1DELA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp and amp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
241
Chain Sequence
MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Phosphotransferase
total genus 85
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1delA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1delA01
1K6MA 3D8BA 2XZPA 4LPSA 3DHWC 1W0JA 2CLSA 1K8RA 4LYHA 2VH5R 1YJ5A 4ZDKA 1T3SA 2CJWA 2H7VA 4LJ7A 1Z08A 5FPKA 1M1YE 2QPAA 2VHQA 2P5TB 3S1AB 1E9BA 1TL7C 3E70C 1P2UA 2IXGA 3G82C 2QL6A 3KB1A 2F1HA 4YXWA 4CEHB 2PH1A 1CS4C 2HT1A 1G3UA 1R6BX 3IUYA 1CR4A 2QEQA 3UXMA 1TQ6A 3KJGA 4KI0A 5DH9A 4EDHA 3EPKA 4TSFA 5TARA 1E2MA 2NGRA 3T1OA 3LX5A 3FMOB 1JXMA 3DMNA 4HEJA 3B60A 5FI0B 3QNUA 4Q9JA 3TK1A 5CB6A 2IL1A 1RRPA 1HV8A 4HAVA 3ZVMA 3KB2A 1KO4A 2VA8A 3FB4A 4OHZA 1GUAA 2ZJZA 3WP1B 4US2R 4GBMA 1EFRD 3AUXA 3V4FA 5K8LA 4DB2A 3IILA 4U00A 4B2LA 3GJXC 3KXLA 4RD0A 4RCZA 1GTVA 3K0FA 1OIXA 2EWVA 2QSYA 4PFSA 1IN8A 2GEUA 2ZTSA 2O8CA 2NIPA 1N0VC 2WJYA 4CGZA 1EG7A 1FNNA 1W1WA 4QJ4A 1ZD9A 2R6CA 4JVMA 3GPLA 4JS0A 4ABYA 4AKGA 3HPQA 1XJCA 3NG1A 1KSGA 5EP3A 2N42A 1QHNA 5JRZA 1UDWA 2FU5C 2P0EA 2ZS7A 4UKDA 3WMEA 2OLJA 3LH5A 2YYZA 3O8DA 1Z28A 3N2EA 4YMWA 3B78A 3TAUA 6Q21A 4MH0R 4GOJA 2J41A 2V6IA 1S4QA 1I4TD 1KHTA 3I73A 3CW2A 4A6PA 1U99A 4B48A 2O8EA 2Q3MA 2X2FA 4UJ5A 1NG9A 1N0WA 4QGGA 1GRQA 2ZEJA 2GNOA 4NCNA 1DO0A 3OAAA 1G8YA 5HPYB 5KDLA 1EWRA 5FUWA 1AGPA 1RZ3A 1P2SA 1SKYB 1TU3A 2QRNA 4YXWD 4LV5B 2Z4SA 4HUTA 4F91B 1ZC4A 2EQBA 3UK6A 2RAPA 3ZQJA 4YMVA 3LBNA 4LUCA 4TYNA 2WJJA 4XTRA 4BPBA 2RHDA 1EXMA 1DAKA 2C04A 2CEAA 4U02A 4FCWA 3QXXA 1OFHA 3UG6A 3WXMA 5F9FA 1HURA 5FR2A 3EIEA 2EFCB 4JYCA 1OW3B 5JI2E 1E9FA 2HJGA 2JAQA 5J40A 1F48A 5FOTA 1AJEA 1VIYA 2IW3A 2GJKA 1RYHA 2WWFA 3QIAA 1NKTA 3ADDA 4N3NA 3A4MA 4MRVA 4CT5A 5CK4A 4C2TA 2DB3A 1W5SA 2I1QA 1JALA 5CM9C 1EWQA 4Z51A 1KO7A 1W4CA 2ZJYA 1E0AA 4GMDA 2QPTA 3U3JA 1AS0A 3DM9B 3KKQA 4H1UA 