3JTDC

Calcium-free scallop myosin regulatory domain with elc-d19a point mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
PKLSQDEIDDLKDVFELFAFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
source organism Argopecten irradians
total genus 41
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jtdC02
2M3WA 1SMGA 2JXLA 2JT8A 1NX0A 2MBXA 5AANA 1M63B 4NDCA 2JRFA 1YUTA 4YBHB 2BCBA 1QV1A 1XK4C 5D7FA 1UHNA 1FBVA 2KHNA 1SRAA 2HF5A 2OTGB 1YVLA 1FF1A 3AAKA 1UHIA 4CFRA 2KI4C 5DKNA 2M1KB 1S3PA 1IRJA 1YTZC 1LKJA 1QLKA 1QVIZ 2LE9B 2BE6A 1SCMB 2M7NA 3LLEA 3PN7B 4OVNF 4A4BA 3E3RA 2MHHA 3TDUA 2V53A 2R2IA 4MZKA 4MZLA 1KFXS 4TNCA 5J3XA 2LUCA 3FWBA 4ORBB 2WOSA 3WHTB 1SL7A 2AAOA 3C1VA 5HKWA 2Q4UA 1C07A 3ICBA 4I5JA 1NSHA 1UURA 1QJTA 1DJYA 2NCOA 3BOWA 3CTNA 4R1EA 3DF0B 1M39A 1XFUO 2Y5IA 1M45A 1S5GZ 2H61A 2LP2A 1KK7Z 3BUNB 3CR4X 1QX7A 2O60A 3NSKA 4N5XA 2JZIA 4PHJA 4FQOA 2COLB 1B9AA 1ZUZA 1C7WA 2FJUB 1B1GA 3NSOA 2KGBC 4HRHA 1TCOB 4DCKA 2IS9A 4ZCVA 1J55A 2BKIB 5CPVA 3DF0A 3PM8A 2KFFA 1WLZA 4YGCB 1OMVA 2ZN9A 3D10A 3D0YA 3SG4A 3GK2A 1KQMB 1G4YR 1Q80A 5KU1A 2WCEA 1AJ5A 1BF5A 2E6WA 1PK0D 1W7JB 1K94A 5G08A 1KCYA 2WCFA 3SIAA 1AUIB 1A03A 2JT3A 4XJKA 1JWDA 1ZOTB 2Y1NA 4ORCB 2LANA 3DD4A 3TS5B 5B8IB 4I5NB 1SCVA 4GAOA 2K7CA 2F2PA 1S6CA 3BXKA 4ORAB 2SCPA 1KSMA 2LP3A 4NDDA 4XYNA 2ZNDA 3KPXA 3TZ1A 1F54A 4GBAA 1QIWA 4I5KA 1JBAA 2NZ0A 1UP5A 4MVFA 1CDPA 1DJHA 1DVIA 2CBLA 1B7TZ 1KSOA 2BCAA 2L2EA 5ER4X 5AXIA 1SKTA 4PHMA 1TNXA 3O78A 1ZFSA 2KGRA 2KI4B 3SG3A 1XVJA 5JJGA 1CFPA 1CFDA 1WRZA 4HREE 1CTRA 3SIBA 1J7OA 2GGMA 3I5GC 1YX7A 3VRQA 4PCWA 2HQWA 2LLSA 1GJYA 4AQIA 1NCYA 1YUSA 4AOMA 2WC8A 3M0WA 1EG3A 2LLTA 3ZWHA 1QATA 2LC5A 4QJ4B 2MLEC 1Y0VH 1QLSA 2K7BA 2KNEA 1FPWA 4GGNA 4QJ5B 4DS7A 1NYAA 2KAVA 5F6TA 1EXRA 1KWOC 4IL1A 5CSNA 1BODA 2EC6C 2JOJA 4I5LB 2LLUA 1TNPA 1U5IA 3CLNA 5CSFA 3DVJA 1UWOA 4MSPA 3TDIA 3OB2B 4GGFC 2K0JA 3DVMA 1PVBA 2JNFA 1G33A 2CNPA 4ICBA 3KEVA 2LV7A 2K61A 5CSIA 3CGAA 1NCXA 1OE9B 2KQYA 3OX5A 5IBWA 3BUWB 3LL8B 2FCEA 2JTTA 1BT6A 1J7QA 1YX8A 2HETA 2LCPA 3A8RA 4OV2A 1DGVA 1XA5A 1QS7A 1YRUB 4MRYA 5PALA 1G8IA 2WORA 1N65A 1NP8A 1YVHA 3KF9A 5KTYA 4D1EA 3HCMA 2BCXA 1UUSA 3PLFB 2NXQA 4U8DA 3VRNA 3SG2A 1N0YA 2MA2A 1JFKA 2ZFDA 2P6BB 5HLVA 1PSRA 2KYCA 1ODBA 1PVAA 3EKJA 1OMDA 1GGZA 1TRFA 1SNLA 3CS1A 3EVVA 1M46A 5BPJA 2K2FA 1F8HA 1AVSA 4YI8A 1NUBA 1RECA 2H2KA 2LVIA 1KK8C 4N1FA 5HKZA 4MEWA 1S26D 1TCFA 2LHIA 2K7OA 1A75B 1DJIA 1K9UA 4CFQA 4GUKA 3WHUB 3O4YA 1QVIY 1SYMA 1MXLC 1DJXA 1MHOA 2VRGA 3KHEA 3WNXB 1MUXA 1SR6C 4M2PA 3SG7A 2Y4QA 1OQPA 1FI5A 3FIAA 4C0KA 3I5GB 2PSRA 1BLQA 3DVEA 1A4PA 1F70A 3EKHA 2F8PA 1H8BA 1SBJA 1CDNA 1CDMA 3EVRA 4C0JA 1LVCD 5I2QA 2JU0A 2JNXA 2SASA 4CPVA 1ZACA 3IF7A 1NX2A 2JQ6A 1GGWA 1S5GY 4ETOA 1UHHA 1CM1A 3KO0A 2M29A 3MSEB 1JSAA 3GK1A 1JF0A 3O6BA 1BR4B 4QJ3B 1KWOB 3CR5X 2EC6B 4P2YB 4YRUA 4DUQA 5ER5A 1QASA 2G9BA 4MLWA 2L4HA 1D1OA 2KAYA 1Y6WA 3FWCA 2RGIA 1KQVA 4USLA 1BG1A 4GNKB 2L50A 1K2HA 1Y1UA 2H61C 2JXCA 1UHKA 3TUYC 1EG4A 2MJWB 5CSJA 4N1GA 1L2OC 1BMOA 2OS8B 1CFCA 2PALA 2L51A 3BYAA 4L9MA 1NIWA 5FYXA 1YUUA 3BQ3A 4FTGA 2WNDA 1TIZA 2I2RE 3RLZA 1TOPA 2ISDA 1BU3A 1MXEA 3H4SE 1NWDA 1IH0A 1HQVA 2QACA 3VRRA 4YI9A 3I5FC 3F45A 1NCZA 1AHRA 1RROA 2TN4A 5I8NA 2A4JA 1LXFC 2F3YA 1K90D 1XK4A 2F33A 4OCIA 3HX4A 1RTP1 2F2OA 3ZNIA 1IQ3A 4YGDB 1CMGA 1QTXA 1N2DA 1QX2A 5K89A 1KFUL 4PE0A 1B7TY 4AQJA 3IQOA 1RJVA 2M97A 4CLNA 1KK8B 2MRDA 1WRKA 2I7AA 1W7IB 1QV0A 2KFGA 3IQQA 3BUXB 1CKKA 1OSAA 2CTNA 1S6IA 2PMYA 2LHLA 4PHNA 5HKYA 1B4CA 2M7LA 1XFZO 1SR6B 2JULA 2OPOA 1AP4A 1CLLA 1GQMA 2ZNEA 1XFYO 2MLFC 3NSLA 2KI6D 1QIVA 3A4UB 1CM4A 1VRKA 4JWQA 1DMOA 3SJSA 1LA3A 2JTZA 1X02A 2OS8C 1YR5A 1JF2A 2LNKA 4M2OA 2LM5A 1HT9A 2PVBA 1Y1XA 3AKAA 3CWGA 3CZTX 1CFFA 1CLMA 3OX6A 1B8RA 1L7ZA 1XO5A 5JOLA 2BKHB 2AUCA 2GGZA 1SW8A 1WDCC 4NQGA 4PE1A 2NLNA 1RK9A 4WRIA 5HLOA 4BY5A 1TN4A 1OMRA 2CCMA 2LAPA 3GK4X 5AERA 2AMIA 4OR9B 2E30A 4E68A 2G2BA 2L5XB 3AAJA 4WQ2A 3NSIA 3PSRA 4PHKA 3LK1A 1NX3A 2JT0A 1ALVA 2LVKA 3LCPC 1QX5B 3RM1A 1S36A 2BE4A 3BOWB 2L0PA 1F4OA 2CT9A 2FOTA 1PALA 1V1FA 2L98A 2M0RA 1EH2A 3LK0A 1A29A 4GFTA 1TTXA 1WY9A 2BL0C 1IQ5A 3TUYB 3QRXA 1IWQA 1B47A 1RFJA 3EK4A 1S6JA 2B1UA 1ALWA 1OZOA 1L2OB 2ZN8A 1AK8A 1JUOA 4CIDA 1WLMA 3I5HC 3JTDC 1PRWA 2O5GA 1F4QA 1TNQA 2BBNA 1BR1B 1F71A 4M2QA 2CXJA 1XFXO 4A4CA 1C7VA 1F55A 2D8NA 2FCDA 1K93D 2LVJA 1J1DA 2K2AA 2NCPA 1JC2A 1KFUS 2KFHA 2KBMA 3I5FB 3D0YB 2ZRSA 1DJGA 1IGVA 1K9KA 5KSZA 1IG5A 1A75A 1NPQA 3PFVA 5D69A 3BUOB 1KK7Y 1Y1AA 2KQ6A 1A2XA 4XJKB 1FI6A 3SG5A 1UHJA 3NXAA 1XFWO 1EL4A 2PRUA 2Y1MA 3JVTB 1XYDA 4OKHA 1AJ4A 3O2PA 2KI6C 2MAZA 1MQ1A 1XFVO 2WCBA 4HRGA 4JPZB 2JWWA 2OTGC 1DF0B 1MWNA 2LMTA 3OHMB 5AFPA 3SG6A 1IKUA 2LVVA 1SL9A 1DGUA 1V1GA 4YGBB 3WXAA 1SCMC 1MR8A 2GV5A 3PN7C 4MZJA 4YGAA 1BOCA 3I5IB 2I18A 1SK6D 2KBIA 3VRPA 1DJZA 1IJ6A 4MBEA 4WQ3A 2EGDA 1K9PA 3EK7A 2EHBA 2QPTA 5I2LA 4DIRA 3BUMB 1LA0A 4GGFA 1PSBA 1PULA 1R6PA 1DF0A 1SL8A 2HPSA 2I94A 2K8MB 4MN0A 1E8AA 2ZRTA 2KDHA 2M1UA 2Q91A 2BBMA 1WDCB 4P5OE 1K95A 3OP0A 4MRXA 1EJ3A 1NX1A 1JFJA 2KSPA 1KFXL 2LMVA 2HQ8A 1DTLA 2M8UA 4NDBA 2LUXA 2K7DA 5DKQA 2KAXA 1SY9A 2F3ZA 3CR2A 1FW4A 4PALA 4Q04A 1B8CA 4YGEB 5DKRA 1BJFA 1DT7B 1K8UA 1J7RA 1WRLA 3JVTC 4HSZA 3EK8A 5GQQC 2LMUA 2BL0B 1U5IB 4GPLB 1M31A 1CMFA 1CNPA 1YURA 3TDZA 2JPTA 4DRWA 2KYFA 3K21A 3FS7A 1DJWA 3PATA 4JQ0D 1H4BA 4ZCUA 1K96A 5TNCA 3PALA 4F0ZB 3I5HB 1KQMC 1S1EA 1QXPA 5I2OA 2M49B 3JTDB 3VROA 2L4IA 2BECA 5HYDA 1LINA 3VGOA 1SPYA 4BY4A 1CDLA 1YRTB 4UPGA 3I5IC 2ZKMX 4PE4A 1MF8B 1CB1A 1OZSA 4PDZA 1R2UA 1ZMZA 3EVUA 2DOQA 4PE7A 1IJ5A 2JC2A 3GOFA 1J7PA 1CLBA 3OB1B 5AEQA 4C0LA 1OOJA 2KOTA 3TS5C 1J1EA 3DVKA 1RWYA 3AKBA 1TNWA 2M9GA 1B8LA 2PASA
