6A 2M7NA 3TDIA 4PDZA 1JFJA 1EXRA 1XA5A 2WORA 1UHKA 1J1DA 2CT9A 4PHKA 3C1VA 2EC6C 3WHUB 1PALA 4OR9B 3I5FB 1CDMA 1HT9A 4M2QA 4N1GA 1LA3A 2D8NA 1ZMZA 1MF8B 1QXPA 1OE9B 1XO5A 1L2OC 2G9BA 3JTDB 4I5KA 1SRAA 3CZTX 2I7AA 3I5GC 1NPQA 5CPVA 1B4CA 2AUCA 1S36A 4ICBA 2OTGC 1IG5A 3ZWHA 2LLTA 1CM1A 5CSFA 1SL7A 2MHHA 1M31A 1QASA 4HREE 1NP8A 1IJ5A 4BY5A 1NX3A 3DVEA 1ZOTB 3DD4A 1A4PA 1EG4A 4HRGA 1NUBA 4I5NB 1QLKA 5HKWA 1NX2A 4QJ3B 2K61A 4JWQA 2AMIA 2KFGA 2LVVA 2HQ8A 3D0YB 1SPYA 1PRWA 5DKRA 2KBIA 2JULA 1OZSA 2JOJA 1WY9A 1K8UA 2NXQA 1D1OA 2F2OA 3SG2A 3O6BA 5DKNA 3I5HC 5IBWA 4YGCB 1W7IB 3SIAA 4WQ3A 1F71A 5KTYA 1MR8A 2IS9A 3WHTB 2RGIA 2KBMA 4GGNA 1QS7A 1W7JB 1UURA 2KQ6A 2M29A 2VRGA 3BOWB 3PATA 2KGBC 1A75B 1QTXA 4GPLB 3OHMB 1TIZA 2JT0A 1B8CA 1K90D 1S5GY 2M8UA 5CSIA 4M2OA 2O5GA 1AJ5A 1E8AA 1NWDA 1QLSA 2KSPA 1UWOA 2BCBA 1Y1UA 2KFHA 1DTLA 2JZIA 1A03A 3OB2B 4YGDB 4I5JA 3A8RA 5HLOA 1BR1B 2M9GA 1DF0B 2LVJA 2MLFC 1CMFA 2E30A 1KK7Y 2AAOA 3LK0A 2KQYA 1SR6B 2WCEA 4CPVA 3BOWA 1XYDA 1FPWA 1A75A 4D1EA 1LVCD 1K2HA 2KDHA 3EK4A 2EHBA 3AKBA 1K94A 1CLBA 2EC6B 5JJGA 2KAYA 4GUKA 2NCOA 1V1FA 1SNLA 1OMVA 1B1GA 1IH0A 4AQJA 2KYFA 1L7ZA 1CDPA 2LVIA 3AKAA 1OSAA 2KAVA 1FI6A 1VRKA 3KEVA 3I5GB 3RLZA 4DUQA 1NIWA 2KI6D 3O4YA 3VROA 3GOFA 1BF5A 1JBAA 2OTGB 3VRRA 2OPOA 1K95A 2K2AA 4MSPA 1Y6WA 3EKHA 4MBEA 2KI4C 2WCFA 5I2LA 2MBXA 2JQ6A 2BBMA 2CNPA 2Y4QA 3H4SE 1R6PA 2I18A 1BJFA 3NXAA 1PSRA 4MRXA 5BPJA 1OOJA 3BXKA 2KI6C 4PHNA 5AEQA 3CTNA 4C0KA 1C7VA 4GBAA 1JUOA 1PVBA 1CNPA 1H4BA 2JU0A 4MVFA 1EL4A 4MRYA 1JSAA 3PM8A 1RECA 1S6CA 1SCVA 1SY9A 2B1UA 2JXLA 3I5HB 3FIAA 1PK0D 2QPTA 1AJ4A 2LCPA 1DVIA 2WC8A 2MRDA 1KQMC 4N1FA 3BUWB 3WXAA 1QX2A 4ZCVA 1UHNA 4M2PA 2LNKA 3WNXB 1CDNA 1B8LA 4OV2A 3TDUA 3LL8B 1BOCA 2M7LA 1UHHA 3CS1A 4WQ2A 1YRTB 1DJHA 5J3XA 3JVTC 1RJVA 4L9MA 1XFUO 1EH2A 1RFJA 1EJ3A 1YUSA 1ZUZA 2LC5A 2Y1NA 1S6JA 2P6BB 1F8HA 4JPZB 1BU3A 4QJ4B 2BE6A 1TNPA 3BUOB 1ZACA 2R2IA 1PSBA 1TCOB 1JC2A 3RM1A 1C07A 4HRHA 1UHJA 1NCYA 1G4YR 4DRWA 1QJTA 1K9PA 2LP3A 1YURA 2ZRSA 4YI9A 5CSNA 1TN4A 3TUYC 4NDBA 3EKJA 5AANA 1QATA 4YBHB 3EK7A 1KCYA 5ER4X 1JF0A 1K96A 1WRZA 1XVJA 1G33A 3NSKA 3PN7C 1B7TY 3QRXA 1IWQA 1G8IA 3O78A 2I2RE 3LLEA 2MJWB 1YR5A 4TNCA 2WNDA 3LK1A 3K21A 4YGAA 4NDCA 2FCDA 1IJ6A 1KQVA 1PULA 2JNFA 1NCXA 5AFPA 1XFXO 2F33A 5JOLA 3SG3A 1XFZO 5K89A 2KI4B 1R2UA 5FYXA 2LM5A 1TCFA 5GQQC 3SG6A 2NCPA 2L4IA 3DVMA 2ZRTA 3EK8A 5HLVA 1TNXA 1N2DA 1J7PA 4ZCUA 1M39A 1F4QA 2A4JA 1AUIB 4PE4A 4CIDA 4JQ0D 3LCPC 1EG3A 1SMGA 3TZ1A 3TS5C 1QX7A 1QX5B 1CFPA 4DCKA 2KAXA 1QVIY 3GK2A 2Q91A 1MHOA 2V53A 1KQMB 3PLFB 1DGUA 4FTGA 2ZN8A 3KO0A 4UPGA 2M1KB 2BECA 2O60A 1M46A 2CBLA 2CXJA 1DJZA 2BCXA 1WRLA 1KWOC 1CFFA 1XFWO 1OQPA 4ORBB 3JVTB 2TN4A 2COLB 3CGAA 3DVJA 3AAKA 3BUMB 1YVHA 1X02A 2PMYA 2H2KA 2E6WA 4QJ5B 1WLZA 1SCMC 2K7OA 2KFFA 2MAZA 2LHLA 2ZNEA 2HETA 4PE1A 1WRKA 1WDCC 1XFYO 1Y1AA 2HF5A 1IGVA 1TNQA 1XK4C 2QACA 3CLNA 2DOQA 1AP4A 1CM4A 4GAOA 1L2OB 2LHIA 1A29A 4P5OE 1B8RA 1KFXL 1S5GZ 3KPXA 3EVRA 1N0YA 1OMRA 2LVKA 1QIVA 1YUUA 1QV0A 1QVIZ 5D7FA 3SG4A 1YVLA 1SYMA 3TUYB 4A4CA 2NLNA 2PVBA 5AXIA 4AOMA 3IF7A 1F54A 1AHRA 3E3RA 2ISDA 1CMGA 3AAJA 4AQIA 1NX1A 2K7CA 1KK7Z 2GV5A 1IQ5A 1J55A 1Q80A 2H61A 1K9UA 4NQGA 1AK8A 5I2QA 4PALA 1CKKA 1S3PA 1F70A 3KF9A 4YGBB 1NSHA 5DKQA 4I5LB 4OVNF 1J7QA 2FOTA 4ETOA 1MXEA 4PHMA 2CTNA 2ZKMX 4MN0A 3HX4A 1CLLA 1KK8C 1SK6D 1CDLA 1M63B 2KHNA 2LLSA 3PSRA 1DJIA 2KNEA 2M3WA 4MZJA 2OS8C 1WLMA 1YX7A 3EVUA 2LMTA 3SG5A 2KOTA 1S1EA 1ZFSA 4GGFC 1M45A 1Y1XA 3I5IC 2Y1MA 4GNKB 2I94A 1RTP1 1RWYA 1S6IA 1YTZC 2M0RA 5CSJA 2JRFA 1CFDA 2Q4UA 2K0JA 2ZNDA 2EGDA 3TS5B 4DIRA 5I8NA 1QIWA 3FS7A 4YI8A 1Y0VH 2CCMA 3OX6A 3F45A 3OB1B 4ORAB 3VRPA 1KFXS 3NSLA 2JXCA 1CFCA 2WOSA 2H61C 1RROA 4WRIA 3MSEB 4F0ZB 3DVKA 3PFVA 1KWOB 4MLWA 1DT7B 4FQOA 4NDDA 1RK9A 1SL9A 4N5XA 4R1EA 1GGWA 1KFUS 1SCMB 1YRUB 2HQWA 2PASA 3DF0A 4Q04A 3BUNB 2LUCA 4BY4A 1WDCB 1IKUA 1F55A 4OCIA 1JWDA 1DJXA 2GGMA 2JWWA 5B8IB 1BG1A 1UHIA 2MLEC 2K7BA 1UUSA 1DJWA 4PCWA 5PALA 5F6TA 5KSZA 2ZN9A 2L50A 2SASA 4IL1A 2PRUA 4E68A 2LAPA 1ODBA 1H8BA 3CR2A 1GJYA 3KHEA 2BBNA 2MA2A 1TNWA
chains in the Genus database with same CATH superfamily
1TTXA 1XK4A 2HPSA 5AERA 2L5XB 1U5IB 2LLUA 2JTZA 2KGRA 2F8PA 2M49B 2ZFDA 3D75A 3GK1A 3PALA 4MZLA 4XJKB 3GK4X 2PALA 1BLQA 5HKYA 2KYCA 1A2XA 1GQMA 4OZDA 1GGZA 3CLNA 2K2FA 1MWNA 3FWBA 3OP0A 3D10A 2L51A 3OX5A 1KSOA 1DQEA 1B7TZ 1KK8B 1TOPA 4P2YB 5G08A 1KSMA 1AVSA 3IQQA 4A4BA 2BL0C 1U5IA 1C7WA 4XJKA 1S26D 1OOHA 2OS8B 1CTRA 2BCAA 2G2BA 3I5IB 3D0YA 2L98A 2M97A 1DGVA 2L4HA 1SBJA 1K93D 1MUXA 2JT8A 1CB1A 3S0DA 2ERBA 4CFQA 3FWCA 3A4UB 2BKHB 4PHJA 2SCPA 1FW4A 2M1UA 3VRNA 4YRUA 1K9KA 1TRFA 2K7DA 1SL8A 3I5FC 1QV1A 3NSIA 1FI5A 2BKIB 3N7HA 5I2OA 3CWGA 1FF1A 4U8DA 3ZNIA 1B47A 1BMOA 5D3OA 1OMDA 4GGFA 3JTDC 1J7RA 3S0FA 2KLDA 2F2PA 1YX8A 1LS8A 2LV7A 1UP5A 2Y5IA 2QEHA 2WCLA 2JPTA 2FJUB 1SW8A 3M0WA 3VGOA 2JT3A 2LE9B 1JFKA 1LA0A 1BODA 2L2EA 3HCMA 3SIBA 1FBVA 2LP2A 1LINA 4YGEB 2JNXA 3NSOA 1KFUL 3PN7B 4HSZA 1PVAA 3V2LA 2F3ZA 3UO9A 1NYAA 1DF0A 3EVVA 1NX0A 1DJGA 3BUXB 4MEWA 2GGZA 1J7OA 1IRJA 1LKJA 3ICBA 3SG7A 1MXLC 3O2PA 2JTTA 4PE0A 1B9AA 1QWVA 1DMOA 3OGNA 4XYNA 2WCBA 3IQOA 4CLNA 4C0JA 