4JL8A 2ZRGA 3E5HA 3SHFA 4POAA 2OFWA 4HUQB 4BZPA 1U81A 1XPOA 3X1YA 4EPYA 1KDTA 1CTQA 2F7SA 4HDCA 2ZR7A 3ZJYA 1J8MF 2PT5A 2IYWA 3AKEA 1RJ9B 3GLIA 4EQ6B 4JL5A 3W3AA 4NPHA 4DCNA 4E22A 1JEDA 3CX6A 4FIDA 2ZJ5A 1NJGA 3WBKA 4PHGA 4IW3B 1G4AE 1E2FA 1E2JA 3OZXA 3WRXC 4CZ2A 2YVUA 1PVOA 3T06B 2WWWA 1BH2A 2FSGA 4FMBB 3IPYA 2D2EA 1SKYE 2GXAA 2OSBA 1ZU5A 4BLRA 1KAGA 2DBYA 4NU0A 2ZAMA 5L3QB 1QHGA 3I8XA 1OXXK 3F5FA 2XXAA 1OF1A 4LCBA 4NCHA 1OH5A 3QXSA 3FKSA 3U44A 2IBMA 1ZINA 1ZRHA 2XSZD 5BN4A 2ORVA 2JCSA 5D3MA 4TMZA 5LD2B 1T0HB 3MWLA 1N5LA 2GHIA 1SULA 4D0GA 1CJMA 1Z0JA 4QNRA 1AQYA 1DAIA 1FX0B 3QI2A 4UNPA 4JLMA 4HAZA 5J4LA 3TLXA 2IHBA 2BMFA 5SZHB 3L0PA 3RRZA 2GK6A 2XOKA 1FTNA 2AXPA 3K09C 3X1DA 2FJUA 1Q3TA 4PC1A 4JMPA 3CWQA 4Q66C 4XSGA 5FTNA 1HQCA 1Q1QA 1SVMA 3FTQA 4DBLC 3MAAC 3TUZC 1G19A 4JVLA 3ZD7A 1VMAA 5DI3A 1DVRA 1XEXA 2D7CA 3CONA 3OEEA 3VHLB 4DDUA 2GF0A 2R62A 3LBHA 1D8TA 5TXGA 1CRPA 5GADl 2JLRA 1ZNZA 4DXAA 3KFXA 4DCUA 4LC1A 2F43A 3DOEA 1AIPA 3EAQA 2BJVA 3LAWA 3TNFA 3BFVA 3HP1A 3EZ7A 1XTJA 1SHKA 4FMDF 4QGAA 1XCPA 5LBIA 5BN3A 4BFYA 4RFVA 5F3WB 1S1CA 3PXGA 3VKHA 1X86B 5JHGB 1COWD 1KKLA 5KNCA 3NBXX 1CEEA 1SXJD 2Z4RA 3D7MA 2FZLA 5JSZA 1YR9A 3ND9A 3ADBA 1AN0A 2IYQA 3T61A 4TMXA 2D62A 3CNNA 5IHPA 5FBWB 5L3SA 1T8TA 1ZU4A 4FWIB 1J90A 3E1SA 3K53A 3WNBA 1F5NA 1LS1A 4QG7A 4LZZA 2YKGA 1FTSA 4A2QA 4GFDA 3U6KA 1WP9A 3SS8A 3P4XA 3VMFA 4GPTA 3VU9B 4BFVA 2XX3A 2F3TA 3C8UA 3RRYA 5FI1B 2QP9X 1NN1A 4DUGA 1OB5A 1N6LA 1DO2A 3Q5EA 3ADKA 1H8ED 3FDIA 2A5YB 4UXIA 4A92A 4EJSC 5J4KA 2HLDA 3NH9A 4C30A 3NDPA 4US0R 2QI9C 1JJVA 1VCOA 3AF4A 3CPJB 3BWDD 4B76A 2IF0A 3NWJA 3D6TB 4BECA 2QA5A 1P9RA 1W4AA 2XOKD 3B2EA 3MGCA 3QJYA 5GJBA 1Q20A 1Z0IA 3ETLA 4IDHA 1OIVA 1C9KA 3P20A 2WJVA 3OHMA 4Q5IA 4K81B 4ESHA 4JT4A 1GAJA 1DAMA 2ERYA 3Q7QA 2VHTA 2GEDA 4KVGA 1G9XA 2FE4A 4M1MA 4XWAA 3VR2A 4KSBA 1X8LA 3LLUA 4KBGA 3PUYA 2VP6A 3KX2A 4Q1EA 3THYB 2ZYTX 1JJ7A 1JNYA 3MSXA 4N0DA 5EXPA 1ESMA 2AL7A 