2KAXA

Solution structure and dynamics of s100a5 in the apo and ca2+ -bound states
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A5
publication title Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 32
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kaxA00
1PK0D 1RFJA 3ZWHA 2LHLA 4DIRA 3QRXA 3I5IB 2PVBA 1ZACA 1TNPA 1W7IB 4M2QA 4NDCA 4GGFC 3VROA 2LCPA 2PRUA 2RGIA 2JXCA 4MLWA 1QIVA 1A75B 2VRGA 4OCIA 1G8IA 1Y1UA 1A75A 1S6JA 2ZKMX 4MBEA 3A4UB 2EC6B 1B1GA 1MF8B 4P2YB 3NXAA 5AERA 1NWDA 4PHKA 1DJHA 1SYMA 3ICBA 1BMOA 3BUXB 3I5HB 2M7LA 1BR1B 1H8BA 2CNPA 1AP4A 2FOTA 2E30A 1YURA 4FQOA 5D69A 2JWWA 1WDCC 3EK7A 3OX5A 4TNCA 2L51A 2HPSA 1N2DA 2NZ0A 1SPYA 2KSPA 3EK4A 3LCPC 4L9MA 2KFHA 2M49B 1QLSA 2JOJA 5HLVA 4YBHB 1D1OA 1TIZA 2BL0C 2Q91A 2WCFA 4Q04A 3KO0A 1NPQA 1SNLA 2TN4A 2JTZA 1TCOB 3AKBA 2LVVA 4MSPA 2LMVA 4ICBA 3CTNA 1QJTA 1QV1A 3BUOB 1SW8A 1U5IB 3IF7A 1RWYA 1UP5A 3K21A 1SL8A 3OB1B 1U5IA 1SCMC 2NCOA 2NCPA 2B1UA 4JWQA 2JT8A 4NDBA 1WLMA 1A2XA 4GUKA 1AK8A 2MHHA 1OQPA 5TNCA 1QATA 2JQ6A 5I2OA 1C07A 1BF5A 2MA2A 4PE4A 2M9GA 4CFRA 1L2OC 1TNWA 2DOQA 1MQ1A 4I5KA 2H2KA 1SL9A 2A4JA 4ZCVA 1PULA 2QPTA 2LVIA 1LA0A 1YR5A 2KBMA 2Y1MA 1K9KA 2JTTA 1JFKA 1IG5A 1OMRA 1Y0VH 1EH2A 1FF1A 2F2PA 4DS7A 1UURA 1AVSA 4QJ3B 3I5FC 1TRFA 1MHOA 2F8PA 2WOSA 2Y1NA 2EC6C 1DT7B 4A4BA 2BE6A 3D0YB 3D0YA 1XFWO 1OZOA 1YUUA 2O5GA 2SASA 3M0WA 4YI8A 3VRQA 3TZ1A 2CTNA 1WY9A 3I5HC 3OP0A 1KFUS 3SG5A 3BUWB 3DVKA 1S36A 1CDMA 1KSMA 1J7QA 1WLZA 1PRWA 2LNKA 3TDIA 2I2RE 1KFUL 3O4YA 2KYCA 1K2HA 1CFDA 3SG2A 1QX5B 1PSBA 1K90D 1HQVA 4PE7A 5G08A 2JNXA 3TDUA 3JTDB 2COLB 1L7ZA 4AQIA 3JVTC 2OS8B 1Y1XA 1IRJA 1PVBA 3GK1A 1B8LA 3CLNA 1GQMA 1S5GZ 1SK6D 4QJ5B 1S26D 4GAOA 1ALWA 4XYNA 3ZNIA 2I94A 2KQ6A 1CDNA 1F55A 3I5GB 1N0YA 1DJZA 2LVJA 3IQQA 3TUYC 1UWOA 1R2UA 1S3PA 3VRPA 3PLFB 1CKKA 5I2LA 1H4BA 1EXRA 1SKTA 2OTGC 1DMOA 2LVKA 2K8MB 3SG3A 1EJ3A 4DRWA 4N1FA 4YGEB 1QX7A 3KEVA 3EK8A 4MRYA 2SCPA 5B8IB 4PE1A 1J1EA 1K95A 1WRKA 2KI6D 4OR9B 4YGAA 2LLSA 4I5LB 1B9AA 1FI6A 1NIWA 2F33A 2WORA 2KFGA 4MZLA 2M29A 4OV2A 1XFVO 1J7OA 4M2OA 1XVJA 1LA3A 4WRIA 1M39A 3VGOA 1G33A 5ER4X 3TDZA 3GK2A 1YRTB 1MWNA 1SL7A 1XA5A 4UPGA 2LMTA 3BYAA 2LLTA 1QLKA 4PALA 2JT0A 1CDLA 3O78A 2BCXA 2KQYA 1FI5A 5K89A 1NCXA 1JUOA 3EKHA 1K96A 2WNDA 1QTXA 3CWGA 3FWBA 2NXQA 3H4SE 2G9BA 1C7VA 3NSLA 1X02A 3EVVA 2M97A 1M31A 2L4HA 4PCWA 1XK4A 2K2AA 1LXFC 2V53A 1RK9A 2KGRA 2LC5A 3VRRA 2MRDA 3JTDC 5AANA 1KCYA 2KBIA 3D10A 2JC2A 3EVRA 3WHTB 4CPVA 1YRUB 1NX3A 1VRKA 1XFZO 2H61C 2LLUA 4GNKB 5PALA 1IGVA 4WQ3A 1CLLA 1BLQA 4MEWA 3DF0B 3O6BA 1MXLC 3DF0A 5HKWA 2K61A 1RROA 1K8UA 1B4CA 1LVCD 1OZSA 2KYFA 1KK7Y 1NX1A 4I5JA 4E68A 1RJVA 1NP8A 1QV0A 1PSRA 1XFYO 2M3WA 1FPWA 1EG4A 2KDHA 2JULA 1F71A 2QACA 3TS5B 1B8RA 1K93D 1C7WA 2E6WA 5KTYA 2Y4QA 3MSEB 1J1DA 4PHNA 3SJSA 2F3ZA 1Q80A 3I5IC 2BE4A 4USLA 2Y5IA 1YUTA 1BG1A 2AMIA 1XFUO 3DD4A 4YGBB 2KAYA 2JZIA 4XJKB 4MZJA 3RLZA 2EGDA 1BJFA 4XJKA 1V1FA 5CSJA 1CMFA 1NX2A 3WXAA 4GBAA 2KGBC 1PALA 2GV5A 2OPOA 1YTZC 2KFFA 2O60A 1ZMZA 2CBLA 1YVLA 1B7TY 1CFPA 2ZNDA 2FCDA 1WRZA 5JJGA 2KI6C 5CPVA 1CM4A 1DGVA 1SR6B 1UHHA 5BPJA 3EKJA 1TNXA 1DTLA 4YGDB 1NX0A 5DKNA 1V1GA 1YX7A 4HRGA 1SRAA 1S5GY 4D1EA 1B47A 3AAJA 1K9UA 2ZNEA 1W7JB 2L0PA 1M45A 3FS7A 3BQ3A 4GGFA 1QXPA 4C0JA 2AAOA 2LAPA 4AQJA 1NCZA 1TN4A 2LMUA 4PDZA 1GGZA 1ALVA 1A29A 1QASA 1TTXA 3CR4X 3A8RA 4BY5A 1SMGA 4JPZB 2LUCA 2ZRSA 1J55A 5J3XA 2PASA 3E3RA 3CR5X 1DJGA 1KFXS 1KWOB 1JSAA 5CSNA 1BT6A 1J7RA 3BOWB 1IQ5A 4MVFA 2MBXA 1FBVA 3BOWA 1UHJA 3KPXA 2CCMA 3LK1A 3F45A 2KI4B 4QJ4B 1ZOTB 1KFXL 5I2QA 1DJYA 2KOTA 4DCKA 1F54A 4M2PA 1G4YR 1SY9A 4HSZA 3LK0A 3SIBA 1M63B 1QIWA 1JF0A 5AFPA 2MLFC 2BECA 2ZFDA 1S6CA 1S6IA 2LP2A 4N5XA 3CS1A 3FIAA 2L4IA 2WCEA 1EL4A 3CGAA 2NLNA 5ER5A 1IJ6A 1SCMB 2HQ8A 2BBMA 4PHJA 2JXLA 1TNQA 1YX8A 4PHMA 1CNPA 1XFXO 1A4PA 3WHUB 1CTRA 1DVIA 5CSIA 3DVJA 2PMYA 1DGUA 1L2OB 2L50A 1OOJA 2LP3A 2K0JA 1AUIB 1YUSA 5D7FA 1CLBA 1KQMB 1KK8B 1IKUA 1JWDA 4IL1A 2GGMA 2L5XB 1UHIA 5KSZA 3BXKA 1AHRA 1ODBA 2WC8A 5DKQA 2M1KB 4BY4A 1NCYA 1YVHA 1QVIZ 4ZCUA 1BOCA 1SBJA 3I5FB 4MN0A 2CT9A 1CLMA 2PALA 2KAVA 5IBWA 2OS8C 4MZKA 5HYDA 1TCFA 4I5NB 1CB1A 3AAKA 1F70A 1GJYA 3GOFA 2BCAA 2HETA 1NYAA 2L98A 2K7CA 3I5GC 1KWOC 4GPLB 3WNXB 3SG4A 1OMVA 3HCMA 4C0LA 3PFVA 4YRUA 2PSRA 2P6BB 5HLOA 1IH0A 2KI4C 3EVUA 4CIDA 1CDPA 1M46A 2BKHB 1OE9B 1OMDA 4ORCB 4WQ2A 1F4QA 5FYXA 2LM5A 3SG6A 4MRXA 2EHBA 1E8AA 2ZN8A 2ZN9A 1R6PA 1CM1A 1LINA 3JVTB 4N1GA 1IWQA 2HQWA 4A4CA 3PN7B 2ZRTA 1NUBA 1MXEA 4GGNA 4PE0A 5I8NA 3CR2A 3BUMB 2FCEA 3TUYB 3PALA 2F2OA 2MJWB 2K7BA 1DJXA 2BKIB 4U8DA 2JPTA 1CFCA 1UUSA 1CMGA 1KSOA 2OTGB 1F8HA 3C1VA 3KF9A 1A03A 1QS7A 1XO5A 4JQ0D 5GQQC 2HF5A 5AEQA 1KQMC 1KK8C 1K9PA 2I18A 3RM1A 1KK7Z 2WCBA 4CFQA 2FJUB 1ZFSA 2KHNA 3AKAA 3NSOA 4CLNA 1DJIA 1XK4C 1LKJA 2M0RA 2G2BA 1CFFA 2K2FA 4F0ZB 2LE9B 1EG3A 1Y1AA 3LL8B 3O2PA 5JOLA 2KAXA 3OB2B 1K94A 1PVAA 2K7DA 2IS9A 5CSFA 1J7PA 2BCBA 5AXIA 1AJ4A 1F4OA 3PSRA 3PATA 4DUQA 2MLEC 1ZUZA 1FW4A 1IJ5A 2CXJA 1RECA 5KU1A 2JNFA 3VRNA 1UHNA 1XYDA 2ISDA 2R2IA 1WRLA 4YI9A 4GFTA 1DJWA 3DVMA 1HT9A 3KHEA 4R1EA 4HRHA 4C0KA 4FTGA 1JC2A 1BU3A 1TOPA 1WDCB 2JT3A 2L2EA 2KNEA 4ORBB 2MAZA 2Q4UA 1B7TZ 3LLEA 1AJ5A 3SG7A 1BR4B 5HKYA 1RTP1 1JBAA 1KQVA 1S1EA 3SIAA 3TS5C 3NSKA 4ORAB 1GGWA 4HREE 1UHKA 1NSHA 3NSIA 1DF0B 2BL0B 3HX4A 2GGZA 1B8CA 1DF0A 2AUCA 2H61A 2JRFA 2LUXA 3FWCA 3PN7C 1OSAA 3IQOA 4OKHA 2D8NA 4NDDA 4OVNF 4AOMA 4ETOA 4P5OE 1MR8A 2M7NA 1JFJA 5F6TA 1SCVA 2I7AA 3PM8A 2F3YA 5HKZA 3OX6A 4YGCB 1IQ3A 3CZTX 1N65A 2JU0A 4NQGA 1JF2A 3OHMB 2K7OA 5DKRA 2LV7A 3GK4X 3BUNB 1MUXA 2M8UA 2M1UA 1QVIY 2BBNA 2LANA 2LHIA 1BODA 1QX2A 1SR6C 3DVEA 1Y6WA