chains in the Genus database with same CATH superfamily
2M3WA 1SMGA 2JXLA 2JT8A 1NX0A 2MBXA 5AANA 1M63B 4NDCA 2JRFA 1YUTA 4YBHB 2BCBA 1QV1A 1XK4C 5D7FA 3B6XA 1UHNA 3B7AA 1FBVA 5EL2A 3S0DA 2KHNA 1SRAA 2HF5A 2OTGB 1YVLA 1FF1A 5D3OA 3AAKA 1OW4A 1UHIA 4CFRA 2KI4C 5DKNA 2M1KB 1S3PA 1IRJA 1YTZC 1LKJA 1QLKA 1QVIZ 2LE9B 2BE6A 1SCMB 2M7NA 3LLEA 3PN7B 4OVNF 4A4BA 3E3RA 2MHHA 3TDUA 2V53A 3SS5A 2R2IA 4MZKA 4MZLA 1KFXS 4TNCA 4IJ7A 5J3XA 2LUCA 3FWBA 4ORBB 2WOSA 3WHTB 1SL7A 2AAOA 3C1VA 5HKWA 2Q4UA 2QDIA 1C07A 3ICBA 4I5JA 1NSHA 1UURA 1QJTA 1DJYA 1Z4HA 2NCOA 3BOWA 3CTNA 4R1EA 3DF0B 1M39A 1XFUO 2Y5IA 1M45A 1S5GZ 2H61A 2LP2A 1KK7Z 3BUNB 3CR4X 1QX7A 2O60A 3B88A 3NSKA 4N5XA 2JZIA 4PHJA 2QEVA 4FQOA 2COLB 1B9AA 3RZSA 3R1OA 1ZUZA 2YGUA 1C7WA 2FJUB 1B1GA 3NSOA 2KGBC 4HRHA 1TCOB 4DCKA 2IS9A 4F7FA 4ZCVA 1J55A 2BKIB 1TUZA 5CPVA 3D75A 3DF0A 2WCMA 3PM8A 2KFFA 1WLZA 4YGCB 1OMVA 2ZN9A 3D10A 3D0YA 4OZDA 3GK2A 1KQMB 1G4YR 3SG4A 1Q80A 5KU1A 2WCEA 5HL1A 1AJ5A 1BF5A 2E6WA 2BNXA 1PK0D 1W7JB 1K94A 2ERBA 4INWA 2PYQA 5G08A 1KCYA 2WCFA 5FI2A 5DICA 3SIAA 1AUIB 1A03A 2JT3A 4XJKA 1JWDA 1ZOTB 2Y1NA 2QEBA 4ORCB 2LANA 3DD4A 2KPHA 3TS5B 3OGNA 5B8IB 4I5NB 1SCVA 2PQLA 4GAOA 2K60A 2K7CA 2F2PA 3FE9A 1S6CA 3BXKA 4ORAB 2SCPA 1KSMA 2LP3A 1LS8A 3NHIA 4NDDA 2ZNDA 3KPXA 4XYNA 3TZ1A 4GBAA 2WCKA 1F54A 1QIWA 4I5KA 1JBAA 3B86A 3B87A 3EG5B 2NZ0A 1UP5A 4MVFA 3UNWA 1CDPA 1DJHA 1DVIA 2CBLA 1B7TZ 1KSOA 2BCAA 2L2EA 5ER4X 5AXIA 1SKTA 4PHMA 1TNXA 3O78A 1ZFSA 2KGRA 2KI4B 3SG3A 1XVJA 5JJGA 1CFPA 1CFDA 1WRZA 3BFBA 1CTRA 4HREE 3SIBA 3IVTA 1J7OA 2GGMA 3I5GC 1YX7A 3VRQA 4PCWA 2HQWA 2LLSA 1GJYA 4PT1A 4AQIA 1NCYA 1YUSA 4AOMA 2WC8A 3M0WA 1EG3A 2LLTA 3ZWHA 1QATA 2LC5A 4QJ4B 1TUJA 2MLEC 1Y0VH 4KYNA 1QLSA 1XFRA 3BFHA 2K7BA 2KNEA 1FPWA 3O4XA 4GGNA 4QJ5B 4DS7A 1NYAA 2KAVA 5F6TA 1EXRA 1KWOC 4IL1A 5CSNA 1BODA 2EC6C 2JOJA 4JD9A 4I5LB 2LLUA 1TNPA 1U5IA 3CLNA 5CSFA 3DVJA 1UWOA 4MSPA 3TDIA 3OB2B 4GGFC 2BAPA 2K0JA 1OOHA 2KLEA 3DVMA 1PVBA 3D77A 2JNFA 1G33A 2CNPA 4ICBA 3KEVA 3S0FA 2LV7A 2K61A 5CSIA 3CGAA 1NCXA 1OE9B 2KQYA 3OX5A 5IBWA 3BUWB 3LL8B 2FCEA 2JTTA 1BT6A 1J7QA 1YX8A 2HETA 2LCPA 3A8RA 2WCJA 1DGVA 1XA5A 1QS7A 1YRUB 3DXLA 4OV2A 4MRYA 5PALA 1G8IA 2WORA 1N65A 1NP8A 1YVHA 3KF9A 5KTYA 4D1EA 3S0EA 3HCMA 2BCXA 1UUSA 3PLFB 2NXQA 3D74A 4U8DA 3VRNA 3SG2A 3S0GA 1N0YA 2MA2A 3DYEA 2WCLA 1JFKA 2ZFDA 2P6BB 5HLVA 1PSRA 2KYCA 1ODBA 1PVAA 3EKJA 1OMDA 1GGZA 1TRFA 3D73A 1SNLA 3CS1A 3EVVA 1M46A 5BPJA 2K2FA 1F8HA 1AVSA 4YI8A 1NUBA 1RECA 2H2KA 2LVIA 1KK8C 4N1FA 5HKZA 4MEWA 1S26D 1TCFA 2LHIA 2JPOA 2K7OA 1C3ZA 1A75B 1DJIA 1K9UA 4CFQA 4GUKA 3WHUB 3O4YA 4JKTA 1QVIY 1SYMA 1MXLC 1DJXA 1MHOA 2VRGA 3KHEA 3WNXB 1MUXA 1SR6C 4M2PA 3SG7A 2Y4QA 2GTEA 1OQPA 1FI5A 3FIAA 4C0KA 3I5GB 2PSRA 1BLQA 3DVEA 1A4PA 1F70A 3EKHA 1DQEA 2F8PA 1H8BA 1SBJA 1CDNA 1CDMA 3EVRA 3VB1A 4C0JA 1LVCD 5I2QA 2JU0A 4FQTA 2JNXA 2SASA 4CPVA 1ZACA 3IF7A 1NX2A 2JQ6A 1GGWA 1S5GY 4ETOA 3R1VA 1UHHA 1CM1A 3S0BA 3KO0A 2M29A 3MSEB 1JSAA 3GK1A 1JF0A 3O6BA 1BR4B 4QJ3B 1KWOB 3CR5X 2EC6B 4P2YB 4YRUA 4DUQA 3SS4A 5ER5A 1QASA 5FI6A 2G9BA 4MLWA 2L4HA 2P70A 1D1OA 2KAYA 1Y6WA 3FWCA 2RGIA 1KQVA 4USLA 1BG1A 4GNKB 2L50A 3R1PA 1K2HA 1Y1UA 2H61C 2JXCA 3K1EA 1UHKA 3UO9A 3TUYC 1EG4A 2MJWB 5CSJA 4N1GA 1L2OC 1BMOA 2OS8B 1CFCA 2PALA 2L51A 3BYAA 4L9MA 1NIWA 3CDNA 5FYXA 1YUUA 3BQ3A 3D78A 4FTGA 2WNDA 1TIZA 2I2RE 3RLZA 3L47A 1TOPA 3PJIA 2ISDA 1BU3A 1MXEA 3H4SE 1NWDA 1IH0A 5I94A 1HQVA 2QACA 3VRRA 4YI9A 3I5FC 3F45A 1NCZA 3NGVA 1AHRA 1RROA 2TN4A 5I8NA 2A4JA 1LXFC 2F3YA 1K90D 1XK4A 2F33A 4OCIA 3HX4A 1RTP1 2F2OA 3ZNIA 1IQ3A 3QMEA 4YGDB 1CMGA 1QTXA 1N2DA 1QX2A 2QEHA 3L4LA 1KFUL 4PE0A 5K89A 1B7TY 4AQJA 3IQOA 1RJVA 2M97A 4CLNA 1KK8B 2MRDA 1WRKA 2I7AA 1W7IB 3FE8A 3CZ1A 1QV0A 2KFGA 3NHTA 3IQQA 3BUXB 1CKKA 1OSAA 2CTNA 3DY9A 1S6IA 2PMYA 2LHLA 4PHNA 5HKYA 1B4CA 2M7LA 1XFZO 1SR6B 2JULA 2OPOA 2WC5A 1AP4A 1CLLA 1GQMA 2ZNEA 1XFYO 2MLFC 3NSLA 2KI6D 1QIVA 3A4UB 1CM4A 1VRKA 4JWQA 1DMOA 3SJSA 1LA3A 2JTZA 1X02A 2OS8C 1IIOA 1YR5A 1JF2A 1SSEB 2LNKA 3CZ0A 2LM5A 4M2OA 1HT9A 2PVBA 1Y1XA 3AKAA 3CWGA 3CZTX 3V2LA 1CFFA 1CLMA 3OX6A 1B8RA 1L7ZA 1QWVA 1XO5A 5JOLA 2BKHB 2AUCA 2GGZA 1SW8A 1WDCC 4NQGA 4PE1A 2NLNA 1RK9A 4WRIA 5HLOA 4BY5A 1OOFA 1TN4A 3OBVA 1OMRA 2CCMA 2LAPA 3GK4X 5AERA 2AMIA 4OR9B 2E30A 4E68A 2G2BA 2L5XB 3AAJA 4WQ2A 3NSIA 3PM2A 3PSRA 4PHKA 3LK1A 1NX3A 2JT0A 1ALVA 2LVKA 3LCPC 1W9ZA 1QX5B 3RM1A 1S36A 2BE4A 3BOWB 1Z2CB 2L0PA 1F4OA 2CT9A 2FOTA 1PALA 1V1FA 2L98A 2M0RA 1EH2A 1ORGA 2KLDA 3LK0A 1A29A 4GFTA 1TTXA 1WY9A 2BL0C 1IQ5A 3TUYB 3QRXA 1IWQA 1B47A 1RFJA 3EK4A 3L4AA 1S6JA 2B1UA 1ALWA 1OZOA 1L2OB 2H8VA 2ZN8A 1JUOA 4CIDA 1WLMA 2L2CA 2L5YA 3I5HC 1AK8A 3CYZA 1PRWA 2O5GA 3JTDC 1F4QA 1TNQA 2BBNA 1BR1B 1F71A 4M2QA 2CXJA 1XFXO 4A4CA 1C7VA 1F55A 2D8NA 3D76A 2FCDA 1K93D 2LVJA 1J1DA 2K2AA 2NCPA 1JC2A 1KFUS 2KFHA 2KBMA 1DEKA 3I5FB 2P71A 2ZRSA 3D0YB 1DC1A 1DJGA 1IGVA 1K9KA 3BFAA 5KSZA 1IG5A 1A75A 1NPQA 2WCHA 3PFVA 3Q8IA 5D69A 3BUOB 1KK7Y 1Y1AA 2KQ6A 1A2XA 4XJKB 1FI6A 3SG5A 1UHJA 3NXAA 1XFWO 1EL4A 2PRUA 2Y1MA 3BJHA 3JVTB 1XYDA 5FI7A 4OKHA 1AJ4A 