2JC2A 4CFRA 1XFVO 2K60A 3BYAA 1DC1A 5D69A 1N65A 1HQVA 1LXFC 2FCEA 2LANA 3B88A 1T14A 2F3YA 1IQ3A 4C0LA 1BR4B 2L0PA 1SKTA 3D74A 1OZOA 4ORCB 1ALVA 1V1GA 4PE7A 1CLMA 2K8MB 4USLA 1MQ1A 2NZ0A 3CR5X 1NCZA 2LUXA 2PSRA 1J1EA 1F4OA 5ER5A 1OOGA 4OKHA 5HKZA 1JF2A 4F7FA 2LMUA 3DF0B 3BQ3A 1ALWA 1DJYA 5TNCA 3CZ2A 2BL0B 5KU1A 2LMVA 3CR4X 3D76A 3DY9A 2BE4A 3TDZA 5HYDA 3SJSA 1YUTA 3VRQA 4DS7A 1SR6C 4MZKA 4GFTA 1BT6A 5FI2A 2M7NA 3SS5A 4PDZA 3TDIA 1EXRA 1XA5A 2WORA 1UHKA 2WCJA 1J1DA 1JFJA 2CT9A 4PHKA 3C1VA 2EC6C 1XFRA 3WHUB 1PALA 4OR9B 1Z4HA 3I5FB 1CDMA 1HT9A 4M2QA 4N1GA 1LA3A 2D8NA 1ZMZA 1MF8B 1QXPA 1OE9B 4IJ7A 3K1EA 1XO5A 1L2OC 2G9BA 3JTDB 4I5KA 1SRAA 3CZTX 2I7AA 3I5GC 1NPQA 5CPVA 1B4CA 2AUCA 1S36A 4ICBA 2OTGC 1IG5A 3ZWHA 2LLTA 1CM1A 5CSFA 3B87A 1SL7A 2MHHA 1M31A 1QASA 4HREE 1NP8A 1IJ5A 4BY5A 1NX3A 3DVEA 1ZOTB 2QEOA 3DD4A 1A4PA 1EG4A 3FE9A 4HRGA 1NUBA 4I5NB 1QLKA 5HKWA 1NX2A 5DICA 4QJ3B 2K61A 4JWQA 2AMIA 2KFGA 2LVVA 2HQ8A 3D0YB 1SPYA 1PRWA 5DKRA 2KBIA 2JULA 1OZSA 2JOJA 1WY9A 1K8UA 2NXQA 3R72A 2F2OA 3SG2A 3O6BA 1D1OA 5DKNA 1GM0A 3I5HC 5IBWA 2WCKA 1W7IB 4YGCB 3SIAA 4WQ3A 1F71A 5KTYA 1MR8A 1DEKA 2IS9A 3WHTB 2RGIA 2KBMA 4GGNA 1QS7A 1W7JB 1UURA 2KQ6A 2M29A 2VRGA 2H8VA 3BOWB 2KGBC 3PATA 1A75B 1QTXA 4GPLB 3OHMB 1TIZA 2JT0A 1B8CA 1K90D 1S5GY 2M8UA 5CSIA 4M2OA 2O5GA 1AJ5A 1E8AA 1NWDA 1QLSA 2KSPA 1W9ZA 1UWOA 2BCBA 1Y1UA 1OW4A 2KFHA 1DTLA 2JZIA 1A03A 3OB2B 4YGDB 4I5JA 3A8RA 2QDIA 5HLOA 1BR1B 2M9GA 1DF0B 1SSEB 2LVJA 2MLFC 1CMFA 2E30A 5I94A 1KK7Y 2AAOA 3LK0A 2KQYA 1SR6B 2WCEA 4CPVA 2KLEA 1XYDA 3BOWA 1FPWA 1A75A 4D1EA 1LVCD 1K2HA 2KDHA 3EK4A 2EHBA 3CYZA 3AKBA 1K94A 1CLBA 2EC6B 5JJGA 2KAYA 4GUKA 2NCOA 1V1FA 1SNLA 1OMVA 1B1GA 1IH0A 3EG5B 2KYFA 3NHTA 1L7ZA 4AQJA 1CDPA 2LVIA 3AKAA 1OSAA 3SS3A 2KAVA 1FI6A 1VRKA 3KEVA 3PM2A 3I5GB 3RLZA 4DUQA 1NIWA 2KI6D 3O4YA 3VROA 3OBVA 3GOFA 1BF5A 3UNWA 2OTGB 1JBAA 3VRRA 2BAPA 2WC5A 2OPOA 1K95A 2K2AA 2GTEA 3Q8IA 1Y6WA 4MSPA 3EKHA 4MBEA 2KI4C 2WCFA 5I2LA 3VB1A 2MBXA 2JQ6A 2PQLA 2BBMA 2CNPA 3S0GA 2Y4QA 3CABA 1R6PA 2I18A 1BJFA 3H4SE 2P70A 3IVTA 3L4AA 3NXAA 1PSRA 1DELA 4MRXA 5BPJA 1OOJA 3BXKA 2KI6C 4PHNA 5AEQA 3CTNA 4C0KA 1C7VA 4GBAA 1JUOA 1PVBA 1CNPA 1H4BA 2JU0A 4MVFA 1EL4A 4MRYA 1JSAA 3PM8A 1RECA 1S6CA 1SCVA 1SY9A 2B1UA 2JXLA 3I5HB 3FIAA 1PK0D 2QPTA 1AJ4A 2LCPA 1DVIA 2WC8A 2MRDA 1KQMC 3DZTA 4N1FA 1OOIX 2WC6A 3BUWB 3WXAA 1QX2A 4ZCVA 1UHNA 4M2PA 2LNKA 3WNXB 1CDNA 1B8LA 3R1PA 4OV2A 3LL8B 3TDUA 2M7LA 1UHHA 3CS1A 4WQ2A 1BOCA 1YRTB 1DJHA 5J3XA 3JVTC 1RJVA 4L9MA 1XFUO 1EH2A 1RFJA 1EJ3A 1YUSA 1ZUZA 2LC5A 2Y1NA 1S6JA 2P6BB 4JKTA 1F8HA 4JPZB 1BU3A 4QJ4B 2BE6A 1TNPA 3BUOB 1ZACA 2R2IA 1PSBA 1TCOB 1JC2A 3RM1A 1C07A 4HRHA 1UHJA 1NCYA 5FI6A 1G4YR 3BFAA 4DRWA 1QJTA 1K9PA 2LP3A 1YURA 2ZRSA 4YI9A 5CSNA 1TN4A 3TUYC 4NDBA 3EKJA 5AANA 2JPOA 1QATA 3O4XA 4PT1A 3EK7A 3R1OA 4YBHB 1KCYA 5FI7A 5ER4X 1JF0A 1K96A 1WRZA 1XVJA 1G33A 3NSKA 3PN7C 1B7TY 3QRXA 1IWQA 1G8IA 2PYQA 3O78A 2I2RE 4FQTA 3RZSA 3LLEA 2MJWB 1TWOA 1YR5A 4TNCA 3CZ0A 2WNDA 3LK1A 3K21A 4YGAA 4NDCA 2FCDA 1IJ6A 1KQVA 1PULA 2JNFA 1NCXA 5AFPA 1XFXO 2F33A 5JOLA 3SG3A 1XFZO 5K89A 2KI4B 1R2UA 5FYXA 2LM5A 1TCFA 5GQQC 3SG6A 2NCPA 2L4IA 3DVMA 2ZRTA 3EK8A 5HLVA 1TNXA 1N2DA 1J7PA 4ZCUA 4INXA 1M39A 1F4QA 2A4JA 2WCHA 3FE8A 1AUIB 4PE4A 3D77A 4CIDA 4JQ0D 3LCPC 1EG3A 1SMGA 3S0EA 3TZ1A 3TS5C 1QX7A 1QX5B 3S0BA 1CFPA 4DCKA 2KAXA 1QVIY 3GK2A 2Q91A 1MHOA 2V53A 1KQMB 3PLFB 1DGUA 1Z2CB 2FJYA 2ZN8A 3KO0A 4FTGA 4UPGA 1OOFA 2M1KB 2BECA 2KPHA 1M46A 2O60A 2QEVA 3S0AA 2CBLA 2CXJA 1DJZA 2BCXA 1WRLA 1KWOC 1CFFA 1XFWO 1OQPA 4ORBB 3PJIA 3JVTB 2TN4A 2COLB 3CGAA 3DVJA 3AAKA 3BUMB 1YVHA 1X02A 2PMYA 2H2KA 2E6WA 4QJ5B 1WLZA 1SCMC 2K7OA 2BNXA 3BFHA 3BJHA 2KFFA 2MAZA 2LHLA 2ZNEA 2HETA 4PE1A 1WRKA 1WDCC 1XFYO 1Y1AA 2HF5A 1IGVA 1TNQA 1XK4C 2QACA 1P28A 2DOQA 1AP4A 1CM4A 4GAOA 1L2OB 5HL1A 3B6XA 2LHIA 1A29A 3B86A 4P5OE 1B8RA 4INWA 1KFXL 1S5GZ 3BFBA 3KPXA 3EVRA 2WCMA 1N0YA 1OMRA 2LVKA 1QIVA 1YUUA 1QV0A 1QVIZ 5D7FA 3SG4A 1YVLA 1SYMA 3TUYB 4A4CA 2NLNA 2PVBA 3L47A 5AXIA 4AOMA 3IF7A 3SS4A 1F54A 1AHRA 3E3RA 2ISDA 1CMGA 3AAJA 4AQIA 1NX1A 2K7CA 1KK7Z 2GV5A 1IQ5A 1J55A 1Q80A 2H61A 1K9UA 4NQGA 1AK8A 5I2QA 4PALA 1CKKA 1S3PA 1F70A 3KF9A 2P71A 4YGBB 1C3YA 1NSHA 5DKQA 4I5LB 4OVNF 1J7QA 2FOTA 4ETOA 1MXEA 2L2CA 4PHMA 2CTNA 3L4LA 2ZKMX 2YGUA 4MN0A 3HX4A 1CLLA 1KK8C 1SK6D 1CDLA 1M63B 2KHNA 2LLSA 3PSRA 1DJIA 2KNEA 2M3WA 3D78A 4MZJA 2OS8C 1WLMA 1YX7A 3EVUA 2LMTA 3SG5A 2KOTA 1S1EA 1ZFSA 4GGFC 1M45A 1Y1XA 3I5IC 2Y1MA 4GNKB 2I94A 1RTP1 1RWYA 1S6IA 1YTZC 2M0RA 5CSJA 3DYEA 2JRFA 1CFDA 3FE6A 2Q4UA 2K0JA 1IIOA 2ZNDA 2EGDA 3D73A 3TS5B 4DIRA 5I8NA 1QIWA 3FS7A 4YI8A 1Y0VH 2CCMA 3OX6A 3F45A 3OB1B 4ORAB 3VRPA 4KYNA 1KFXS 3NSLA 2JXCA 1CFCA 3NGVA 2WOSA 2H61C 1RROA 1ORGA 4WRIA 3MSEB 3B7AA 4F0ZB 3DVKA 3PFVA 1KWOB 4MLWA 1DT7B 4FQOA 4NDDA 1RK9A 1SL9A 3NHIA 4N5XA 1C3ZA 4R1EA 2L5YA 1GGWA 1KFUS 1SCMB 1YRUB 2HQWA 2PASA 3DF0A 4Q04A 3BUNB 4JD9A 2LUCA 4BY4A 1WDCB 1IKUA 1F55A 4OCIA 1JWDA 1DJXA 2GGMA 2JWWA 5EL2A 5B8IB 1BG1A 1UHIA 2MLEC 2QEBA 3CDNA 2K7BA 1UUSA 1DJWA 1TUZA 4PCWA 5PALA 5F6TA 5KSZA 3R1VA 2ZN9A 2L50A 2SASA 4IL1A 2PRUA 4E68A 3QMEA 3DXLA 2LAPA 1ODBA 1H8BA 1TUJA 3CR2A 1GJYA 3KHEA 3CZ1A 2BBNA 2MA2A 1TNWA