chains in the Genus database with same CATH superfamily
1PK0D 1RFJA 3ZWHA 2LHLA 3D73A 4DIRA 5EL2A 3QRXA 3I5IB 2PVBA 1ZACA 1TNPA 1W7IB 4M2QA 4NDCA 4GGFC 3VROA 2LCPA 2PRUA 2RGIA 2JXCA 4MLWA 1QIVA 1A75B 2VRGA 4PT1A 4OCIA 1G8IA 1Y1UA 1A75A 1S6JA 3RZSA 2ZKMX 4MBEA 3A4UB 2EC6B 1B1GA 3O4XA 1MF8B 4P2YB 3NXAA 4IJ7A 5AERA 3B87A 1NWDA 4PHKA 1IIOA 1DJHA 1SYMA 3ICBA 1BMOA 2QEHA 3BUXB 3I5HB 2M7LA 1BR1B 1H8BA 2CNPA 1AP4A 2WC6A 2FOTA 2E30A 1YURA 2WCKA 4FQOA 5D69A 2JWWA 1WDCC 3EK7A 3OX5A 3R1PA 3OGNA 4TNCA 2L51A 2HPSA 1N2DA 2NZ0A 1SPYA 2KSPA 3EK4A 3LCPC 3BJHA 2KFHA 2M49B 1QLSA 2JOJA 5HLVA 4YBHB 1D1OA 1TIZA 2BL0C 2Q91A 2WCFA 4Q04A 3KO0A 1NPQA 2BAPA 1SNLA 2TN4A 2JTZA 1TCOB 3AKBA 2LVVA 4MSPA 2K60A 2LMVA 3NGVA 4ICBA 3CTNA 1QJTA 1QV1A 3BUOB 1SW8A 1U5IB 3IF7A 1RWYA 1UP5A 3K21A 1SL8A 3OB1B 1U5IA 1SCMC 2NCOA 2NCPA 2B1UA 4JWQA 2JT8A 4NDBA 1WLMA 1A2XA 4GUKA 1AK8A 2MHHA 1OQPA 5TNCA 1W9ZA 1QATA 2JQ6A 3R1VA 5I2OA 1C07A 1BF5A 2MA2A 4PE4A 3CDNA 2M9GA 4L9MA 1Z2CB 4CFRA 1L2OC 1TNWA 3CZ1A 2DOQA 1MQ1A 4I5KA 2H2KA 1SL9A 2A4JA 4ZCVA 1PULA 2QPTA 2LVIA 1LA0A 1YR5A 2KBMA 4JKTA 2Y1MA 1K9KA 2JTTA 1JFKA 1IG5A 1OMRA 1Y0VH 1EH2A 2P70A 1FF1A 2F2PA 3S0AA 4DS7A 3FE8A 1OOFA 1UURA 3DYEA 1AVSA 4QJ3B 3I5FC 1TRFA 1MHOA 2F8PA 2WOSA 2Y1NA 2EC6C 1DT7B 4A4BA 2BE6A 3L47A 3D0YB 4F7FA 3DY9A 3FE9A 3D0YA 1XFWO 1OZOA 1YUUA 2O5GA 2SASA 3M0WA 4YI8A 3VRQA 3D78A 3TZ1A 2CTNA 1WY9A 3I5HC 3OP0A 1KFUS 3SG5A 1OW4A 3BUWB 3D74A 1S36A 3DVKA 1CDMA 1KSMA 1J7QA 1WLZA 1PRWA 2LNKA 3PN7C 3TDIA 2I2RE 1KFUL 3O4YA 2KYCA 1K2HA 1CFDA 3SG2A 1QX5B 1T14A 1PSBA 1K90D 1HQVA 4PE7A 5G08A 2JNXA 3TDUA 2WCJA 3JTDB 2COLB 1L7ZA 4AQIA 3JVTC 2OS8B 1Y1XA 1IRJA 1PVBA 3GK1A 1B8LA 3CLNA 1GQMA 3PJIA 5I94A 1S5GZ 1SK6D 4QJ5B 1S26D 4GAOA 1ALWA 4XYNA 5FI2A 3ZNIA 2I94A 2KQ6A 1CDNA 1F55A 3I5GB 1N0YA 1DJZA 2LVJA 3IQQA 3TUYC 1UWOA 1R2UA 3UO9A 1S3PA 3VRPA 3PLFB 1CKKA 5I2LA 1H4BA 1EXRA 1SKTA 1TUZA 2OTGC 1DMOA 2LVKA 2K8MB 3SG3A 1EJ3A 4DRWA 4N1FA 3CZ0A 4YGEB 1QX7A 3KEVA 3EK8A 4MRYA 2SCPA 5B8IB 4PE1A 1J1EA 1K95A 1WRKA 2KI6D 4OR9B 4YGAA 2LLSA 2BNXA 4I5LB 1B9AA 1FI6A 1NIWA 2F33A 2WORA 2KFGA 3D75A 4MZLA 5FI6A 2M29A 4OV2A 1XFVO 1J7OA 1OOHA 4M2OA 1XVJA 1LA3A 4WRIA 1M39A 3VGOA 1G33A 5ER4X 3TDZA 3GK2A 1YRTB 1MWNA 1SL7A 1XA5A 4UPGA 2LMTA 3BYAA 2LLTA 1QLKA 4PALA 2JT0A 1TUJA 1CDLA 3O78A 1XFRA 2BCXA 2KQYA 5K89A 1FI5A 1NCXA 3CABA 1JUOA 3EKHA 3N7HA 1K96A 2WNDA 1QTXA 3CWGA 3FWBA 2NXQA 3H4SE 2G9BA 1C7VA 3NSLA 1X02A 3EVVA 2M97A 1M31A 2L4HA 2WCLA 4PCWA 1XK4A 2PQLA 2QEOA 2K2AA 1LXFC 2V53A 3B86A 1RK9A 2KGRA 3S0DA 2LC5A 3VRRA 2MRDA 3JTDC 5AANA 1KCYA 2KBIA 3D10A 2JC2A 3EVRA 3WHTB 5HL1A 4JD9A 1YRUB 1NX3A 1VRKA 1XFZO 2H61C 2LLUA 4CPVA 4GNKB 5PALA 1IGVA 4WQ3A 1CLLA 1BLQA 4MEWA 3DF0B 3O6BA 1MXLC 3DF0A 5D3OA 5HKWA 2K61A 1RROA 1K8UA 1B4CA 1LVCD 1OZSA 2KYFA 2QEBA 1KK7Y 1NX1A 4I5JA 1QWVA 4E68A 1RJVA 1NP8A 3FE6A 1OOGA 1QV0A 1PSRA 1XFYO 2M3WA 2L2CA 1FPWA 1EG4A 2KDHA 2JULA 3NHTA 1F71A 2QACA 3TS5B 2P71A 3K1EA 1B8RA 1K93D 1C7WA 2E6WA 5KTYA 2Y4QA 1TWOA 3MSEB 1J1DA 4PHNA 3SJSA 2F3ZA 3L4AA 1Q80A 3I5IC 2BE4A 4USLA 2Y5IA 1YUTA 1BG1A 2AMIA 2FJYA 4KYNA 1XFUO 3DD4A 4YGBB 2KAYA 2JZIA 4XJKB 4MZJA 3RLZA 2EGDA 1BJFA 4XJKA 1V1FA 2H8VA 5CSJA 1CMFA 1NX2A 3WXAA 4GBAA 1GM0A 2KGBC 1PALA 2GV5A 2OPOA 1YTZC 2KFFA 2O60A 1ZMZA 2CBLA 1DQEA 1YVLA 1B7TY 1CFPA 2ZNDA 2FCDA 1WRZA 2WC5A 5JJGA 2KI6C 5CPVA 1CM4A 1DGVA 1SR6B 1UHHA 5BPJA 1DEKA 3EKJA 1TNXA 1DTLA 4YGDB 2JPOA 1NX0A 5DKNA 1V1GA 1YX7A 3QMEA 4HRGA 1SRAA 1S5GY 3BFAA 4D1EA 1B47A 3AAJA 1K9UA 2ZNEA 1W7JB 2L0PA 1M45A 3FS7A 3BQ3A 4GGFA 1QXPA 4C0JA 3EG5B 2AAOA 2LAPA 3BFHA 4AQJA 4OZDA 1NCZA 1TN4A 2LMUA 4PDZA 1GGZA 1DC1A 1ALVA 1A29A 1QASA 1TTXA 3CR4X 3A8RA 4BY5A 1SMGA 4JPZB 2LUCA 3SS5A 2ZRSA 1J55A 3B6XA 5J3XA 2PASA 1Z4HA 3CR5X 1DJGA 3E3RA 1KFXS 1KWOB 1JSAA 5CSNA 1BT6A 1J7RA 3BOWB 1IQ5A 1C3ZA 4MVFA 2MBXA 1FBVA 3BOWA 1UHJA 3KPXA 2CCMA 1SSEB 3LK1A 3F45A 2KI4B 4QJ4B 1ZOTB 1KFXL 5I2QA 1DJYA 3SS3A 2KOTA 4DCKA 3OBVA 1F54A 4M2PA 1G4YR 1SY9A 4HSZA 3LK0A 3SIBA 1DELA 1M63B 1QIWA 1JF0A 5AFPA 2MLFC 2BECA 2ZFDA 1S6CA 1S6IA 2LP2A 4N5XA 3CS1A 3FIAA 2L4IA 2WCEA 3D77A 1EL4A 3CGAA 2NLNA 5ER5A 1IJ6A 1SCMB 2HQ8A 2BBMA 4FQTA 1ORGA 4PHJA 3R72A 2JXLA 1TNQA 1YX8A 4PHMA 1CNPA 1XFXO 1A4PA 3WHUB 1CTRA 1LS8A 1DVIA 3S0FA 5CSIA 3BFBA 3DVJA 2PMYA 3L4LA 1DGUA 1L2OB 2L50A 1OOJA 1OOIX 2LP3A 2K0JA 3S0BA 1AUIB 1YUSA 3Q8IA 5D7FA 1CLBA 1KQMB 1KK8B 2KLDA 1IKUA 1JWDA 4IL1A 2GGMA 2L5XB 1UHIA 5KSZA 1P28A 3VB1A 3BXKA 1AHRA 1ODBA 2WC8A 5DKQA 2M1KB 4BY4A 1NCYA 1YVHA 1QVIZ 4ZCUA 1BOCA 1SBJA 3I5FB 4MN0A 2CT9A 1CLMA 2PALA 2KAVA 5IBWA 2OS8C 4MZKA 1C3YA 5HYDA 1TCFA 4I5NB 1CB1A 5FI7A 3AAKA 1F70A 1GJYA 3GOFA 2BCAA 2HETA 1NYAA 2L98A 3CZ2A 2K7CA 3I5GC 1KWOC 4GPLB 3WNXB 3SG4A 1OMVA 3HCMA 4C0LA 2WCHA 3PM2A 3PFVA 4YRUA 2PSRA 2P6BB 5HLOA 1IH0A 2KI4C 3EVUA 4CIDA 1CDPA 2KPHA 1M46A 2BKHB 2YGUA 1OE9B 1OMDA 4ORCB 4WQ2A 3V2LA 1F4QA 5FYXA 2LM5A 3SG6A 4MRXA 2EHBA 1E8AA 2ZN8A 2ZN9A 1R6PA 1CM1A 1LINA 3JVTB 4N1GA 1IWQA 2HQWA 4A4CA 3PN7B 2ZRTA 1NUBA 1MXEA 2GTEA 4GGNA 4PE0A 5I8NA 3CR2A 3BUMB 2FCEA 2QDIA 4INXA 3PALA 2WCMA 2F2OA 3SS4A 3TUYB 2MJWB 2K7BA 1DJXA 