3O2PA 2KI6C 3CABA 2MAZA 1MQ1A 1XFVO 2WCBA 4HRGA 4JPZB 2JWWA 2OTGC 1DF0B 1MWNA 2LMTA 3OHMB 1OOGA 5AFPA 3SG6A 1T14A 2LVVA 1IKUA 1H4BA 1SL9A 1DGUA 1V1GA 4YGBB 3WXAA 1SCMC 1MR8A 2GV5A 3PN7C 4MZJA 4YGAA 1C3YA 1BOCA 1TWOA 3I5IB 2I18A 1SK6D 2KBIA 3VRPA 1DJZA 1IJ6A 4MBEA 4WQ3A 2EGDA 1K9PA 3EK7A 2EHBA 2QPTA 5I2LA 4DIRA 3BUMB 1LA0A 4GGFA 1PSBA 1PULA 1R6PA 1DF0A 1SL8A 2HPSA 2I94A 2K8MB 4MN0A 1E8AA 2ZRTA 2KDHA 2M1UA 2Q91A 2BBMA 1WDCB 4P5OE 1K95A 3OP0A 2QEOA 1EJ3A 1NX1A 4MRXA 1JFJA 2KSPA 1KFXL 2LMVA 2HQ8A 3SS3A 1DTLA 2M8UA 4NDBA 2LUXA 2K7DA 5DKQA 2KAXA 1SY9A 2F3ZA 3CR2A 1FW4A 4PALA 4Q04A 1B8CA 4YGEB 5DKRA 1BJFA 1DT7B 1K8UA 1J7RA 2FJYA 1WRLA 3JVTC 4HSZA 3EK8A 5GQQC 2LMUA 2BL0B 1U5IB 4GPLB 1M31A 1CMFA 1CNPA 3S0AA 1YURA 3TDZA 2JPTA 4DRWA 2KYFA 3CZ2A 3FS7A 1DJWA 1DELA 3K21A 3PATA 4JQ0D 1K96A 4ZCUA 3PALA 5TNCA 4F0ZB 3I5HB 1KQMC 1S1EA 1QXPA 5I2OA 2M49B 3JTDB 3VROA 2L4IA 2BECA 5HYDA 1LINA 3VGOA 1SPYA 4BY4A 1CDLA 1YRTB 3R72A 4UPGA 3I5IC 2ZKMX 4PE4A 1MF8B 1CB1A 1GM0A 1OZSA 4PDZA 1R2UA 1ZMZA 3EVUA 2DOQA 4PE7A 1IJ5A 2JC2A 3GOFA 1J7PA 1CLBA 3OB1B 3N7HA 3FE6A 5AEQA 2WC6A 4C0LA 1OOJA 1P28A 2KOTA 3TS5C 1J1EA 3DVKA 1RWYA 3AKBA 1OOIX 1TNWA 1B8LA 2M9GA 4INXA 2PASA 3DZTA
chains in the Genus database with same CATH topology
2M3WA 1SMGA 2JXLA 2JT8A 1NX0A 2MBXA 5AANA 1M63B 4NDCA 2JRFA 1YUTA 4YBHB 2BCBA 1QV1A 1XK4C 5D7FA 1UHNA 1FBVA 2KHNA 1SRAA 2HF5A 2OTGB 1YVLA 1FF1A 3AAKA 1UHIA 4CFRA 2KI4C 5DKNA 2M1KB 1S3PA 1IRJA 1YTZC 1LKJA 1QLKA 1QVIZ 2LE9B 2BE6A 1SCMB 2M7NA 3LLEA 3PN7B 4OVNF 4A4BA 3E3RA 2MHHA 3TDUA 2V53A 2R2IA 4MZKA 4MZLA 1KFXS 4TNCA 5J3XA 2LUCA 3FWBA 4ORBB 2WOSA 3WHTB 1SL7A 2AAOA 3C1VA 5HKWA 2Q4UA 1C07A 3ICBA 4I5JA 1NSHA 1UURA 1QJTA 1DJYA 2NCOA 3BOWA 3CTNA 4R1EA 3DF0B 1M39A 1XFUO 2Y5IA 1M45A 1S5GZ 2H61A 2LP2A 1KK7Z 3BUNB 3CR4X 1QX7A 2O60A 3NSKA 4N5XA 2JZIA 4PHJA 4FQOA 2COLB 1B9AA 1ZUZA 1C7WA 2FJUB 1B1GA 3NSOA 2KGBC 4HRHA 1TCOB 4DCKA 2IS9A 4ZCVA 1J55A 2BKIB 5CPVA 3DF0A 3PM8A 2KFFA 1WLZA 4YGCB 1OMVA 2ZN9A 3D10A 3D0YA 3SG4A 3GK2A 1KQMB 1G4YR 1Q80A 5KU1A 2WCEA 1AJ5A 1BF5A 2E6WA 1PK0D 1W7JB 1K94A 5G08A 1KCYA 2WCFA 3SIAA 1AUIB 1A03A 2JT3A 4XJKA 1JWDA 1ZOTB 2Y1NA 4ORCB 2LANA 3DD4A 3TS5B 5B8IB 4I5NB 1SCVA 4GAOA 2K7CA 2F2PA 1S6CA 3BXKA 4ORAB 2SCPA 1KSMA 2LP3A 4NDDA 4XYNA 2ZNDA 3KPXA 3TZ1A 1F54A 4GBAA 1QIWA 4I5KA 1JBAA 2NZ0A 1UP5A 4MVFA 1CDPA 1DJHA 1DVIA 2CBLA 1B7TZ 1KSOA 2BCAA 2L2EA 5ER4X 5AXIA 1SKTA 4PHMA 1TNXA 3O78A 1ZFSA 2KGRA 2KI4B 3SG3A 1XVJA 5JJGA 1CFPA 1CFDA 1WRZA 4HREE 1CTRA 3SIBA 1J7OA 2GGMA 3I5GC 1YX7A 3VRQA 4PCWA 2HQWA 2LLSA 1GJYA 4AQIA 1NCYA 1YUSA 4AOMA 2WC8A 3M0WA 1EG3A 2LLTA 3ZWHA 1QATA 2LC5A 4QJ4B 2MLEC 1Y0VH 1QLSA 2K7BA 2KNEA 1FPWA 4GGNA 4QJ5B 4DS7A 1NYAA 2KAVA 5F6TA 1EXRA 1KWOC 4IL1A 5CSNA 1BODA 2EC6C 2JOJA 4I5LB 2LLUA 1TNPA 1U5IA 3CLNA 5CSFA 3DVJA 1UWOA 4MSPA 3TDIA 3OB2B 4GGFC 2K0JA 3DVMA 1PVBA 2JNFA 1G33A 2CNPA 4ICBA 3KEVA 2LV7A 2K61A 5CSIA 3CGAA 1NCXA 1OE9B 2KQYA 3OX5A 5IBWA 3BUWB 3LL8B 2FCEA 2JTTA 1BT6A 1J7QA 1YX8A 2HETA 2LCPA 3A8RA 4OV2A 1DGVA 1XA5A 1QS7A 1YRUB 4MRYA 5PALA 1G8IA 2WORA 1N65A 1NP8A 1YVHA 3KF9A 5KTYA 4D1EA 3HCMA 2BCXA 1UUSA 3PLFB 2NXQA 4U8DA 3VRNA 3SG2A 1N0YA 2MA2A 1JFKA 2ZFDA 2P6BB 5HLVA 1PSRA 2KYCA 1ODBA 1PVAA 3EKJA 1OMDA 1GGZA 1TRFA 1SNLA 3CS1A 3EVVA 1M46A 5BPJA 2K2FA 1F8HA 1AVSA 4YI8A 1NUBA 1RECA 2H2KA 2LVIA 1KK8C 4N1FA 5HKZA 4MEWA 1S26D 1TCFA 2LHIA 2K7OA 1A75B 1DJIA 1K9UA 4CFQA 4GUKA 3WHUB 3O4YA 1QVIY 1SYMA 1MXLC 1DJXA 1MHOA 2VRGA 3KHEA 3WNXB 1MUXA 1SR6C 4M2PA 3SG7A 2Y4QA 1OQPA 1FI5A 3FIAA 4C0KA 3I5GB 2PSRA 1BLQA 3DVEA 1A4PA 1F70A 3EKHA 2F8PA 1H8BA 1SBJA 1CDNA 1CDMA 3EVRA 4C0JA 1LVCD 5I2QA 2JU0A 2JNXA 2SASA 4CPVA 1ZACA 3IF7A 1NX2A 2JQ6A 1GGWA 1S5GY 4ETOA 1UHHA 1CM1A 3KO0A 2M29A 3MSEB 1JSAA 3GK1A 1JF0A 3O6BA 1BR4B 4QJ3B 1KWOB 3CR5X 2EC6B 4P2YB 4YRUA 4DUQA 5ER5A 1QASA 2G9BA 4MLWA 2L4HA 1D1OA 2KAYA 1Y6WA 3FWCA 2RGIA 1KQVA 4USLA 1BG1A 4GNKB 2L50A 1K2HA 1Y1UA 2H61C 2JXCA 1UHKA 3TUYC 1EG4A 2MJWB 5CSJA 4N1GA 1L2OC 1BMOA 2OS8B 1CFCA 2PALA 2L51A 3BYAA 4L9MA 1NIWA 5FYXA 1YUUA 3BQ3A 4FTGA 2WNDA 1TIZA 2I2RE 3RLZA 1TOPA 2ISDA 1BU3A 1MXEA 3H4SE 1NWDA 1IH0A 1HQVA 2QACA 3VRRA 4YI9A 3I5FC 3F45A 1NCZA 1AHRA 1RROA 2TN4A 5I8NA 2A4JA 1LXFC 2F3YA 1K90D 1XK4A 2F33A 4OCIA 3HX4A 1RTP1 2F2OA 3ZNIA 1IQ3A 4YGDB 1CMGA 1QTXA 1N2DA 1QX2A 5K89A 1KFUL 4PE0A 1B7TY 4AQJA 3IQOA 1RJVA 2M97A 4CLNA 1KK8B 2MRDA 1WRKA 2I7AA 1W7IB 1QV0A 2KFGA 3IQQA 3BUXB 1CKKA 1OSAA 2CTNA 1S6IA 2PMYA 2LHLA 4PHNA 5HKYA 1B4CA 2M7LA 1XFZO 1SR6B 2JULA 2OPOA 1AP4A 1CLLA 1GQMA 2ZNEA 1XFYO 2MLFC 3NSLA 2KI6D 1QIVA 3A4UB 1CM4A 1VRKA 4JWQA 1DMOA 3SJSA 1LA3A 2JTZA 1X02A 2OS8C 1YR5A 1JF2A 2LNKA 4M2OA 2LM5A 1HT9A 2PVBA 1Y1XA 3AKAA 3CWGA 3CZTX 1CFFA 1CLMA 3OX6A 1B8RA 1L7ZA 1XO5A 5JOLA 2BKHB 2AUCA 2GGZA 1SW8A 1WDCC 4NQGA 4PE1A 2NLNA 1RK9A 4WRIA 5HLOA 4BY5A 1TN4A 1OMRA 2CCMA 2LAPA 3GK4X 5AERA 2AMIA 4OR9B 2E30A 4E68A 2G2BA 2L5XB 3AAJA 4WQ2A 3NSIA 3PSRA 4PHKA 3LK1A 1NX3A 2JT0A 1ALVA 2LVKA 3LCPC 1QX5B 3RM1A 1S36A 2BE4A 3BOWB 2L0PA 1F4OA 2CT9A 2FOTA 1PALA 1V1FA 2L98A 2M0RA 1EH2A 3LK0A 1A29A 4GFTA 1TTXA 1WY9A 2BL0C 1IQ5A 3TUYB 3QRXA 1IWQA 1B47A 1RFJA 3EK4A 1S6JA 2B1UA 1ALWA 1OZOA 1L2OB 2ZN8A 1AK8A 1JUOA 4CIDA 1WLMA 3I5HC 3JTDC 1PRWA 2O5GA 1F4QA 1TNQA 2BBNA 1BR1B 1F71A 4M2QA 2CXJA 1XFXO 4A4CA 1C7VA 1F55A 2D8NA 2FCDA 1K93D 2LVJA 1J1DA 2K2AA 2NCPA 1JC2A 1KFUS 2KFHA 2KBMA 3I5FB 3D0YB 2ZRSA 1DJGA 