1DELA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp and amp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
241
Chain Sequence
MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Phosphotransferase
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
total genus 85
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1delA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1delA01
2NO7A 5FOVA 5CDFA 3RRZA 4IOLA 4LHYA 4DLWA 2X2EA 3FHCB 3TUJC 3GEEA 1N0VC 1BIFA 4F91B 2YV5A 1BS1A 2YC2C 4HAUA 5IDVA 3UMFA 4RZUA 3C15C 1CLUA 4CF7A 3MWYW 1GNPA 2P65A 5FOXA 4M1KA 3WYAA 3AVQA 1E79A 2DR3A 2OO7A 2VHCA 4UXHA 4DDVA 4JLOA 4MRSA 4Q4HA 1YRBA 1T4GA 2J7PA 5FTKA 1MABA 3K70C 4C2TA 2IS6A 2V7QA 4QBGB 1Q20A 2X1VA 3LVRE 3WMGA 3A4MA 1OXVA 1AM4D 4RD4A 1Q0UA 3NBFA 1N25A 2XZLA 5HTKA 4FMDB 4X8OA 2MSDB 1B0UA 4KHZA 4JSTA 1XD2A 5CYOA 4TZ6A 1GAJA 5H1YA 3B9PA 4PTLA 3O47A 4PC7A 1IXSB 4Q1BA 1SXJB 3KB2A 3ZJYA 1XJQA 5LDDC 3ADDA 2VHQA 5IK2A 1NN5A 1XPOA 2QP3A 4Q9KA 2ZITA 1F6BA 4BQSA 3THXA 2O8EA 1OB5A 1KZ7B 3NBYC 3SZRA 4HI0E 1NMZA 2ZRBA 2D7CA 2JJ1A 3MWJA 1G4UR 3TNFA 2B92A 2OV2A 2P6UA 3TUZC 3GLFE 2WOJA 4LHWA 2XXAA 1Q1EA 1FTSA 1UEIA 3UXMA 3UG6A 3D7MA 4KYIB 3DM5A 1E98A 3VKHA 2WIAA 3G5UA 4C0AC 4I1SA 1WBDA 2XOKD 4D26A 1NVWQ 3ZVNA 2AD5A 4ZIRA 3AF3A 1R0ZA 4YMWA 1E9CA 3KUDA 1OB2A 2GAAA 2J87A 1FMJA 4P33A 3SYNA 1JAHA 3MWLA 1EGAA 4B74A 1CRQA 4C0JA 3R9IA 4BLRA 1QDEA 4L9WA 2P6RA 1DVRA 3TKLA 4ZCMA 3UWOA 3REFA 4ZV4A 3WNCA 2RCNA 3QPWA 3ICQB 3Q5EA 1E2IA 1Z6TA 2G77B 4YXWA 3TIFA 2A78A 1U8AA 2ANCA 1KJWA 1WF3A 5P21A 5H70A 4JVSB 1EX6A 2Z0MA 3GLHE 1ZNXA 4UNPA 3HPQA 4LHXA 2B8WA 2BKEA 1E2KA 4NL4H 1OXUA 3K0CA 3LVQE 1AIPA 3CW2A 2C78A 4XH9B 1OW3B 2WSMA 2HEIA 3T06B 5GJBA 1UDWA 3VNVA 4B3CA 5K8IA 4R9UC 5DHFA 2YWGA 5J40A 5JWOA 1Z6AA 3ZIAD 4P4SA 4H1UA 4U5XA 4RZXA 3MG9A 2JLZA 4M9XA 1RPZA 3D31A 3NEJA 5TB5A 3U7FB 1RW4A 5EE1A 4LYFA 1UM8A 3IDQA 2NTYC 2JLUA 4HLQB 4OHXA 1DAMA 3FKQA 4RD3A 1HA3A 3SC3A 1M1YE 2BEJA 4OQNA 3MGCA 4QNMA 1MT0A 1VHLA 4X8LA 1VCOA 3VKWA 1RC8A 2VL7A 4GSYA 2JLVA 3RRMA 4DHEA 2C9CA 1YRAA 4PXAA 2GCNA 4KV9A 1I2MA 1VG0B 2ZRJA 4DDWA 4RFVA 3K1JA 3HU1A 1XTQA 1OH5A 3N70A 4KSCA 3VU9B 4GPTA 2QBYA 2CHGA 2NIPA 2GF9A 4ZI3A 2VLIA 1XX6A 1WRBA 4NBSA 1NN0A 4BLPA 3AVTA 3IO3A 3MAAC 2IA5A 2CL6X 2ZUDA 3DOFA 2OCBA 2WWFA 2ERXA 3D6TB 1N6OA 2VYFA 1W2GA 1Z0JA 5A0FA 5HR5A 1EWQA 2OBNA 3NC0C 4C3ZA 1VYUA 2P2LA 4KO8A 4MYTA 3FB4A 1KNXA 3JVVA 1TNDA 1LNZA 3GFTA 2GXQA 3VR1A 1ELOA 4TLDA 4W7SA 3BXZA 4AKGA 2HF8A 4DSNA 2IYVA 3KXKA 4K8OA 4TLEA 4LV5B 1E2PA 5KTYA 1RE0A 2HJVA 1OT3A 3W6NA 1S1CA 1TQ6A 4R71A 4B75A 2PJZA 1D2MA 4ARZB 2QTFA 1QHIA 1G17A 2Z4SA 5EE9A 4GDFA 2F43A 1ZUHA 2RAPA 3QVVA 5JS8A 3UANA 3RHFA 1OXXK 3SJAA 3CH4B 5IF9A 1CS4C 2AWOA 2P5TB 1CJKC 3PUWA 4LJYA 3EPLA 4TL9A 1P4SA 3EXAA 3GLGA 1UKZA 3K8YA 1OYYA 3KX2A 1Z0KA 3FGNA 3TGPA 2WJGA 3DDCA 3H1TA 4JLPA 3TBKA 1J90A 4XTRA 5FTMA 4TT3A 3ZZUA 4BLTA 4LJ8A 2OZEA 4R2IA 1N5IA 1KAOA 1AK2A 1RYHA 1OIWA 1UDXA 4XVQA 1R0XA 3KQNA 3SFZA 1U0LA 1NI3A 5AJZA 2REXB 2W0SA 3AF2A 4L16A 4WZBE 1OSNA 1TTTA 1IN6A 3ZVLA 1MO3A 1E99A 4M1OA 2KI5A 1KI6A 1XP8A 1VG1A 2PCLA 1YR9A 1RVDA 1UJ2A 4A0GA 1KGDA 4LBVA 3SHFA 2RGNC 3U61B 4A36A 3TUIC 4CGZA 1KDOA 3F3YA 3OFNA 3FMFA 3E5HA 1YR6A 2X8AA 4ASUD 1YZNA 1FL9A 3THWA 2ZUCA 3EZ6A 1GZSA 3CZPA 3SNHA 2J1LA 3TSWA 5JSZA 2RKOA 4AYTA 1E1RA 1T9HA 2VP4A 5KOYA 1W4CA 4JLMA 1HV8A 1S2MA 3FYHA 1F5NA 3LX5A 1QHNA 3BJIC 1F2TB 4RFSA 3THYB 2YINC 4XJXA 3GJXC 1NJFA 4ZDIA 3PFIA 1UADA 2K5UA 2N42A 4XVRA 3ZGXA 2FE4A 4TYPA 1W44A 2ZREA 1XEXB 2W6ID 1TEXA 4M0LA 4W5HA 2XTZA 3M0EA 2GILA 1U94A 2Q3FA 3IBYA 4B2IA 1JJ7A 3BRWD 4TMTA 4NYIQ 4TZ0A 1LV7A 1HQYE 3H0KA 3QKUA 4NZYA 3GJ4A 2QA5A 4AG6A 4EPVA 4Z8XA 1XRJA 2FSHA 2HXSA 1N6NA 5J4LA 1XB2A 4G0NA 4M22A 1KO1A 4BZPA 5EZ6B 1ZNZA 4NDZA 1P2SA 1AS2A 3PUZA 2XTMA 1U9IC 2J46A 1GRRA 2WICA 1VDZA 3JZAA 2IUSA 4JJKA 1ZD1A 1DG1G 1DS6A 1G3IA 3H86A 4LJAA 3ZLJA 3EWAA 3GCGA 3QPVA 4JBWA 4KVAA 5CB8A 3QKTA 4TYYA 2O8BB 3BB3A 5JBQA 2MMCA 4BFZA 3QXSA 4NMMA 1AKYA 5CJPA 3ADKA 4POAA 2OT3B 2CMKA 2HT1A 1H8EA 3QEJA 1S1MA 5J4KA 3CF6R 3OEHD 4Z8YA 3PUYA 1XNJA 4Q4JB 2BCJQ 2CCGA 5FI1B 3K9NA 5B30A 3BK7A 3CX6A 3I1FA 4B48A 5IT5A 3VX4A 4F4IA 4CEHB 4C0KA 3A1SA 3BE4A 1T8TA 2OLKA 1JXMA 3IO5A 4MUAA 2HDNB 5B64A 2WWIA 3AVYA 2PLRA 4LCBA 4YMUA 3GLFB 2BMEA 4IDHA 2OG2A 2GXSA 4AC9A 4IOMA 1R4AA 5E7IA 4KXFB 4QGHA 1R5OA 1XMVA 3T35A 1E9SA 1PUIA 1R2QA 1W5SA 5KNDA 2IWHA 2XOKA 3VMFA 2NZ8A 821PA 3CX7A 2G0TA 1Z6GA 4RY2A 2IYWA 4E03A 2LKCA 2DFLA 2EFHB 4AKEA 3KFXA 3U6BA 2CCKA 4DWJA 3A6PC 2VTKA 1MKYA 1IY2A 3THOA 2DFTA 1L4YA 4Q9LA 1GNQA 2HUPA 2FPMA 2WTUA 1FNNA 2QMEA 4WVFA 3EZ2A 4U02A 2VO1A 5BQ5A 3JZMA 2FX3A 3N2EA 1RRPA 4AK9A 4DCSA 4OI4A 1SGWA 4BFSA 1T0HB 2MMGA 1U2RA 1W46A 2QGZA 2ZYUX 4IFBA 4TYQA 4M1SA 1P60A 4HB4A 4DC9A 1EFTA 5FPSA 3B1XA 1ANKA 2GZAA 3BERA 4ZKDA 4PC6A 1CJVC 1JXOA 3AF1A 4M8NE 3UG7A 1U98A 5J47A 4KAXA 1F2UB 1DPFA 2C9OA 2V1UA 1T0JB 1WCV1 4IVPA 4YDSA 5F98A 2VBCA 1T91A 2CVHA 1Q44A 2SHKA 3KKPA 2AX4A 2IWRA 1US8A 4B32A 2H18A 4NPHA 1BKDR 3R7WA 1XCPA 4DVGA 1CKEA 3TSZA 1E9FA 4KITB 1G9XA 