chains in the Genus database with same CATH topology
1TTXA 1XK4A 2HPSA 5AERA 2L5XB 1U5IB 2LLUA 2JTZA 2KGRA 2F8PA 2M49B 2ZFDA 3GK1A 3PALA 4MZLA 4XJKB 3GK4X 2PALA 1BLQA 5HKYA 2KYCA 1A2XA 1GQMA 1GGZA 2K2FA 1MWNA 3FWBA 3OP0A 3D10A 2L51A 3OX5A 1KSOA 1KK8B 1B7TZ 1TOPA 4P2YB 5G08A 1KSMA 1AVSA 3IQQA 4A4BA 2BL0C 1U5IA 1C7WA 4XJKA 1S26D 2OS8B 1CTRA 2BCAA 2G2BA 3I5IB 3D0YA 2L98A 2M97A 1DGVA 2L4HA 1SBJA 1K93D 1MUXA 2JT8A 1CB1A 4CFQA 3FWCA 3A4UB 2BKHB 4PHJA 2SCPA 1FW4A 2M1UA 3VRNA 4YRUA 1K9KA 1TRFA 2K7DA 1SL8A 3I5FC 1QV1A 3NSIA 1FI5A 2BKIB 5I2OA 3CWGA 1FF1A 4U8DA 3ZNIA 1B47A 1BMOA 1OMDA 4GGFA 3JTDC 1J7RA 2Y5IA 2F2PA 1YX8A 2LV7A 1UP5A 2JPTA 2FJUB 1SW8A 3M0WA 3VGOA 2JT3A 2LE9B 1JFKA 1LA0A 1BODA 2L2EA 3HCMA 3SIBA 1FBVA 2LP2A 1LINA 4YGEB 2JNXA 3NSOA 1KFUL 3PN7B 4HSZA 1PVAA 2F3ZA 1NYAA 1DF0A 3EVVA 1NX0A 1DJGA 3BUXB 4MEWA 2GGZA 1J7OA 1IRJA 1LKJA 3ICBA 3SG7A 1MXLC 3O2PA 2JTTA 4PE0A 1B9AA 1DMOA 4XYNA 2WCBA 3IQOA 4CLNA 4C0JA 2JC2A 4CFRA 1XFVO 3BYAA 5D69A 1N65A 1HQVA 1LXFC 2FCEA 2LANA 1IQ3A 2F3YA 4C0LA 1BR4B 2L0PA 1SKTA 1OZOA 4ORCB 1ALVA 1V1GA 4PE7A 1CLMA 2K8MB 4USLA 1MQ1A 2NZ0A 3CR5X 1NCZA 2LUXA 2PSRA 1J1EA 1F4OA 5ER5A 4OKHA 5HKZA 1JF2A 2LMUA 3DF0B 3BQ3A 1ALWA 1DJYA 5TNCA 2BL0B 5KU1A 2LMVA 3CR4X 2BE4A 3TDZA 5HYDA 3SJSA 1YUTA 3VRQA 4DS7A 1SR6C 4MZKA 4GFTA 1BT6A 2M7NA 3TDIA 4PDZA 1JFJA 1EXRA 1XA5A 2WORA 1UHKA 1J1DA 2CT9A 4PHKA 3C1VA 2EC6C 3WHUB 1PALA 4OR9B 3I5FB 1CDMA 1HT9A 4M2QA 4N1GA 1LA3A 2D8NA 1ZMZA 1MF8B 1QXPA 1OE9B 1XO5A 1L2OC 2G9BA 3JTDB 4I5KA 1SRAA 3CZTX 2I7AA 3I5GC 1NPQA 5CPVA 1B4CA 2AUCA 1S36A 4ICBA 2OTGC 1IG5A 3ZWHA 2LLTA 1CM1A 5CSFA 1SL7A 2MHHA 1M31A 1QASA 4HREE 1NP8A 1IJ5A 4BY5A 1NX3A 3DVEA 1ZOTB 3DD4A 1A4PA 1EG4A 4HRGA 1NUBA 4I5NB 1QLKA 5HKWA 1NX2A 4QJ3B 2K61A 4JWQA 2AMIA 2KFGA 2LVVA 2HQ8A 3D0YB 1SPYA 1PRWA 5DKRA 2KBIA 2JULA 1OZSA 2JOJA 1WY9A 1K8UA 2NXQA 1D1OA 2F2OA 3SG2A 3O6BA 5DKNA 3I5HC 5IBWA 4YGCB 1W7IB 3SIAA 4WQ3A 1F71A 5KTYA 1MR8A 2IS9A 3WHTB 2RGIA 2KBMA 4GGNA 1QS7A 1W7JB 1UURA 2KQ6A 2M29A 2VRGA 3BOWB 3PATA 2KGBC 1A75B 1QTXA 4GPLB 3OHMB 1TIZA 2JT0A 1B8CA 1K90D 1S5GY 2M8UA 5CSIA 4M2OA 2O5GA 1AJ5A 1E8AA 1NWDA 1QLSA 2KSPA 1UWOA 2BCBA 1Y1UA 2KFHA 1DTLA 2JZIA 1A03A 3OB2B 4YGDB 4I5JA 3A8RA 5HLOA 1BR1B 2M9GA 1DF0B 2LVJA 2MLFC 1CMFA 2E30A 1KK7Y 2AAOA 3LK0A 2KQYA 1SR6B 2WCEA 4CPVA 3BOWA 1XYDA 1FPWA 1A75A 4D1EA 1LVCD 1K2HA 2KDHA 3EK4A 2EHBA 3AKBA 1K94A 1CLBA 2EC6B 5JJGA 2KAYA 4GUKA 2NCOA 1V1FA 1SNLA 1OMVA 1B1GA 1IH0A 4AQJA 2KYFA 1L7ZA 1CDPA 2LVIA 3AKAA 1OSAA 2KAVA 1FI6A 1VRKA 3KEVA 3I5GB 3RLZA 4DUQA 1NIWA 2KI6D 3O4YA 3VROA 3GOFA 1BF5A 1JBAA 2OTGB 3VRRA 2OPOA 1K95A 2K2AA 4MSPA 1Y6WA 3EKHA 4MBEA 2KI4C 2WCFA 5I2LA 2MBXA 2JQ6A 2BBMA 2CNPA 2Y4QA 3H4SE 1R6PA 2I18A 1BJFA 3NXAA 1PSRA 4MRXA 5BPJA 1OOJA 3BXKA 2KI6C 4PHNA 5AEQA 3CTNA 4C0KA 1C7VA 4GBAA 1JUOA 1PVBA 1CNPA 1H4BA 2JU0A 4MVFA 1EL4A 4MRYA 1JSAA 3PM8A 1RECA 1S6CA 1SCVA 1SY9A 2B1UA 2JXLA 3I5HB 3FIAA 1PK0D 2QPTA 1AJ4A 2LCPA 1DVIA 2WC8A 2MRDA 1KQMC 4N1FA 3BUWB 3WXAA 1QX2A 4ZCVA 1UHNA 4M2PA 2LNKA 3WNXB 1CDNA 1B8LA 4OV2A 3TDUA 3LL8B 1BOCA 2M7LA 1UHHA 3CS1A 4WQ2A 1YRTB 1DJHA 5J3XA 3JVTC 1RJVA 4L9MA 1XFUO 1EH2A 1RFJA 1EJ3A 1YUSA 1ZUZA 2LC5A 2Y1NA 1S6JA 2P6BB 1F8HA 4JPZB 1BU3A 4QJ4B 2BE6A 1TNPA 3BUOB 1ZACA 2R2IA 1PSBA 1TCOB 1JC2A 3RM1A 1C07A 4HRHA 1UHJA 1NCYA 1G4YR 4DRWA 1QJTA 1K9PA 2LP3A 1YURA 2ZRSA 4YI9A 5CSNA 1TN4A 3TUYC 4NDBA 3EKJA 5AANA 1QATA 4YBHB 3EK7A 1KCYA 5ER4X 1JF0A 1K96A 1WRZA 1XVJA 1G33A 3NSKA 3PN7C 1B7TY 3QRXA 1IWQA 1G8IA 3O78A 2I2RE 3LLEA 2MJWB 1YR5A 4TNCA 2WNDA 3LK1A 3K21A 4YGAA 4NDCA 2FCDA 1IJ6A 1KQVA 1PULA 2JNFA 1NCXA 5AFPA 1XFXO 2F33A 5JOLA 3SG3A 1XFZO 5K89A 2KI4B 1R2UA 5FYXA 2LM5A 1TCFA 5GQQC 3SG6A 2NCPA 2L4IA 3DVMA 2ZRTA 3EK8A 5HLVA 1TNXA 1N2DA 1J7PA 4ZCUA 1M39A 1F4QA 2A4JA 1AUIB 4PE4A 4CIDA 4JQ0D 3LCPC 1EG3A 1SMGA 3TZ1A 3TS5C 1QX7A 1QX5B 1CFPA 4DCKA 2KAXA 1QVIY 3GK2A 2Q91A 1MHOA 2V53A 1KQMB 3PLFB 1DGUA 4FTGA 2ZN8A 3KO0A 4UPGA 2M1KB 2BECA 2O60A 1M46A 2CBLA 2CXJA 1DJZA 2BCXA 1WRLA 1KWOC 1CFFA 1XFWO 1OQPA 4ORBB 3JVTB 2TN4A 2COLB 3CGAA 3DVJA 3AAKA 3BUMB 1YVHA 1X02A 2PMYA 2H2KA 2E6WA 4QJ5B 1WLZA 1SCMC 2K7OA 2KFFA 2MAZA 2LHLA 2ZNEA 2HETA 4PE1A 1WRKA 1WDCC 1XFYO 1Y1AA 2HF5A 1IGVA 1TNQA 1XK4C 2QACA 3CLNA 2DOQA 1AP4A 1CM4A 4GAOA 1L2OB 2LHIA 1A29A 4P5OE 1B8RA 1KFXL 1S5GZ 3KPXA 3EVRA 1N0YA 1OMRA 2LVKA 1QIVA 1YUUA 1QV0A 1QVIZ 5D7FA 3SG4A 1YVLA 1SYMA 3TUYB 4A4CA 2NLNA 2PVBA 5AXIA 4AOMA 3IF7A 1F54A 1AHRA 3E3RA 2ISDA 1CMGA 3AAJA 4AQIA 1NX1A 2K7CA 1KK7Z 2GV5A 1IQ5A 1J55A 1Q80A 2H61A 1K9UA 4NQGA 1AK8A 5I2QA 4PALA 1CKKA 1S3PA 1F70A 3KF9A 4YGBB 1NSHA 5DKQA 4I5LB 4OVNF 1J7QA 2FOTA 4ETOA 1MXEA 4PHMA 2CTNA 2ZKMX 4MN0A 3HX4A 1CLLA 1KK8C 1SK6D 1CDLA 1M63B 2KHNA 2LLSA 3PSRA 1DJIA 2KNEA 2M3WA 4MZJA 2OS8C 1WLMA 1YX7A 3EVUA 2LMTA 3SG5A 2KOTA 1S1EA 1ZFSA 4GGFC 1M45A 1Y1XA 3I5IC 2Y1MA 4GNKB 2I94A 1RTP1 1RWYA 1S6IA 1YTZC 2M0RA 5CSJA 2JRFA 1CFDA 2Q4UA 2K0JA 2ZNDA 2EGDA 3TS5B 4DIRA 5I8NA 1QIWA 3FS7A 4YI8A 1Y0VH 2CCMA 3OX6A 3F45A 3OB1B 4ORAB 3VRPA 1KFXS 3NSLA 2JXCA 1CFCA 2WOSA 2H61C 1RROA 4WRIA 3MSEB 4F0ZB 3DVKA 3PFVA 1KWOB 4MLWA 1DT7B 4FQOA 4NDDA 1RK9A 1SL9A 4N5XA 4R1EA 1GGWA 1KFUS 1SCMB 1YRUB 