1IGVA 1K9KA 5KSZA 1IG5A 1A75A 1NPQA 3PFVA 5D69A 3BUOB 1KK7Y 1Y1AA 2KQ6A 1A2XA 4XJKB 1FI6A 3SG5A 1UHJA 3NXAA 1XFWO 1EL4A 2PRUA 2Y1MA 3JVTB 1XYDA 4OKHA 1AJ4A 3O2PA 2KI6C 2MAZA 1MQ1A 1XFVO 2WCBA 4HRGA 4JPZB 2JWWA 2OTGC 1DF0B 1MWNA 2LMTA 3OHMB 5AFPA 3SG6A 1IKUA 2LVVA 1SL9A 1DGUA 1V1GA 4YGBB 3WXAA 1SCMC 1MR8A 2GV5A 3PN7C 4MZJA 4YGAA 1BOCA 3I5IB 2I18A 1SK6D 2KBIA 3VRPA 1DJZA 1IJ6A 4MBEA 4WQ3A 2EGDA 1K9PA 3EK7A 2EHBA 2QPTA 5I2LA 4DIRA 3BUMB 1LA0A 4GGFA 1PSBA 1PULA 1R6PA 1DF0A 1SL8A 2HPSA 2I94A 2K8MB 4MN0A 1E8AA 2ZRTA 2KDHA 2M1UA 2Q91A 2BBMA 1WDCB 4P5OE 1K95A 3OP0A 4MRXA 1EJ3A 1NX1A 1JFJA 2KSPA 1KFXL 2LMVA 2HQ8A 1DTLA 2M8UA 4NDBA 2LUXA 2K7DA 5DKQA 2KAXA 1SY9A 2F3ZA 3CR2A 1FW4A 4PALA 4Q04A 1B8CA 4YGEB 5DKRA 1BJFA 1DT7B 1K8UA 1J7RA 1WRLA 3JVTC 4HSZA 3EK8A 5GQQC 2LMUA 2BL0B 1U5IB 4GPLB 1M31A 1CMFA 1CNPA 1YURA 3TDZA 2JPTA 4DRWA 2KYFA 3K21A 3FS7A 1DJWA 3PATA 4JQ0D 1H4BA 4ZCUA 1K96A 5TNCA 3PALA 4F0ZB 3I5HB 1KQMC 1S1EA 1QXPA 5I2OA 2M49B 3JTDB 3VROA 2L4IA 2BECA 5HYDA 1LINA 3VGOA 1SPYA 4BY4A 1CDLA 1YRTB 4UPGA 3I5IC 2ZKMX 4PE4A 1MF8B 1CB1A 1OZSA 4PDZA 1R2UA 1ZMZA 3EVUA 2DOQA 4PE7A 1IJ5A 2JC2A 3GOFA 1J7PA 1CLBA 3OB1B 5AEQA 4C0LA 1OOJA 2KOTA 3TS5C 1J1EA 3DVKA 1RWYA 3AKBA 1TNWA 2M9GA 1B8LA 2PASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3W A;  1SMG A;  2JXL A;  2JT8 A;  1NX0 A;  2MBX A;  5AAN A;  1M63 B;  4NDC A;  2JRF A;  1YUT A;  4YBH B;  2BCB A;  1QV1 A;  1XK4 C;  5D7F A;  1UHN A;  1FBV A;  2KHN A;  1SRA A;  2HF5 A;  2OTG B;  1YVL A;  1FF1 A;  3AAK A;  1UHI A;  4CFR A;  2KI4 C;  5DKN A;  2M1K B;  1S3P A;  1IRJ A;  1YTZ C;  1LKJ A;  1QLK A;  1QVI Z;  2LE9 B;  2BE6 A;  1SCM B;  2M7N A;  3LLE A;  3PN7 B;  4OVN F;  4A4B A;  3E3R A;  2MHH A;  3TDU A;  2V53 A;  2R2I A;  4MZK A;  4MZL A;  1KFX S;  4TNC A;  5J3X A;  2LUC A;  3FWB A;  4ORB B;  2WOS A;  3WHT B;  1SL7 A;  2AAO A;  3C1V A;  5HKW A;  2Q4U A;  1C07 A;  3ICB A;  4I5J A;  1NSH A;  1UUR A;  1QJT A;  1DJY A;  2NCO A;  3BOW A;  3CTN A;  4R1E A;  3DF0 B;  1M39 A;  1XFU O;  2Y5I A;  1M45 A;  1S5G Z;  2H61 A;  2LP2 A;  1KK7 Z;  3BUN B;  3CR4 X;  1QX7 A;  2O60 A;  3NSK A;  4N5X A;  2JZI A;  4PHJ A;  4FQO A;  2COL B;  1B9A A;  1ZUZ A;  1C7W A;  2FJU B;  1B1G A;  3NSO A;  2KGB C;  4HRH A;  1TCO B;  4DCK A;  2IS9 A;  4ZCV A;  1J55 A;  2BKI B;  5CPV A;  3DF0 A;  3PM8 A;  2KFF A;  1WLZ A;  4YGC B;  1OMV A;  2ZN9 A;  3D10 A;  3D0Y A;  3SG4 A;  3GK2 A;  1KQM B;  1G4Y R;  1Q80 A;  5KU1 A;  2WCE A;  1AJ5 A;  1BF5 A;  2E6W A;  1PK0 D;  1W7J B;  1K94 A;  5G08 A;  1KCY A;  2WCF A;  3SIA A;  1AUI B;  1A03 A;  2JT3 A;  4XJK A;  1JWD A;  1ZOT B;  2Y1N A;  4ORC B;  2LAN A;  3DD4 A;  3TS5 B;  5B8I B;  4I5N B;  1SCV A;  4GAO A;  2K7C A;  2F2P A;  1S6C A;  3BXK A;  4ORA B;  2SCP A;  1KSM A;  2LP3 A;  4NDD A;  4XYN A;  2ZND A;  3KPX A;  3TZ1 A;  1F54 A;  4GBA A;  1QIW A;  4I5K A;  1JBA A;  2NZ0 A;  1UP5 A;  4MVF A;  1CDP A;  1DJH A;  1DVI A;  2CBL A;  1B7T Z;  1KSO A;  2BCA A;  2L2E A;  5ER4 X;  5AXI A;  1SKT A;  4PHM A;  1TNX A;  3O78 A;  1ZFS A;  2KGR A;  2KI4 B;  3SG3 A;  1XVJ A;  5JJG A;  1CFP A;  1CFD A;  1WRZ A;  4HRE E;  1CTR A;  3SIB A;  1J7O A;  2GGM A;  3I5G C;  1YX7 A;  3VRQ A;  4PCW A;  2HQW A;  2LLS A;  1GJY A;  4AQI A;  1NCY A;  1YUS A;  4AOM A;  2WC8 A;  3M0W A;  1EG3 A;  2LLT A;  3ZWH A;  1QAT A;  2LC5 A;  4QJ4 B;  2MLE C;  1Y0V H;  1QLS A;  2K7B A;  2KNE A;  1FPW A;  4GGN A;  4QJ5 B;  4DS7 A;  1NYA A;  2KAV A;  5F6T A;  1EXR A;  1KWO C;  4IL1 A;  5CSN A;  1BOD A;  2EC6 C;  2JOJ A;  4I5L B;  2LLU A;  1TNP A;  1U5I A;  3CLN A;  5CSF A;  3DVJ A;  1UWO A;  4MSP A;  3TDI A;  3OB2 B;  4GGF C;  2K0J A;  3DVM A;  1PVB A;  2JNF A;  1G33 A;  2CNP A;  4ICB A;  3KEV A;  2LV7 A;  2K61 A;  5CSI A;  3CGA A;  1NCX A;  1OE9 B;  2KQY A;  3OX5 A;  5IBW A;  3BUW B;  3LL8 B;  2FCE A;  2JTT A;  1BT6 A;  1J7Q A;  1YX8 A;  2HET A;  2LCP A;  3A8R A;  4OV2 A;  1DGV A;  1XA5 A;  1QS7 A;  1YRU B;  4MRY A;  5PAL A;  1G8I A;  2WOR A;  1N65 A;  1NP8 A;  1YVH A;  3KF9 A;  5KTY A;  4D1E A;  3HCM A;  2BCX A;  1UUS A;  3PLF B;  2NXQ A;  4U8D A;  3VRN A;  3SG2 A;  1N0Y A;  2MA2 A;  1JFK A;  2ZFD A;  2P6B B;  5HLV A;  1PSR A;  2KYC A;  1ODB A;  1PVA A;  3EKJ A;  1OMD A;  1GGZ A;  1TRF A;  1SNL A;  3CS1 A;  3EVV A;  1M46 A;  5BPJ A;  2K2F A;  1F8H A;  1AVS A;  4YI8 A;  1NUB A;  1REC A;  2H2K A;  2LVI A;  1KK8 C;  4N1F A;  5HKZ A;  4MEW A;  1S26 D;  1TCF A;  2LHI A;  2K7O A;  1A75 B;  1DJI A;  1K9U A;  4CFQ A;  4GUK A;  3WHU B;  3O4Y A;  1QVI Y;  1SYM A;  1MXL C;  1DJX A;  1MHO A;  2VRG A;  3KHE A;  3WNX B;  1MUX A;  1SR6 C;  4M2P A;  3SG7 A;  2Y4Q A;  1OQP A;  1FI5 A;  3FIA A;  4C0K A;  3I5G B;  2PSR A;  1BLQ A;  3DVE A;  1A4P A;  1F70 A;  3EKH A;  2F8P A;  1H8B A;  1SBJ A;  1CDN A;  1CDM A;  3EVR A;  4C0J A;  1LVC D;  5I2Q A;  2JU0 A;  2JNX A;  2SAS A;  4CPV A;  1ZAC A;  3IF7 A;  1NX2 A;  2JQ6 A;  1GGW A;  1S5G Y;  4ETO A;  1UHH A;  1CM1 A;  3KO0 A;  2M29 A;  3MSE B;  1JSA A;  3GK1 A;  1JF0 A;  3O6B A;  1BR4 B;  4QJ3 B;  1KWO B;  3CR5 X;  2EC6 B;  4P2Y B;  4YRU A;  4DUQ A;  5ER5 A;  1QAS A;  2G9B A;  4MLW A;  2L4H A;  1D1O A;  2KAY A;  1Y6W A;  3FWC A;  2RGI A;  1KQV A;  4USL A;  1BG1 A;  4GNK B;  2L50 A;  1K2H A;  1Y1U A;  2H61 C;  2JXC A;  1UHK A;  3TUY C;  1EG4 A;  2MJW B;  5CSJ A;  4N1G A;  1L2O C;  1BMO A;  2OS8 B;  