2BKIB 4U8DA 2JPTA 1CFCA 1UUSA 1CMGA 1KSOA 2OTGB 1F8HA 3C1VA 3KF9A 1A03A 1QS7A 1XO5A 4JQ0D 3B7AA 5GQQC 2HF5A 5AEQA 3B88A 1KQMC 1KK8C 1K9PA 2I18A 3RM1A 1KK7Z 2WCBA 4CFQA 2FJUB 1ZFSA 2PYQA 2KHNA 3AKAA 3NSOA 4CLNA 1DJIA 1XK4C 1LKJA 2M0RA 2G2BA 1CFFA 4INWA 2K2FA 4F0ZB 2LE9B 1Y1AA 1EG3A 3LL8B 3O2PA 5JOLA 2KAXA 3D76A 3OB2B 1K94A 1PVAA 2K7DA 2IS9A 5CSFA 1J7PA 2BCBA 5AXIA 1AJ4A 5DICA 1F4OA 3PSRA 2KLEA 3PATA 2MLEC 4DUQA 1ZUZA 1FW4A 1IJ5A 2CXJA 3NHIA 1RECA 5KU1A 2JNFA 2QEVA 3VRNA 1UHNA 1XYDA 2ISDA 2R2IA 1WRLA 4YI9A 4GFTA 1DJWA 3DVMA 1HT9A 3KHEA 4R1EA 4HRHA 3DZTA 4C0KA 4FTGA 1JC2A 1BU3A 1TOPA 1WDCB 2JT3A 2L2EA 2KNEA 4ORBB 2MAZA 2Q4UA 1B7TZ 3LLEA 1AJ5A 3SG7A 1BR4B 5HKYA 1RTP1 1JBAA 1KQVA 1S1EA 3SIAA 3TS5C 3NSKA 4ORAB 1GGWA 4HREE 1UHKA 1NSHA 3NSIA 1DF0B 2BL0B 3HX4A 3R1OA 2GGZA 3S0GA 1B8CA 1DF0A 2AUCA 2H61A 2JRFA 2LUXA 3CYZA 3FWCA 1OSAA 3IQOA 4OKHA 2D8NA 4NDDA 4OVNF 4AOMA 4ETOA 4P5OE 1MR8A 2L5YA 2M7NA 5F6TA 1JFJA 1SCVA 2I7AA 3PM8A 2F3YA 5HKZA 3OX6A 4YGCB 3IVTA 3CZTX 1IQ3A 1N65A 2ERBA 2JU0A 4NQGA 1JF2A 3OHMB 2K7OA 5DKRA 2LV7A 3GK4X 3BUNB 1MUXA 2M8UA 3UNWA 2M1UA 3S0EA 3DXLA 1QVIY 2BBNA 2LANA 2LHIA 1BODA 1QX2A 1SR6C 3DVEA 1Y6WA
chains in the Genus database with same CATH topology
1PK0D 1RFJA 3ZWHA 2LHLA 4DIRA 3QRXA 3I5IB 2PVBA 1ZACA 1TNPA 1W7IB 4M2QA 4NDCA 4GGFC 3VROA 2LCPA 2PRUA 2RGIA 2JXCA 4MLWA 1QIVA 1A75B 2VRGA 4OCIA 1G8IA 1Y1UA 1A75A 1S6JA 2ZKMX 4MBEA 3A4UB 2EC6B 1B1GA 1MF8B 4P2YB 3NXAA 5AERA 1NWDA 4PHKA 1DJHA 1SYMA 3ICBA 1BMOA 3BUXB 3I5HB 2M7LA 1BR1B 1H8BA 2CNPA 1AP4A 2FOTA 2E30A 1YURA 4FQOA 5D69A 2JWWA 1WDCC 3EK7A 3OX5A 4TNCA 2L51A 2HPSA 1N2DA 2NZ0A 1SPYA 2KSPA 3EK4A 3LCPC 4L9MA 2KFHA 2M49B 1QLSA 2JOJA 5HLVA 4YBHB 1D1OA 1TIZA 2BL0C 2Q91A 2WCFA 4Q04A 3KO0A 1NPQA 1SNLA 2TN4A 2JTZA 1TCOB 3AKBA 2LVVA 4MSPA 2LMVA 4ICBA 3CTNA 1QJTA 1QV1A 3BUOB 1SW8A 1U5IB 3IF7A 1RWYA 1UP5A 3K21A 1SL8A 3OB1B 1U5IA 1SCMC 2NCOA 2NCPA 2B1UA 4JWQA 2JT8A 4NDBA 1WLMA 1A2XA 4GUKA 1AK8A 2MHHA 1OQPA 5TNCA 1QATA 2JQ6A 5I2OA 1C07A 1BF5A 2MA2A 4PE4A 2M9GA 4CFRA 1L2OC 1TNWA 2DOQA 1MQ1A 4I5KA 2H2KA 1SL9A 2A4JA 4ZCVA 1PULA 2QPTA 2LVIA 1LA0A 1YR5A 2KBMA 2Y1MA 1K9KA 2JTTA 1JFKA 1IG5A 1OMRA 1Y0VH 1EH2A 1FF1A 2F2PA 4DS7A 1UURA 1AVSA 4QJ3B 3I5FC 1TRFA 1MHOA 2F8PA 2WOSA 2Y1NA 2EC6C 1DT7B 4A4BA 2BE6A 3D0YB 3D0YA 1XFWO 1OZOA 1YUUA 2O5GA 2SASA 3M0WA 4YI8A 3VRQA 3TZ1A 2CTNA 1WY9A 3I5HC 3OP0A 1KFUS 3SG5A 3BUWB 3DVKA 1S36A 1CDMA 1KSMA 1J7QA 1WLZA 1PRWA 2LNKA 3TDIA 2I2RE 1KFUL 3O4YA 2KYCA 1K2HA 1CFDA 3SG2A 1QX5B 1PSBA 1K90D 1HQVA 4PE7A 5G08A 2JNXA 3TDUA 3JTDB 2COLB 1L7ZA 4AQIA 3JVTC 2OS8B 1Y1XA 1IRJA 1PVBA 3GK1A 1B8LA 3CLNA 1GQMA 1S5GZ 1SK6D 4QJ5B 1S26D 4GAOA 1ALWA 4XYNA 3ZNIA 2I94A 2KQ6A 1CDNA 1F55A 3I5GB 1N0YA 1DJZA 2LVJA 3IQQA 3TUYC 1UWOA 1R2UA 1S3PA 3VRPA 3PLFB 1CKKA 5I2LA 1H4BA 1EXRA 1SKTA 2OTGC 1DMOA 2LVKA 2K8MB 3SG3A 1EJ3A 4DRWA 4N1FA 4YGEB 1QX7A 3KEVA 3EK8A 4MRYA 2SCPA 5B8IB 4PE1A 1J1EA 1K95A 1WRKA 2KI6D 4OR9B 4YGAA 2LLSA 4I5LB 1B9AA 1FI6A 1NIWA 2F33A 2WORA 2KFGA 4MZLA 2M29A 4OV2A 1XFVO 1J7OA 4M2OA 1XVJA 1LA3A 4WRIA 1M39A 3VGOA 1G33A 5ER4X 3TDZA 3GK2A 1YRTB 1MWNA 1SL7A 1XA5A 4UPGA 2LMTA 3BYAA 2LLTA 1QLKA 4PALA 2JT0A 1CDLA 3O78A 2BCXA 2KQYA 1FI5A 5K89A 1NCXA 1JUOA 3EKHA 1K96A 2WNDA 1QTXA 3CWGA 3FWBA 2NXQA 3H4SE 2G9BA 1C7VA 3NSLA 1X02A 3EVVA 2M97A 1M31A 2L4HA 4PCWA 1XK4A 2K2AA 1LXFC 2V53A 1RK9A 2KGRA 2LC5A 3VRRA 2MRDA 3JTDC 5AANA 1KCYA 2KBIA 3D10A 2JC2A 3EVRA 3WHTB 4CPVA 1YRUB 1NX3A 1VRKA 1XFZO 2H61C 2LLUA 4GNKB 5PALA 1IGVA 4WQ3A 1CLLA 1BLQA 4MEWA 3DF0B 3O6BA 1MXLC 3DF0A 5HKWA 2K61A 1RROA 1K8UA 1B4CA 1LVCD 1OZSA 2KYFA 1KK7Y 1NX1A 4I5JA 4E68A 1RJVA 1NP8A 1QV0A 1PSRA 1XFYO 2M3WA 1FPWA 1EG4A 2KDHA 2JULA 1F71A 2QACA 3TS5B 1B8RA 1K93D 1C7WA 2E6WA 5KTYA 2Y4QA 3MSEB 1J1DA 4PHNA 3SJSA 2F3ZA 1Q80A 3I5IC 2BE4A 4USLA 2Y5IA 1YUTA 1BG1A 2AMIA 1XFUO 3DD4A 4YGBB 2KAYA 2JZIA 4XJKB 4MZJA 3RLZA 2EGDA 1BJFA 4XJKA 1V1FA 5CSJA 1CMFA 1NX2A 3WXAA 4GBAA 2KGBC 1PALA 2GV5A 2OPOA 1YTZC 2KFFA 2O60A 1ZMZA 2CBLA 1YVLA 1B7TY 1CFPA 2ZNDA 2FCDA 1WRZA 5JJGA 2KI6C 5CPVA 1CM4A 1DGVA 1SR6B 1UHHA 5BPJA 3EKJA 1TNXA 1DTLA 4YGDB 1NX0A 5DKNA 1V1GA 1YX7A 4HRGA 1SRAA 1S5GY 4D1EA 1B47A 3AAJA 1K9UA 2ZNEA 1W7JB 2L0PA 1M45A 3FS7A 3BQ3A 4GGFA 1QXPA 4C0JA 2AAOA 2LAPA 4AQJA 1NCZA 1TN4A 2LMUA 4PDZA 1GGZA 1ALVA 1A29A 1QASA 1TTXA 3CR4X 3A8RA 4BY5A 1SMGA 4JPZB 2LUCA 2ZRSA 1J55A 5J3XA 2PASA 3E3RA 3CR5X 1DJGA 1KFXS 1KWOB 1JSAA 5CSNA 1BT6A 1J7RA 3BOWB 1IQ5A 4MVFA 2MBXA 1FBVA 3BOWA 1UHJA 3KPXA 2CCMA 3LK1A 3F45A 2KI4B 4QJ4B 1ZOTB 1KFXL 5I2QA 1DJYA 2KOTA 4DCKA 1F54A 4M2PA 1G4YR 1SY9A 4HSZA 3LK0A 3SIBA 1M63B 1QIWA 1JF0A 5AFPA 2MLFC 2BECA 2ZFDA 1S6CA 1S6IA 2LP2A 4N5XA 3CS1A 3FIAA 2L4IA 2WCEA 1EL4A 3CGAA 2NLNA 5ER5A 1IJ6A 1SCMB 2HQ8A 2BBMA 4PHJA 2JXLA 1TNQA 1YX8A 4PHMA 1CNPA 1XFXO 1A4PA 3WHUB 1CTRA 1DVIA 5CSIA 3DVJA 2PMYA 1DGUA 1L2OB 2L50A 1OOJA 2LP3A 2K0JA 1AUIB 1YUSA 5D7FA 1CLBA 1KQMB 1KK8B 1IKUA 1JWDA 4IL1A 2GGMA 2L5XB 1UHIA 5KSZA 3BXKA 1AHRA 1ODBA 2WC8A 5DKQA 2M1KB 4BY4A 1NCYA 1YVHA 1QVIZ 4ZCUA 1BOCA 1SBJA 3I5FB 4MN0A 2CT9A 1CLMA 2PALA 2KAVA 5IBWA 2OS8C 4MZKA 5HYDA 1TCFA 4I5NB 1CB1A 3AAKA 1F70A 1GJYA 3GOFA 2BCAA 2HETA 1NYAA 2L98A 2K7CA 3I5GC 1KWOC 4GPLB 3WNXB 3SG4A 1OMVA 3HCMA 4C0LA 3PFVA 4YRUA 2PSRA 2P6BB 5HLOA 1IH0A 2KI4C 3EVUA 4CIDA 1CDPA 1M46A 2BKHB 1OE9B 1OMDA 4ORCB 4WQ2A 1F4QA 5FYXA 2LM5A 3SG6A 4MRXA 2EHBA 1E8AA 2ZN8A 