3KTAB 4GOKA 3PQCA 2AKYA 4D4JA 3CIOA 3CR7A 4OHWA 1IBRA 2ZJBA 1AKEA 1AQUA 2IL1A 3I61A 1SVSA 1OH6A 2DCUA 1AN0A 3NBZC 1G7RA 2QENA 4G5OA 4RSGA 5E95A 4OHVA 4B73A 4DZZA 4ZKEA 3B7GA 2ZI5A 1U0HC 5FR1A 2ZSAA 1NF3A 3OF5A 4NYIR 4TMZA 1E4VA 4Q7JB 3B85A 5EP1A 4IHQA 2ZVQX 3OIUA 3RS4A 4B44A 2PL3A 4JIMA 4AIIA 1YZTA 4IRUB 3I5XA 1VTKA 3LBHA 2ZRMA 4CEIB 4OK6A 4W9MC 3EZ9A 3AP3A 4H1VA 1KO5A 3KDSE 3L0SA 4Q02A 1NMYA 3A36A 2RGDA 1NBME 4LPKA 3MLEA 1HYQA 5FPTA 3C5CA 2BM0A 4HLDA 1Z2AA 3ASYA 2HLDD 5FI0B 3T5DA 1CTQA 1OPXA 3KXIA 1W2HA 3CWZA 2Z4RA 4NH0A 2VQSA 2ZJ2A 3CRRA 5JEDA 1G8YA 4MYHA 4PO8A 1N6KA 1ZW6A 2VF7A 3VX3A 2O8DB 2VRWA 1E69A 1OIXA 3REGA 5E7MA 3DZ8A 2GK7A 1ZD9A 3CPEA 3LNCA 2J0UA 2ZI7A 5BXQC 1JECA 2QI9C 3P4XA 3P26A 1E9BA 3AKYA 5TDHA 1UBEA 5FOUA 2BCGY 4OYHA 3KL4A 1E2EA 1UBFA 2ZSFA 1H65A 1SQ5A 5EP2A 2GK6A 4QBHA 3GLHA 1PLLA 4QGGA 2PLFA 4B35A 2WWWA 4LJ9A 1KK3A 2I3BA 2G3YA 2KBEA 3IILA 4NU0A 1KIMA 4LWZA 1IONA 1KDTA 3K0AA 4NYJQ 4Q1FA 3RYTC 3FPAA 3W5JA 1U90A 2QEQA 2QMOA 3RS5A 5D3MA 3N5CA 4GZMA 2HF9A 1Z5ZA 4PO9A 1KZGB 1P5ZB 3QF4B 3Q72A 3E1SA 3UPUA 4KLZA 3LQRA 2R65A 2YJTD 4PZZA 3W8RA 5BN3A 4B3BA 4EAQA 2F6RA 2LCFA 2LKDA 4IW3B 4EUNA 5CYPA 5H8WA 1A82A 1ZC4A 2XZOA 2CHQA 2KWIA 2DWPA 1A7JA 3CM0A 2QZ4A 4XIGS 4BUJA 4O3MA 3W3AA 4QJ3A 3GLIB 4A1FA 4P4UA 4GI7A 2GJAA 3IQWA 3GMTA 3AP2A 1KDPA 4HUQA 5TMPA 1KOFA 3L2OB 3I72A 3RS3A 3KQLA 2IYUA 2ZSDA 1ZCAA 2BBSA 2OBLA 2CJWB 4XSHA 4XWOA 2QUZA 2B21A 3DL0A 5HCIA 4IXMA 3I32A 1WMSA 3RRYA 3GLIE 3U5ZB 5JECA 1N6LA 4B33A 4QC2A 2WWGA 2BMJA 3FFAA 3UKDA 1BOFA 1TADA 1P9NA 2G9NA 2A3RA 3M1IA 2H92A 2ORVA 2XJ9A 2ZRHA 4LBWA 4HDCA 4FIDA 2YOHA 3MRSA 3WHKA 4C0SA 2ORWA 1NMXA 1DBSA 521PA 3W8NA 1FW6A 1OF1A 1WP9A 4BLSA 1M7HA 1DO0A 1W1WA 3KJGA 1ODFA 2QE7D 4TQAA 5E4FA 1CBUA 1NSFA 3LAWA 4MYUA 3SQXA 1OHHA 1GRQA 1CP2A 4UJ5A 4JYBA 1NLYA 2W83A 3BOSA 4B6FA 2GXAA 1ZCBA 5FPKA 1KI3A 4EPWA 5JFGA 4A9AA 3W5IA 5FH9A 4RCYA 1MH1A 4AI6A 3GJ5A 4A2QA 4WXRA 5ANRB 1XTRA 1FQJA 1Z83A 1ESNA 2W00A 5DI3A 2R6DA 3ADBA 4MGIR 4PPGA 1M6NA 1ZYUA 1Z3IX 4P31A 4P32A 3VR3A 2D74A 3VHXA 4BZXA 4DLSA 1HURA 1NG9A 1DADA 3NXSA 3FKSA 1GILA 4LJ5A 4D4KA 4C4PA 1E1RD 3QBVA 4QJ5A 4CT5A 4IVRA 1TF2A 4NYMR 4Q21A 3X1ZA 4CIDA 2YOFA 1GL6A 4NCJA 1XTKA 4YC7A 5TV2A 3ZIAA 4Q66C 4EFLA 1RIFA 1TQDA 4A6XA 2ZR9A 4D25A 4FINA 4QGFA 5C18A 3EIEA 2FJUA 2HCBA 2O8FA 1QVRA 4RJLA 3PVSA 1CJTC 1W36B 3BIFA 4R7ZA 2DY1A 2W2TA 3GQBA 3L8YA 2ZRAA 4I99A 5KPDA 3IUYA 3MSXA 2HXYA 1BYIA 2RGGA 2D2EA 1IN5A 1Q22A 421PA 1Z8FA 4YLGA 3ZD7A 1E96A 3LBNA 2OSBA 1FX0A 3E2IA 3CRW1 1FUUA 1DOAA 121PA 3RLFA 4V02A 3AVXA 2AFIE 2BEKA 5FBQB 3RS0A 5CM8B 4YXWD 3QI2A 1SXJE 1Y63A 2WPDD 1G8HA 3IIMA 4R98A 2HCJB 1NIPA 1OKKA 1MRNA 4Q7KA 1YZUA 3TJZA 3QQ5A 4EPXA 1II8A 3FHOA 1FQKA 3L0PA 4DT1A 3J81k 4LHVA 4PPFA 1Z0AA 5AUQA 2QP9X 2WOOA 3X1XA 4B3FX 3KKNA 2JLXA 5EJEA 1T3SA 3EC2A 3BFXA 4JLDA 3WHLA 4ACBA 1T5LA 2Q0HA 3VQTA 5JCZA 4ERNA 2JCSA 3EPKA 2A5GA 1ZNWA 3U3RA 1LW7A 2OCYC 5G40A 3ZZTA 1M8PA 4BFUA 5KNCA 4HSEA 4ZCIA 3LLUA 4DCUA 1OJLA 3T1TA 5JJLA 3EZFA 3B78A 4HATA 2WJYA 4YQFA 4LRWA 1IXZA 3OEEA 1G3QA 4OQMA 2JJ2A 3FMIA 2G88A 3TE6A 4A8JA 5E3HA 3PEWA 3U7EB 2GRJA 2Q9BA 1KAGA 3IEVA 3B82A 2WWHA 2ZE6A 3GEHA 1LF0A 1Z6XA 3B5JA 3MJRA 1ZM3A 1NVXQ 3OZXA 1R6BX 1Z0FA 2XJ4A 4XD7D 4TYWA 3RC8A 3U3KA 2EU8A 1R8QA 3TW8B 4NCKA 3IPXA 1UEJA 4Q4AA 5IHPA 3G82C 1SHKA 4QBIA 2REBA 1K8RA 2AHOA 3GJ8A 3A1TA 2L0XA 4OJKA 1W4AA 3VHLB 1OFIA 3V9PA 2IXFA 4L8GA 1GVNB 2ZXUA 1Z22A 4C0LA 3CH5A 5E7JA 4QGAA 2BM1A 3Q9LA 2QMUA 5FUVA 1Z0IA 4ESHA 3KQHA 4L15A 4DIDA 1LY1A 2IT1A 5F9FA 1DAHA 3PIRA 1E9RA 2C9YA 4MH0R 2IYZA 5L3QA 1Z47A 4FMCF 4LY6A 1OV4A 3BB1A 2Z5FA 3IIKA 2GEUA 2VP6A 2CLSA 5A5GA 2EQBA 3QKSB 2HLDA 3AVPA 4ACAA 1KSHA 3KKMA 3BH7A 3UMRA 3NHBA 4GZLA 1KO4A 1VMAA 2O8CB 1XTJA 1MO6A 1X6VA 3CRMA 4MUBA 1YKSA 2WAXA 1ZBDA 3E70C 3AEZA 3RWMB 5L3SA 4X8MA 1S0UA 3K9HA 4YONB 4I1UA 2GESA 2FEOA 4Y0VA 5BW8A 4DLXA 4EFMA 5JEEA 1VCIA 2GZHA 4LV8B 2XTNA 1IN7A 4FI3C 2QPTA 4JVNA 2ONJA 3AVWA 1AGRA 2YNMA 1IN8A 3HR7A 2QSZA 3IPYA 4FN5A 4BRWA 5DLQC 1E2NA 4GBMA 1G6OA 1G8FA 4IKEA 4PHFA 1SVOA 4WZAE 5B58C 3C41J 3I92A 3ADCA 4UNRA 1KKMA 4JL6A 5SZKB 1GTVA 3SBDA 4ITRC 1E2GA 1G6HA 2RGNA 2ZSEA 3PUXA 2IXGA 4R2HA 5KDLA 5DSZA 1UF9A 1SKYB 1YZQA 5CK4A 3RNLA 3HPRA 3BD9A 3RWOA 4B2PA 3B1ZA 2A7QA 1IY1A 2RB4A 4Q00A 2PH1A 1R0YA 3A4NA 1HH4A 4TL8A 4XTCS 4URXR 2F1JA 2IHYA 1E2FA 1VIYA 2QNRA 4GOXA 1YU9A 4JLJA 4EQ6B 5JLJA 3BAFA 5C4GB 1UAAA 4HB3A 1OFHA 5K8TA 5J4HA 3SBEA 1ZM2A 1PLKA 2AR7A 4JZKA 1AJEA 4FMBB 4URUR 2G1KA 2QSYA 3B1VA 3GPLA 4DB2A 3BH0A 3WYFA 3B6EA 4EPRA 5HZKA 2ZJAA 2R6FA 1VG9B 4RKFA 1JBKA 3BGWA 1XEFA 1GRNA 3U44A 4UNQA 1AZTA 1XD2B 3K0EA 3AVOA 4IJMA 3SR0A 3K53A 3I5YA 1NKTA 4TQ9A 3PR1A 1PV4A 5DNYB 2NZJA 4URYR 1UKVY 1XD8A 1SXJA 4KBFA 5GJCA 4F93B 4HAVA 4PO1A 5AJYA 1CULC 4MKHA 3QXXA 3VFDA 5F9HA 1WDTA 3IHWA 2EFDB 3N2IA 4P4TA 3WYGA 5JHHB 1ZM9A 2O8EB 1SHZA 3V00A 4PAOA 5KSYA 1VCNA 3HP1A 1CEEA 1M2OB 3LDAA 5EXPA 3FWYA 3BFKA 1J70A 1XPRA 1N5JA 4D82A 4XVUA 3AUXA 3QKRB 2JLRA 2ANBA 1D2NA 4FMDF 2V7QD 1QHSA 1XD9A 5DHAA 4B3DA 4EPTA 3C8UA 4RD1A 2CDNA 3CPJB 2ZIAA 1NL3A 