1CFC A;  2PAL A;  2L51 A;  3BYA A;  4L9M A;  1NIW A;  5FYX A;  1YUU A;  3BQ3 A;  4FTG A;  2WND A;  1TIZ A;  2I2R E;  3RLZ A;  1TOP A;  2ISD A;  1BU3 A;  1MXE A;  3H4S E;  1NWD A;  1IH0 A;  1HQV A;  2QAC A;  3VRR A;  4YI9 A;  3I5F C;  3F45 A;  1NCZ A;  1AHR A;  1RRO A;  2TN4 A;  5I8N A;  2A4J A;  1LXF C;  2F3Y A;  1K90 D;  1XK4 A;  2F33 A;  4OCI A;  3HX4 A;  1RTP 1;  2F2O A;  3ZNI A;  1IQ3 A;  4YGD B;  1CMG A;  1QTX A;  1N2D A;  1QX2 A;  5K89 A;  1KFU L;  4PE0 A;  1B7T Y;  4AQJ A;  3IQO A;  1RJV A;  2M97 A;  4CLN A;  1KK8 B;  2MRD A;  1WRK A;  2I7A A;  1W7I B;  1QV0 A;  2KFG A;  3IQQ A;  3BUX B;  1CKK A;  1OSA A;  2CTN A;  1S6I A;  2PMY A;  2LHL A;  4PHN A;  5HKY A;  1B4C A;  2M7L A;  1XFZ O;  1SR6 B;  2JUL A;  2OPO A;  1AP4 A;  1CLL A;  1GQM A;  2ZNE A;  1XFY O;  2MLF C;  3NSL A;  2KI6 D;  1QIV A;  3A4U B;  1CM4 A;  1VRK A;  4JWQ A;  1DMO A;  3SJS A;  1LA3 A;  2JTZ A;  1X02 A;  2OS8 C;  1YR5 A;  1JF2 A;  2LNK A;  4M2O A;  2LM5 A;  1HT9 A;  2PVB A;  1Y1X A;  3AKA A;  3CWG A;  3CZT X;  1CFF A;  1CLM A;  3OX6 A;  1B8R A;  1L7Z A;  1XO5 A;  5JOL A;  2BKH B;  2AUC A;  2GGZ A;  1SW8 A;  1WDC C;  4NQG A;  4PE1 A;  2NLN A;  1RK9 A;  4WRI A;  5HLO A;  4BY5 A;  1TN4 A;  1OMR A;  2CCM A;  2LAP A;  3GK4 X;  5AER A;  2AMI A;  4OR9 B;  2E30 A;  4E68 A;  2G2B A;  2L5X B;  3AAJ A;  4WQ2 A;  3NSI A;  3PSR A;  4PHK A;  3LK1 A;  1NX3 A;  2JT0 A;  1ALV A;  2LVK A;  3LCP C;  1QX5 B;  3RM1 A;  1S36 A;  2BE4 A;  3BOW B;  2L0P A;  1F4O A;  2CT9 A;  2FOT A;  1PAL A;  1V1F A;  2L98 A;  2M0R A;  1EH2 A;  3LK0 A;  1A29 A;  4GFT A;  1TTX A;  1WY9 A;  2BL0 C;  1IQ5 A;  3TUY B;  3QRX A;  1IWQ A;  1B47 A;  1RFJ A;  3EK4 A;  1S6J A;  2B1U A;  1ALW A;  1OZO A;  1L2O B;  2ZN8 A;  1AK8 A;  1JUO A;  4CID A;  1WLM A;  3I5H C;  3JTD C;  1PRW A;  2O5G A;  1F4Q A;  1TNQ A;  2BBN A;  1BR1 B;  1F71 A;  4M2Q A;  2CXJ A;  1XFX O;  4A4C A;  1C7V A;  1F55 A;  2D8N A;  2FCD A;  1K93 D;  2LVJ A;  1J1D A;  2K2A A;  2NCP A;  1JC2 A;  1KFU S;  2KFH A;  2KBM A;  3I5F B;  3D0Y B;  2ZRS A;  1DJG A;  1IGV A;  1K9K A;  5KSZ A;  1IG5 A;  1A75 A;  1NPQ A;  3PFV A;  5D69 A;  3BUO B;  1KK7 Y;  1Y1A A;  2KQ6 A;  1A2X A;  4XJK B;  1FI6 A;  3SG5 A;  1UHJ A;  3NXA A;  1XFW O;  1EL4 A;  2PRU A;  2Y1M A;  3JVT B;  1XYD A;  4OKH A;  1AJ4 A;  3O2P A;  2KI6 C;  2MAZ A;  1MQ1 A;  1XFV O;  2WCB A;  4HRG A;  4JPZ B;  2JWW A;  2OTG C;  1DF0 B;  1MWN A;  2LMT A;  3OHM B;  5AFP A;  3SG6 A;  1IKU A;  2LVV A;  1SL9 A;  1DGU A;  1V1G A;  4YGB B;  3WXA A;  1SCM C;  1MR8 A;  2GV5 A;  3PN7 C;  4MZJ A;  4YGA A;  1BOC A;  3I5I B;  2I18 A;  1SK6 D;  2KBI A;  3VRP A;  1DJZ A;  1IJ6 A;  4MBE A;  4WQ3 A;  2EGD A;  1K9P A;  3EK7 A;  2EHB A;  2QPT A;  5I2L A;  4DIR A;  3BUM B;  1LA0 A;  4GGF A;  1PSB A;  1PUL A;  1R6P A;  1DF0 A;  1SL8 A;  2HPS A;  2I94 A;  2K8M B;  4MN0 A;  1E8A A;  2ZRT A;  2KDH A;  2M1U A;  2Q91 A;  2BBM A;  1WDC B;  4P5O E;  1K95 A;  3OP0 A;  4MRX A;  1EJ3 A;  1NX1 A;  1JFJ A;  2KSP A;  1KFX L;  2LMV A;  2HQ8 A;  1DTL A;  2M8U A;  4NDB A;  2LUX A;  2K7D A;  5DKQ A;  2KAX A;  1SY9 A;  2F3Z A;  3CR2 A;  1FW4 A;  4PAL A;  4Q04 A;  1B8C A;  4YGE B;  5DKR A;  1BJF A;  1DT7 B;  1K8U A;  1J7R A;  1WRL A;  3JVT C;  4HSZ A;  3EK8 A;  5GQQ C;  2LMU A;  2BL0 B;  1U5I B;  4GPL B;  1M31 A;  1CMF A;  1CNP A;  1YUR A;  3TDZ A;  2JPT A;  4DRW A;  2KYF A;  3K21 A;  3FS7 A;  1DJW A;  3PAT A;  4JQ0 D;  1H4B A;  4ZCU A;  1K96 A;  5TNC A;  3PAL A;  4F0Z B;  3I5H B;  1KQM C;  1S1E A;  1QXP A;  5I2O A;  2M49 B;  3JTD B;  3VRO A;  2L4I A;  2BEC A;  5HYD A;  1LIN A;  3VGO A;  1SPY A;  4BY4 A;  1CDL A;  1YRT B;  4UPG A;  3I5I C;  2ZKM X;  4PE4 A;  1MF8 B;  1CB1 A;  1OZS A;  4PDZ A;  1R2U A;  1ZMZ A;  3EVU A;  2DOQ A;  4PE7 A;  1IJ5 A;  2JC2 A;  3GOF A;  1J7P A;  1CLB A;  3OB1 B;  5AEQ A;  4C0L A;  1OOJ A;  2KOT A;  3TS5 C;  1J1E A;  3DVK A;  1RWY A;  3AKB A;  1TNW A;  2M9G A;  1B8L A;  2PAS A; 
#chains in the Genus database with same CATH topology
 2M3W A;  1SMG A;  2JXL A;  2JT8 A;  1NX0 A;  2MBX A;  5AAN A;  1M63 B;  4NDC A;  2JRF A;  1YUT A;  4YBH B;  2BCB A;  1QV1 A;  1XK4 C;  5D7F A;  3B6X A;  1UHN A;  3B7A A;  1FBV A;  5EL2 A;  3S0D A;  2KHN A;  1SRA A;  2HF5 A;  2OTG B;  1YVL A;  1FF1 A;  5D3O A;  3AAK A;  1OW4 A;  1UHI A;  4CFR A;  2KI4 C;  5DKN A;  2M1K B;  1S3P A;  1IRJ A;  1YTZ C;  1LKJ A;  1QLK A;  1QVI Z;  2LE9 B;  2BE6 A;  1SCM B;  2M7N A;  3LLE A;  3PN7 B;  4OVN F;  4A4B A;  3E3R A;  2MHH A;  3TDU A;  2V53 A;  3SS5 A;  2R2I A;  4MZK A;  4MZL A;  1KFX S;  4TNC A;  4IJ7 A;  5J3X A;  2LUC A;  3FWB A;  4ORB B;  2WOS A;  3WHT B;  1SL7 A;  2AAO A;  3C1V A;  5HKW A;  2Q4U A;  2QDI A;  1C07 A;  3ICB A;  4I5J A;  1NSH A;  1UUR A;  1QJT A;  1DJY A;  1Z4H A;  2NCO A;  3BOW A;  3CTN A;  4R1E A;  3DF0 B;  1M39 A;  1XFU O;  2Y5I A;  1M45 A;  1S5G Z;  2H61 A;  2LP2 A;  1KK7 Z;  3BUN B;  3CR4 X;  1QX7 A;  2O60 A;  3B88 A;  3NSK A;  4N5X A;  2JZI A;  4PHJ A;  2QEV A;  4FQO A;  2COL B;  1B9A A;  3RZS A;  3R1O A;  1ZUZ A;  2YGU A;  1C7W A;  2FJU B;  1B1G A;  3NSO A;  2KGB C;  4HRH A;  1TCO B;  4DCK A;  2IS9 A;  4F7F A;  4ZCV A;  1J55 A;  2BKI B;  1TUZ A;  5CPV A;  3D75 A;  3DF0 A;  2WCM A;  3PM8 A;  2KFF A;  1WLZ A;  4YGC B;  1OMV A;  2ZN9 A;  3D10 A;  3D0Y A;  4OZD A;  3GK2 A;  1KQM B;  1G4Y R;  3SG4 A;  1Q80 A;  