2ZN9A 1R6PA 1CM1A 1LINA 3JVTB 4N1GA 1IWQA 2HQWA 4A4CA 3PN7B 2ZRTA 1NUBA 1MXEA 4GGNA 4PE0A 5I8NA 3CR2A 3BUMB 2FCEA 3TUYB 3PALA 2F2OA 2MJWB 2K7BA 1DJXA 2BKIB 4U8DA 2JPTA 1CFCA 1UUSA 1CMGA 1KSOA 2OTGB 1F8HA 3C1VA 3KF9A 1A03A 1QS7A 1XO5A 4JQ0D 5GQQC 2HF5A 5AEQA 1KQMC 1KK8C 1K9PA 2I18A 3RM1A 1KK7Z 2WCBA 4CFQA 2FJUB 1ZFSA 2KHNA 3AKAA 3NSOA 4CLNA 1DJIA 1XK4C 1LKJA 2M0RA 2G2BA 1CFFA 2K2FA 4F0ZB 2LE9B 1EG3A 1Y1AA 3LL8B 3O2PA 5JOLA 2KAXA 3OB2B 1K94A 1PVAA 2K7DA 2IS9A 5CSFA 1J7PA 2BCBA 5AXIA 1AJ4A 1F4OA 3PSRA 3PATA 4DUQA 2MLEC 1ZUZA 1FW4A 1IJ5A 2CXJA 1RECA 5KU1A 2JNFA 3VRNA 1UHNA 1XYDA 2ISDA 2R2IA 1WRLA 4YI9A 4GFTA 1DJWA 3DVMA 1HT9A 3KHEA 4R1EA 4HRHA 4C0KA 4FTGA 1JC2A 1BU3A 1TOPA 1WDCB 2JT3A 2L2EA 2KNEA 4ORBB 2MAZA 2Q4UA 1B7TZ 3LLEA 1AJ5A 3SG7A 1BR4B 5HKYA 1RTP1 1JBAA 1KQVA 1S1EA 3SIAA 3TS5C 3NSKA 4ORAB 1GGWA 4HREE 1UHKA 1NSHA 3NSIA 1DF0B 2BL0B 3HX4A 2GGZA 1B8CA 1DF0A 2AUCA 2H61A 2JRFA 2LUXA 3FWCA 3PN7C 1OSAA 3IQOA 4OKHA 2D8NA 4NDDA 4OVNF 4AOMA 4ETOA 4P5OE 1MR8A 2M7NA 1JFJA 5F6TA 1SCVA 2I7AA 3PM8A 2F3YA 5HKZA 3OX6A 4YGCB 1IQ3A 3CZTX 1N65A 2JU0A 4NQGA 1JF2A 3OHMB 2K7OA 5DKRA 2LV7A 3GK4X 3BUNB 1MUXA 2M8UA 2M1UA 1QVIY 2BBNA 2LANA 2LHIA 1BODA 1QX2A 1SR6C 3DVEA 1Y6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK0 D;  1RFJ A;  3ZWH A;  2LHL A;  4DIR A;  3QRX A;  3I5I B;  2PVB A;  1ZAC A;  1TNP A;  1W7I B;  4M2Q A;  4NDC A;  4GGF C;  3VRO A;  2LCP A;  2PRU A;  2RGI A;  2JXC A;  4MLW A;  1QIV A;  1A75 B;  2VRG A;  4OCI A;  1G8I A;  1Y1U A;  1A75 A;  1S6J A;  2ZKM X;  4MBE A;  3A4U B;  2EC6 B;  1B1G A;  1MF8 B;  4P2Y B;  3NXA A;  5AER A;  1NWD A;  4PHK A;  1DJH A;  1SYM A;  3ICB A;  1BMO A;  3BUX B;  3I5H B;  2M7L A;  1BR1 B;  1H8B A;  2CNP A;  1AP4 A;  2FOT A;  2E30 A;  1YUR A;  4FQO A;  5D69 A;  2JWW A;  1WDC C;  3EK7 A;  3OX5 A;  4TNC A;  2L51 A;  2HPS A;  1N2D A;  2NZ0 A;  1SPY A;  2KSP A;  3EK4 A;  3LCP C;  4L9M A;  2KFH A;  2M49 B;  1QLS A;  2JOJ A;  5HLV A;  4YBH B;  1D1O A;  1TIZ A;  2BL0 C;  2Q91 A;  2WCF A;  4Q04 A;  3KO0 A;  1NPQ A;  1SNL A;  2TN4 A;  2JTZ A;  1TCO B;  3AKB A;  2LVV A;  4MSP A;  2LMV A;  4ICB A;  3CTN A;  1QJT A;  1QV1 A;  3BUO B;  1SW8 A;  1U5I B;  3IF7 A;  1RWY A;  1UP5 A;  3K21 A;  1SL8 A;  3OB1 B;  1U5I A;  1SCM C;  2NCO A;  2NCP A;  2B1U A;  4JWQ A;  2JT8 A;  4NDB A;  1WLM A;  1A2X A;  4GUK A;  1AK8 A;  2MHH A;  1OQP A;  5TNC A;  1QAT A;  2JQ6 A;  5I2O A;  1C07 A;  1BF5 A;  2MA2 A;  4PE4 A;  2M9G A;  4CFR A;  1L2O C;  1TNW A;  2DOQ A;  1MQ1 A;  4I5K A;  2H2K A;  1SL9 A;  2A4J A;  4ZCV A;  1PUL A;  2QPT A;  2LVI A;  1LA0 A;  1YR5 A;  2KBM A;  2Y1M A;  1K9K A;  2JTT A;  1JFK A;  1IG5 A;  1OMR A;  1Y0V H;  1EH2 A;  1FF1 A;  2F2P A;  4DS7 A;  1UUR A;  1AVS A;  4QJ3 B;  3I5F C;  1TRF A;  1MHO A;  2F8P A;  2WOS A;  2Y1N A;  2EC6 C;  1DT7 B;  4A4B A;  2BE6 A;  3D0Y B;  3D0Y A;  1XFW O;  1OZO A;  1YUU A;  2O5G A;  2SAS A;  3M0W A;  4YI8 A;  3VRQ A;  3TZ1 A;  2CTN A;  1WY9 A;  3I5H C;  3OP0 A;  1KFU S;  3SG5 A;  3BUW B;  3DVK A;  1S36 A;  1CDM A;  1KSM A;  1J7Q A;  1WLZ A;  1PRW A;  2LNK A;  3TDI A;  2I2R E;  1KFU L;  3O4Y A;  2KYC A;  1K2H A;  1CFD A;  3SG2 A;  1QX5 B;  1PSB A;  1K90 D;  1HQV A;  4PE7 A;  5G08 A;  2JNX A;  3TDU A;  3JTD B;  2COL B;  1L7Z A;  4AQI A;  3JVT C;  2OS8 B;  1Y1X A;  1IRJ A;  1PVB A;  3GK1 A;  1B8L A;  3CLN A;  1GQM A;  1S5G Z;  1SK6 D;  4QJ5 B;  1S26 D;  4GAO A;  1ALW A;  4XYN A;  3ZNI A;  2I94 A;  2KQ6 A;  1CDN A;  1F55 A;  3I5G B;  1N0Y A;  1DJZ A;  2LVJ A;  3IQQ A;  3TUY C;  1UWO A;  1R2U A;  1S3P A;  3VRP A;  3PLF B;  1CKK A;  5I2L A;  1H4B A;  1EXR A;  1SKT A;  2OTG C;  1DMO A;  2LVK A;  2K8M B;  3SG3 A;  1EJ3 A;  4DRW A;  4N1F A;  4YGE B;  1QX7 A;  3KEV A;  3EK8 A;  4MRY A;  2SCP A;  5B8I B;  4PE1 A;  1J1E A;  1K95 A;  1WRK A;  2KI6 D;  4OR9 B;  4YGA A;  2LLS A;  4I5L B;  1B9A A;  1FI6 A;  1NIW A;  2F33 A;  2WOR A;  2KFG A;  4MZL A;  2M29 A;  4OV2 A;  1XFV O;  1J7O A;  4M2O A;  1XVJ A;  1LA3 A;  4WRI A;  1M39 A;  3VGO A;  1G33 A;  5ER4 X;  3TDZ A;  3GK2 A;  1YRT B;  1MWN A;  1SL7 A;  1XA5 A;  4UPG A;  2LMT A;  3BYA A;  2LLT A;  1QLK A;  4PAL A;  2JT0 A;  1CDL A;  3O78 A;  2BCX A;  2KQY A;  1FI5 A;  5K89 A;  1NCX A;  1JUO A;  3EKH A;  1K96 A;  2WND A;  1QTX A;  3CWG A;  3FWB A;  2NXQ A;  3H4S E;  2G9B A;  1C7V A;  3NSL A;  1X02 A;  3EVV A;  2M97 A;  1M31 A;  2L4H A;  4PCW A;  1XK4 A;  2K2A A;  1LXF C;  2V53 A;  1RK9 A;  2KGR A;  2LC5 A;  3VRR A;  2MRD A;  3JTD C;  5AAN A;  1KCY A;  2KBI A;  3D10 A;  2JC2 A;  3EVR A;  3WHT B;  4CPV A;  1YRU B;  1NX3 A;  1VRK A;  1XFZ O;  2H61 C;  2LLU A;  4GNK B;  5PAL A;  1IGV A;  4WQ3 A;  1CLL A;  1BLQ A;  4MEW A;  3DF0 B;  3O6B A;  1MXL C;  3DF0 A;  5HKW A;  2K61 A;  1RRO A;  1K8U A;  1B4C A;  1LVC D;  1OZS A;  2KYF A;  1KK7 Y;  1NX1 A;  4I5J A;  4E68 A;  1RJV A;  1NP8 A;  1QV0 A;  1PSR A;  1XFY O;  2M3W A;  1FPW A;  1EG4 A;  2KDH A;  2JUL A;  1F71 A;  2QAC A;  3TS5 B;  1B8R A;  1K93 D;  1C7W A;  2E6W A;  5KTY A;  2Y4Q A;  3MSE B;  1J1D A;  4PHN A;  3SJS A;  2F3Z A;  1Q80 A;  3I5I C;  2BE4 A;  4USL A;  2Y5I A;  1YUT A;  1BG1 A;  2AMI A;  1XFU O;  3DD4 A;  4YGB B;  2KAY A;  2JZI A;  4XJK B;  4MZJ A;  3RLZ A;  2EGD A;  1BJF A;  4XJK A;  1V1F A;  5CSJ A;  1CMF A;  1NX2 A;  3WXA A;  4GBA A;  2KGB C;  1PAL A;  2GV5 A;  2OPO A;  1YTZ C;  2KFF