2HQWA 2PASA 3DF0A 4Q04A 3BUNB 2LUCA 4BY4A 1WDCB 1IKUA 1F55A 4OCIA 1JWDA 1DJXA 2GGMA 2JWWA 5B8IB 1BG1A 1UHIA 2MLEC 2K7BA 1UUSA 1DJWA 4PCWA 5PALA 5F6TA 5KSZA 2ZN9A 2L50A 2SASA 4IL1A 2PRUA 4E68A 2LAPA 1ODBA 1H8BA 3CR2A 1GJYA 3KHEA 2BBNA 2MA2A 1TNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTX A;  1XK4 A;  2HPS A;  5AER A;  2L5X B;  1U5I B;  2LLU A;  2JTZ A;  2KGR A;  2F8P A;  2M49 B;  2ZFD A;  3GK1 A;  3PAL A;  4MZL A;  4XJK B;  3GK4 X;  2PAL A;  1BLQ A;  5HKY A;  2KYC A;  1A2X A;  1GQM A;  1GGZ A;  2K2F A;  1MWN A;  3FWB A;  3OP0 A;  3D10 A;  2L51 A;  3OX5 A;  1KSO A;  1KK8 B;  1B7T Z;  1TOP A;  4P2Y B;  5G08 A;  1KSM A;  1AVS A;  3IQQ A;  4A4B A;  2BL0 C;  1U5I A;  1C7W A;  4XJK A;  1S26 D;  2OS8 B;  1CTR A;  2BCA A;  2G2B A;  3I5I B;  3D0Y A;  2L98 A;  2M97 A;  1DGV A;  2L4H A;  1SBJ A;  1K93 D;  1MUX A;  2JT8 A;  1CB1 A;  4CFQ A;  3FWC A;  3A4U B;  2BKH B;  4PHJ A;  2SCP A;  1FW4 A;  2M1U A;  3VRN A;  4YRU A;  1K9K A;  1TRF A;  2K7D A;  1SL8 A;  3I5F C;  1QV1 A;  3NSI A;  1FI5 A;  2BKI B;  5I2O A;  3CWG A;  1FF1 A;  4U8D A;  3ZNI A;  1B47 A;  1BMO A;  1OMD A;  4GGF A;  3JTD C;  1J7R A;  2Y5I A;  2F2P A;  1YX8 A;  2LV7 A;  1UP5 A;  2JPT A;  2FJU B;  1SW8 A;  3M0W A;  3VGO A;  2JT3 A;  2LE9 B;  1JFK A;  1LA0 A;  1BOD A;  2L2E A;  3HCM A;  3SIB A;  1FBV A;  2LP2 A;  1LIN A;  4YGE B;  2JNX A;  3NSO A;  1KFU L;  3PN7 B;  4HSZ A;  1PVA A;  2F3Z A;  1NYA A;  1DF0 A;  3EVV A;  1NX0 A;  1DJG A;  3BUX B;  4MEW A;  2GGZ A;  1J7O A;  1IRJ A;  1LKJ A;  3ICB A;  3SG7 A;  1MXL C;  3O2P A;  2JTT A;  4PE0 A;  1B9A A;  1DMO A;  4XYN A;  2WCB A;  3IQO A;  4CLN A;  4C0J A;  2JC2 A;  4CFR A;  1XFV O;  3BYA A;  5D69 A;  1N65 A;  1HQV A;  1LXF C;  2FCE A;  2LAN A;  1IQ3 A;  2F3Y A;  4C0L A;  1BR4 B;  2L0P A;  1SKT A;  1OZO A;  4ORC B;  1ALV A;  1V1G A;  4PE7 A;  1CLM A;  2K8M B;  4USL A;  1MQ1 A;  2NZ0 A;  3CR5 X;  1NCZ A;  2LUX A;  2PSR A;  1J1E A;  1F4O A;  5ER5 A;  4OKH A;  5HKZ A;  1JF2 A;  2LMU A;  3DF0 B;  3BQ3 A;  1ALW A;  1DJY A;  5TNC A;  2BL0 B;  5KU1 A;  2LMV A;  3CR4 X;  2BE4 A;  3TDZ A;  5HYD A;  3SJS A;  1YUT A;  3VRQ A;  4DS7 A;  1SR6 C;  4MZK A;  4GFT A;  1BT6 A;  2M7N A;  3TDI A;  4PDZ A;  1JFJ A;  1EXR A;  1XA5 A;  2WOR A;  1UHK A;  1J1D A;  2CT9 A;  4PHK A;  3C1V A;  2EC6 C;  3WHU B;  1PAL A;  4OR9 B;  3I5F B;  1CDM A;  1HT9 A;  4M2Q A;  4N1G A;  1LA3 A;  2D8N A;  1ZMZ A;  1MF8 B;  1QXP A;  1OE9 B;  1XO5 A;  1L2O C;  2G9B A;  3JTD B;  4I5K A;  1SRA A;  3CZT X;  2I7A A;  3I5G C;  1NPQ A;  5CPV A;  1B4C A;  2AUC A;  1S36 A;  4ICB A;  2OTG C;  1IG5 A;  3ZWH A;  2LLT A;  1CM1 A;  5CSF A;  1SL7 A;  2MHH A;  1M31 A;  1QAS A;  4HRE E;  1NP8 A;  1IJ5 A;  4BY5 A;  1NX3 A;  3DVE A;  1ZOT B;  3DD4 A;  1A4P A;  1EG4 A;  4HRG A;  1NUB A;  4I5N B;  1QLK A;  5HKW A;  1NX2 A;  4QJ3 B;  2K61 A;  4JWQ A;  2AMI A;  2KFG A;  2LVV A;  2HQ8 A;  3D0Y B;  1SPY A;  1PRW A;  5DKR A;  2KBI A;  2JUL A;  1OZS A;  2JOJ A;  1WY9 A;  1K8U A;  2NXQ A;  1D1O A;  2F2O A;  3SG2 A;  3O6B A;  5DKN A;  3I5H C;  5IBW A;  4YGC B;  1W7I B;  3SIA A;  4WQ3 A;  1F71 A;  5KTY A;  1MR8 A;  2IS9 A;  3WHT B;  2RGI A;  2KBM A;  4GGN A;  1QS7 A;  1W7J B;  1UUR A;  2KQ6 A;  2M29 A;  2VRG A;  3BOW B;  3PAT A;  2KGB C;  1A75 B;  1QTX A;  4GPL B;  3OHM B;  1TIZ A;  2JT0 A;  1B8C A;  1K90 D;  1S5G Y;  2M8U A;  5CSI A;  4M2O A;  2O5G A;  1AJ5 A;  1E8A A;  1NWD A;  1QLS A;  2KSP A;  1UWO A;  2BCB A;  1Y1U A;  2KFH A;  1DTL A;  2JZI A;  1A03 A;  3OB2 B;  4YGD B;  4I5J A;  3A8R A;  5HLO A;  1BR1 B;  2M9G A;  1DF0 B;  2LVJ A;  2MLF C;  1CMF A;  2E30 A;  1KK7 Y;  2AAO A;  3LK0 A;  2KQY A;  1SR6 B;  2WCE A;  4CPV A;  3BOW A;  1XYD A;  1FPW A;  1A75 A;  4D1E A;  1LVC D;  1K2H A;  2KDH A;  3EK4 A;  2EHB A;  3AKB A;  1K94 A;  1CLB A;  2EC6 B;  5JJG A;  2KAY A;  4GUK A;  2NCO A;  1V1F A;  1SNL A;  1OMV A;  1B1G A;  1IH0 A;  4AQJ A;  2KYF A;  1L7Z A;  1CDP A;  2LVI A;  3AKA A;  1OSA A;  2KAV A;  1FI6 A;  1VRK A;  3KEV A;  3I5G B;  3RLZ A;  4DUQ A;  1NIW A;  2KI6 D;  3O4Y A;  3VRO A;  3GOF A;  1BF5 A;  1JBA A;  2OTG B;  3VRR A;  2OPO A;  1K95 A;  2K2A A;  4MSP A;  1Y6W A;  3EKH A;  4MBE A;  2KI4 C;  2WCF A;  5I2L A;  2MBX A;  2JQ6 A;  2BBM A;  2CNP A;  2Y4Q A;  3H4S E;  1R6P A;  2I18 A;  1BJF A;  3NXA A;  1PSR A;  4MRX A;  5BPJ A;  1OOJ A;  3BXK A;  2KI6 C;  4PHN A;  5AEQ A;  3CTN A;  4C0K A;  1C7V A;  4GBA A;  1JUO A;  1PVB A;  1CNP A;  1H4B A;  2JU0 A;  4MVF A;  1EL4 A;  4MRY A;  1JSA A;  3PM8 A;  1REC A;  1S6C A;  1SCV A;  1SY9 A;  2B1U A;  2JXL A;  3I5H B;  3FIA A;  1PK0 D;  2QPT A;  1AJ4 A;  2LCP A;  1DVI A;  2WC8 A;  2MRD A;  1KQM C;  4N1F A;  3BUW B;  3WXA A;  1QX2 A;  4ZCV A;  1UHN A;  4M2P A;  2LNK A;  3WNX B;  1CDN A;  1B8L A;  4OV2 A;  3TDU A;  3LL8 B;  1BOC A;  2M7L A;  1UHH A;  3CS1 A;  4WQ2 A;  1YRT B;  1DJH A;  5J3X A;  3JVT C;  1RJV A;  4L9M A;  1XFU O;  1EH2 A;  1RFJ A;  1EJ3 A;  1YUS A;  1ZUZ A;  2LC5 A;  2Y1N A;  1S6J A;  2P6B B;  1F8H A;  4JPZ B;  1BU3 A;  4QJ4 B;  2BE6 A;  1TNP A;  3BUO B;  1ZAC A;  2R2I A;  1PSB A;  1TCO B;  1JC2 A;  3RM1 A;  1C07 A;  4HRH A;  1UHJ A;  1NCY