5KU1 A;  2WCE A;  5HL1 A;  1AJ5 A;  1BF5 A;  2E6W A;  2BNX A;  1PK0 D;  1W7J B;  1K94 A;  2ERB A;  4INW A;  2PYQ A;  5G08 A;  1KCY A;  2WCF A;  5FI2 A;  5DIC A;  3SIA A;  1AUI B;  1A03 A;  2JT3 A;  4XJK A;  1JWD A;  1ZOT B;  2Y1N A;  2QEB A;  4ORC B;  2LAN A;  3DD4 A;  2KPH A;  3TS5 B;  3OGN A;  5B8I B;  4I5N B;  1SCV A;  2PQL A;  4GAO A;  2K60 A;  2K7C A;  2F2P A;  3FE9 A;  1S6C A;  3BXK A;  4ORA B;  2SCP A;  1KSM A;  2LP3 A;  1LS8 A;  3NHI A;  4NDD A;  2ZND A;  3KPX A;  4XYN A;  3TZ1 A;  4GBA A;  2WCK A;  1F54 A;  1QIW A;  4I5K A;  1JBA A;  3B86 A;  3B87 A;  3EG5 B;  2NZ0 A;  1UP5 A;  4MVF A;  3UNW A;  1CDP A;  1DJH A;  1DVI A;  2CBL A;  1B7T Z;  1KSO A;  2BCA A;  2L2E A;  5ER4 X;  5AXI A;  1SKT A;  4PHM A;  1TNX A;  3O78 A;  1ZFS A;  2KGR A;  2KI4 B;  3SG3 A;  1XVJ A;  5JJG A;  1CFP A;  1CFD A;  1WRZ A;  3BFB A;  1CTR A;  4HRE E;  3SIB A;  3IVT A;  1J7O A;  2GGM A;  3I5G C;  1YX7 A;  3VRQ A;  4PCW A;  2HQW A;  2LLS A;  1GJY A;  4PT1 A;  4AQI A;  1NCY A;  1YUS A;  4AOM A;  2WC8 A;  3M0W A;  1EG3 A;  2LLT A;  3ZWH A;  1QAT A;  2LC5 A;  4QJ4 B;  1TUJ A;  2MLE C;  1Y0V H;  4KYN A;  1QLS A;  1XFR A;  3BFH A;  2K7B A;  2KNE A;  1FPW A;  3O4X A;  4GGN A;  4QJ5 B;  4DS7 A;  1NYA A;  2KAV A;  5F6T A;  1EXR A;  1KWO C;  4IL1 A;  5CSN A;  1BOD A;  2EC6 C;  2JOJ A;  4JD9 A;  4I5L B;  2LLU A;  1TNP A;  1U5I A;  3CLN A;  5CSF A;  3DVJ A;  1UWO A;  4MSP A;  3TDI A;  3OB2 B;  4GGF C;  2BAP A;  2K0J A;  1OOH A;  2KLE A;  3DVM A;  1PVB A;  3D77 A;  2JNF A;  1G33 A;  2CNP A;  4ICB A;  3KEV A;  3S0F A;  2LV7 A;  2K61 A;  5CSI A;  3CGA A;  1NCX A;  1OE9 B;  2KQY A;  3OX5 A;  5IBW A;  3BUW B;  3LL8 B;  2FCE A;  2JTT A;  1BT6 A;  1J7Q A;  1YX8 A;  2HET A;  2LCP A;  3A8R A;  2WCJ A;  1DGV A;  1XA5 A;  1QS7 A;  1YRU B;  3DXL A;  4OV2 A;  4MRY A;  5PAL A;  1G8I A;  2WOR A;  1N65 A;  1NP8 A;  1YVH A;  3KF9 A;  5KTY A;  4D1E A;  3S0E A;  3HCM A;  2BCX A;  1UUS A;  3PLF B;  2NXQ A;  3D74 A;  4U8D A;  3VRN A;  3SG2 A;  3S0G A;  1N0Y A;  2MA2 A;  3DYE A;  2WCL A;  1JFK A;  2ZFD A;  2P6B B;  5HLV A;  1PSR A;  2KYC A;  1ODB A;  1PVA A;  3EKJ A;  1OMD A;  1GGZ A;  1TRF A;  3D73 A;  1SNL A;  3CS1 A;  3EVV A;  1M46 A;  5BPJ A;  2K2F A;  1F8H A;  1AVS A;  4YI8 A;  1NUB A;  1REC A;  2H2K A;  2LVI A;  1KK8 C;  4N1F A;  5HKZ A;  4MEW A;  1S26 D;  1TCF A;  2LHI A;  2JPO A;  2K7O A;  1C3Z A;  1A75 B;  1DJI A;  1K9U A;  4CFQ A;  4GUK A;  3WHU B;  3O4Y A;  4JKT A;  1QVI Y;  1SYM A;  1MXL C;  1DJX A;  1MHO A;  2VRG A;  3KHE A;  3WNX B;  1MUX A;  1SR6 C;  4M2P A;  3SG7 A;  2Y4Q A;  2GTE A;  1OQP A;  1FI5 A;  3FIA A;  4C0K A;  3I5G B;  2PSR A;  1BLQ A;  3DVE A;  1A4P A;  1F70 A;  3EKH A;  1DQE A;  2F8P A;  1H8B A;  1SBJ A;  1CDN A;  1CDM A;  3EVR A;  3VB1 A;  4C0J A;  1LVC D;  5I2Q A;  2JU0 A;  4FQT A;  2JNX A;  2SAS A;  4CPV A;  1ZAC A;  3IF7 A;  1NX2 A;  2JQ6 A;  1GGW A;  1S5G Y;  4ETO A;  3R1V A;  1UHH A;  1CM1 A;  3S0B A;  3KO0 A;  2M29 A;  3MSE B;  1JSA A;  3GK1 A;  1JF0 A;  3O6B A;  1BR4 B;  4QJ3 B;  1KWO B;  3CR5 X;  2EC6 B;  4P2Y B;  4YRU A;  4DUQ A;  3SS4 A;  5ER5 A;  1QAS A;  5FI6 A;  2G9B A;  4MLW A;  2L4H A;  2P70 A;  1D1O A;  2KAY A;  1Y6W A;  3FWC A;  2RGI A;  1KQV A;  4USL A;  1BG1 A;  4GNK B;  2L50 A;  3R1P A;  1K2H A;  1Y1U A;  2H61 C;  2JXC A;  3K1E A;  1UHK A;  3UO9 A;  3TUY C;  1EG4 A;  2MJW B;  5CSJ A;  4N1G A;  1L2O C;  1BMO A;  2OS8 B;  1CFC A;  2PAL A;  2L51 A;  3BYA A;  4L9M A;  1NIW A;  3CDN A;  5FYX A;  1YUU A;  3BQ3 A;  3D78 A;  4FTG A;  2WND A;  1TIZ A;  2I2R E;  3RLZ A;  3L47 A;  1TOP A;  3PJI A;  2ISD A;  1BU3 A;  1MXE A;  3H4S E;  1NWD A;  1IH0 A;  5I94 A;  1HQV A;  2QAC A;  3VRR A;  4YI9 A;  3I5F C;  3F45 A;  1NCZ A;  3NGV A;  1AHR A;  1RRO A;  2TN4 A;  5I8N A;  2A4J A;  1LXF C;  2F3Y A;  1K90 D;  1XK4 A;  2F33 A;  4OCI A;  3HX4 A;  1RTP 1;  2F2O A;  3ZNI A;  1IQ3 A;  3QME A;  4YGD B;  1CMG A;  1QTX A;  1N2D A;  1QX2 A;  2QEH A;  3L4L A;  1KFU L;  4PE0 A;  5K89 A;  1B7T Y;  4AQJ A;  3IQO A;  1RJV A;  2M97 A;  4CLN A;  1KK8 B;  2MRD A;  1WRK A;  2I7A A;  1W7I B;  3FE8 A;  3CZ1 A;  1QV0 A;  2KFG A;  3NHT A;  3IQQ A;  3BUX B;  1CKK A;  1OSA A;  2CTN A;  3DY9 A;  1S6I A;  2PMY A;  2LHL A;  4PHN A;  5HKY A;  1B4C A;  2M7L A;  1XFZ O;  1SR6 B;  2JUL A;  2OPO A;  2WC5 A;  1AP4 A;  1CLL A;  1GQM A;  2ZNE A;  1XFY O;  2MLF C;  3NSL A;  2KI6 D;  1QIV A;  3A4U B;  1CM4 A;  1VRK A;  4JWQ A;  1DMO A;  3SJS A;  1LA3 A;  2JTZ A;  1X02 A;  2OS8 C;  1IIO A;  1YR5 A;  1JF2 A;  1SSE B;  2LNK A;  3CZ0 A;  2LM5 A;  4M2O A;  1HT9 A;  2PVB A;  1Y1X A;  3AKA A;  3CWG A;  3CZT X;  3V2L A;  1CFF A;  1CLM A;  3OX6 A;  1B8R A;  1L7Z A;  1QWV A;  1XO5 A;  5JOL A;  2BKH B;  2AUC A;  2GGZ A;  1SW8 A;  1WDC C;  4NQG A;  4PE1 A;  2NLN A;  1RK9 A;  4WRI A;  5HLO A;  4BY5 A;  1OOF A;  1TN4 A;  3OBV A;  1OMR A;  2CCM A;  2LAP A;  3GK4 X;  5AER A;  2AMI A;  4OR9 B;  2E30 A;  4E68 A;  2G2B A;  2L5X B;  3AAJ A;  4WQ2 A;  3NSI A;  3PM2 A;  3PSR A;  4PHK A;  3LK1 A;  1NX3 A;  2JT0 A;  1ALV A;  2LVK A;  3LCP C;  1W9Z A;  1QX5 B;  3RM1 A;  1S36 A;  2BE4 A;  3BOW B;  1Z2C B;  2L0P A;  1F4O A;  2CT9 A;  2FOT A;  1PAL A;  1V1F A;  2L98 A;  2M0R A;  1EH2 A;  1ORG A;  2KLD A;  3LK0 A;  1A29 A;  4GFT A;  1TTX A;  1WY9 A;  2BL0 C;  1IQ5 A;  3TUY B;  3QRX A;  1IWQ A;  1B47 