A;  2O60 A;  1ZMZ A;  2CBL A;  1YVL A;  1B7T Y;  1CFP A;  2ZND A;  2FCD A;  1WRZ A;  5JJG A;  2KI6 C;  5CPV A;  1CM4 A;  1DGV A;  1SR6 B;  1UHH A;  5BPJ A;  3EKJ A;  1TNX A;  1DTL A;  4YGD B;  1NX0 A;  5DKN A;  1V1G A;  1YX7 A;  4HRG A;  1SRA A;  1S5G Y;  4D1E A;  1B47 A;  3AAJ A;  1K9U A;  2ZNE A;  1W7J B;  2L0P A;  1M45 A;  3FS7 A;  3BQ3 A;  4GGF A;  1QXP A;  4C0J A;  2AAO A;  2LAP A;  4AQJ A;  1NCZ A;  1TN4 A;  2LMU A;  4PDZ A;  1GGZ A;  1ALV A;  1A29 A;  1QAS A;  1TTX A;  3CR4 X;  3A8R A;  4BY5 A;  1SMG A;  4JPZ B;  2LUC A;  2ZRS A;  1J55 A;  5J3X A;  2PAS A;  3E3R A;  3CR5 X;  1DJG A;  1KFX S;  1KWO B;  1JSA A;  5CSN A;  1BT6 A;  1J7R A;  3BOW B;  1IQ5 A;  4MVF A;  2MBX A;  1FBV A;  3BOW A;  1UHJ A;  3KPX A;  2CCM A;  3LK1 A;  3F45 A;  2KI4 B;  4QJ4 B;  1ZOT B;  1KFX L;  5I2Q A;  1DJY A;  2KOT A;  4DCK A;  1F54 A;  4M2P A;  1G4Y R;  1SY9 A;  4HSZ A;  3LK0 A;  3SIB A;  1M63 B;  1QIW A;  1JF0 A;  5AFP A;  2MLF C;  2BEC A;  2ZFD A;  1S6C A;  1S6I A;  2LP2 A;  4N5X A;  3CS1 A;  3FIA A;  2L4I A;  2WCE A;  1EL4 A;  3CGA A;  2NLN A;  5ER5 A;  1IJ6 A;  1SCM B;  2HQ8 A;  2BBM A;  4PHJ A;  2JXL A;  1TNQ A;  1YX8 A;  4PHM A;  1CNP A;  1XFX O;  1A4P A;  3WHU B;  1CTR A;  1DVI A;  5CSI A;  3DVJ A;  2PMY A;  1DGU A;  1L2O B;  2L50 A;  1OOJ A;  2LP3 A;  2K0J A;  1AUI B;  1YUS A;  5D7F A;  1CLB A;  1KQM B;  1KK8 B;  1IKU A;  1JWD A;  4IL1 A;  2GGM A;  2L5X B;  1UHI A;  5KSZ A;  3BXK A;  1AHR A;  1ODB A;  2WC8 A;  5DKQ A;  2M1K B;  4BY4 A;  1NCY A;  1YVH A;  1QVI Z;  4ZCU A;  1BOC A;  1SBJ A;  3I5F B;  4MN0 A;  2CT9 A;  1CLM A;  2PAL A;  2KAV A;  5IBW A;  2OS8 C;  4MZK A;  5HYD A;  1TCF A;  4I5N B;  1CB1 A;  3AAK A;  1F70 A;  1GJY A;  3GOF A;  2BCA A;  2HET A;  1NYA A;  2L98 A;  2K7C A;  3I5G C;  1KWO C;  4GPL B;  3WNX B;  3SG4 A;  1OMV A;  3HCM A;  4C0L A;  3PFV A;  4YRU A;  2PSR A;  2P6B B;  5HLO A;  1IH0 A;  2KI4 C;  3EVU A;  4CID A;  1CDP A;  1M46 A;  2BKH B;  1OE9 B;  1OMD A;  4ORC B;  4WQ2 A;  1F4Q A;  5FYX A;  2LM5 A;  3SG6 A;  4MRX A;  2EHB A;  1E8A A;  2ZN8 A;  2ZN9 A;  1R6P A;  1CM1 A;  1LIN A;  3JVT B;  4N1G A;  1IWQ A;  2HQW A;  4A4C A;  3PN7 B;  2ZRT A;  1NUB A;  1MXE A;  4GGN A;  4PE0 A;  5I8N A;  3CR2 A;  3BUM B;  2FCE A;  3TUY B;  3PAL A;  2F2O A;  2MJW B;  2K7B A;  1DJX A;  2BKI B;  4U8D A;  2JPT A;  1CFC A;  1UUS A;  1CMG A;  1KSO A;  2OTG B;  1F8H A;  3C1V A;  3KF9 A;  1A03 A;  1QS7 A;  1XO5 A;  4JQ0 D;  5GQQ C;  2HF5 A;  5AEQ A;  1KQM C;  1KK8 C;  1K9P A;  2I18 A;  3RM1 A;  1KK7 Z;  2WCB A;  4CFQ A;  2FJU B;  1ZFS A;  2KHN A;  3AKA A;  3NSO A;  4CLN A;  1DJI A;  1XK4 C;  1LKJ A;  2M0R A;  2G2B A;  1CFF A;  2K2F A;  4F0Z B;  2LE9 B;  1EG3 A;  1Y1A A;  3LL8 B;  3O2P A;  5JOL A;  2KAX A;  3OB2 B;  1K94 A;  1PVA A;  2K7D A;  2IS9 A;  5CSF A;  1J7P A;  2BCB A;  5AXI A;  1AJ4 A;  1F4O A;  3PSR A;  3PAT A;  4DUQ A;  2MLE C;  1ZUZ A;  1FW4 A;  1IJ5 A;  2CXJ A;  1REC A;  5KU1 A;  2JNF A;  3VRN A;  1UHN A;  1XYD A;  2ISD A;  2R2I A;  1WRL A;  4YI9 A;  4GFT A;  1DJW A;  3DVM A;  1HT9 A;  3KHE A;  4R1E A;  4HRH A;  4C0K A;  4FTG A;  1JC2 A;  1BU3 A;  1TOP A;  1WDC B;  2JT3 A;  2L2E A;  2KNE A;  4ORB B;  2MAZ A;  2Q4U A;  1B7T Z;  3LLE A;  1AJ5 A;  3SG7 A;  1BR4 B;  5HKY A;  1RTP 1;  1JBA A;  1KQV A;  1S1E A;  3SIA A;  3TS5 C;  3NSK A;  4ORA B;  1GGW A;  4HRE E;  1UHK A;  1NSH A;  3NSI A;  1DF0 B;  2BL0 B;  3HX4 A;  2GGZ A;  1B8C A;  1DF0 A;  2AUC A;  2H61 A;  2JRF A;  2LUX A;  3FWC A;  3PN7 C;  1OSA A;  3IQO A;  4OKH A;  2D8N A;  4NDD A;  4OVN F;  4AOM A;  4ETO A;  4P5O E;  1MR8 A;  2M7N A;  1JFJ A;  5F6T A;  1SCV A;  2I7A A;  3PM8 A;  2F3Y A;  5HKZ A;  3OX6 A;  4YGC B;  1IQ3 A;  3CZT X;  1N65 A;  2JU0 A;  4NQG A;  1JF2 A;  3OHM B;  2K7O A;  5DKR A;  2LV7 A;  3GK4 X;  3BUN B;  1MUX A;  2M8U A;  2M1U A;  1QVI Y;  2BBN A;  2LAN A;  2LHI A;  1BOD A;  1QX2 A;  1SR6 C;  3DVE A;  1Y6W A; 
#chains in the Genus database with same CATH topology
 1PK0 D;  1RFJ A;  3ZWH A;  2LHL A;  3D73 A;  4DIR A;  5EL2 A;  3QRX A;  3I5I B;  2PVB A;  1ZAC A;  1TNP A;  1W7I B;  4M2Q A;  4NDC A;  4GGF C;  3VRO A;  2LCP A;  2PRU A;  2RGI A;  2JXC A;  4MLW A;  1QIV A;  1A75 B;  2VRG A;  4PT1 A;  4OCI A;  1G8I A;  1Y1U A;  1A75 A;  1S6J A;  3RZS A;  2ZKM X;  4MBE A;  3A4U B;  2EC6 B;  1B1G A;  3O4X A;  1MF8 B;  4P2Y B;  3NXA A;  4IJ7 A;  5AER A;  3B87 A;  1NWD A;  4PHK A;  1IIO A;  1DJH A;  1SYM A;  3ICB A;  1BMO A;  2QEH A;  3BUX B;  3I5H B;  2M7L A;  1BR1 B;  1H8B A;  2CNP A;  1AP4 A;  2WC6 A;  2FOT A;  2E30 A;  1YUR A;  2WCK A;  4FQO A;  5D69 A;  2JWW A;  1WDC C;  3EK7 A;  3OX5 A;  3R1P A;  3OGN A;  4TNC A;  2L51 A;  2HPS A;  1N2D A;  2NZ0 A;  1SPY A;  2KSP A;  3EK4 A;  3LCP C;  3BJH A;  2KFH A;  2M49 B;  1QLS A;  2JOJ A;  5HLV A;  4YBH B;  1D1O A;  1TIZ A;  2BL0 C;  2Q91 A;  2WCF A;  4Q04 A;  3KO0 A;  1NPQ A;  2BAP A;  1SNL A;  2TN4 A;  2JTZ A;  1TCO B;  3AKB A;  2LVV A;  4MSP A;  2K60 A;  2LMV A;  3NGV A;  4ICB A;  3CTN A;  1QJT A;  1QV1 A;  3BUO B;  1SW8 A;  1U5I B;  3IF7 A;  1RWY A;  1UP5 A;  3K21 A;  1SL8 A;  3OB1 B;  1U5I A;  1SCM C;  2NCO A;  2NCP A;  2B1U A;  4JWQ A;  2JT8 A;  4NDB A;  1WLM A;  1A2X A;  4GUK A;  1AK8 A;  2MHH A;  1OQP A;  5TNC A;  1W9Z A;  1QAT A;  2JQ6 A;  3R1V A;  5I2O A;  1C07 A;  1BF5 A;  2MA2 A;  4PE4 A;  3CDN