3I62A 1CJUC 4HB0A 5FBLB 3ZVMA 4E07A 2YHSA 4DDUA 1GL9B 1B23P 2QAGC 3HU3A 4LOAA 1RKBA 2ASEA 2GJ9A 1Z63A 1TMKA 1G7CA 3GJ0A 5KYKA 1QHHB 2C2HA 3QOFA 2JLYA 3PUVA 2X19A 3U4QB 3K70B 4M9QA 1E94E 2QQ0A 4FWTA 5CIWA 2ZYVX 4LJ6A 4Q1DA 1XZQA 2FSIA 4IDOA 2QORA 3WNDA 2ZM5A 2JJ1D 1G8GA 1P3JA 1OIVA 3MFYA 3DPUA 2ZYWX 1KYIA 3P1JA 2FZLA 3SYKA 1NG1A 1HE1C 3FKSD 1ZMXA 3LXRA 4JL8A 2UZIR 3NG1A 3NDPA 3GP8A 2XZPA 1L7VC 5KDOA 1E0JA 3V4FA 4U7DA 1XXHA 1XJCA 4JVLA 4O2RA 2RGCA 4B6EA 5JJKA 1P7CA 2CLCX 1DTSA 3L0OA 4X8HA 2C03A 2W2VA 1X8LA 4L4UA 4BFYA 1J8MF 1D9ZA 3DZDA 3U3MA 3TSOA 3CNNA 2NPIA 1GDDA 1SZPA 5CK5A 1EFUA 4KJZA 4WXPA 1X8KA 3TH5A 3PJRA 2NO6A 3AKDA 2IF0A 3LV8A 4HLCA 5KO2A 1DEKA 3MJHA 2BV3A 2PT5A 1GKIA 4OQLA 2FNAA 2HV8A 1P6XA 2PBRA 2ZS7A 4FXPA 3C7KA 2Z6VA 3BB4A 4LV6A 2C5LA 1NY5A 1K5DA 4FD2A 4NKRA 3OFND 5G3YA 2FF7A 2V54A 2IHBA 4FCTA 2DYKA 3W6PA 2QBYB 4ASUA 5AWFC 2QROA 3IQXA 4TLBA 1KMHA 2FSGA 1WXQA 5A4JA 1JALA 2W58A 2GVDC 4MKIA 2WHXA 3GLGE 5B2ZA 2FV8A 4WOPA 1GM5A 4S35A 1BMFD 5SZHB 1W4RA 2D06A 3B9QA 2R8RA 1QHYA 5DH9A 4Q47A 4F92B 3KJEA 3VR5A 4KU4A 4LGMA 2YWEA 2WM9B 5J5CA 2V9PA 2F3TA 4US1R 4HAWA 1SVLA 1YHNA 2NO9A 4Q1AA 1BH2A 2BBOA 1G7TA 1E9AA 2DFNA 2D62A 3L82B 2ERYA 4Q7LA 2JASA 5FOTA 3U7GA 2WV9A 4ARZA 2FSFA 5TVKA 4RD6A 4C7OA 2AKAB 3ZH9B 2CE2X 2R2AA 2CLDX 2IEZA 2OM2A 2W6JD 3CF2A 2YKGA 1U8ZA 3KKOA 4QL3A 4KODA 2OFOA 2GEVA 1G16A 1L8QA 2ZAOA 4M1TA 4B71A 1SVWA 2EFEB 1OHHD 2VSOA 1AZSC 2WZQA 2Z83A 4Q01A 1XPUA 1G41A 1Q57A 2FFAA 1P75A 2ODEA 3QXCA 1BMFA 2J45A 2OAP1 1RRFA 4NE2A 3DM9B 2G83A 3P27A 2JJ8A 1FOEB 4HZUA 2GZDA 2DWQA 3NH9A 1GOTA 3A1WA 3CKLA 3AB3A 4RKEA 1IXRC 5HKKA 2OESA 2CL0X 4JLKA 1KI6B 4ABYA 4UNNA 2IUUA 1JI0A 3DEFA 3R9WA 4JLVA 2OEPA 1XEWY 3RDPA 1OXTA 1PZNA 4O0MA 4HDOB 4ILEA 5LB4A 4PFSA 4BFWA 5DN6D 1ESMA 5JI3E 3EPJA 1BYUA 5KSPA 1JAIA 2BBWA 5HE8A 4CZ2A 4TMKA 3X1DA 1XU4A 4WW0A 4A0FA 4F38A 3VTKA 2FZ4A 3RS7A 3THWB 2O52A 4I81A 4PZYA 1G1MA 5HCNA 3RAPR 4DEXA 4QJ4A 2PCJA 3LD9A 3W3ZB 5D3QA 4BEJA 2IUTA 4IFEA 4TLAA 4D0LB 3A58B 2G1JA 3A4LA 4D0GA 2F1RA 721PA 3H2YA 3AVVA 1EFRA 1QZXA 4ZDJA 2GCOB 2ZAMA 4II7A 4NCNA 3FVQA 1XCMA 4DLYA 3QUSA 5BN5A 4PR0A 1CRPA 1W49A 5EP4A 1XEXA 1GSIA 3KZ1E 1TUIA 5LD2C 4B43A 5CB6A 4PPQA 4KFUA 1J2JA 1VYVA 2BJWA 3EPHA 2KJQA 4JBXA 3ZD6A 1RFLA 4NONA 3OAAD 1GNRA 2AK2A 4B47A 4MDEA 2CK3D 4XOIA 2OCAA 1RRCA 2QP4A 1GP2A 2FEMA 4WA7A 4IEEA 3SHWA 5GVRA 1HTWA 1S4QA 1SXJC 2GXUA 4E5UA 1E32A 4BZQA 1T8UA 5DYIA 3AP1A 1DAGA 3K0FB 2X77A 4KCGA 3NIBA 2CBZA 4YMSA 2VHTA 2JEOA 4ON9A 5AJXA 1LFDB 1KDRA 3LXXA 1G5RA 1Q1QA 1R5BA 2UZ3A 4US0R 4OL0A 4URZR 4GFDA 1KSFX 3RABA 4A6PA 3WP0A 1E6CA 1ONBA 2VHJA 4OQFA 5AUNB 3CWQA 4MYCA 5TY0A 1XCGB 1X1RA 4IDQA 3S1AA 1VIAA 1HT2E 5DN6A 2Q9CA 5GJWC 5KSZA 3DOEA 2QAGB 1FTNA 3C5HA 4CEHA 4LX0A 4M1MA 1N6IA 4Y0AA 4Q7MB 4BFTA 2H5EA 4K81B 4L5BA 2D7DA 3PEVA 4XSGA 4DCNA 2IXEA 4XD7A 4AWXA 1JJVA 3KB1A 5CM9C 2WBLC 5FUYA 3UK6A 1S96A 1JEDA 1T3HA 1T6NA 1CF4A 4PZLA 1KSGA 3TR0A 5GJVC 3VNUA 4LYJA 2ZEJA 5TXGA 1E1QD 3HJNA 1ZM4A 2JATA 2ZI4A 4QNRA 3I8XA 4QG7A 1E3MA 2DFKB 2ZRPA 4MITA 3C16C 4DKXA 4MRNA 2QY9A 4PQYA 2IYYA 3ECCA 2W6IA 4EJSB 2QQEA 1XTIA 3CR8A 2FU5C 1LTQA 3UWKA 2QM7A 3TRFA 2H57A 1NN3A 1EWRA 1KK0A 4JMPA 4JS0A 4RZ2A 1ZC3A 4DLZA 4B76A 4BASA 5M04A 3TK1A 4M2LA 1II9A 4NYMQ 1YR7A 4TLCA 4XWAA 5KHOC 4Q1EA 2X2FA 3TW4A 5L8VA 5SZJA 4TTQA 5JI2E 4DBLC 1HQCA 5L3RA 3HWSA 2ZI6A 4S2EA 1UFQA 2QAJA 1F2UA 2IYLD 3D3QA 1Z2CA 3NH6A 1DAFA 1E9EA 3FE2A 2J59A 4Q9HA 4QOSA 2ZJ8A 2JDIA 3TVTA 3K0SA 1ZRHA 4DLVA 4HAZA 3CRVA 1OYWA 1US8B 2R62A 3QEOA 1VCMA 3R7WB 3UIEA 4CEJB 2XITA 1NSTA 3KTAA 5LB2A 2PJRA 3F5FA 4Q5IA 5KDDA 1MO4A 2ZE5A 2ZU6A 3B13B 2QT1A 2JIZA 4LDJA 3QXJA 5DO9A 4HAYA 1IAQA 5CJ2A 2GKSA 1C1YA 1ZIOA 2J9RA 3HYTA 1S9HA 2VP9A 1WA5A 3WRXC 5IRCD 3O8BA 2CEAA 2O0JA 2WVJA 2YVUA 4OHYA 5CITA 3KJHA 4GMDA 5DISB 2BMFA 4UNSA 2W2XA 3NHAA 3DMDA 3DVLA 1N0UA 1P9WA 2NMVA 2GBLC 3VR4A 1DELA 1G3UA 3R8CA 3BBPA 4ZO4A 2CL7X 3CZQA 4HZIA 1P2VA 1KKLA 4V0OA 4EFNA 4Z1MD 4CEIA 2OCPA 1EFHA 3W6OA 3TMKA 1F3OA 3K70D 2PEZA 2ZYTX 3I73A 1Q12A 4DSUA 1GFIA 4CVNA 4PPNA 1RJ9B 4IVQA 2OXRA 2ZRGA 2V55B 4PSVA 4YDHB 5C4MA 5G53C 3A1VA 4TL7A 4UXIA 2RHDA 3EWSA 3EX7C 1GL7A 1V43A 4TQUS 1NRJB 4OI0A 2AWNA 3LQQA 2GEDA 4QM7A 3G0HA 4OI1A 3PXGA 4PQFA 4BFXA 4A2PA 1W7AA 4N0DA 3GFOA 3MCAA 2P6NA 1XBTA 3RSLA 2C96A 1MO5A 3KXLA 4A15A 1P9RA 4Q4HB 1KY2A 2Q21A 3ONWA 4L9SA 1G4AE 1MABB 3RS2A 1DAKA 1W0JD 1R7RA 4LC0A 1Y3AA 1TU3A 1COWD 3IIJA 3GLHB 2GBLA 2ZRNA 2VSXA 1AS0A 3CUEF 3IEUA 2V8OA 3P4YA 4BLQA 4I1OA 2MSEB 2IYTA 4QHTA 3CNOA 1GKUB 4UJ3A 2FG5A 3EA0A 2QN6A 1TL7C 4G5QA 3ZS9A 4MKFA 5D3MB 1JQJC 3HU2A 3L43A 1BO6A 3L0IB 4PAQA 1N5KA 3RANA 2XB4A 4MGZR 4KSBA 5BWMA 3THXB 2KSQA 1FZQA 2EFCB 4IEIA 3H4MA 3GJ7A 2ZRIA 3IBGA 4MRPA 2WWYA 2ZE8A 5C2JB 2J0SA 4CDGA 4RVCA 4LI0A 3ZQ6A 1P61B 3ETLA 4EKDA 2XXAB 2OILA 1ZUNB 4ZI2A 1RZ3A 2C98A 2DPXA 3BORA 4JT4A 5BYJA 4B3GA 3DKVA 3NC1C 4TMWA 4HUQB 2OHFA 1Q1ZA 2YOGA 4XWKA 3P20A 2A2ZA 2WKQA 1EESA 4ZIRB 1S3SA 2CJWA 1GG2A 4K46A 4MRRA 4URWR 3C14C 1JR3E 2RGEA 4URVR 3Q5DA 1CR0A 5DIFA 2N1BA 4V0LA 1YQTA 3QNUA 1IY0A 4A92A 4PX9A 3U6KA 