A;  1RFJ A;  3EK4 A;  3L4A A;  1S6J A;  2B1U A;  1ALW A;  1OZO A;  1L2O B;  2H8V A;  2ZN8 A;  1JUO A;  4CID A;  1WLM A;  2L2C A;  2L5Y A;  3I5H C;  1AK8 A;  3CYZ A;  1PRW A;  2O5G A;  3JTD C;  1F4Q A;  1TNQ A;  2BBN A;  1BR1 B;  1F71 A;  4M2Q A;  2CXJ A;  1XFX O;  4A4C A;  1C7V A;  1F55 A;  2D8N A;  3D76 A;  2FCD A;  1K93 D;  2LVJ A;  1J1D A;  2K2A A;  2NCP A;  1JC2 A;  1KFU S;  2KFH A;  2KBM A;  1DEK A;  3I5F B;  2P71 A;  2ZRS A;  3D0Y B;  1DC1 A;  1DJG A;  1IGV A;  1K9K A;  3BFA A;  5KSZ A;  1IG5 A;  1A75 A;  1NPQ A;  2WCH A;  3PFV A;  3Q8I A;  5D69 A;  3BUO B;  1KK7 Y;  1Y1A A;  2KQ6 A;  1A2X A;  4XJK B;  1FI6 A;  3SG5 A;  1UHJ A;  3NXA A;  1XFW O;  1EL4 A;  2PRU A;  2Y1M A;  3BJH A;  3JVT B;  1XYD A;  5FI7 A;  4OKH A;  1AJ4 A;  3O2P A;  2KI6 C;  3CAB A;  2MAZ A;  1MQ1 A;  1XFV O;  2WCB A;  4HRG A;  4JPZ B;  2JWW A;  2OTG C;  1DF0 B;  1MWN A;  2LMT A;  3OHM B;  1OOG A;  5AFP A;  3SG6 A;  1T14 A;  2LVV A;  1IKU A;  1H4B A;  1SL9 A;  1DGU A;  1V1G A;  4YGB B;  3WXA A;  1SCM C;  1MR8 A;  2GV5 A;  3PN7 C;  4MZJ A;  4YGA A;  1C3Y A;  1BOC A;  1TWO A;  3I5I B;  2I18 A;  1SK6 D;  2KBI A;  3VRP A;  1DJZ A;  1IJ6 A;  4MBE A;  4WQ3 A;  2EGD A;  1K9P A;  3EK7 A;  2EHB A;  2QPT A;  5I2L A;  4DIR A;  3BUM B;  1LA0 A;  4GGF A;  1PSB A;  1PUL A;  1R6P A;  1DF0 A;  1SL8 A;  2HPS A;  2I94 A;  2K8M B;  4MN0 A;  1E8A A;  2ZRT A;  2KDH A;  2M1U A;  2Q91 A;  2BBM A;  1WDC B;  4P5O E;  1K95 A;  3OP0 A;  2QEO A;  1EJ3 A;  1NX1 A;  4MRX A;  1JFJ A;  2KSP A;  1KFX L;  2LMV A;  2HQ8 A;  3SS3 A;  1DTL A;  2M8U A;  4NDB A;  2LUX A;  2K7D A;  5DKQ A;  2KAX A;  1SY9 A;  2F3Z A;  3CR2 A;  1FW4 A;  4PAL A;  4Q04 A;  1B8C A;  4YGE B;  5DKR A;  1BJF A;  1DT7 B;  1K8U A;  1J7R A;  2FJY A;  1WRL A;  3JVT C;  4HSZ A;  3EK8 A;  5GQQ C;  2LMU A;  2BL0 B;  1U5I B;  4GPL B;  1M31 A;  1CMF A;  1CNP A;  3S0A A;  1YUR A;  3TDZ A;  2JPT A;  4DRW A;  2KYF A;  3CZ2 A;  3FS7 A;  1DJW A;  1DEL A;  3K21 A;  3PAT A;  4JQ0 D;  1K96 A;  4ZCU A;  3PAL A;  5TNC A;  4F0Z B;  3I5H B;  1KQM C;  1S1E A;  1QXP A;  5I2O A;  2M49 B;  3JTD B;  3VRO A;  2L4I A;  2BEC A;  5HYD A;  1LIN A;  3VGO A;  1SPY A;  4BY4 A;  1CDL A;  1YRT B;  3R72 A;  4UPG A;  3I5I C;  2ZKM X;  4PE4 A;  1MF8 B;  1CB1 A;  1GM0 A;  1OZS A;  4PDZ A;  1R2U A;  1ZMZ A;  3EVU A;  2DOQ A;  4PE7 A;  1IJ5 A;  2JC2 A;  3GOF A;  1J7P A;  1CLB A;  3OB1 B;  3N7H A;  3FE6 A;  5AEQ A;  2WC6 A;  4C0L A;  1OOJ A;  1P28 A;  2KOT A;  3TS5 C;  1J1E A;  3DVK A;  1RWY A;  3AKB A;  1OOI X;  1TNW A;  1B8L A;  2M9G A;  4INX A;  2PAS A;  3DZT A; 
#chains in the Genus database with same CATH homology
 2M3W A;  1SMG A;  2JXL A;  2JT8 A;  1NX0 A;  2MBX A;  5AAN A;  1M63 B;  4NDC A;  2JRF A;  1YUT A;  4YBH B;  2BCB A;  1QV1 A;  1XK4 C;  5D7F A;  1UHN A;  1FBV A;  2KHN A;  1SRA A;  2HF5 A;  2OTG B;  1YVL A;  1FF1 A;  3AAK A;  1UHI A;  4CFR A;  2KI4 C;  5DKN A;  2M1K B;  1S3P A;  1IRJ A;  1YTZ C;  1LKJ A;  1QLK A;  1QVI Z;  2LE9 B;  2BE6 A;  1SCM B;  2M7N A;  3LLE A;  3PN7 B;  4OVN F;  4A4B A;  3E3R A;  2MHH A;  3TDU A;  2V53 A;  2R2I A;  4MZK A;  4MZL A;  1KFX S;  4TNC A;  5J3X A;  2LUC A;  3FWB A;  4ORB B;  2WOS A;  3WHT B;  1SL7 A;  2AAO A;  3C1V A;  5HKW A;  2Q4U A;  1C07 A;  3ICB A;  4I5J A;  1NSH A;  1UUR A;  1QJT A;  1DJY A;  2NCO A;  3BOW A;  3CTN A;  4R1E A;  3DF0 B;  1M39 A;  1XFU O;  2Y5I A;  1M45 A;  1S5G Z;  2H61 A;  2LP2 A;  1KK7 Z;  3BUN B;  3CR4 X;  1QX7 A;  2O60 A;  3NSK A;  4N5X A;  2JZI A;  4PHJ A;  4FQO A;  2COL B;  1B9A A;  1ZUZ A;  1C7W A;  2FJU B;  1B1G A;  3NSO A;  2KGB C;  4HRH A;  1TCO B;  4DCK A;  2IS9 A;  4ZCV A;  1J55 A;  2BKI B;  5CPV A;  3DF0 A;  3PM8 A;  2KFF A;  1WLZ A;  4YGC B;  1OMV A;  2ZN9 A;  3D10 A;  3D0Y A;  3SG4 A;  3GK2 A;  1KQM B;  1G4Y R;  1Q80 A;  5KU1 A;  2WCE A;  1AJ5 A;  1BF5 A;  2E6W A;  1PK0 D;  1W7J B;  1K94 A;  5G08 A;  1KCY A;  2WCF A;  3SIA A;  1AUI B;  1A03 A;  2JT3 A;  4XJK A;  1JWD A;  1ZOT B;  2Y1N A;  4ORC B;  2LAN A;  3DD4 A;  3TS5 B;  5B8I B;  4I5N B;  1SCV A;  4GAO A;  2K7C A;  2F2P A;  1S6C A;  3BXK A;  4ORA B;  2SCP A;  1KSM A;  2LP3 A;  4NDD A;  4XYN A;  2ZND A;  3KPX A;  3TZ1 A;  1F54 A;  4GBA A;  1QIW A;  4I5K A;  1JBA A;  2NZ0 A;  1UP5 A;  4MVF A;  1CDP A;  1DJH A;  1DVI A;  2CBL A;  1B7T Z;  1KSO A;  2BCA A;  2L2E A;  5ER4 X;  5AXI A;  1SKT A;  4PHM A;  1TNX A;  3O78 A;  1ZFS A;  2KGR A;  2KI4 B;  3SG3 A;  1XVJ A;  5JJG A;  1CFP A;  1CFD A;  1WRZ A;  4HRE E;  1CTR A;  3SIB A;  1J7O A;  2GGM A;  3I5G C;  1YX7 A;  3VRQ A;  4PCW A;  2HQW A;  2LLS A;  1GJY A;  4AQI A;  1NCY A;  1YUS A;  4AOM A;  2WC8 A;  3M0W A;  1EG3 A;  2LLT A;  3ZWH A;  1QAT A;  2LC5 A;  4QJ4 B;  2MLE C;  1Y0V H;  1QLS A;  2K7B A;  2KNE A;  1FPW A;  4GGN A;  4QJ5 B;  4DS7 A;  1NYA A;  2KAV A;  5F6T A;  1EXR A;  1KWO C;  4IL1 A;  5CSN A;  1BOD A;  2EC6 C;  2JOJ A;  4I5L B;  2LLU A;  1TNP A;  1U5I A;  3CLN A;  5CSF A;  3DVJ A;  1UWO A;  4MSP A;  3TDI A;  3OB2 B;  4GGF C;  2K0J A;  3DVM A;  1PVB A;  2JNF A;  1G33 A;  2CNP A;  4ICB A;  3KEV A;  2LV7 A;  2K61 A;  5CSI A;  3CGA A;  1NCX A;  1OE9 B;  2KQY A;  3OX5 A;  5IBW A;  3BUW B;  3LL8 B;  2FCE A;  2JTT A;  1BT6 A;  1J7Q A;  1YX8 A;  2HET A;  2LCP A;  3A8R A;  4OV2 A;  1DGV A;  1XA5 A;  1QS7 A;  1YRU B;  4MRY A;  5PAL A;  1G8I A;  2WOR A;  1N65 A;  1NP8 