A;  2M9G A;  4L9M A;  1Z2C B;  4CFR A;  1L2O C;  1TNW A;  3CZ1 A;  2DOQ A;  1MQ1 A;  4I5K A;  2H2K A;  1SL9 A;  2A4J A;  4ZCV A;  1PUL A;  2QPT A;  2LVI A;  1LA0 A;  1YR5 A;  2KBM A;  4JKT A;  2Y1M A;  1K9K A;  2JTT A;  1JFK A;  1IG5 A;  1OMR A;  1Y0V H;  1EH2 A;  2P70 A;  1FF1 A;  2F2P A;  3S0A A;  4DS7 A;  3FE8 A;  1OOF A;  1UUR A;  3DYE A;  1AVS A;  4QJ3 B;  3I5F C;  1TRF A;  1MHO A;  2F8P A;  2WOS A;  2Y1N A;  2EC6 C;  1DT7 B;  4A4B A;  2BE6 A;  3L47 A;  3D0Y B;  4F7F A;  3DY9 A;  3FE9 A;  3D0Y A;  1XFW O;  1OZO A;  1YUU A;  2O5G A;  2SAS A;  3M0W A;  4YI8 A;  3VRQ A;  3D78 A;  3TZ1 A;  2CTN A;  1WY9 A;  3I5H C;  3OP0 A;  1KFU S;  3SG5 A;  1OW4 A;  3BUW B;  3D74 A;  1S36 A;  3DVK A;  1CDM A;  1KSM A;  1J7Q A;  1WLZ A;  1PRW A;  2LNK A;  3PN7 C;  3TDI A;  2I2R E;  1KFU L;  3O4Y A;  2KYC A;  1K2H A;  1CFD A;  3SG2 A;  1QX5 B;  1T14 A;  1PSB A;  1K90 D;  1HQV A;  4PE7 A;  5G08 A;  2JNX A;  3TDU A;  2WCJ A;  3JTD B;  2COL B;  1L7Z A;  4AQI A;  3JVT C;  2OS8 B;  1Y1X A;  1IRJ A;  1PVB A;  3GK1 A;  1B8L A;  3CLN A;  1GQM A;  3PJI A;  5I94 A;  1S5G Z;  1SK6 D;  4QJ5 B;  1S26 D;  4GAO A;  1ALW A;  4XYN A;  5FI2 A;  3ZNI A;  2I94 A;  2KQ6 A;  1CDN A;  1F55 A;  3I5G B;  1N0Y A;  1DJZ A;  2LVJ A;  3IQQ A;  3TUY C;  1UWO A;  1R2U A;  3UO9 A;  1S3P A;  3VRP A;  3PLF B;  1CKK A;  5I2L A;  1H4B A;  1EXR A;  1SKT A;  1TUZ A;  2OTG C;  1DMO A;  2LVK A;  2K8M B;  3SG3 A;  1EJ3 A;  4DRW A;  4N1F A;  3CZ0 A;  4YGE B;  1QX7 A;  3KEV A;  3EK8 A;  4MRY A;  2SCP A;  5B8I B;  4PE1 A;  1J1E A;  1K95 A;  1WRK A;  2KI6 D;  4OR9 B;  4YGA A;  2LLS A;  2BNX A;  4I5L B;  1B9A A;  1FI6 A;  1NIW A;  2F33 A;  2WOR A;  2KFG A;  3D75 A;  4MZL A;  5FI6 A;  2M29 A;  4OV2 A;  1XFV O;  1J7O A;  1OOH A;  4M2O A;  1XVJ A;  1LA3 A;  4WRI A;  1M39 A;  3VGO A;  1G33 A;  5ER4 X;  3TDZ A;  3GK2 A;  1YRT B;  1MWN A;  1SL7 A;  1XA5 A;  4UPG A;  2LMT A;  3BYA A;  2LLT A;  1QLK A;  4PAL A;  2JT0 A;  1TUJ A;  1CDL A;  3O78 A;  1XFR A;  2BCX A;  2KQY A;  5K89 A;  1FI5 A;  1NCX A;  3CAB A;  1JUO A;  3EKH A;  3N7H A;  1K96 A;  2WND A;  1QTX A;  3CWG A;  3FWB A;  2NXQ A;  3H4S E;  2G9B A;  1C7V A;  3NSL A;  1X02 A;  3EVV A;  2M97 A;  1M31 A;  2L4H A;  2WCL A;  4PCW A;  1XK4 A;  2PQL A;  2QEO A;  2K2A A;  1LXF C;  2V53 A;  3B86 A;  1RK9 A;  2KGR A;  3S0D A;  2LC5 A;  3VRR A;  2MRD A;  3JTD C;  5AAN A;  1KCY A;  2KBI A;  3D10 A;  2JC2 A;  3EVR A;  3WHT B;  5HL1 A;  4JD9 A;  1YRU B;  1NX3 A;  1VRK A;  1XFZ O;  2H61 C;  2LLU A;  4CPV A;  4GNK B;  5PAL A;  1IGV A;  4WQ3 A;  1CLL A;  1BLQ A;  4MEW A;  3DF0 B;  3O6B A;  1MXL C;  3DF0 A;  5D3O A;  5HKW A;  2K61 A;  1RRO A;  1K8U A;  1B4C A;  1LVC D;  1OZS A;  2KYF A;  2QEB A;  1KK7 Y;  1NX1 A;  4I5J A;  1QWV A;  4E68 A;  1RJV A;  1NP8 A;  3FE6 A;  1OOG A;  1QV0 A;  1PSR A;  1XFY O;  2M3W A;  2L2C A;  1FPW A;  1EG4 A;  2KDH A;  2JUL A;  3NHT A;  1F71 A;  2QAC A;  3TS5 B;  2P71 A;  3K1E A;  1B8R A;  1K93 D;  1C7W A;  2E6W A;  5KTY A;  2Y4Q A;  1TWO A;  3MSE B;  1J1D A;  4PHN A;  3SJS A;  2F3Z A;  3L4A A;  1Q80 A;  3I5I C;  2BE4 A;  4USL A;  2Y5I A;  1YUT A;  1BG1 A;  2AMI A;  2FJY A;  4KYN A;  1XFU O;  3DD4 A;  4YGB B;  2KAY A;  2JZI A;  4XJK B;  4MZJ A;  3RLZ A;  2EGD A;  1BJF A;  4XJK A;  1V1F A;  2H8V A;  5CSJ A;  1CMF A;  1NX2 A;  3WXA A;  4GBA A;  1GM0 A;  2KGB C;  1PAL A;  2GV5 A;  2OPO A;  1YTZ C;  2KFF A;  2O60 A;  1ZMZ A;  2CBL A;  1DQE A;  1YVL A;  1B7T Y;  1CFP A;  2ZND A;  2FCD A;  1WRZ A;  2WC5 A;  5JJG A;  2KI6 C;  5CPV A;  1CM4 A;  1DGV A;  1SR6 B;  1UHH A;  5BPJ A;  1DEK A;  3EKJ A;  1TNX A;  1DTL A;  4YGD B;  2JPO A;  1NX0 A;  5DKN A;  1V1G A;  1YX7 A;  3QME A;  4HRG A;  1SRA A;  1S5G Y;  3BFA A;  4D1E A;  1B47 A;  3AAJ A;  1K9U A;  2ZNE A;  1W7J B;  2L0P A;  1M45 A;  3FS7 A;  3BQ3 A;  4GGF A;  1QXP A;  4C0J A;  3EG5 B;  2AAO A;  2LAP A;  3BFH A;  4AQJ A;  4OZD A;  1NCZ A;  1TN4 A;  2LMU A;  4PDZ A;  1GGZ A;  1DC1 A;  1ALV A;  1A29 A;  1QAS A;  1TTX A;  3CR4 X;  3A8R A;  4BY5 A;  1SMG A;  4JPZ B;  2LUC A;  3SS5 A;  2ZRS A;  1J55 A;  3B6X A;  5J3X A;  2PAS A;  1Z4H A;  3CR5 X;  1DJG A;  3E3R A;  1KFX S;  1KWO B;  1JSA A;  5CSN A;  1BT6 A;  1J7R A;  3BOW B;  1IQ5 A;  1C3Z A;  4MVF A;  2MBX A;  1FBV A;  3BOW A;  1UHJ A;  3KPX A;  2CCM A;  1SSE B;  3LK1 A;  3F45 A;  2KI4 B;  4QJ4 B;  1ZOT B;  1KFX L;  5I2Q A;  1DJY A;  3SS3 A;  2KOT A;  4DCK A;  3OBV A;  1F54 A;  4M2P A;  1G4Y R;  1SY9 A;  4HSZ A;  3LK0 A;  3SIB A;  1DEL A;  1M63 B;  1QIW A;  1JF0 A;  5AFP A;  2MLF C;  2BEC A;  2ZFD A;  1S6C A;  1S6I A;  2LP2 A;  4N5X A;  3CS1 A;  3FIA A;  2L4I A;  2WCE A;  3D77 A;  1EL4 A;  3CGA A;  2NLN A;  5ER5 A;  1IJ6 A;  1SCM B;  2HQ8 A;  2BBM A;  4FQT A;  1ORG A;  4PHJ A;  3R72 A;  2JXL A;  1TNQ A;  1YX8 A;  4PHM A;  1CNP A;  1XFX O;  1A4P A;  3WHU B;  1CTR A;  1LS8 A;  1DVI A;  3S0F A;  5CSI A;  3BFB A;  3DVJ A;  2PMY A;  3L4L A;  1DGU A;  1L2O B;  2L50 A;  1OOJ A;  1OOI X;  2LP3 A;  2K0J A;  3S0B A;  1AUI B;  1YUS A;  3Q8I A;  5D7F A;  1CLB A;  1KQM B;  1KK8 B;  2KLD A;  1IKU A;  1JWD A;  4IL1 A;  2GGM A;  2L5X B;  1UHI A;  5KSZ A;  1P28 A;  3VB1 A;  3BXK A;  1AHR A;  1ODB A;  2WC8 A;  5DKQ A;  2M1K B;  4BY4 A;  1NCY A;  1YVH A;  1QVI Z;  4ZCU A;  1BOC A;  1SBJ A;  3I5F B;  4MN0 A;  2CT9 A;  1CLM A;  2PAL A;  2KAV A;  