1ZM7A 1II0A 3LRPA 3TAUA 1L2TA 4OKSA 3VAAA 1KI7A 1SKYE 4DLUA 4BEBA 4IOKA 2BMDA 3RSOA 1YZLA 2RGAA 3T1OA 1L4UA 2AK3A 1AA9A 2PZGA 4AYWA 3MWKA 4D80A 1KI1A 3B8HA 3LO5A 1GIAA 4OI2A 2PMKA 2GJSA 1UKYA 5JJIA 2ZE7A 3P32A 1LF5A 4BFVA 3RVBA 1ZD8A 3I8SA 1LVGA 4TT3D 2IS1A 3Q8XB 4J0QA 3B1YA 5K8UA 4LC1A 2F3RA 3GEIA 4DUGD 4KFRA 1XTSA 2D4HA 2ZVPX 2E1RA 4DIEA 3EW9A 1JB1A 1UKEA 1W0KA 1JR3D 5JCPA 5F3WB 3SQWA 1JQLB 2XSZA 4P4SB 1CU1A 3TR5A 1KI8A 2A30A 3LW8A 2ZANA 5H68A 1G3MA 2QRZA 2CK3A 3EIQA 2MSCB 2OFWA 3CO5A 4HLUC 4PHGA 2Q3HA 1ZVQA 2ZR0A 1J8YF 3CNLA 2RHMA 4EDHA 2LWIA 3KQUA 4E22A 3EIHA 3HDTA 2QT0A 1H8HD 5BYKA 1XF9A 3NWJA 5EE0A 4IOJA 2FA9A 5C46F 2JLWA 1XXHE 1YZKA 3LY5A 3OIVA 4GRAA 4TN1A 2O8FB 1GWNA 3VU9A 5CIQA 2R44A 4A4DA 2ZPTX 5FUWA 1CR4A 3W34A 1N3BA 2GVZC 2P3SA 1ZJ6A 2PT7A 1HY3A 3QF7A 1Q1BA 2JLSA 3NEYA 3PEUA 5EUQB 2ODWA 2WJIA 3OEHA 2RMKA 4LK2A 1D2EA 5AK0A 2WWXA 4CRWB 1VYTA 1R0WA 2ZRLA 5FOWA 1ZU5A 4TYNA 3OESA 4AYXA 2BWJA 2ZJ5A 3AH8A 1H8HA 1II8B 3LX8A 5JWHA 2VPPA 1SXJD 2Q3MA 4A0RA 1XMIA 3LLMA 3BH6A 4LPSA 4DT1B 5JZVA 1E1QA 3T12A 2F43B 4KFSA 1Z07A 3EASA 2O5VA 3OEED 3X2SA 3QJYA 4EJSC 4PC3A 1ZP6A 1NN1A 1E2LA 1TUEA 4Q18A 1I2DA 5HPYB 2C95A 5EXXA 3GLGB 2AN9A 4HUTA 2ZS8A 5IK2D 2I1VB 2XSZD 1OFTA 2CCJA 2GNOA 4M1YA 1W0KD 3ND8A 4UXJA 4PHTA 1XDBA 2XAUA 5SZIA 4A8JB 4UKDA 4D2IA 2ZUBA 1KNQA 3PITA 1SVIA 3D8BA 3M6AA 1M74A 2GHIA 1XMSA 5EUMA 1GKYA 3NBXX 4MGYR 1A5TA 2FGJA 3WY9A 2JLQA 2FPKA 4Q48A 3U3OA 1NBMD 4Q4AB 1NP6A 4QHYA 4C2UA 3UMSA 4I1VA 4G3XA 4DSTA 1CR1A 2D3WA 2PX0A 1RYFA 2V4ZA 4V0MA 4GP6A 2W0MA 1KMQA 1W36D 4P3YA 1O3YA 2PZEA 2C8VA 2VSFA 4MDFA 3W9YA 5JSZB 2ZRFA 2F9LA 1HE8B 4G5RA 3QG1A 3CLVA 1V5WA 4RFSB 2IW3A 3THYA 1F2TA 4D4LA 1A4RA 2A5FA 2WJJA 3DMNA 4JT2A 5L3QB 3ZDQA 1G21E 3HYRA 2QRNA 5JS7A 3AF4A 4WAUA 2FFQA 3AQ4A 2YC4C 5BN4A 4V03A 5UKDA 1JR3A 2GA8A 3AF0A 3QKSA 1ETUA 5KPJA 4BPBA 4DUGA 2OXCA 1M34E 1U99A 2WSSA 3KFVA 4PSKA 2ZRCA 2QU8A 1VECA 1PUJA 2D2FA 4G5SA 4TWZA 5FTNA 3IKJA 3WBKA 4A8JC 2OLJA 2VH5R 4M1WA 1QF9A 4DSOA 4IDNA 5KNBA 5HZHA 3X1YA 5GVSA 1K5GA 3SOPA 1QHXA 3WBJA 3U3JA 3BFVA 1YZGA 3ICEA 3SI7A 3WXMA 1NLZA 1TAGA 1TU4A 1F60A 2C99A 3Q7QA 3QY0A 4PC1A 1JR6A 4TMXA 2ATVA 3FMOB 5C1BA 4LYHA 1X86B 3R8FA 2B8TA 3WMFA 1COWA 1NVVR 1XWIA 2H16A 1NJGA 2DBYA 4TSFD 4LHZA 4B2LA 2O8BA 1FP7A 1LS1A 1ZU4A 5FFMA 5HKKD 1CJMA 2IF2A 2J0VA 5DI9A 3K0CC 4MQBA 4DCVA 1X3SA 2QE7A 4QBFA 3EC1A 1J7KA 5FR2A 2YWHA 1T5IA 2OAQ1 4QHSA 1F48A 4Q4JA 5AUPB 3CONA 1OFUX 4FCVA 5KSOA 2FGKA 2BVNA 3AGPA 1QG2A 2UVQA 1PVOA 4O25A 1IQPA 3DO6A 4EQ6A 4MA4A 3SS8A 2V6JA 1G8PA 2EW1A 1VPLA 3AUYA 3SJZA 1X1SA 2GJ8A 2HJGA 3L8ZA 1N0WA 3GLFA 1HT1E 2BBTA 2JA1A 3B60A 3SDZA 1PLJA 1G291 4FMCB 4EPYA 5ELXA 1U8YA 2ODBA 4TTPA 1Z6YA 5FPYA 3EZ7A 2WAYA 4M9SA 3PV0A 1U0JA 3QG5A 2GJKA 3QBTA 3SN6A 3I4LA 5FL3A 2R9VA 4JSYA 2V6IA 3U44B 3FFBA 4AY2A 3TQCA 2H7VA 8OHMA 1IJFA 4JVMA 2ZJOA 4N1AA 2OBMA 4KVGA 4M53A 2NPFA 2R6AA 1YE8A 1QG4A 3AKCA 1QHGA 4EIWA 2PEYA 3FTQA 2FFHA 4JJZA 5EE3A 2A5JA 1C4OA 2J0QA 2XNDA 4US2R 2EWVA 1OH7A 1EXMA 1G5PA 3Q85A 5AR1A 4DCTA 3U7HB 2WSSD 3FOZA 3EG5A 4N0EA 2IYXA 1W5TA 1CR2A 3SJBA 4HB2A 1IN4A 2ECKA 4GP7A 2BIFA 3DKPA 3QKRA 4DRZA 3UATA 4OQXA 2FWRA 2EYQA 2REOA 2ZJYA 3Q3JB 1P73A 4IDPA 2IS4A 2ZI9A 2GETA 4GMXA 4Q9IA 1DAIA 1G20E 1E4YA 2VIIA 3NKVA 4AURA 2ZS9A 2FOLA 3LA6A 5G3ZA 4WBSA 2IS2A 1KO7A 2G6BA 4RZ3A 3B1WA 3ZQJA 2VEDA 3HR8A 1EX7A 1P72A 1JNYA 2ZU0C 1YJ5A 4DXAA 4BLOA 2NGRA 2ZRKA 2N46A 2FDCA 1OE0A 2AFHE 1QHHA 3U4QA 3WRYC 1TPZA 4G01B 2DB3A 4NHOA 2BJVA 4DLTA 3PEYA 2ZETA 1UPTA 4Z1MA 1JEEA 4Z54A 4HAXA 4DJTA 5LD2B 3KJIA 2FMXA 2PMDA 1Z0DA 2HYIC 1KI4A 4M9ZA 3F0TA 3IHLA 4P0TA 1WB9A 1EK0A 4B3XA 1HEIA 1EG7A 1U81A 3I3SR 2EYUA 3MD0A 4NCIA 4MKGA 2NO1A 2JIZD 3LW7A 5L3VA 3PG5A 4U00A 1X8JA 2KBFA 1XXHB 3TQFA 2EWWA 3T1VA 4DDTA 5LPNA 1ZNYA 2NO0A 1KTVA 5EXTA 2WKRA 1NIJA 1D9XA 3A1UA 3AGQA 3A8TA 1Q21A 2IC5A 4HLUA 4YMTA 2AL7A 3KUCA 1J99A 2JAQA 1QBKC 1DO2A 5AJWA 3LWNA 2GDJA 3T34A 2CXXA 621PA 1UBCA 1TF5A 4LSGA 1FUKA 2YWFA 4HYYA 4KFTA 1IM2A 2NOAA 1GUAA 5DE3A 2O8DA 2ZQ5A 3OE7D 2XEXA 1VHTA 4PQRA 2B7BA 1E2MA 4BGDA 5FOSA 5EZ5A 2J0UB 5FBRB 2KB0A 2J7KA 3A37A 2IYRA 5G41A 4V0ME 4C0HA 1D8TA 2O0HA 2TMKA 1K6MA 2IBMA 4O2LA 2XNSA 3K09A 1WQ1R 4YMVA 3BS4A 1A2BA 4MGKR 1PJRA 1IJEA 3QIAA 2EVWX 1KMHB 4LJ4A 4ZPXA 1R5NA 4BRUA 3EAQA 2QPOA 2GCPA 2VP5A 2WMOB 4C9BA 1KY3A 1GITA 3MMPA 2XB2A 4HEJA 4AKIA 4GT1A 3K9LA 3K0AB 3BWDD 5DYGA 1P2TA 4B34A 1SKQA 4A0HA 3K9GA 3ZS8A 2E9SA 3O8CA 4W5JA 3CB4A 3QF4A 3FDIA 3QE0A 4NYJR 3QPUA 4M21A 4E09A 3LH5A 2OFXA 3MUFA 5HE9A 3GJ3A 3DHWC 4D6PA 221PA 2ZR7A 2XX3A 4C30A 2FPLA 2V3CC 1KHTA 2NQ2C 4Z51A 3GLIA 4UQOA 2R6CA 4C7OB 2IYSA 5JRZA 4I4LA 2H8KA 3C4JA 4QXAA 5FL7D 1OLOA 4DLRA 1NKSA 3H84A 3NVAA 4ZDKA 3BC1A 2CE7A 1FP6A 1E0SA 1AS3A 4ESVA 2Y8EA 3T61A 2I1QA 3U2QA 1G64A 2ZJZA 2IX3A 2WIBA 2QG6A 3RRNA 3X1WA 5TARA 2ZSBA 4PAMA 1I4DD 1E2QA 1P2UA 3B2EA 2AXPA 3AV0B 3V4RA 1EFRD 2QGNA 2JGNA 2Z43A 4HZUB 3ND9A 4TTRA 3ZZ0A 4H9GA 1N6RA 3RC3A 4RD2A 1IOZA 3PENA 3SEAA 5KUTA 2F9MA 5JHGB 2GTPA 4LUCA 1OKKD 1H8ED 2QTHA 1JPJA 4NTZA 2H1LA 2PX3A 4TMVA 1AGPA 1SULA 2J5XA 