A;  1YVH A;  3KF9 A;  5KTY A;  4D1E A;  3HCM A;  2BCX A;  1UUS A;  3PLF B;  2NXQ A;  4U8D A;  3VRN A;  3SG2 A;  1N0Y A;  2MA2 A;  1JFK A;  2ZFD A;  2P6B B;  5HLV A;  1PSR A;  2KYC A;  1ODB A;  1PVA A;  3EKJ A;  1OMD A;  1GGZ A;  1TRF A;  1SNL A;  3CS1 A;  3EVV A;  1M46 A;  5BPJ A;  2K2F A;  1F8H A;  1AVS A;  4YI8 A;  1NUB A;  1REC A;  2H2K A;  2LVI A;  1KK8 C;  4N1F A;  5HKZ A;  4MEW A;  1S26 D;  1TCF A;  2LHI A;  2K7O A;  1A75 B;  1DJI A;  1K9U A;  4CFQ A;  4GUK A;  3WHU B;  3O4Y A;  1QVI Y;  1SYM A;  1MXL C;  1DJX A;  1MHO A;  2VRG A;  3KHE A;  3WNX B;  1MUX A;  1SR6 C;  4M2P A;  3SG7 A;  2Y4Q A;  1OQP A;  1FI5 A;  3FIA A;  4C0K A;  3I5G B;  2PSR A;  1BLQ A;  3DVE A;  1A4P A;  1F70 A;  3EKH A;  2F8P A;  1H8B A;  1SBJ A;  1CDN A;  1CDM A;  3EVR A;  4C0J A;  1LVC D;  5I2Q A;  2JU0 A;  2JNX A;  2SAS A;  4CPV A;  1ZAC A;  3IF7 A;  1NX2 A;  2JQ6 A;  1GGW A;  1S5G Y;  4ETO A;  1UHH A;  1CM1 A;  3KO0 A;  2M29 A;  3MSE B;  1JSA A;  3GK1 A;  1JF0 A;  3O6B A;  1BR4 B;  4QJ3 B;  1KWO B;  3CR5 X;  2EC6 B;  4P2Y B;  4YRU A;  4DUQ A;  5ER5 A;  1QAS A;  2G9B A;  4MLW A;  2L4H A;  1D1O A;  2KAY A;  1Y6W A;  3FWC A;  2RGI A;  1KQV A;  4USL A;  1BG1 A;  4GNK B;  2L50 A;  1K2H A;  1Y1U A;  2H61 C;  2JXC A;  1UHK A;  3TUY C;  1EG4 A;  2MJW B;  5CSJ A;  4N1G A;  1L2O C;  1BMO A;  2OS8 B;  1CFC A;  2PAL A;  2L51 A;  3BYA A;  4L9M A;  1NIW A;  5FYX A;  1YUU A;  3BQ3 A;  4FTG A;  2WND A;  1TIZ A;  2I2R E;  3RLZ A;  1TOP A;  2ISD A;  1BU3 A;  1MXE A;  3H4S E;  1NWD A;  1IH0 A;  1HQV A;  2QAC A;  3VRR A;  4YI9 A;  3I5F C;  3F45 A;  1NCZ A;  1AHR A;  1RRO A;  2TN4 A;  5I8N A;  2A4J A;  1LXF C;  2F3Y A;  1K90 D;  1XK4 A;  2F33 A;  4OCI A;  3HX4 A;  1RTP 1;  2F2O A;  3ZNI A;  1IQ3 A;  4YGD B;  1CMG A;  1QTX A;  1N2D A;  1QX2 A;  5K89 A;  1KFU L;  4PE0 A;  1B7T Y;  4AQJ A;  3IQO A;  1RJV A;  2M97 A;  4CLN A;  1KK8 B;  2MRD A;  1WRK A;  2I7A A;  1W7I B;  1QV0 A;  2KFG A;  3IQQ A;  3BUX B;  1CKK A;  1OSA A;  2CTN A;  1S6I A;  2PMY A;  2LHL A;  4PHN A;  5HKY A;  1B4C A;  2M7L A;  1XFZ O;  1SR6 B;  2JUL A;  2OPO A;  1AP4 A;  1CLL A;  1GQM A;  2ZNE A;  1XFY O;  2MLF C;  3NSL A;  2KI6 D;  1QIV A;  3A4U B;  1CM4 A;  1VRK A;  4JWQ A;  1DMO A;  3SJS A;  1LA3 A;  2JTZ A;  1X02 A;  2OS8 C;  1YR5 A;  1JF2 A;  2LNK A;  4M2O A;  2LM5 A;  1HT9 A;  2PVB A;  1Y1X A;  3AKA A;  3CWG A;  3CZT X;  1CFF A;  1CLM A;  3OX6 A;  1B8R A;  1L7Z A;  1XO5 A;  5JOL A;  2BKH B;  2AUC A;  2GGZ A;  1SW8 A;  1WDC C;  4NQG A;  4PE1 A;  2NLN A;  1RK9 A;  4WRI A;  5HLO A;  4BY5 A;  1TN4 A;  1OMR A;  2CCM A;  2LAP A;  3GK4 X;  5AER A;  2AMI A;  4OR9 B;  2E30 A;  4E68 A;  2G2B A;  2L5X B;  3AAJ A;  4WQ2 A;  3NSI A;  3PSR A;  4PHK A;  3LK1 A;  1NX3 A;  2JT0 A;  1ALV A;  2LVK A;  3LCP C;  1QX5 B;  3RM1 A;  1S36 A;  2BE4 A;  3BOW B;  2L0P A;  1F4O A;  2CT9 A;  2FOT A;  1PAL A;  1V1F A;  2L98 A;  2M0R A;  1EH2 A;  3LK0 A;  1A29 A;  4GFT A;  1TTX A;  1WY9 A;  2BL0 C;  1IQ5 A;  3TUY B;  3QRX A;  1IWQ A;  1B47 A;  1RFJ A;  3EK4 A;  1S6J A;  2B1U A;  1ALW A;  1OZO A;  1L2O B;  2ZN8 A;  1AK8 A;  1JUO A;  4CID A;  1WLM A;  3I5H C;  3JTD C;  1PRW A;  2O5G A;  1F4Q A;  1TNQ A;  2BBN A;  1BR1 B;  1F71 A;  4M2Q A;  2CXJ A;  1XFX O;  4A4C A;  1C7V A;  1F55 A;  2D8N A;  2FCD A;  1K93 D;  2LVJ A;  1J1D A;  2K2A A;  2NCP A;  1JC2 A;  1KFU S;  2KFH A;  2KBM A;  3I5F B;  3D0Y B;  2ZRS A;  1DJG A;  1IGV A;  1K9K A;  5KSZ A;  1IG5 A;  1A75 A;  1NPQ A;  3PFV A;  5D69 A;  3BUO B;  1KK7 Y;  1Y1A A;  2KQ6 A;  1A2X A;  4XJK B;  1FI6 A;  3SG5 A;  1UHJ A;  3NXA A;  1XFW O;  1EL4 A;  2PRU A;  2Y1M A;  3JVT B;  1XYD A;  4OKH A;  1AJ4 A;  3O2P A;  2KI6 C;  2MAZ A;  1MQ1 A;  1XFV O;  2WCB A;  4HRG A;  4JPZ B;  2JWW A;  2OTG C;  1DF0 B;  1MWN A;  2LMT A;  3OHM B;  5AFP A;  3SG6 A;  1IKU A;  2LVV A;  1SL9 A;  1DGU A;  1V1G A;  4YGB B;  3WXA A;  1SCM C;  1MR8 A;  2GV5 A;  3PN7 C;  4MZJ A;  4YGA A;  1BOC A;  3I5I B;  2I18 A;  1SK6 D;  2KBI A;  3VRP A;  1DJZ A;  1IJ6 A;  4MBE A;  4WQ3 A;  2EGD A;  1K9P A;  3EK7 A;  2EHB A;  2QPT A;  5I2L A;  4DIR A;  3BUM B;  1LA0 A;  4GGF A;  1PSB A;  1PUL A;  1R6P A;  1DF0 A;  1SL8 A;  2HPS A;  2I94 A;  2K8M B;  4MN0 A;  1E8A A;  2ZRT A;  2KDH A;  2M1U A;  2Q91 A;  2BBM A;  1WDC B;  4P5O E;  1K95 A;  3OP0 A;  4MRX A;  1EJ3 A;  1NX1 A;  1JFJ A;  2KSP A;  1KFX L;  2LMV A;  2HQ8 A;  1DTL A;  2M8U A;  4NDB A;  2LUX A;  2K7D A;  5DKQ A;  2KAX A;  1SY9 A;  2F3Z A;  3CR2 A;  1FW4 A;  4PAL A;  4Q04 A;  1B8C A;  4YGE B;  5DKR A;  1BJF A;  1DT7 B;  1K8U A;  1J7R A;  1WRL A;  3JVT C;  4HSZ A;  3EK8 A;  5GQQ C;  2LMU A;  2BL0 B;  1U5I B;  4GPL B;  1M31 A;  1CMF A;  1CNP A;  1YUR A;  3TDZ A;  2JPT A;  4DRW A;  2KYF A;  3K21 A;  3FS7 A;  1DJW A;  3PAT A;  4JQ0 D;  1H4B A;  4ZCU A;  1K96 A;  5TNC A;  3PAL A;  4F0Z B;  3I5H B;  1KQM C;  1S1E A;  1QXP A;  5I2O A;  2M49 B;  3JTD B;  3VRO A;  2L4I A;  2BEC A;  5HYD A;  1LIN A;  3VGO A;  1SPY A;  4BY4 A;  1CDL A;  1YRT B;  4UPG A;  3I5I C;  2ZKM X;  4PE4 A;  1MF8 B;  1CB1 A;  1OZS A;  4PDZ A;  1R2U A;  1ZMZ A;  3EVU A;  2DOQ A;  4PE7 A;  1IJ5 A;  2JC2 A;  3GOF A;  1J7P A;  1CLB A;  3OB1 B;  5AEQ A;  4C0L A;  1OOJ A;  2KOT A;  3TS5 C;  1J1E A;  3DVK A;  1RWY A;  3AKB A;  1TNW A;  2M9G A;  1B8L A;  2PAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...