5IBW A;  2OS8 C;  4MZK A;  1C3Y A;  5HYD A;  1TCF A;  4I5N B;  1CB1 A;  5FI7 A;  3AAK A;  1F70 A;  1GJY A;  3GOF A;  2BCA A;  2HET A;  1NYA A;  2L98 A;  3CZ2 A;  2K7C A;  3I5G C;  1KWO C;  4GPL B;  3WNX B;  3SG4 A;  1OMV A;  3HCM A;  4C0L A;  2WCH A;  3PM2 A;  3PFV A;  4YRU A;  2PSR A;  2P6B B;  5HLO A;  1IH0 A;  2KI4 C;  3EVU A;  4CID A;  1CDP A;  2KPH A;  1M46 A;  2BKH B;  2YGU A;  1OE9 B;  1OMD A;  4ORC B;  4WQ2 A;  3V2L A;  1F4Q A;  5FYX A;  2LM5 A;  3SG6 A;  4MRX A;  2EHB A;  1E8A A;  2ZN8 A;  2ZN9 A;  1R6P A;  1CM1 A;  1LIN A;  3JVT B;  4N1G A;  1IWQ A;  2HQW A;  4A4C A;  3PN7 B;  2ZRT A;  1NUB A;  1MXE A;  2GTE A;  4GGN A;  4PE0 A;  5I8N A;  3CR2 A;  3BUM B;  2FCE A;  2QDI A;  4INX A;  3PAL A;  2WCM A;  2F2O A;  3SS4 A;  3TUY B;  2MJW B;  2K7B A;  1DJX A;  2BKI B;  4U8D A;  2JPT A;  1CFC A;  1UUS A;  1CMG A;  1KSO A;  2OTG B;  1F8H A;  3C1V A;  3KF9 A;  1A03 A;  1QS7 A;  1XO5 A;  4JQ0 D;  3B7A A;  5GQQ C;  2HF5 A;  5AEQ A;  3B88 A;  1KQM C;  1KK8 C;  1K9P A;  2I18 A;  3RM1 A;  1KK7 Z;  2WCB A;  4CFQ A;  2FJU B;  1ZFS A;  2PYQ A;  2KHN A;  3AKA A;  3NSO A;  4CLN A;  1DJI A;  1XK4 C;  1LKJ A;  2M0R A;  2G2B A;  1CFF A;  4INW A;  2K2F A;  4F0Z B;  2LE9 B;  1Y1A A;  1EG3 A;  3LL8 B;  3O2P A;  5JOL A;  2KAX A;  3D76 A;  3OB2 B;  1K94 A;  1PVA A;  2K7D A;  2IS9 A;  5CSF A;  1J7P A;  2BCB A;  5AXI A;  1AJ4 A;  5DIC A;  1F4O A;  3PSR A;  2KLE A;  3PAT A;  2MLE C;  4DUQ A;  1ZUZ A;  1FW4 A;  1IJ5 A;  2CXJ A;  3NHI A;  1REC A;  5KU1 A;  2JNF A;  2QEV A;  3VRN A;  1UHN A;  1XYD A;  2ISD A;  2R2I A;  1WRL A;  4YI9 A;  4GFT A;  1DJW A;  3DVM A;  1HT9 A;  3KHE A;  4R1E A;  4HRH A;  3DZT A;  4C0K A;  4FTG A;  1JC2 A;  1BU3 A;  1TOP A;  1WDC B;  2JT3 A;  2L2E A;  2KNE A;  4ORB B;  2MAZ A;  2Q4U A;  1B7T Z;  3LLE A;  1AJ5 A;  3SG7 A;  1BR4 B;  5HKY A;  1RTP 1;  1JBA A;  1KQV A;  1S1E A;  3SIA A;  3TS5 C;  3NSK A;  4ORA B;  1GGW A;  4HRE E;  1UHK A;  1NSH A;  3NSI A;  1DF0 B;  2BL0 B;  3HX4 A;  3R1O A;  2GGZ A;  3S0G A;  1B8C A;  1DF0 A;  2AUC A;  2H61 A;  2JRF A;  2LUX A;  3CYZ A;  3FWC A;  1OSA A;  3IQO A;  4OKH A;  2D8N A;  4NDD A;  4OVN F;  4AOM A;  4ETO A;  4P5O E;  1MR8 A;  2L5Y A;  2M7N A;  5F6T A;  1JFJ A;  1SCV A;  2I7A A;  3PM8 A;  2F3Y A;  5HKZ A;  3OX6 A;  4YGC B;  3IVT A;  3CZT X;  1IQ3 A;  1N65 A;  2ERB A;  2JU0 A;  4NQG A;  1JF2 A;  3OHM B;  2K7O A;  5DKR A;  2LV7 A;  3GK4 X;  3BUN B;  1MUX A;  2M8U A;  3UNW A;  2M1U A;  3S0E A;  3DXL A;  1QVI Y;  2BBN A;  2LAN A;  2LHI A;  1BOD A;  1QX2 A;  1SR6 C;  3DVE A;  1Y6W A; 
#chains in the Genus database with same CATH homology
 1PK0 D;  1RFJ A;  3ZWH A;  2LHL A;  4DIR A;  3QRX A;  3I5I B;  2PVB A;  1ZAC A;  1TNP A;  1W7I B;  4M2Q A;  4NDC A;  4GGF C;  3VRO A;  2LCP A;  2PRU A;  2RGI A;  2JXC A;  4MLW A;  1QIV A;  1A75 B;  2VRG A;  4OCI A;  1G8I A;  1Y1U A;  1A75 A;  1S6J A;  2ZKM X;  4MBE A;  3A4U B;  2EC6 B;  1B1G A;  1MF8 B;  4P2Y B;  3NXA A;  5AER A;  1NWD A;  4PHK A;  1DJH A;  1SYM A;  3ICB A;  1BMO A;  3BUX B;  3I5H B;  2M7L A;  1BR1 B;  1H8B A;  2CNP A;  1AP4 A;  2FOT A;  2E30 A;  1YUR A;  4FQO A;  5D69 A;  2JWW A;  1WDC C;  3EK7 A;  3OX5 A;  4TNC A;  2L51 A;  2HPS A;  1N2D A;  2NZ0 A;  1SPY A;  2KSP A;  3EK4 A;  3LCP C;  4L9M A;  2KFH A;  2M49 B;  1QLS A;  2JOJ A;  5HLV A;  4YBH B;  1D1O A;  1TIZ A;  2BL0 C;  2Q91 A;  2WCF A;  4Q04 A;  3KO0 A;  1NPQ A;  1SNL A;  2TN4 A;  2JTZ A;  1TCO B;  3AKB A;  2LVV A;  4MSP A;  2LMV A;  4ICB A;  3CTN A;  1QJT A;  1QV1 A;  3BUO B;  1SW8 A;  1U5I B;  3IF7 A;  1RWY A;  1UP5 A;  3K21 A;  1SL8 A;  3OB1 B;  1U5I A;  1SCM C;  2NCO A;  2NCP A;  2B1U A;  4JWQ A;  2JT8 A;  4NDB A;  1WLM A;  1A2X A;  4GUK A;  1AK8 A;  2MHH A;  1OQP A;  5TNC A;  1QAT A;  2JQ6 A;  5I2O A;  1C07 A;  1BF5 A;  2MA2 A;  4PE4 A;  2M9G A;  4CFR A;  1L2O C;  1TNW A;  2DOQ A;  1MQ1 A;  4I5K A;  2H2K A;  1SL9 A;  2A4J A;  4ZCV A;  1PUL A;  2QPT A;  2LVI A;  1LA0 A;  1YR5 A;  2KBM A;  2Y1M A;  1K9K A;  2JTT A;  1JFK A;  1IG5 A;  1OMR A;  1Y0V H;  1EH2 A;  1FF1 A;  2F2P A;  4DS7 A;  1UUR A;  1AVS A;  4QJ3 B;  3I5F C;  1TRF A;  1MHO A;  2F8P A;  2WOS A;  2Y1N A;  2EC6 C;  1DT7 B;  4A4B A;  2BE6 A;  3D0Y B;  3D0Y A;  1XFW O;  1OZO A;  1YUU A;  2O5G A;  2SAS A;  3M0W A;  4YI8 A;  3VRQ A;  3TZ1 A;  2CTN A;  1WY9 A;  3I5H C;  3OP0 A;  1KFU S;  3SG5 A;  3BUW B;  3DVK A;  1S36 A;  1CDM A;  1KSM A;  1J7Q A;  1WLZ A;  1PRW A;  2LNK A;  3TDI A;  2I2R E;  1KFU L;  3O4Y A;  2KYC A;  1K2H A;  1CFD A;  3SG2 A;  1QX5 B;  1PSB A;  1K90 D;  1HQV A;  4PE7 A;  5G08 A;  2JNX A;  3TDU A;  3JTD B;  2COL B;  1L7Z A;  4AQI A;  3JVT C;  2OS8 B;  1Y1X A;  1IRJ A;  1PVB A;  3GK1 A;  1B8L A;  3CLN A;  1GQM A;  1S5G Z;  1SK6 D;  4QJ5 B;  1S26 D;  4GAO A;  1ALW A;  4XYN A;  3ZNI A;  2I94 A;  2KQ6 A;  1CDN A;  1F55 A;  3I5G B;  1N0Y A;  1DJZ A;  2LVJ A;  3IQQ A;  3TUY C;  1UWO A;  1R2U A;  1S3P A;  3VRP A;  3PLF B;  1CKK A;  5I2L A;  1H4B A;  1EXR A;  1SKT A;  2OTG C;  1DMO A;  2LVK A;  2K8M B;  3SG3 A;  1EJ3 A;  4DRW A;  4N1F A;  4YGE B;  1QX7 A;  3KEV A;  3EK8 A;  4MRY A;  2SCP A;  5B8I B;  4PE1 A;  1J1E A;  1K95 A;  1WRK A;  2KI6 D;  4OR9 B;  4YGA A;  2LLS A;  4I5L B;  1B9A A;  1FI6 A;  1NIW A;  2F33 A;  2WOR A;  2KFG A;  4MZL A;  2M29 A;  4OV2 A;  1XFV O;  1J7O A;  4M2O A;  1XVJ A;  