1E2JA 1NNEA 1Z28A 2RGBA 2WKPA 1XJ0A 3WMEA 3VR6A 1DAEA 3QXHA 3SFVA 3JVUA 2ODNA 3OAAA 1KO8A 2V1XA 1E79D 5J4VA 1ZINA 3T1QA 4Q9JA 5FL7A 1UBGA 1E2HA 4LBYA 1N6HA 3R9XA 2HT6A 4WIAA 5FUXA 1AQYA 5CLLA 5FTJA 1XFAA 2QTVB 1MRSA 1TF7A 1KJZA 4CT4B 1XEWX 4DB4A 1W48A 5CDFE 2GF0A 4C0BA 1JPNA 1Q3TA 1KK2A 3EARA 5DI3B 3SYLA 2ATXA 4OBEA 4GL2A 1I4LD 2ZTSA 3OIYA 4Q4LA 4JLNA 2OUKA 2JJ2D 2Q6TA 2GCOA 3TAHA 2E87A 4QKQA 4Q1CA 1C9KA 1ZIPA 2IK8A 2C77A 1VKJA 4AG5A 1N6PA 2I4IA 4PANA 5J4YA 2WJHA 3OIWA 3ZVRA 1G7SA 3TLXA 4CW7A 2O0KA 4N3NA 1FFHA 4V0NA 2P67A 4KLNA 1NLFA 4FCWA 1FMLA 3M4YA 1W47A 5FBVB 2F1IA 2VF8A 4LBZA 4AD8A 1TX4B 3GJ6A 3O8DA 2DWOA 4FWIB 4Q03A 2WPDA 4DEYA 1NY6A 5K8LA 4JKIA 2B6HA 3W90A 2KE5A 3CPHA 2J7PD 4CYMA 2H17A 4V0KA 1KI9A 1OH8A 4LZZA 2GWHA 1CXZA 6Q21A 4KYUA 1E2DA 2BHRA 1N2CE 5CLQA 1MOZA 1NVUQ 1G3RA 4GOJA 4RD0A 1NVVQ 3K0FA 4KI0A 1IHUA 3ZYCA 1D6JA 5GADl 2VHUA 4JBYA 1OXSC 4MRVA 3CF0A 1Q3HA 4W5WA 1FX0B 1S8FA 1U9IA 2F1HA 1SVMA 3TVDA 3NDBB 1DE0A 2F7SA 2OE2A 5EE5B 3OE7A 1XZPA 3WNBA 1XMJA 2YZ2A 4NP6A 4F4CA 5LBIA 2VP2A 3CX8A 4GNKA 2FN4A 3O8RA 4G1UC 2NG1A 2P0EA 1I4TD 1Z06A 2XNDD 3S1AB 1P62B 4HDQB 4PSAA 3R20A 1E0KA 2QAGA 2P5SA 1KSJA 2FFBA 1M7BA 2ONKA 5DGXA 2FH5B 1QVAA 3GD7A 1WE2A 4LJ7A 2QM8A 4M4SA 1R8SA 3SE0A 4BWYA 4A2WA 4RCZA 2W6JA 2VA8A 2QL6A 3FMPB 4NCHA 1WBBA 4JKYA 3VR2A 1O87A 3AM1A 2WMNB 4OJQA 2BOVA 2YYZA 3KQKA 1D5CA 1G19A 2F55A 1G18A 4G5GA 1YVDA 5FTLA 4TL6A 4JYCA 1EFCA 4PHHA 5JRJA 3ASZA 4OK5A 2BKUA 2QMHA 3PCRB 4QRHA 3Q7PA 4D0NA 1E9DA 1YR8A 4LYAA 4F7WA 2G0NA 1SVKA 4BECA 1S9DA 1TQ2A 2CNWD 4EJSA 3T5GA 1MV5A 3GFPA 1KI2A 2B7CA 3EA5A 1W36C 3SJCA 1ZUIA 4KBGA 1VG8A 3KKQA 2EFGA 3WP1B 2JDID 3NTUA 1W0JA 5JMTA 3QSYA 2J41A 1T3LA 2J3EA 1E0AA 5FPHA 1G5TA 4JL5A 3LBIA 4IXNA 4PC2A 2VP0A 2QPAA 4ZCLA 2ZI3A 5AJVB 4WZ6A 2AXNA 2AD1A 2ZROA 2BC9A 4QM6A 1QRAA 4JLAA 3QENA 2CNWA 4FW9A 1Z29A 1W4BA 1Z08A 3CRQA 5KU1A 2UKDA 4TSFA 2RH5A 3QVUA 1FPMA 3K09C 4BE7B 5EQTA 2A5DA 1DG3A 5EP3A 1A2KC 1NBMA 4CEJA 4OK3A 4C0QC 2IYQA 1CIPA 1TQ4A 4Q19A 2O8CA 3AKEA 4D4MA 1KJYA 4JLBA 5F2EA 2CVFA 1N5LA 2ORIA 3CBQA 4A82A 5JWRA 1R10A 5L3SB 3U60B 4AKHA 1LS6A 1DARA 2GAOA 2A5YB 4OHZA 2XGJA 2Q9AA 4D81A 5B57C 3IGFA 3OHMA 2IEYA 2BDTA 2C04A 1FNMA 3FHTA 1KK1A 2HYDA 3AVUA 5EXSA 3F8TA 2WJVA 2PZFA 4QFMA 2DHRA 1RRGA 3LFUA 5FBWB 1ZAKA 1S3GA 1M7GA 1MR3F 4F4JA 1HUQA 2A9KA 3VKGA 3SU8A 1A1VA 5AUOB 2CHVA 2R6GA 1LB1B 2RGXA 1TEVA 2ZRDA 1RJ9A 4ZDWA 3T15A
chains in the Genus database with same CATH superfamily
1U0EA 3BUSA 3PB3A 1UBLS 2D0OB 4IOLA 4LHYA 4UM9B 1AKUA 2E3JA 4DLWA 3GEEA 1CTRA 1FC0A 5AK5A 1QRDA 3LF2A 4OGLA 1E62A 5LA6A 1DI0A 2P7HA 4WBNA 1I3OA 1JH9A 2J4DA 1SL8A 5IDVA 1KWKA 4EYGA 1HYGA 2O5GA 2ZWVA 2PKQP 3KPWA 5LWHA 4P7BA 4BL5A 4BP3A 3U6BA 5IN4A 4Q3KA 4D8TA 3O0DA 3ROEA 3W4JA 1JG1A 3VVBA 4YRMA 1SBYA 2JI4A 2JLBA 3OURA 4V2UA 1IBLB 5G08A 2A9OA 2Q8NA 1YRBA 4C2TA 1BMDA 4UHJA 1MABA 1AQJA 4QBGB 4XYMA 4NENA 1HKHA 3Q8LA 3HKEA 1GN9A 1Q20A 1GEGA 2HF7A 1JWDA 2X1VA 5IBRA 3S8MA 3WMGA 3CVXA 1ZR2A 1JIKA 4XFJA 5AW9A 1K2HA 2E4AA 5HUJA 4WOCA 4E12A 1EK1A 2LVJA 2AOVA 3CGWA 1HX7A 3ZHBA 2BZ1A 3J7TA 1P5RA 1XD2A 1QV9A 3T7RA 1RZRA 3BOWA 3FF4A 1EP3B 3E9EA 3HBJA 4PTLA 1VJGA 4TV9A 3IQIX 3W1WA 4PC7A 4XVCA 4YNBA 3KXDA 4Q1BA 3KB2A 1CUYA 4C22A 5LDDC 3D4OA 1I3CA 3OCVA 5HW0A 3KJZA 3QUTA 1NN5A 4DA6A 1FFEA 4YV1A 5JJCA 1RXIA 1TB4A 1J97A 2B20A 2W2NA 4K6MA 1V0JA 3MMXA 3ZCQA 5F7XA 5JTTA 3DLBA 2NV2B 4RVOA 4BQSA 4OUDB 2G36A 2X86A 4UW9A 3OKCA 3KC2A 2WD9A 3CLSD 4JNKA 1EBUA 1BMTA 1NMZA 1SQGA 2JJ1A 2ZRBA 3MGBA 4ICIA 3TNFA 1X3LA 2VDVE 3WGKA 3D6AA 4Q3BA 4V1CI 4LHWA 5FWDA 5K4GA 3GLFE 3UXMA 1FTSA 5ALMA 4KYIB 4KR9A 4NZOA 1E98A 3VKHA 3ZCXA 1A0OA 3G5UA 1YRTB 3N9IA 2LAPA 3KS9A 2R5NA 4I1SA 4NK5A 1YD7A 4G1VA 2R2IA 1PV2A 2VZ0A 4ZIRA 2PXCA 1R0ZA 3AF3A 4RQBA 3MGGA 4XIIA 1GAQA 3KUDA 3BXEA 3OLCX 2FPRA 2GAAA 4UBLA 1ZOPA 5LDGA 4B6QA 3HCPA 5A06A 3R9IA 2X2PA 4BLRA 3STUA 4DMRA 1QDEA 1T1SA 2FR8C 3MLAA 5ENZA 4D79A 3TKLA 4A26A 4ZCMA 4IR7A 4ZV4A 4QTUB 2UUBB 5DYWA 2GN6A 3WNCA 5MGNA 1OLUB 2CT8A 4UTRA 3SXJA 4BLUA 5B6IA 2G77B 3PNPA 2JH9A 4HO1X 5FNVB 5P21A 5G02A 4EHFA 1FSPA 4MS1A 2LIPA 2ZSIA 3NHMA 3FWBA 2WEKA 4BKOA 1VRWA 4WTOA 4LSWA 5A3QA 1NAHA 2Z0MA 3GLHE 1ZNXA 4UNPA 3HPQA 1G21A 3AM5A 4P2YB 4JFRA 3EXHA 4FGZA 3PC7A 4KGXA 2ZBPA 5MDHA 3LCRA 1TKBA 5JPCA 1XALA 4J8PA 3R5FA 2NZXA 5LJIA 2GPAA 1SUAA 3T4XA 5B8IB 1Z5PA 2NSYA 1T4DA 2PX6A 3CW2A 4JY7A 5B3AA 3TGLA 4W99A 2X0JA 1PJAA 2HEIA 3T06B 3VGPA 3CPSA 3H2BA 4O4JF 3SIPA 4BNKA 4IJUA 1K9UA 3UN1A 3M2PA 3D2CA 1XZFA 3VNVA 4R9UC 4RW0A 3UY4A 4AMVA 4F85A 2WYIA 1H8BA 3OP0A 3C6XA 3ETJA 3GH1A 1AE1A 4P4SA 4Y9SA 4H1UA 1JVSA 2LZ0A 4B0OA 2FKAA 4N7MA 4M9XA 1RPZA 2G25A 1EVKA 1RW4A 2YRWA 3HJRA 4EAAA 5I51A 2YWRA 3DFMA 1EM8A 3IDQA 2NTYC 1K92A 4JOCA 4MPRA 1J24A 1XELA 3FDJA 4LNUB 5AVZA 5JSHA 4O08A 2A9VA 3PRYA 4KKXB 2BEJA 2EJCA 4BNXA 4BWFB 1FDIA 7YASA 4QXOA 3I9V1 2JLVA 3VKWA 1RC8A 1KYZA 2GKGA 4DHEA 3MTDA 4CM9A 4IIJA 1GUYA 1YRAA 5I5GA 4P5DA 4G36A 4PXAA 1PNVA 4JODA 4DR5B 3MM4A 1VG0B 2ZRJA 1ECPA 2PSHA 3AXSA 4RFVA 2Q6KA 1VJDA 1SG6A 1F1BA 1OH5A 4FYPA 1PGOA 4KSCA 