A;  1G4Y R;  4DRW A;  1QJT A;  1K9P A;  2LP3 A;  1YUR A;  2ZRS A;  4YI9 A;  5CSN A;  1TN4 A;  3TUY C;  4NDB A;  3EKJ A;  5AAN A;  1QAT A;  4YBH B;  3EK7 A;  1KCY A;  5ER4 X;  1JF0 A;  1K96 A;  1WRZ A;  1XVJ A;  1G33 A;  3NSK A;  3PN7 C;  1B7T Y;  3QRX A;  1IWQ A;  1G8I A;  3O78 A;  2I2R E;  3LLE A;  2MJW B;  1YR5 A;  4TNC A;  2WND A;  3LK1 A;  3K21 A;  4YGA A;  4NDC A;  2FCD A;  1IJ6 A;  1KQV A;  1PUL A;  2JNF A;  1NCX A;  5AFP A;  1XFX O;  2F33 A;  5JOL A;  3SG3 A;  1XFZ O;  5K89 A;  2KI4 B;  1R2U A;  5FYX A;  2LM5 A;  1TCF A;  5GQQ C;  3SG6 A;  2NCP A;  2L4I A;  3DVM A;  2ZRT A;  3EK8 A;  5HLV A;  1TNX A;  1N2D A;  1J7P A;  4ZCU A;  1M39 A;  1F4Q A;  2A4J A;  1AUI B;  4PE4 A;  4CID A;  4JQ0 D;  3LCP C;  1EG3 A;  1SMG A;  3TZ1 A;  3TS5 C;  1QX7 A;  1QX5 B;  1CFP A;  4DCK A;  2KAX A;  1QVI Y;  3GK2 A;  2Q91 A;  1MHO A;  2V53 A;  1KQM B;  3PLF B;  1DGU A;  4FTG A;  2ZN8 A;  3KO0 A;  4UPG A;  2M1K B;  2BEC A;  2O60 A;  1M46 A;  2CBL A;  2CXJ A;  1DJZ A;  2BCX A;  1WRL A;  1KWO C;  1CFF A;  1XFW O;  1OQP A;  4ORB B;  3JVT B;  2TN4 A;  2COL B;  3CGA A;  3DVJ A;  3AAK A;  3BUM B;  1YVH A;  1X02 A;  2PMY A;  2H2K A;  2E6W A;  4QJ5 B;  1WLZ A;  1SCM C;  2K7O A;  2KFF A;  2MAZ A;  2LHL A;  2ZNE A;  2HET A;  4PE1 A;  1WRK A;  1WDC C;  1XFY O;  1Y1A A;  2HF5 A;  1IGV A;  1TNQ A;  1XK4 C;  2QAC A;  3CLN A;  2DOQ A;  1AP4 A;  1CM4 A;  4GAO A;  1L2O B;  2LHI A;  1A29 A;  4P5O E;  1B8R A;  1KFX L;  1S5G Z;  3KPX A;  3EVR A;  1N0Y A;  1OMR A;  2LVK A;  1QIV A;  1YUU A;  1QV0 A;  1QVI Z;  5D7F A;  3SG4 A;  1YVL A;  1SYM A;  3TUY B;  4A4C A;  2NLN A;  2PVB A;  5AXI A;  4AOM A;  3IF7 A;  1F54 A;  1AHR A;  3E3R A;  2ISD A;  1CMG A;  3AAJ A;  4AQI A;  1NX1 A;  2K7C A;  1KK7 Z;  2GV5 A;  1IQ5 A;  1J55 A;  1Q80 A;  2H61 A;  1K9U A;  4NQG A;  1AK8 A;  5I2Q A;  4PAL A;  1CKK A;  1S3P A;  1F70 A;  3KF9 A;  4YGB B;  1NSH A;  5DKQ A;  4I5L B;  4OVN F;  1J7Q A;  2FOT A;  4ETO A;  1MXE A;  4PHM A;  2CTN A;  2ZKM X;  4MN0 A;  3HX4 A;  1CLL A;  1KK8 C;  1SK6 D;  1CDL A;  1M63 B;  2KHN A;  2LLS A;  3PSR A;  1DJI A;  2KNE A;  2M3W A;  4MZJ A;  2OS8 C;  1WLM A;  1YX7 A;  3EVU A;  2LMT A;  3SG5 A;  2KOT A;  1S1E A;  1ZFS A;  4GGF C;  1M45 A;  1Y1X A;  3I5I C;  2Y1M A;  4GNK B;  2I94 A;  1RTP 1;  1RWY A;  1S6I A;  1YTZ C;  2M0R A;  5CSJ A;  2JRF A;  1CFD A;  2Q4U A;  2K0J A;  2ZND A;  2EGD A;  3TS5 B;  4DIR A;  5I8N A;  1QIW A;  3FS7 A;  4YI8 A;  1Y0V H;  2CCM A;  3OX6 A;  3F45 A;  3OB1 B;  4ORA B;  3VRP A;  1KFX S;  3NSL A;  2JXC A;  1CFC A;  2WOS A;  2H61 C;  1RRO A;  4WRI A;  3MSE B;  4F0Z B;  3DVK A;  3PFV A;  1KWO B;  4MLW A;  1DT7 B;  4FQO A;  4NDD A;  1RK9 A;  1SL9 A;  4N5X A;  4R1E A;  1GGW A;  1KFU S;  1SCM B;  1YRU B;  2HQW A;  2PAS A;  3DF0 A;  4Q04 A;  3BUN B;  2LUC A;  4BY4 A;  1WDC B;  1IKU A;  1F55 A;  4OCI A;  1JWD A;  1DJX A;  2GGM A;  2JWW A;  5B8I B;  1BG1 A;  1UHI A;  2MLE C;  2K7B A;  1UUS A;  1DJW A;  4PCW A;  5PAL A;  5F6T A;  5KSZ A;  2ZN9 A;  2L50 A;  2SAS A;  4IL1 A;  2PRU A;  4E68 A;  2LAP A;  1ODB A;  1H8B A;  3CR2 A;  1GJY A;  3KHE A;  2BBN A;  2MA2 A;  1TNW A; 
#chains in the Genus database with same CATH topology
 1TTX A;  1XK4 A;  2HPS A;  5AER A;  2L5X B;  1U5I B;  2LLU A;  2JTZ A;  2KGR A;  2F8P A;  2M49 B;  2ZFD A;  3D75 A;  3GK1 A;  3PAL A;  4MZL A;  4XJK B;  3GK4 X;  2PAL A;  1BLQ A;  5HKY A;  2KYC A;  1A2X A;  1GQM A;  4OZD A;  1GGZ A;  3CLN A;  2K2F A;  1MWN A;  3FWB A;  3OP0 A;  3D10 A;  2L51 A;  3OX5 A;  1KSO A;  1DQE A;  1B7T Z;  1KK8 B;  1TOP A;  4P2Y B;  5G08 A;  1KSM A;  1AVS A;  3IQQ A;  4A4B A;  2BL0 C;  1U5I A;  1C7W A;  4XJK A;  1S26 D;  1OOH A;  2OS8 B;  1CTR A;  2BCA A;  2G2B A;  3I5I B;  3D0Y A;  2L98 A;  2M97 A;  1DGV A;  2L4H A;  1SBJ A;  1K93 D;  1MUX A;  2JT8 A;  1CB1 A;  3S0D A;  2ERB A;  4CFQ A;  3FWC A;  3A4U B;  2BKH B;  4PHJ A;  2SCP A;  1FW4 A;  2M1U A;  3VRN A;  4YRU A;  1K9K A;  1TRF A;  2K7D A;  1SL8 A;  3I5F C;  1QV1 A;  3NSI A;  1FI5 A;  2BKI B;  3N7H A;  5I2O A;  3CWG A;  1FF1 A;  4U8D A;  3ZNI A;  1B47 A;  1BMO A;  5D3O A;  1OMD A;  4GGF A;  3JTD C;  1J7R A;  3S0F A;  2KLD A;  2F2P A;  1YX8 A;  1LS8 A;  2LV7 A;  1UP5 A;  2Y5I A;  2QEH A;  2WCL A;  2JPT A;  2FJU B;  1SW8 A;  3M0W A;  3VGO A;  2JT3 A;  2LE9 B;  1JFK A;  1LA0 A;  1BOD A;  2L2E A;  3HCM A;  3SIB A;  1FBV A;  2LP2 A;  1LIN A;  4YGE B;  2JNX A;  3NSO A;  1KFU L;  3PN7 B;  4HSZ A;  1PVA A;  3V2L A;  2F3Z A;  3UO9 A;  1NYA A;  1DF0 A;  3EVV A;  1NX0 A;  1DJG A;  3BUX B;  4MEW A;  2GGZ A;  1J7O A;  1IRJ A;  1LKJ A;  3ICB A;  3SG7 A;  1MXL C;  3O2P A;  2JTT A;  4PE0 A;  1B9A A;  1QWV A;  1DMO A;  3OGN A;  4XYN A;  2WCB A;  3IQO A;  4CLN A;  4C0J A;  2JC2 A;  4CFR A;  1XFV O;  2K60 A;  3BYA A;  1DC1 A;  5D69 A;  1N65 A;  1HQV A;  1LXF C;  2FCE A;  2LAN A;  3B88 A;  1T14 A;  2F3Y A;  1IQ3 A;  4C0L A;  1BR4 B;  2L0P A;  1SKT A;  3D74 A;  1OZO A;  4ORC B;  1ALV A;  1V1G A;  4PE7 A;  1CLM A;  2K8M B;  4USL A;  1MQ1 A;  2NZ0 A;  3CR5 X;  1NCZ A;  2LUX A;  2PSR A;  1J1E A;  1F4O A;  5ER5 A;  1OOG A;  4OKH A;  5HKZ A;  1JF2 A;  4F7F A;  2LMU A;  