1LA3 A;  4WRI A;  1M39 A;  3VGO A;  1G33 A;  5ER4 X;  3TDZ A;  3GK2 A;  1YRT B;  1MWN A;  1SL7 A;  1XA5 A;  4UPG A;  2LMT A;  3BYA A;  2LLT A;  1QLK A;  4PAL A;  2JT0 A;  1CDL A;  3O78 A;  2BCX A;  2KQY A;  1FI5 A;  5K89 A;  1NCX A;  1JUO A;  3EKH A;  1K96 A;  2WND A;  1QTX A;  3CWG A;  3FWB A;  2NXQ A;  3H4S E;  2G9B A;  1C7V A;  3NSL A;  1X02 A;  3EVV A;  2M97 A;  1M31 A;  2L4H A;  4PCW A;  1XK4 A;  2K2A A;  1LXF C;  2V53 A;  1RK9 A;  2KGR A;  2LC5 A;  3VRR A;  2MRD A;  3JTD C;  5AAN A;  1KCY A;  2KBI A;  3D10 A;  2JC2 A;  3EVR A;  3WHT B;  4CPV A;  1YRU B;  1NX3 A;  1VRK A;  1XFZ O;  2H61 C;  2LLU A;  4GNK B;  5PAL A;  1IGV A;  4WQ3 A;  1CLL A;  1BLQ A;  4MEW A;  3DF0 B;  3O6B A;  1MXL C;  3DF0 A;  5HKW A;  2K61 A;  1RRO A;  1K8U A;  1B4C A;  1LVC D;  1OZS A;  2KYF A;  1KK7 Y;  1NX1 A;  4I5J A;  4E68 A;  1RJV A;  1NP8 A;  1QV0 A;  1PSR A;  1XFY O;  2M3W A;  1FPW A;  1EG4 A;  2KDH A;  2JUL A;  1F71 A;  2QAC A;  3TS5 B;  1B8R A;  1K93 D;  1C7W A;  2E6W A;  5KTY A;  2Y4Q A;  3MSE B;  1J1D A;  4PHN A;  3SJS A;  2F3Z A;  1Q80 A;  3I5I C;  2BE4 A;  4USL A;  2Y5I A;  1YUT A;  1BG1 A;  2AMI A;  1XFU O;  3DD4 A;  4YGB B;  2KAY A;  2JZI A;  4XJK B;  4MZJ A;  3RLZ A;  2EGD A;  1BJF A;  4XJK A;  1V1F A;  5CSJ A;  1CMF A;  1NX2 A;  3WXA A;  4GBA A;  2KGB C;  1PAL A;  2GV5 A;  2OPO A;  1YTZ C;  2KFF A;  2O60 A;  1ZMZ A;  2CBL A;  1YVL A;  1B7T Y;  1CFP A;  2ZND A;  2FCD A;  1WRZ A;  5JJG A;  2KI6 C;  5CPV A;  1CM4 A;  1DGV A;  1SR6 B;  1UHH A;  5BPJ A;  3EKJ A;  1TNX A;  1DTL A;  4YGD B;  1NX0 A;  5DKN A;  1V1G A;  1YX7 A;  4HRG A;  1SRA A;  1S5G Y;  4D1E A;  1B47 A;  3AAJ A;  1K9U A;  2ZNE A;  1W7J B;  2L0P A;  1M45 A;  3FS7 A;  3BQ3 A;  4GGF A;  1QXP A;  4C0J A;  2AAO A;  2LAP A;  4AQJ A;  1NCZ A;  1TN4 A;  2LMU A;  4PDZ A;  1GGZ A;  1ALV A;  1A29 A;  1QAS A;  1TTX A;  3CR4 X;  3A8R A;  4BY5 A;  1SMG A;  4JPZ B;  2LUC A;  2ZRS A;  1J55 A;  5J3X A;  2PAS A;  3E3R A;  3CR5 X;  1DJG A;  1KFX S;  1KWO B;  1JSA A;  5CSN A;  1BT6 A;  1J7R A;  3BOW B;  1IQ5 A;  4MVF A;  2MBX A;  1FBV A;  3BOW A;  1UHJ A;  3KPX A;  2CCM A;  3LK1 A;  3F45 A;  2KI4 B;  4QJ4 B;  1ZOT B;  1KFX L;  5I2Q A;  1DJY A;  2KOT A;  4DCK A;  1F54 A;  4M2P A;  1G4Y R;  1SY9 A;  4HSZ A;  3LK0 A;  3SIB A;  1M63 B;  1QIW A;  1JF0 A;  5AFP A;  2MLF C;  2BEC A;  2ZFD A;  1S6C A;  1S6I A;  2LP2 A;  4N5X A;  3CS1 A;  3FIA A;  2L4I A;  2WCE A;  1EL4 A;  3CGA A;  2NLN A;  5ER5 A;  1IJ6 A;  1SCM B;  2HQ8 A;  2BBM A;  4PHJ A;  2JXL A;  1TNQ A;  1YX8 A;  4PHM A;  1CNP A;  1XFX O;  1A4P A;  3WHU B;  1CTR A;  1DVI A;  5CSI A;  3DVJ A;  2PMY A;  1DGU A;  1L2O B;  2L50 A;  1OOJ A;  2LP3 A;  2K0J A;  1AUI B;  1YUS A;  5D7F A;  1CLB A;  1KQM B;  1KK8 B;  1IKU A;  1JWD A;  4IL1 A;  2GGM A;  2L5X B;  1UHI A;  5KSZ A;  3BXK A;  1AHR A;  1ODB A;  2WC8 A;  5DKQ A;  2M1K B;  4BY4 A;  1NCY A;  1YVH A;  1QVI Z;  4ZCU A;  1BOC A;  1SBJ A;  3I5F B;  4MN0 A;  2CT9 A;  1CLM A;  2PAL A;  2KAV A;  5IBW A;  2OS8 C;  4MZK A;  5HYD A;  1TCF A;  4I5N B;  1CB1 A;  3AAK A;  1F70 A;  1GJY A;  3GOF A;  2BCA A;  2HET A;  1NYA A;  2L98 A;  2K7C A;  3I5G C;  1KWO C;  4GPL B;  3WNX B;  3SG4 A;  1OMV A;  3HCM A;  4C0L A;  3PFV A;  4YRU A;  2PSR A;  2P6B B;  5HLO A;  1IH0 A;  2KI4 C;  3EVU A;  4CID A;  1CDP A;  1M46 A;  2BKH B;  1OE9 B;  1OMD A;  4ORC B;  4WQ2 A;  1F4Q A;  5FYX A;  2LM5 A;  3SG6 A;  4MRX A;  2EHB A;  1E8A A;  2ZN8 A;  2ZN9 A;  1R6P A;  1CM1 A;  1LIN A;  3JVT B;  4N1G A;  1IWQ A;  2HQW A;  4A4C A;  3PN7 B;  2ZRT A;  1NUB A;  1MXE A;  4GGN A;  4PE0 A;  5I8N A;  3CR2 A;  3BUM B;  2FCE A;  3TUY B;  3PAL A;  2F2O A;  2MJW B;  2K7B A;  1DJX A;  2BKI B;  4U8D A;  2JPT A;  1CFC A;  1UUS A;  1CMG A;  1KSO A;  2OTG B;  1F8H A;  3C1V A;  3KF9 A;  1A03 A;  1QS7 A;  1XO5 A;  4JQ0 D;  5GQQ C;  2HF5 A;  5AEQ A;  1KQM C;  1KK8 C;  1K9P A;  2I18 A;  3RM1 A;  1KK7 Z;  2WCB A;  4CFQ A;  2FJU B;  1ZFS A;  2KHN A;  3AKA A;  3NSO A;  4CLN A;  1DJI A;  1XK4 C;  1LKJ A;  2M0R A;  2G2B A;  1CFF A;  2K2F A;  4F0Z B;  2LE9 B;  1EG3 A;  1Y1A A;  3LL8 B;  3O2P A;  5JOL A;  2KAX A;  3OB2 B;  1K94 A;  1PVA A;  2K7D A;  2IS9 A;  5CSF A;  1J7P A;  2BCB A;  5AXI A;  1AJ4 A;  1F4O A;  3PSR A;  3PAT A;  4DUQ A;  2MLE C;  1ZUZ A;  1FW4 A;  1IJ5 A;  2CXJ A;  1REC A;  5KU1 A;  2JNF A;  3VRN A;  1UHN A;  1XYD A;  2ISD A;  2R2I A;  1WRL A;  4YI9 A;  4GFT A;  1DJW A;  3DVM A;  1HT9 A;  3KHE A;  4R1E A;  4HRH A;  4C0K A;  4FTG A;  1JC2 A;  1BU3 A;  1TOP A;  1WDC B;  2JT3 A;  2L2E A;  2KNE A;  4ORB B;  2MAZ A;  2Q4U A;  1B7T Z;  3LLE A;  1AJ5 A;  3SG7 A;  1BR4 B;  5HKY A;  1RTP 1;  1JBA A;  1KQV A;  1S1E A;  3SIA A;  3TS5 C;  3NSK A;  4ORA B;  1GGW A;  4HRE E;  1UHK A;  1NSH A;  3NSI A;  1DF0 B;  2BL0 B;  3HX4 A;  2GGZ A;  1B8C A;  1DF0 A;  2AUC A;  2H61 A;  2JRF A;  2LUX A;  3FWC A;  3PN7 C;  1OSA A;  3IQO A;  4OKH A;  2D8N A;  4NDD A;  4OVN F;  4AOM A;  4ETO A;  4P5O E;  1MR8 A;  2M7N A;  1JFJ A;  5F6T A;  1SCV A;  2I7A A;  3PM8 A;  2F3Y A;  5HKZ A;  3OX6 A;  4YGC B;  1IQ3 A;  3CZT X;  1N65 A;  2JU0 A;  4NQG A;  1JF2 A;  3OHM B;  2K7O A;  5DKR A;  2LV7 A;  3GK4 X;  3BUN B;  1MUX A;  2M8U A;  2M1U A;  1QVI Y;  2BBN A;  2LAN A;  2LHI A;  1BOD A;  1QX2 A;  1SR6 C;  3DVE A;  1Y6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...