3KUUA 4NLLA 4GPTA 3DOJA 2GF9A 4CIAA 4REQA 2WAOA 5K3FA 1CZHA 1RKVA 1XX6A 3KCNA 4M0KA 2AFIB 3SZLA 5AKZA 3HY3A 1IRJA 1IQUA 2CMHA 2AE2A 3BXPA 3C4QA 3L6UA 3V1TC 5IDQA 2DETA 3DOFA 1DT5A 3MBOA 2QMQA 4BB6A 1O94C 1RPJA 3ZDAA 2Y9PB 2XRMA 1Y4ZA 5HDBB 3RIYA 2HK6A 5CFLA 5HR5A 1EB8A 2NZYA 2P2LA 2AJ8A 4ZYLA 1QVVA 2WT8A 1NX9A 1UQUA 3JVVA 3GFTA 3VU1A 2GXQA 3PNKA 4ODIA 1X39A 3ESBA 4U63A 3PNMA 3FCXA 4RVFA 4R8KA 1O7JA 3KXKA 4DR1B 3RYHA 1GG5A 1QKKA 1JG6A 4YGYA 2YIMA 1TQ6A 2AYZA 3FSRA 4YRRA 2SICE 4V24A 1E8MA 1V11B 1D2MA 2XVMA 3WV4A 3CLTC 3H2KA 4DWOA 1G17A 2P3QA 4GDFA 1N2DA 4LCJA 4HGOA 1Y8AA 4KQGA 1Y8QB 3UANA 2PMBA 1NVAA 2X0NA 2M8UA 3NTVA 5FLKA 2O3TA 1E6LA 1CS4C 2DPGA 2P5TB 1CJKC 3G7NA 4G63A 5EQFA 5C5EA 2ZB4A 3VC2A 4DV5B 5LQMA 3GLGA 1XNQB 5LCXA 1K6XA 5LMNB 3RYFA 1CZUA 3FGNA 4UHBA 2HQWA 2WJGA 3DDCA 3M3HA 4BLTA 3TBKA 1J90A 1GTG1 2OZEA 1N5IA 1QORA 1OIWA 4FQOA 3IMFA 3KQNA 1R0XA 3K1EA 2WNSA 3AJ8A 1RVV1 1NWCA 1NPQA 3AF2A 4UZEA 2A6PA 2VNJA 3V8PA 4PBTA 5HS6A 1LDEA 4M1OA 1VPDA 2H9YA 1RM4A 3ZDBA 1EUCB 2PCLA 5A05A 1XZGA 1SBCA 5CDSA 1TFUA 1YR9A 4CTKA 1UJ2A 3GLRA 1CLEA 3TDKA 3R6LA 4A0GA 4CI0B 1KGDA 4EMBA 3OLXA 2RGNC 3TUIC 3BWVA 1DBIA 1V39A 1J0DA 3GFVA 2ZWAA 1G4YR 2X0RA 3MINB 3DNFA 4KO2S 5H80A 4MGEA 1BG1A 4Z6KA 4TV9F 2G09A 2PMWB 2WHPA 2X8AA 4UVIA 3R3SA 3CYZA 2JAWA 5LSAA 4RKWA 4CM3A 5GONA 3THWA 3EZ6A 1GZSA 3I2FA 2BFNA 4FTGA 2PA3A 3SNHA 1RJEA 5BMVB 1GARA 3AHFA 2GERA 2RKOA 1U80A 3CSSA 3N74A 5F77A 1W4CA 4BO7A 3W1EA 1HV8A 2KI4C 3FYHA 1F5NA 1Y1RA 2C31A 3BJIC 3HZHA 4RFSA 3ZE2B 2YINC 4RTQA 1HDOA 3TTTA 3D8UA 3GJXC 5IARA 5TGZA 4J9UE 5CBPA 3PFIA 4ORAB 1WUJS 4DABA 1BXZA 1JLKA 4IZ6A 5AXAA 3UHJA 1HMPA 3MVEA 1PUXA 3U60B 3RLZA 1LJLA 1UC4B 3EVNA 4F7FA 1CMFA 1Z82A 5KOHA 4LRTB 3C6BA 4K9DA 5JJBA 2GILA 4RK4A 4WADA 1J06A 2Q3FA 1J2RA 1SK9A 3PQEA 1TZJA 2IPXA 1NVDA 3F9RA 4R1LA 2WC5A 1C2YA 3T9DA 3OTOB 2H7CA 3JARB 4FGUA 1OH8A 4Z8XA 2HMWA 1XRJA 5LOVA 3DF0B 2XUKA 2IH4A 1TTPB 4OQDA 5E6UA 3E15A 4AN1A 1H2BA 4EQ6B 1IEQA 1URPA 4M22A 2R7AA 3BL6A 4ND5A 1L5FA 1ZNZA 1CZNA 2JPDA 1C9EA 2NU6A 3AEQA 4S1TA 4TRMA 3NAMA 3BE6A 1P2SA 2FUG6 3CN9A 2PLWA 2GNPA 3HXTA 3AYZB 3K6KA 1VDZA 4A4BA 1WIWA 2GYWA 2D5CA 1XVLA 4NPAA 3U4MA 3VI4B 1ZD1A 2B2CA 1C14A 4B79A 1BN6A 1DS6A 1G3IA 3D1JA 4M99A 1BDIA 4XARA 3OIGA 3EWAA 5CJJA 2O2SA 1Y4SA 3OI7A 4DS3A 3IJ5A 5KWEA 5IJWA 5JBQA 1BS2A 4KACA 5E6RA 2EIXA 5E1MA 3OB2B 3ADKA 4POAA 4E14A 2CMKA 2PL1A 2XLBA 3EG9B 5DJ5A 2O7RA 2PLNA 5BSRA 5TS3A 2AS0A 1MOQA 3IC5A 4BFCA 3DR3A 5C1OA 3K16A 1XNJA 1NNI1 3U7JA 2CCGA 1GCIA 3B6IA 3PX3A 4K6KA 2NVUA 3PC6A 3CX6A 3VX4A 1O6BA 3CS3A 5IPFA 5HCUA 3X3HA 4CEHB 1RSZA 4F4FA 5IANA 3BE4A 3MCUA 3IULA 1JXMA 1QH0A 4G0YA 4LRSB 4QREA 5B64A 1A9SA 4CLHA 2PLAA 1QV6A 4J6EA 4CQLA 3GF4A 4W5OA 2OG2A 2V9ZA 1UPBA 1GYRA 4YBZA 4IOMA 5E7IA 3NI2A 4Z9BA 1Y34E 1SRAA 2C54A 2NQ8A 3KQMA 2G82A 3HO6A 2GZRA 1W5SA 3CUVA 2GN4A 4NY1A 5DGIA 4KMMA 3RFFA 2IWHA 4I6JA 3NUZA 2Q4EA 4UBOA 2FMHA 2E4ZA 1X0VA 2A1UB 3BX1A 1Z6GA 2B35A 2EQAA 4KGVA 4QU5A 5DDIP 3WA6A 2LKCA 4UAGA 4AKEA 4E21A 4HQKA 4KQFA 1UUFA 1I32A 1MKYA 1QQ5A 3HBFA 3THOA 4CKBB 1W88A 3A1CA 3T95A 1WG8A 3IVGA 2QX4A 3DMGA 4Q9LA 2MOKA 4EUSA 1XMQB 2G1PA 2MAZA 2X5OA 4JBIA 1OASA 3R6DA 3NSKA 4NAVA 5LN1A 2WTUA 2QMEA 2JD0A 3IB6A 2VO1A 3VYVA 3GXBA 3UK1A 2C3YA 1W9ZA 3N2EA 2R1TB 5BT9A 4BFSA 4GM1A 2MMGA 3GUHA 4M3NA 1R9GA 2QGZA 3GFGA 4FILA 4FZRA 4HX2A 4YJKA 4TYQA 1PHRA 4X90A 1P60A 4DC9A 1EFTA 3C7DB 3O0TA 3PRKE 3EFEA 5EL0A 2I2WA 1N5RA 4FN4A 4N3AA 2ZRTA 2HB6A 3IAXA 1G98A 3ELYA 4PCUA 4UUMA 4LOIA 2QXYA 4M8NE 1Z0UA 3GAFA 3GLUA 4NF2A 2H2WA 4KAXA 3DEJA 4Z3OA 1NXTA 4B3RB 4YRKA 4J94A 5B2EA 3UAYA 4IVPA 1WCV1 1FVOA 4FNAA 1L4KA 3MJSA 4FS8A 4MUNA 3TR6A 1C7EA 4DFDA 1T91A 1J2TA 4QJIA 2Q3CA 5GADl 3L6OO 2AX4A 1FPWA 3DKIA 4XM0A 4ZO9A 3GLTA 2IWRA 3LPMA 1KA9H 2PD6A 1DQRA 3CLSC 1O5IA 4X20A 4O2BB 2KI6C 1TT7A 1G9XA 1GUZA 4GOKA 4GKBA 4N7BA 5FWYB 3YASA 1PKEA 1DIAA 1CDNA 1KEPA 3QMVA 4QOJA 1IBRA 1AQUA 3OHPA 4BBZA 2DCUA 1K9VF 3NBZC 2VTBB 3U7QB 2DR2A 4RSGA 1ZH6A 1SBJA 3I5FB 2XYGA 2YIVX 2ATCA 2JAOA 4ROSA 4DZZA 4IAOA 1UDRA 3WSVA 5CD9A 1ZIYA 3SLRA 4EYEA 3B7GA 6PFKA 1U0HC 3MCVA 1JI3A 1R9JA 3SXUA 4TMZA 1E4VA 4Q7JB 1CVRA 1Z5UA 2M6RA 2ZOSA 3N3AC 3DE6X 4IP0A 2PASA 3HJTA 4MQLA 5EP1A 1R4MB 1NC3A 2AOWA 1OBVA 1DRWA 3K21A 1P5HA 1YVEI 1R27A 1A8HA 2PL3A 3AEKA 1FJXA 2X8LA 3P9KA 1F0KA 4IRUB 5JRDS 1IWBB 2VRNA 2Y1XA 1YIDA 3ABRB 3PICA 4FS3A 5BV7A 1UMCB 1KO5A 4X00A 1L5KA 2C2GA 5L4LA 1MTZA 3QEAZ 4WESB 3QU2A 1EFDN 4BVHA 4RHCA 3ME5A 3OU6A 2OCXA 5COQA 2I5PO 4I4IA 2ZGVA 3NQ41 1R3DA 3PD7A 3C5CA 4JIGA 4WD3A 4JA2A 1QFMA 1PG2A 4HLDA 5FI0B 2PE5A 1OPXA 4UPEA 3AI7A 3GNLA 3V7UA 3MSEB 1W2HA 3KRTA 4JJ4A 4CU2A 3W5DA 4NECA 3BD7A 4NH0A 1B1AA 2YHBA 1OBCA 2E4YA 2X9LA 1SCUA 3IE2A 3OQOA 1BSVA 2B94A 1EUYA 2WJWA 4HQFA 4MYHA 1PK9A 4EA8A 3H6HA 4C06A 2XE8A 2VRWA 3VZQA 5E7MA 5CSFA 1J9ZA 1ZD9A 2RAVA 3PS9A 4GEKA 3TZKA 4A03A 3IUMA 4EVQA 1C3EA 5IS2A 3P26A 2NO5A 3QV1A 1WDMA 4UFNA 4DIKA 3WA7A 1PULA 4ROTA 4S1NA 1Y8RB 3EVVA 2CKMA 3WFZA 3D43A 1PLLA 1RAIA 2NYRA 4H0NA 1EE1A 1ACLA 2XYVA 3I76A 2YIJA 4H7KA 3W7BA 1XNRB 3B1FA 1A95A 2ZIXA 