3DF0 B;  3BQ3 A;  1ALW A;  1DJY A;  5TNC A;  3CZ2 A;  2BL0 B;  5KU1 A;  2LMV A;  3CR4 X;  3D76 A;  3DY9 A;  2BE4 A;  3TDZ A;  5HYD A;  3SJS A;  1YUT A;  3VRQ A;  4DS7 A;  1SR6 C;  4MZK A;  4GFT A;  1BT6 A;  5FI2 A;  2M7N A;  3SS5 A;  4PDZ A;  3TDI A;  1EXR A;  1XA5 A;  2WOR A;  1UHK A;  2WCJ A;  1J1D A;  1JFJ A;  2CT9 A;  4PHK A;  3C1V A;  2EC6 C;  1XFR A;  3WHU B;  1PAL A;  4OR9 B;  1Z4H A;  3I5F B;  1CDM A;  1HT9 A;  4M2Q A;  4N1G A;  1LA3 A;  2D8N A;  1ZMZ A;  1MF8 B;  1QXP A;  1OE9 B;  4IJ7 A;  3K1E A;  1XO5 A;  1L2O C;  2G9B A;  3JTD B;  4I5K A;  1SRA A;  3CZT X;  2I7A A;  3I5G C;  1NPQ A;  5CPV A;  1B4C A;  2AUC A;  1S36 A;  4ICB A;  2OTG C;  1IG5 A;  3ZWH A;  2LLT A;  1CM1 A;  5CSF A;  3B87 A;  1SL7 A;  2MHH A;  1M31 A;  1QAS A;  4HRE E;  1NP8 A;  1IJ5 A;  4BY5 A;  1NX3 A;  3DVE A;  1ZOT B;  2QEO A;  3DD4 A;  1A4P A;  1EG4 A;  3FE9 A;  4HRG A;  1NUB A;  4I5N B;  1QLK A;  5HKW A;  1NX2 A;  5DIC A;  4QJ3 B;  2K61 A;  4JWQ A;  2AMI A;  2KFG A;  2LVV A;  2HQ8 A;  3D0Y B;  1SPY A;  1PRW A;  5DKR A;  2KBI A;  2JUL A;  1OZS A;  2JOJ A;  1WY9 A;  1K8U A;  2NXQ A;  3R72 A;  2F2O A;  3SG2 A;  3O6B A;  1D1O A;  5DKN A;  1GM0 A;  3I5H C;  5IBW A;  2WCK A;  1W7I B;  4YGC B;  3SIA A;  4WQ3 A;  1F71 A;  5KTY A;  1MR8 A;  1DEK A;  2IS9 A;  3WHT B;  2RGI A;  2KBM A;  4GGN A;  1QS7 A;  1W7J B;  1UUR A;  2KQ6 A;  2M29 A;  2VRG A;  2H8V A;  3BOW B;  2KGB C;  3PAT A;  1A75 B;  1QTX A;  4GPL B;  3OHM B;  1TIZ A;  2JT0 A;  1B8C A;  1K90 D;  1S5G Y;  2M8U A;  5CSI A;  4M2O A;  2O5G A;  1AJ5 A;  1E8A A;  1NWD A;  1QLS A;  2KSP A;  1W9Z A;  1UWO A;  2BCB A;  1Y1U A;  1OW4 A;  2KFH A;  1DTL A;  2JZI A;  1A03 A;  3OB2 B;  4YGD B;  4I5J A;  3A8R A;  2QDI A;  5HLO A;  1BR1 B;  2M9G A;  1DF0 B;  1SSE B;  2LVJ A;  2MLF C;  1CMF A;  2E30 A;  5I94 A;  1KK7 Y;  2AAO A;  3LK0 A;  2KQY A;  1SR6 B;  2WCE A;  4CPV A;  2KLE A;  1XYD A;  3BOW A;  1FPW A;  1A75 A;  4D1E A;  1LVC D;  1K2H A;  2KDH A;  3EK4 A;  2EHB A;  3CYZ A;  3AKB A;  1K94 A;  1CLB A;  2EC6 B;  5JJG A;  2KAY A;  4GUK A;  2NCO A;  1V1F A;  1SNL A;  1OMV A;  1B1G A;  1IH0 A;  3EG5 B;  2KYF A;  3NHT A;  1L7Z A;  4AQJ A;  1CDP A;  2LVI A;  3AKA A;  1OSA A;  3SS3 A;  2KAV A;  1FI6 A;  1VRK A;  3KEV A;  3PM2 A;  3I5G B;  3RLZ A;  4DUQ A;  1NIW A;  2KI6 D;  3O4Y A;  3VRO A;  3OBV A;  3GOF A;  1BF5 A;  3UNW A;  2OTG B;  1JBA A;  3VRR A;  2BAP A;  2WC5 A;  2OPO A;  1K95 A;  2K2A A;  2GTE A;  3Q8I A;  1Y6W A;  4MSP A;  3EKH A;  4MBE A;  2KI4 C;  2WCF A;  5I2L A;  3VB1 A;  2MBX A;  2JQ6 A;  2PQL A;  2BBM A;  2CNP A;  3S0G A;  2Y4Q A;  3CAB A;  1R6P A;  2I18 A;  1BJF A;  3H4S E;  2P70 A;  3IVT A;  3L4A A;  3NXA A;  1PSR A;  1DEL A;  4MRX A;  5BPJ A;  1OOJ A;  3BXK A;  2KI6 C;  4PHN A;  5AEQ A;  3CTN A;  4C0K A;  1C7V A;  4GBA A;  1JUO A;  1PVB A;  1CNP A;  1H4B A;  2JU0 A;  4MVF A;  1EL4 A;  4MRY A;  1JSA A;  3PM8 A;  1REC A;  1S6C A;  1SCV A;  1SY9 A;  2B1U A;  2JXL A;  3I5H B;  3FIA A;  1PK0 D;  2QPT A;  1AJ4 A;  2LCP A;  1DVI A;  2WC8 A;  2MRD A;  1KQM C;  3DZT A;  4N1F A;  1OOI X;  2WC6 A;  3BUW B;  3WXA A;  1QX2 A;  4ZCV A;  1UHN A;  4M2P A;  2LNK A;  3WNX B;  1CDN A;  1B8L A;  3R1P A;  4OV2 A;  3LL8 B;  3TDU A;  2M7L A;  1UHH A;  3CS1 A;  4WQ2 A;  1BOC A;  1YRT B;  1DJH A;  5J3X A;  3JVT C;  1RJV A;  4L9M A;  1XFU O;  1EH2 A;  1RFJ A;  1EJ3 A;  1YUS A;  1ZUZ A;  2LC5 A;  2Y1N A;  1S6J A;  2P6B B;  4JKT A;  1F8H A;  4JPZ B;  1BU3 A;  4QJ4 B;  2BE6 A;  1TNP A;  3BUO B;  1ZAC A;  2R2I A;  1PSB A;  1TCO B;  1JC2 A;  3RM1 A;  1C07 A;  4HRH A;  1UHJ A;  1NCY A;  5FI6 A;  1G4Y R;  3BFA A;  4DRW A;  1QJT A;  1K9P A;  2LP3 A;  1YUR A;  2ZRS A;  4YI9 A;  5CSN A;  1TN4 A;  3TUY C;  4NDB A;  3EKJ A;  5AAN A;  2JPO A;  1QAT A;  3O4X A;  4PT1 A;  3EK7 A;  3R1O A;  4YBH B;  1KCY A;  5FI7 A;  5ER4 X;  1JF0 A;  1K96 A;  1WRZ A;  1XVJ A;  1G33 A;  3NSK A;  3PN7 C;  1B7T Y;  3QRX A;  1IWQ A;  1G8I A;  2PYQ A;  3O78 A;  2I2R E;  4FQT A;  3RZS A;  3LLE A;  2MJW B;  1TWO A;  1YR5 A;  4TNC A;  3CZ0 A;  2WND A;  3LK1 A;  3K21 A;  4YGA A;  4NDC A;  2FCD A;  1IJ6 A;  1KQV A;  1PUL A;  2JNF A;  1NCX A;  5AFP A;  1XFX O;  2F33 A;  5JOL A;  3SG3 A;  1XFZ O;  5K89 A;  2KI4 B;  1R2U A;  5FYX A;  2LM5 A;  1TCF A;  5GQQ C;  3SG6 A;  2NCP A;  2L4I A;  3DVM A;  2ZRT A;  3EK8 A;  5HLV A;  1TNX A;  1N2D A;  1J7P A;  4ZCU A;  4INX A;  1M39 A;  1F4Q A;  2A4J A;  2WCH A;  3FE8 A;  1AUI B;  4PE4 A;  3D77 A;  4CID A;  4JQ0 D;  3LCP C;  1EG3 A;  1SMG A;  3S0E A;  3TZ1 A;  3TS5 C;  1QX7 A;  1QX5 B;  3S0B A;  1CFP A;  4DCK A;  2KAX A;  1QVI Y;  3GK2 A;  2Q91 A;  1MHO A;  2V53 A;  1KQM B;  3PLF B;  1DGU A;  1Z2C B;  2FJY A;  2ZN8 A;  3KO0 A;  4FTG A;  4UPG A;  1OOF A;  2M1K B;  2BEC A;  2KPH A;  1M46 A;  2O60 A;  2QEV A;  3S0A A;  2CBL A;  2CXJ A;  1DJZ A;  2BCX A;  1WRL A;  1KWO C;  1CFF A;  1XFW O;  1OQP A;  4ORB B;  3PJI A;  3JVT B;  2TN4 A;  2COL B;  3CGA A;  3DVJ A;  3AAK A;  3BUM B;  1YVH A;  1X02 A;  2PMY A;  2H2K A;  2E6W A;  4QJ5 B;  1WLZ A;  1SCM C;  2K7O A;  2BNX A;  3BFH A;  3BJH A;  2KFF A;  2MAZ A;  2LHL A;  2ZNE A;  2HET A;  4PE1 A;  