1MQAA 2OPBA 1JEJA 1IONA 4Q1FA 4ZDWA 1MX9A 3W5JA 5B1YA 3A7EA 5D3MA 2ECFA 2B5OA 2CGEA 4ZQFA 2NX2A 4P86A 3MNFA 2BISA 5ILQA 1UCFA 2HF9A 1Z5ZA 2QLBA 4ZOLA 1YQEA 2W6QA 2WFMA 3DXLA 1KH2A 1L8AA 1W0CA 1GO2A 3OMWA 3Q72A 3QF4B 4YRLA 2WG0A 3DEAA 4UEKA 4BCCA 4B3BA 1B8VA 2F6RA 1SYMA 2LCFA 2LKDA 2QTNA 2QKYA 1QGUA 4H4EA 4IW3B 4CG0A 1SOUA 5JD4A 1WXEA 2OQVA 2RHTA 3GLSA 2I4RA 3JQ8A 2HD4A 2CHQA 2KLEA 2II6A 2ZYIA 3UC5A 3V4SA 3HP7A 2LE0A 2BTQB 4JNCA 2A9JA 1K2VN 3DZBA 2WOSA 4F5WA 1OI2A 2J30A 3GARA 1QQBA 3GMTA 1VHJA 1XRPA 3AP2A 3QKIA 5BT8A 1GY8A 2YHUA 1KOFA 1VHDA 1XZEA 2C5AA 3CZ0A 5DHPA 3MJVA 1QU2A 3DVJA 1TIBA 4MW6A 5MN5A 4S0ZA 4HYEA 1CZOA 2B21A 1B7TZ 5HCIA 3RARA 1QRRA 4DV3B 1TCVA 1ZK0A 2E21A 1YDWA 1T6YA 5HS4A 4LSMA 3U5ZB 1XWFA 1UQRA 4XFKA 3WC4A 2WQZA 4KXVA 1ZD4A 3WK9A 4FOOA 1PGPA 4JOQA 5JSQA 3U5TA 4OLAA 3PRJA 4E1VA 1IVSA 3ML1A 2OZPA 4TWJA 3U40A 3FGZA 3C45A 1Q83A 3G1UA 3UPDA 4UMFA 3FFAA 3UKDA 1TADA 3EK7A 3OBVA 3ONNA 3FR8A 2A3RA 1ZH0A 3PTZA 2H92A 2VPWA 4RV9A 3OFVA 4U2DA 5IM4A 4HDCA 2YOHA 3MRSA 2OV1A 3AX6A 3WHKA 4C0SA 2WK1A 2WUDA 3CZ9A 3DOIA 3LK1A 2R48A 3JQGB 5IJ0A 2QRKA 5T7BA 1T2EA 3O4IA 4K05A 2RGIA 5KYYB 4BLSA 4AS1A 3BTSA 3KQVA 1ORHA 3FH0A 3IDAA 3WJ7A 4CTOA 3ZLUA 4E08A 2HETA 2QE7D 4TQAA 4MYUA 1OHHA 1GRQA 1ULZA 4I19A 4QQNA 3BJRA 3PEFA 1C7FA 4P7JA 5FPKA 3S8EA 2C29D 1QX2A 1JE0A 1Z8DA 4ZT6A 4EPWA 1YWGO 3O75A 4TTIA 5E2AA 4MQEB 3NIWA 3PM8A 4JJFA 2L2QA 3BSWA 3GJ5A 5E9AA 5IJXA 1L4HA 3AEUB 1K7XB 1EZ1A 3Q3HA 2O7VA 3KSDO 4PX3A 4MGIR 3U4CA 1PWEA 1BE1A 2C5BA 3H1EA 1TIZA 2ZKIA 2CVOA 1B6GA 1HTBA 2FQ1A 3BMNA 2QM0A 3Q6NA 2E4XA 3EQ9A 1IULA 1WDCC 3MXTA 3PKJA 2DPLA 4M8LA 1IUNA 5KNBD 4C4PA 3OLWA 4FGLA 4D8VA 2FWNA 2O59A 5G0VA 2IZ1A 1F8FA 1A9QA 1C3OB 3G9TA 5ENVA 2Y4NA 3F1KA 2NTEA 4M9CA 4CMIB 5TV2A 4P36A 4JR2A 3ZIAA 3PZBA 3Q2OA 5HIAA 3GWZA 4B8YA 4D25A 2Q6IA 2YXNA 2UVPA 4QGFA 1UAYA 4KOEC 4V0RA 4ZXPA 3CUKA 5BNWA 1N2CB 2XUQA 2D8AA 2Q8QA 5TPZD 4OHCA 2O8FA 3HBMA 1JT9A 1N2ZA 3U80A 1W36B 2BGLA 5KKNB 2ZIGA 3BIFA 1YACA 3ASVA 4M0UA 3JWGA 1NX0A 3GQBA 3L8YA 1OA1A 3R8XA 2BFEA 2FP3A 4U5QA 1E3LA 3MSXA 3V4LA 1CE8A 4QUJA 5TEWA 5AKKA 2RGGA 3GD5A 1PT6A 3PPWA 3QA3E 421PA 4QFDA 1Z8FA 4O2AF 5K3SA 3DHNA 3KD2A 3VOBA 3ZD7A 1CDMA 1I51A 3SM9A 1S4MA 5TPZA 3LBNA 3DQQA 1XVUA 5TMDA 4B46A 2GUGA 3W2EA 3GDOA 1Z0ZA 3H11A 3COYA 121PA 1NW8A 4LIPD 3AVXA 1L7EA 4M6WA 4YXWD 3LCPC 4EEKA 1IWOA 3KTOA 3O92A 4DKJA 4EG0A 1K1EA 1Y63A 1AVSA 2QE6A 3DH0A 1OW4A 3IIMA 1Q1NA 1GGVA 3KOMA 5JSUA 5CNKA 1QAQA 1JFLA 4JQ0D 5ITWA 13PKA 1C50A 5FX2A 3QQ5A 3L49A 3FHOA 4EKNB 1LD3A 1S02A 5JE8A 2Q4BA 2AW3A 3M89A 2CNKA 2CUKA 4R01A 1NW5A 2YVAA 3DXZA 5J2UB 3WRWA 4AJPA 2EBFX 4ZYZA 5BV1A 2LV7A 1P5FA 1TPYA 2MYPA 3WXAA 1HDCA 3KKNA 3OT1B 4I2NA 3NJ8A 3IV6A 4JLDA 1DBRA 3L4EA 1T5LA 2Q0HA 1FFAA 3WHLA 5DWQA 1RLTA 1L7MA 16PKA 4J76A 1T3TA 1DP4A 3PGLA 3ZJTA 2A5GA 3C3CA 2PGNA 4D26A 1GA4A 1LW7A 1XL1A 2OCYC 2Z04A 1W7IB 2FRXA 5G40A 5SICE 3LLUA 1ZL0A 5JJLA 2VXYA 3I9NA 2WJYA 1MF7A 1HG0A 1PRYA 2XNCA 1M2NA 1G3QA 2HBRA 1C81A 2JJ2A 2QJRA 3C5WP 2HMTA 5KTTA 4M54A 4KN9S 5IMBA 1WCWA 1NW9B 2ZUTA 1KAGA 2OHXA 4K03A 5B4TA 3B82A 4E4TA 4N5XA 3D81A 1CCWA 1IC6A 2WWHA 2VR1A 3PA6A 3NTQA 5FQNA 1PJ4A 1Z6XA 3B5JA 3MJRA 4TYWA 1Q7RA 3K94A 3K7EA 1Z0FA 1N8TA 3HNRA 2DUWA 2OP1A 3RC8A 1ONSA 3ZIDA 2EU8A 2W37A 3Q0IA 1E18A 1R8QA 5DBFA 3TW8B 1JW9B 1UEJA 4NIMA 3DKKA 4R2XA 2PX5A 2BM8A 3FG9A 1SHKA 3G82C 3H4VA 3MS2A 4I2VA 4J91A 3IX7A 2DQYA 5EKXA 2XT9A 1BXRB 4KPUA 3A1TA 2EEPA 2L0XA 3Q9UA 1M2KA 3R3YA 4OJKA 3Q6MA 1N32B 1JAYA 4S1OA 3A7DA 3BFBA 3E5MA 2GBCA 3ABIA 3DPSA 3ETCA 1OXKB 3LECA 1FW4A 3V9PA 3VHLB 5CFRA 4L8GA 1GVNB 3B3AA 1Z22A 2ZXUA 4UPDA 3U48A 1JHZA 1GD1O 4MHOA 4F4UA 1THGA 4ASUA 3Q40A 1GZ3A 4QYMA 3Q9LA 1Y1LA 4D9BA 5J3XA 1ZVKA 1Z0IA 2J5QA 3IEXA 1J00A 2NYAA 4USLA 2Y92A 3IB3A 1KZ6A 1M75A 4EK9A 1FNSA 2QRGA 4CF4A 1DQZA 3D8RA 4BP9A 2EARA 4N7JA 4B4VA 5DEIA 4RL4A 5T67A 1JAXA 3WBFA 4RACA 2JKZA 2ZTHA 1A8PA 1ODBA 1YK0A 4PICA 2F1OA 2VP6A 4L57A 4OREX 3HL4A 4C4SA 5C5IA 3UGQA 2EQBA 1FS5A 3AVPA 4TPKA 4OQQA 4HY3A 2IHKA 1Y1KE 2LVBA 2PYIA 3UMRA 1QTNA 2LTAA 4GZLA 3BXGA 1WQ3A 5LZ9A 1ULSA 3ETDA 1QS7A 1ZBDA 3JQEA 3VTZA 1MHOA 1V5GA 3UH1A 5L3SA 4X8MA 1S0UA 2FEOA 4Y0VA 1DEHA 4EFMA 5JEEA 5IT9A 1DBVO 1QK3A 2VQFB 2GZHA 4UPVA 2IXAA 3O4XA 2XTNA 3HWWA 3O83A 3AHHA 4JN6B 3AVWA 4JI2B 1AGRA 6LDHA 3KEVA 1KZ1A 1I0IA 1Z56C 3EULA 1FYXA 3IPYA 3T0FA 2X6QA 4GBMA 3MGKA 2R66A 4KW7A 1MUUA 4TKMA 1ZVMA 4PHFA 3DD5A 1QH9A 5B58C 2WU8A 2GO7A 3ADCA 4EBBA 2FLWA 3A2KA 3IQZA 1GTVA 4ITRC 1G6HA 1G5IA 5CHYA 4X6UA 4JMLA 4BATA 3VROA 2IBSA 5HX7A 4QDUA 5EIWA 1OLSB 2OOKA 2RK3A 3I42A 5DSZA 2WWTA 1UF9A 2W4QA 3SY8A 3ETNA 4Y7DA 5LYJA 5GY7A 1YZQA 3LQ1A 3RNLA 3DE1X 2Q5EA 4CKWA 3C1AA 1G4HA 3H16A 1NYTA 4IV0A 4XVHA 1S6IA 5AVSA 1X77A 4K3UA 3C7TA 1U2DA 3MTBA 1AUOA 1R0YA 3FHLA 1SBTA 2P5UA 4LQDA 5LQKA 2DVMA 3OZIA 4XYNA 4TL8A 4UAJA 2I7TA 2IYEA 4URXR 1HXHA 3P2IA 3SMVA 3RAJA 4JLJA 1YU9A 1X1DA 3H9EO 4CV1A 4QFCA 5DMXA 1UAAA 1S6CA 3DLHA 3DBLA 3PPIA 5J58A 3PLRA 3SBEA 2E37A 1ZM2A 5IT0A 1XZBA 4KNVA 2C83A 4DDHA 2PIDA 2WDZA 3M7IA 3AAKA 1YZHA 4FMBB 4K6CA 1JDJA 4UUQA 4DQVA 1AJEA 5JZMA 3JQQA 4H17A 2I2RE 3B1VA 2JIRA 3GPLA 3C8HA 3WYFA 5KNLA 3E7XA 1H5NA 3I45A 1DQNA 3AY0A 1Z8HA 3PDIB 5FULA 5LZ5A 1XEFA 1ZOTB 3I39X 1GRNA 1OAOA 2N3ZA 3K0EA 2VXBA 4HDRA 1Z73A 3BXKA 1HFWA 2CFCA 4WT7A 4C7XA 1NKTA 4Z7JA 1U7HA 2BELA 3HDYA 4II2A 4HNVA 1N2JA 1CUFA 1QFJA 2F3QA 3UF0A 3TZHA 4F93B 1J2YA 1XD8A 1SXJA 4YP5A 5C31A 2GFQA 4H1HA 2HRCA 4HAVA 2RD2A 5K0LA 1CULC 4MWBA 4JC8A 2IJGX 4IDGA 1BQ4A 2EFDB 3WYGA 1VSTA 4RKRA 1DEOA 1ZM9A 1SHZA 2OTGB 1GFSA 1C7ZA 1TZKA 1XTUA 3LM8A 3NT2A 2O8EB 3V00A 4PAOA 2YW9A 3VPXA 1Z2PX 3GZNA 1M2OB 2B0CA 2Q0QA 3BFKA 3QVJA 4RELA 5CA0F 3SF8B 1XZAA 2CV2A 4MPDA 2QW0X 4GKVA 4AJNA 3EVTA 3QKRB 2JLRA 3FAZA 5KAPA 1FZTA 1F0PA 2ANBA 4RJIA 3CABA 1XD9A 2P9QA 1T24A 4W4TA 3H5AA 1N2XA 2JCBA 5DHAA 5BR7A 3KVNA 3JAMA 2B1IA 1VM6A 4KIFA 3ZDFA 4KRFA 3W7VA 4DMKA 4HB0A 4DRXA 4QUDA 5FBLB 2YHSA 5IULC 3EGWA 3F6RA 4ZREA 1YDMA 1UJ4A 2ASEA 3CEAA 1PHPA 2P6MA 5JATA 2I3ZA 2A0XA 4NS4A 1BX1A 4LMAA 3AZPA 4CMAA 4ZICA 5KYKA 1A9XA 1QHHB 1VMKA 2QUJA 1Z63A 1HDXA 2P9TA 3PUVA 5A62A 3FLBA 4V1CA 1KDZA 1SPBS 5IKMA 2HAEA 1UPUA 1JFFA 2EQ5A 3IV9A 4Q1DA 5JQGA 3GT3A 3DKRA 2ZW9A 4Y9UA 1TUJA 6YASA 2ZG6A 2FW7A 1VA4A 3O4VA 4JBNA 4M76B 4JXXA 3B7PA 3GLKA 3UMJA 3H5VA 2V97A 1GPDG 1OTXA 1O6FA 1SVUA 4TKZA 1Y0BA 4JENA 3P1JA 4PE4A 4N7RA 3TSCA 4L50A 1XQ1A 2FZLA 2D54A 3A2LA 3SYKA 2R1UA 1ZMXA 3ENQA 3OJEA 4OVKA 1IPHA 1VBKA 1W75A 1QE0A 3NG1A 5EQDA 2JKVA 2ENWA 4II3A 1L7VC 4F3RA 2RGYA 4KGZA 5KDOA 4U7DA 4P0PB 1XXHA 2EERA 2R8OA 1USWA 2PZBA 4JVLA 4KX3A 4AL4A 1PK8A 4EH1A 4EOGA 1P7CA 3V9AA 1DTSA 1UK8A 3SSMA 4PYOA 5E6SB 1NUBA 2HLPA 1JZSA 1J8MF 1WKCA 3LVBA 5AVTA 1PJZA 1D9ZA 4IHAA 4NV0A 3O31A 5I9BA 4E51A 3CNNA 2NPIA 1GDDA 4HV4A 5BQ3A 1V1JA 5AW5A 2XAAA 2P9JA 4I3FA 1KPGA 1QLJA 4X54A 3AKDA 3LV8A 3E3NA 4H4DA 4IQ4A 4Y2RA 3TTUA 2CT9A 5KO2A 1CUCA 2OBBA 3L7IA 2FW0A 3LZ6A 4ED9A 4K7JA 2DULA 2ONCA 1KL7A 4OQLA 5M29A 2KS6A 2TS1A 3TL6A 2HV8A 2PBRA 4IUCS 2FZ5A 4FXPA 4LV6A 3C7KA 3BB4A 5FCDA 3TK1A 2VJQA 1BA3A 5G3YA 2C84A 2IHBA 1CUGA 4RO0A 2DYKA 3M6XA 4KE7A 1C29B 3PQDA 4KK4A 3FNFA 2QROA 1N9ZA 4TLBA 5AWFC 1L7ZA 2IE0A 2PANA 5A4JA 3WTBA 1JALA 4FOSA 2W58A 4LW8A 3PQ3A 3VH4A 2O2ZA 2WHXA 1H69A 2EZ8A 5B2ZA 4WOPA 1K6JA 3V4ZA 2VK2A 1GGNA 1BXGB 3SVTA 2B4RO 4MZJA 1DMOA 5SZHB 4UOZA 3B9QA 3LLCA 3AFGA 1QHYA 4P3NA 5KHAA 3RNOA 4Q47A 1C07A 1BROA 1ZFNA 1D2AA 4KU4A 2O0MA 3LE8A 1CY4A 2IPNA 2YWEA 5T8KA 5AIBA 2JFNA 1WB9A 1JSCA 2GPNA 2CSXA 2XECA 5A5VA 1JB9A 1XK6A 1UBMS 4Y2PA 1YHNA 4X9XA 5AJUA 2L19A 2K2FA 3JALA 2NO9A 4HGNA 1PNTA 2XB6A 4LWPA 3AERB 2V03A 1H4VB 1Z68A 2A0FA 2ERYA 3DGFC 4Q7LA 5FOTA 4ZJUA 4QOGA 2FSFA 3OOJA 1EYZA 4RD6A 2H2AA 2AKAB 2ZB3A 2CE2X 2JGRA 2VK1A 3K4HA 1G9TA 4WFJA 5ESXA 3GOFA 4X66B 1GM0A 1Y5NA 3KKOA 4KODA 5EZYB 2WM2A 2VSOA 4H59A 4O6VA 4Q01A 1PFQA 3QMPA 1HGXA 4KE9A 3T5MA 3HADA 1DWUA 3THRA 1XDZA 3VGOA 1Q57A 2FFAA 2G8NA 3C6MA 3OOEA 1WDWB 4IJ6A 1P6QA 4JT9A 1B0PA 2J45A 1Z2OX 2OAP1 1LQTA 4NFLA 4MUGA 3ILHA 1HYBA 1RM5A 4ETOA 4XQ9A 2JJ8A 2BE6A 2I3DA 5FYQA 4RY0A 1Y9DA 5SY4A 3FOWA 3M6IA 1W9MA 3VSBA 2GZDA 2O1XA 2AOXA 1GOTA 2LW7A 2XDAA 2Q2QA 1DDOA 2P4HX 3MERA 1TXGA 2Y27A 3RM1A 3KLMX 4YPOA 2LBPA 1BDHA 1OA0A 2BFMA 2DF8A 2Y0CA 5KCMA 2O05A 3EWNA 2ZYSA 1XEWY 2ON6A 3QRXA 1OXTA 3HVJA 1PZNA 3PSRA 1P1RA 4M9UA 4NU5A 5LB4A 4PFSA 4X5OA 1ESMA 3KVOA 3S0DA 3OQIB 3RUPA 2BFCA 1P31A 3PBKA 5IW8A 5KSPA 2Q7DA 2BBWA 5FV4A 5I01A 3RAEC 2HJ9A 3ZKWB 1Z18A 2XCUA 1IKUA 1A8UA 5KTRA 5EMNA 1DQEA 2A4JA 1OMDA 1TM2A 4TMKA 3H1BA 3X1DA 4PCWA 3EIXA 4A0FA 5B55A 2I2FA 2ZCJA 1YVPA 1PFYA 2RHOA 3PJEA 1CPYA 2G71A 3GA5A 1RWMA 2OM6A 4OIMA 3ZOKA 4EHHA 1T26A 3PFKA 2O52A 4QJ4A 2PCJA 1W73A 4ZAVA 1KVQA 2Q50A 1M2FA 4C01A 3JYQA 1B4CA 1T0BA 2VTDA 3FDFA 4F3KA 2YV1A 3VYTB 1EFRA 1QZXA 1AT1A 1B2LA 1B1CA 1VLMA 2GCOB 3CC8A 6CHYA 1CKKA 4DLYA 1H6BA 3OO0A 3QUSA 1NI4A 4LS3A 3OMXA 1XG5A 3PFNA 4OIFA 4B85A 3NSIA 4S2UA 1W49A 2GBFA 1P4RA 1XEXA 3WK4A 3KZ1E 5T6BA 3BN3A 1TUIA 4BGUA 3HA3A 3SG6A 5FHRA 4DE5A 2OHJA 4DYHA 2UUCB 1A4IA 1I0LA 1S7CA 5FBHA 2XIJA 3MWDA 2BJWA 1CUWA 1HNNA 1FXWF 1NVTA 4JUCA 1CNMA 1DZIA 4GS5A 1E6EA 3O2JA 2NXJA 5I8PA 4B47A 1AV7A 3BICA 3GRPA 4O4LF 5K0TA 4FBGA 1RXVA 1WUYA 1V9SA 3KBBA 4YP9A 1HZJA 3ANYB 3GL9A 4YIKA 4J43A 4KRXA 5DKRA 1Q7CA 2JQ6A 2FZVA 2BFAA 4QASA 3JYLA 4FUTA 1E32A 3LT0A 2J6HA 3OTWA 4PLPA 1DAGA 2JFUA 1V9LA 4EY3A 2X77A 3V8EA 3SG4A 3T3PB 1Z6PA 1JEYB 3AHIA 2Z2XA 1BAPA 4Z4IA 1Q0ZA 3UZUA 1A2QA 4ON9A 1MCZA 1ENPA 1H2YA 1U3VA 5AJXA 3VMMA 5HOEA 3Q8MA 4KPEC 1KZHA 1BCRB 2C00A 1JHOA 3T38A 1NOKA 2VPIA 1Q1QA 2OHGA 2ZTVA 1U1EA 4IMJB 3DWEX 4XE5A 4QYIB 4DNXA 1KSFX 5AHWA 2WKWA 3S8YA 3NTXA 4NDBA 4MTCA 1ABFA 3T52A 3WP0A 1GZ5A 1ONBA 3PL5A 2VHJA 5E4TA 4DJDC 5F7ZA 3CWQA 4D9MA 5F7OA 1XCGB 2B1JA 4TV8A 1WKBA 1Z5WA 2LNDA 3A31A 1RKQA 5TF4A 5GJWC 1HT2E 3W9SA 2Q9CA 1JF2A 1A29A 4GWLA 2F2TA 2CNOA 4KO3S 3DOEA 4ND8A 2RG7A 4K2HA 1TZMA 1D03A 1IG5A 2CLHB 4LX0A 3EXFB 3WOVA 4BFTA 4Z4FA 3AI3A 1CNFA 2D7DA 3PDCA 3DAPA 4GH5A 1WLZA 1NE7A 5AKLA 1NVBA 4D41A 1P4HA 5JFOA 1SCBA 3UK7A 3UK6A 4E2YA 2VF5X 1JEDA 1K7EB 2Z5VA 3O8LA 1QHEA 1TJ5A 1JHVA 5GJVC 3P19A 4CL0A 3F5QA 1SAYA 4F7DA 2DLC<