1WRK A;  1WDC C;  1XFY O;  1Y1A A;  2HF5 A;  1IGV A;  1TNQ A;  1XK4 C;  2QAC A;  1P28 A;  2DOQ A;  1AP4 A;  1CM4 A;  4GAO A;  1L2O B;  5HL1 A;  3B6X A;  2LHI A;  1A29 A;  3B86 A;  4P5O E;  1B8R A;  4INW A;  1KFX L;  1S5G Z;  3BFB A;  3KPX A;  3EVR A;  2WCM A;  1N0Y A;  1OMR A;  2LVK A;  1QIV A;  1YUU A;  1QV0 A;  1QVI Z;  5D7F A;  3SG4 A;  1YVL A;  1SYM A;  3TUY B;  4A4C A;  2NLN A;  2PVB A;  3L47 A;  5AXI A;  4AOM A;  3IF7 A;  3SS4 A;  1F54 A;  1AHR A;  3E3R A;  2ISD A;  1CMG A;  3AAJ A;  4AQI A;  1NX1 A;  2K7C A;  1KK7 Z;  2GV5 A;  1IQ5 A;  1J55 A;  1Q80 A;  2H61 A;  1K9U A;  4NQG A;  1AK8 A;  5I2Q A;  4PAL A;  1CKK A;  1S3P A;  1F70 A;  3KF9 A;  2P71 A;  4YGB B;  1C3Y A;  1NSH A;  5DKQ A;  4I5L B;  4OVN F;  1J7Q A;  2FOT A;  4ETO A;  1MXE A;  2L2C A;  4PHM A;  2CTN A;  3L4L A;  2ZKM X;  2YGU A;  4MN0 A;  3HX4 A;  1CLL A;  1KK8 C;  1SK6 D;  1CDL A;  1M63 B;  2KHN A;  2LLS A;  3PSR A;  1DJI A;  2KNE A;  2M3W A;  3D78 A;  4MZJ A;  2OS8 C;  1WLM A;  1YX7 A;  3EVU A;  2LMT A;  3SG5 A;  2KOT A;  1S1E A;  1ZFS A;  4GGF C;  1M45 A;  1Y1X A;  3I5I C;  2Y1M A;  4GNK B;  2I94 A;  1RTP 1;  1RWY A;  1S6I A;  1YTZ C;  2M0R A;  5CSJ A;  3DYE A;  2JRF A;  1CFD A;  3FE6 A;  2Q4U A;  2K0J A;  1IIO A;  2ZND A;  2EGD A;  3D73 A;  3TS5 B;  4DIR A;  5I8N A;  1QIW A;  3FS7 A;  4YI8 A;  1Y0V H;  2CCM A;  3OX6 A;  3F45 A;  3OB1 B;  4ORA B;  3VRP A;  4KYN A;  1KFX S;  3NSL A;  2JXC A;  1CFC A;  3NGV A;  2WOS A;  2H61 C;  1RRO A;  1ORG A;  4WRI A;  3MSE B;  3B7A A;  4F0Z B;  3DVK A;  3PFV A;  1KWO B;  4MLW A;  1DT7 B;  4FQO A;  4NDD A;  1RK9 A;  1SL9 A;  3NHI A;  4N5X A;  1C3Z A;  4R1E A;  2L5Y A;  1GGW A;  1KFU S;  1SCM B;  1YRU B;  2HQW A;  2PAS A;  3DF0 A;  4Q04 A;  3BUN B;  4JD9 A;  2LUC A;  4BY4 A;  1WDC B;  1IKU A;  1F55 A;  4OCI A;  1JWD A;  1DJX A;  2GGM A;  2JWW A;  5EL2 A;  5B8I B;  1BG1 A;  1UHI A;  2MLE C;  2QEB A;  3CDN A;  2K7B A;  1UUS A;  1DJW A;  1TUZ A;  4PCW A;  5PAL A;  5F6T A;  5KSZ A;  3R1V A;  2ZN9 A;  2L50 A;  2SAS A;  4IL1 A;  2PRU A;  4E68 A;  3QME A;  3DXL A;  2LAP A;  1ODB A;  1H8B A;  1TUJ A;  3CR2 A;  1GJY A;  3KHE A;  3CZ1 A;  2BBN A;  2MA2 A;  1TNW A; 
#chains in the Genus database with same CATH homology
 1TTX A;  1XK4 A;  2HPS A;  5AER A;  2L5X B;  1U5I B;  2LLU A;  2JTZ A;  2KGR A;  2F8P A;  2M49 B;  2ZFD A;  3GK1 A;  3PAL A;  4MZL A;  4XJK B;  3GK4 X;  2PAL A;  1BLQ A;  5HKY A;  2KYC A;  1A2X A;  1GQM A;  1GGZ A;  2K2F A;  1MWN A;  3FWB A;  3OP0 A;  3D10 A;  2L51 A;  3OX5 A;  1KSO A;  1KK8 B;  1B7T Z;  1TOP A;  4P2Y B;  5G08 A;  1KSM A;  1AVS A;  3IQQ A;  4A4B A;  2BL0 C;  1U5I A;  1C7W A;  4XJK A;  1S26 D;  2OS8 B;  1CTR A;  2BCA A;  2G2B A;  3I5I B;  3D0Y A;  2L98 A;  2M97 A;  1DGV A;  2L4H A;  1SBJ A;  1K93 D;  1MUX A;  2JT8 A;  1CB1 A;  4CFQ A;  3FWC A;  3A4U B;  2BKH B;  4PHJ A;  2SCP A;  1FW4 A;  2M1U A;  3VRN A;  4YRU A;  1K9K A;  1TRF A;  2K7D A;  1SL8 A;  3I5F C;  1QV1 A;  3NSI A;  1FI5 A;  2BKI B;  5I2O A;  3CWG A;  1FF1 A;  4U8D A;  3ZNI A;  1B47 A;  1BMO A;  1OMD A;  4GGF A;  3JTD C;  1J7R A;  2Y5I A;  2F2P A;  1YX8 A;  2LV7 A;  1UP5 A;  2JPT A;  2FJU B;  1SW8 A;  3M0W A;  3VGO A;  2JT3 A;  2LE9 B;  1JFK A;  1LA0 A;  1BOD A;  2L2E A;  3HCM A;  3SIB A;  1FBV A;  2LP2 A;  1LIN A;  4YGE B;  2JNX A;  3NSO A;  1KFU L;  3PN7 B;  4HSZ A;  1PVA A;  2F3Z A;  1NYA A;  1DF0 A;  3EVV A;  1NX0 A;  1DJG A;  3BUX B;  4MEW A;  2GGZ A;  1J7O A;  1IRJ A;  1LKJ A;  3ICB A;  3SG7 A;  1MXL C;  3O2P A;  2JTT A;  4PE0 A;  1B9A A;  1DMO A;  4XYN A;  2WCB A;  3IQO A;  4CLN A;  4C0J A;  2JC2 A;  4CFR A;  1XFV O;  3BYA A;  5D69 A;  1N65 A;  1HQV A;  1LXF C;  2FCE A;  2LAN A;  1IQ3 A;  2F3Y A;  4C0L A;  1BR4 B;  2L0P A;  1SKT A;  1OZO A;  4ORC B;  1ALV A;  1V1G A;  4PE7 A;  1CLM A;  2K8M B;  4USL A;  1MQ1 A;  2NZ0 A;  3CR5 X;  1NCZ A;  2LUX A;  2PSR A;  1J1E A;  1F4O A;  5ER5 A;  4OKH A;  5HKZ A;  1JF2 A;  2LMU A;  3DF0 B;  3BQ3 A;  1ALW A;  1DJY A;  5TNC A;  2BL0 B;  5KU1 A;  2LMV A;  3CR4 X;  2BE4 A;  3TDZ A;  5HYD A;  3SJS A;  1YUT A;  3VRQ A;  4DS7 A;  1SR6 C;  4MZK A;  4GFT A;  1BT6 A;  2M7N A;  3TDI A;  4PDZ A;  1JFJ A;  1EXR A;  1XA5 A;  2WOR A;  1UHK A;  1J1D A;  2CT9 A;  4PHK A;  3C1V A;  2EC6 C;  3WHU B;  1PAL A;  4OR9 B;  3I5F B;  1CDM A;  1HT9 A;  4M2Q A;  4N1G A;  1LA3 A;  2D8N A;  1ZMZ A;  1MF8 B;  1QXP A;  1OE9 B;  1XO5 A;  1L2O C;  2G9B A;  3JTD B;  4I5K A;  1SRA A;  3CZT X;  2I7A A;  3I5G C;  1NPQ A;  5CPV A;  1B4C A;  2AUC A;  1S36 A;  4ICB A;  2OTG C;  1IG5 A;  3ZWH A;  2LLT A;  1CM1 A;  5CSF A;  1SL7 A;  2MHH A;  1M31 A;  1QAS A;  4HRE E;  1NP8 A;  1IJ5 A;  4BY5 A;  1NX3 A;  3DVE A;  1ZOT B;  3DD4 A;  1A4P A;  1EG4 A;  4HRG A;  1NUB A;  4I5N B;  1QLK A;  5HKW A;  1NX2 A;  4QJ3 B;  2K61 A;  4JWQ A;  2AMI A;  2KFG A;  2LVV A;  2HQ8 A;  3D0Y B;  1SPY A;  1PRW A;  5DKR A;  2KBI A;  2JUL A;  1OZS A;  2JOJ A;  1WY9 A;  1K8U A;  2NXQ A;  1D1O A;  2F2O A;  3SG2 A;  3O6B A;  5DKN A;  3I5H C;  5IBW A;  4YGC B;  1W7I B;  3SIA A;  4WQ3 A;  1F71 A;  5KTY A;  1MR8 A;  2IS9 A;  3WHT B;  2RGI A;  2KBM A;  4GGN A;  1QS7 A;  1W7J B;  1UUR A;  2KQ6 A;  2M29 A;  2VRG A;  3BOW B;  3PAT A;  2KGB C;  1A75 B;  1QTX A;  4GPL B;  3OHM B;  1TIZ A;  2JT0 A;  1B8C A;  1K90 D;  1S5G Y;  2M8U A;  5CSI A;  4M2O A;  2O5G A;  1AJ5 A;  1E8A A;  1NWD A;  1QLS A;  2KSP A;  1UWO A;  2BCB A;  1Y1U A;  2KFH A;  1DTL A;  2JZI A;  1A03 A;  3OB2 B;  4YGD B;  4I5J A;  3A8R A;  5HLO A;  1BR1 B;  2M9G A;  1DF0 B;  2LVJ A;  2MLF C;  1CMF A;  2E30 A;  1KK7 Y;  2AAO A;  3LK0 A;  2KQY A;  1SR6 B;  2WCE A;  4CPV A;  3BOW A;  1XYD A;  1FPW A;  1A75 A;  4D1E A;  1LVC D;  1K2H A;  2KDH A;  3EK4 A;  2EHB A;  3AKB A;  1K94 A;  1CLB A;  2EC6 B;  5JJG A;  2KAY A;  4GUK A;  2NCO A;  1V1F A;  1SNL A;  1OMV A;  1B1G A;  1IH0 A;  4AQJ A;  2KYF A;  1L7Z A;  1CDP A;  2LVI A;  3AKA A;  1OSA A;  2KAV A;  1FI6 A;  1VRK A;  3KEV A;  3I5G B;  3RLZ A;  4DUQ A;  1NIW A;  2KI6 D;  3O4Y A;  3VRO A;  3GOF A;  1BF5 A;  1JBA A;  2OTG B;  3VRR A;  2OPO A;  1K95 A;  2K2A A;  4MSP A;  1Y6W A;  3EKH A;  4MBE A;  2KI4 C;  2WCF A;  5I2L A;  2MBX A;  2JQ6 A;  2BBM A;  2CNP A;  2Y4Q A;  3H4S E;  1R6P A;  2I18 A;  1BJF A;  3NXA A;  1PSR A;  4MRX A;  5BPJ A;  1OOJ A;  3BXK A;  2KI6 C;  4PHN A;  5AEQ A;  3CTN A;  4C0K A;  1C7V A;  4GBA A;  1JUO A;  1PVB A;  1CNP A;  1H4B A;  2JU0 A;  4MVF A;  1EL4 A;  4MRY A;  1JSA A;  3PM8 A;  1REC A;  1S6C A;  1SCV A;  1SY9 A;  2B1U A;  2JXL A;  3I5H B;  3FIA A;  1PK0 D;  2QPT A;  1AJ4 A;  2LCP A;  1DVI A;  2WC8 A;  2MRD A;  1KQM C;  4N1F A;  3BUW B;  3WXA A;  1QX2 A;  4ZCV A;  1UHN A;  4M2P A;  2LNK A;  3WNX B;  1CDN A;  1B8L A;  4OV2 A;  3TDU A;  3LL8 B;  1BOC A;  2M7L A;  1UHH A;  3CS1 A;  4WQ2 A;  1YRT B;  1DJH A;  5J3X A;  3JVT C;  1RJV A;  4L9M A;  1XFU O;  1EH2 A;  1RFJ A;  1EJ3 A;  1YUS A;  1ZUZ A;  2LC5 A;  2Y1N A;  1S6J A;  2P6B B;  1F8H A;  4JPZ B;  1BU3 A;  4QJ4 B;  2BE6 A;  1TNP A;  3BUO B;  1ZAC A;  2R2I A;  1PSB A;  1TCO B;  1JC2 A;  3RM1 A;  1C07 A;  4HRH A;  1UHJ A;  1NCY A;  1G4Y R;  4DRW A;  1QJT A;  1K9P A;  2LP3 A;  1YUR A;  2ZRS A;  4YI9 A;  5CSN A;  1TN4 A;  3TUY C;  4NDB A;  3EKJ A;  5AAN A;  1QAT A;  4YBH B;  3EK7 A;  1KCY A;  5ER4 X;  1JF0 A;  1K96 A;  1WRZ A;  1XVJ A;  1G33 A;  3NSK A;  3PN7 C;  1B7T Y;  3QRX A;  1IWQ A;  1G8I A;  3O78 A;  2I2R E;  3LLE A;  2MJW B;  1YR5 A;  4TNC A;  2WND A;  3LK1 A;  3K21 A;  4YGA A;  4NDC A;  2FCD A;  1IJ6 A;  1KQV A;  1PUL A;  2JNF A;  1NCX A;  5AFP A;  1XFX O;  2F33 A;  5JOL A;  3SG3 A;  1XFZ O;  5K89 A;  2KI4 B;  1R2U A;  5FYX A;  2LM5 A;  1TCF A;  5GQQ C;  3SG6 A;  2NCP A;  2L4I A;  3DVM A;  2ZRT A;  3EK8 A;  5HLV A;  1TNX A;  1N2D A;  1J7P A;  4ZCU A;  1M39 A;  1F4Q A;  2A4J A;  1AUI B;  4PE4 A;  4CID A;  4JQ0 D;  3LCP C;  1EG3 A;  1SMG A;  3TZ1 A;  3TS5 C;  1QX7 A;  1QX5 B;  1CFP A;  4DCK A;  2KAX A;  1QVI Y;  3GK2 A;  2Q91 A;  1MHO A;  2V53 A;  1KQM B;  3PLF B;  1DGU A;  4FTG A;  2ZN8 A;  3KO0 A;  4UPG A;  2M1K B;  2BEC A;  2O60 A;  1M46 A;  2CBL A;  2CXJ A;  1DJZ A;  2BCX A;  1WRL A;  1KWO C;  1CFF A;  1XFW O;  1OQP A;  4ORB B;  3JVT B;  2TN4 A;  2COL B;  3CGA A;  3DVJ A;  3AAK A;  3BUM B;  1YVH A;  1X02 A;  2PMY A;  2H2K A;  2E6W A;  4QJ5 B;  1WLZ A;  1SCM C;  2K7O A;  2KFF A;  2MAZ A;  2LHL A;  2ZNE A;  2HET A;  4PE1 A;  1WRK A;  1WDC C;  1XFY O;  1Y1A A;  2HF5 A;  1IGV A;  1TNQ A;  1XK4 C;  2QAC A;  3CLN A;  2DOQ A;  1AP4 A;  1CM4 A;  4GAO A;  1L2O B;  2LHI A;  1A29 A;  4P5O E;  1B8R A;  1KFX L;  1S5G Z;  3KPX A;  3EVR A;  1N0Y A;  1OMR A;  2LVK A;  1QIV A;  1YUU A;  1QV0 A;  1QVI Z;  5D7F A;  3SG4 A;  1YVL A;  1SYM A;  3TUY B;  4A4C A;  2NLN A;  2PVB A;  5AXI A;  4AOM A;  3IF7 A;  1F54 A;  1AHR A;  3E3R A;  2ISD A;  1CMG A;  3AAJ A;  4AQI A;  1NX1 A;  2K7C A;  1KK7 Z;  2GV5 A;  1IQ5 A;  1J55 A;  1Q80 A;  2H61 A;  1K9U A;  4NQG A;  1AK8 A;  5I2Q A;  4PAL A;  1CKK A;  1S3P A;  1F70 A;  3KF9 A;  4YGB B;  1NSH A;  5DKQ A;  4I5L B;  4OVN F;  1J7Q A;  2FOT A;  4ETO A;  1MXE A;  4PHM A;  2CTN A;  2ZKM X;  4MN0 A;  3HX4 A;  1CLL A;  1KK8 C;  1SK6 D;  1CDL A;  1M63 B;  2KHN A;  2LLS A;  3PSR A;  1DJI A;  2KNE A;  2M3W A;  4MZJ A;  2OS8 C;  1WLM A;  1YX7 A;  3EVU A;  2LMT A;  3SG5 A;  2KOT A;  1S1E A;  1ZFS A;  4GGF C;  1M45 A;  1Y1X A;  3I5I C;  2Y1M A;  4GNK B;  2I94 A;  1RTP 1;  1RWY A;  1S6I A;  1YTZ C;  2M0R A;  5CSJ A;  2JRF A;  1CFD A;  2Q4U A;  2K0J A;  2ZND A;  2EGD A;  3TS5 B;  4DIR A;  5I8N A;  1QIW A;  3FS7 A;  4YI8 A;  1Y0V H;  2CCM A;  3OX6 A;  3F45 A;  3OB1 B;  4ORA B;  3VRP A;  1KFX S;  3NSL A;  2JXC A;  1CFC A;  2WOS A;  2H61 C;  1RRO A;  4WRI A;  3MSE B;  4F0Z B;  3DVK A;  3PFV A;  1KWO B;  4MLW A;  1DT7 B;  4FQO A;  4NDD A;  1RK9 A;  1SL9 A;  4N5X A;  4R1E A;  1GGW A;  1KFU S;  1SCM B;  1YRU B;  2HQW A;  2PAS A;  3DF0 A;  4Q04 A;  3BUN B;  2LUC A;  4BY4 A;  1WDC B;  1IKU A;  1F55 A;  4OCI A;  1JWD A;  1DJX A;  2GGM A;  2JWW A;  5B8I B;  1BG1 A;  1UHI A;  2MLE C;  2K7B A;  1UUS A;  1DJW A;  4PCW A;  5PAL A;  5F6T A;  5KSZ A;  2ZN9 A;  2L50 A;  2SAS A;  4IL1 A;  2PRU A;  4E68 A;  2LAP A;  1ODB A;  1H8B A;  3CR2 A;  1GJY A;  3KHE A;  2BBN A;  2MA2 A;  1TNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...