2FFBA 2BBWA 3AVQA 4AG6A 1VCNA 1BYIA 1E94E 4X8MA 1E98A 2R6AA 1XJQA 3P27A 3TMKA 4K8OA 1DEKA 3IO3A 2BIFA 2ORIA 4RD4A 5CK5A 4GI7A 1P61B 1OSNA 3LFUA 4MGKR 3CF6R 1JXOA 1PUJA 3M4YA 3AVYA 1F3OA 2Q3FA 1ANKA 2W2XA 3AVWA 4Q4JB 3GLHB 3RLFA 4IHQA 4OQXA 4TLCA 4LYJA 4LJAA 4XVRA 1HTWA 3OEHA 4B73A 2EU8A 3U4QA 2R9VA 3RS2A 1DBSA 4KFRA 5G41A 2WBLC 1SXJC 1ONBA 2I3BA 221PA 1JR3E 2BWJA 3NBYC 4MGIR 1ZNXA 1Z6AA 1U9IC 1M8PA 4P0TA 2OFOA 3DOFA 3DO6A 4E09A 3TQFA 1QHHB 1T9HA 1X3SA 4R98A 4CYMA 1W48A 3NVAA 4C0JA 1HT2E 1XMIA 2PT7A 2WAYA 4D26A 2ZE6A 4JLNA 3ASZA 1PV4A 2IC5A 4XWOA 1E2IA 2C96A 3ND8A 3OE7D 4UNQA 4A0HA 4EFLA 1ZMXA 1ELOA 1Q57A 2CCKA 2QE7A 4HDOB 4XD7D 2HLDD 3H86A 1VHTA 2VF7A 3ZD6A 5TMPA 2GXQA 2QENA 3M6AA 3K70D 4P4UA 3OFNA 4QGHA 3BFKA 4IEIA 3L43A 4IVQA 1G16A 1QDEA 3B5JA 4WXPA 5JS8A 1F2UB 3QE0A 4DLSA 1KYIA 4TL8A 4G5OA 5ELXA 1B0UA 2OO7A 5B58C 3LQRA 3I1FA 1LF5A 2QBYB 2WSMA 1G291 2CL0X 3R8FA 1D9XA 4M9SA 3IBYA 1OT3A 4MDEA 4Z1MD 1U98A 4D0NA 4PQRA 1M7HA 2QM8A 1W5TA 2GK7A 5DYIA 8OHMA 5K8TA 1OXVA 2JDIA 1MR3F 2ASEA 2G88A 1OJLA 3DM5A 4A82A 1NP6A 3CRVA 3EWSA 2IXFA 1XEWX 3EZ6A 4TWZA 5C1BA 1SVLA 4L5BA 1Q22A 1P5ZB 1HUQA 3K9LA 1QHYA 2NTYC 4FMCB 1XMSA 2ZRDA 1OFTA 1LFDB 2VHCA 5BXQC 4HZIA 3KTAA 4MYUA 3M1IA 2VF8A 1N6KA 3A1VA 3T5GA 4A8JA 4M8NE 4ASUD 4F93B 4PZZA 2D7DA 2FSIA 1U0HC 3GLHE 4A4DA 1BOFA 2HYIC 4B3XA 1IN6A 4HLUC 3W9YA 2JLUA 1OH6A 4KITB 3RNLA 4IEEA 3QSYA 2VP5A 1JAHA 1N0UA 2R2AA 4JVNA 5EP2A 3Q8XB 4LJ5A 1VECA 1NMYA 1B23P 1E6CA 3CO5A 1F6BA 4G1UC 4UXHA 2OESA 4O2RA 2KB0A 1JPJA 2GCNA 1FUUA 1LTQA 1P73A 2WKRA 5FTKA 5KDDA 4GL2A 2GA8A 2BBOA 2GRJA 3CH4B 4QJ5A 2JASA 3ZZTA 2E87A 3ZH9B 1KSJA 2BDTA 1NG1A 3SBDA 1W2GA 1RKBA 4DKXA 1QHXA 4URXR 2F55A 4KU4A 2WWYA 3BAFA 3IHWA 1NVXQ 2IHYA 3NEJA 4TT3A 2EW1A 3PV0A 5AR1A 4RZUA 2ZJAA 2RGDA 3BORA 5H1YA 1UBGA 2A5GA 2FSHA 4LI0A 3K70C 1W46A 1II8A 1JR6A 4I4LA 3RVBA 4GSYA 1UBCA 2Y8EA 3I3SR 1IOZA 4O0MA 2DFNA 3I4LA 4DLXA 1KY2A 4TZ6A 3P1JA 2YOHA 1QG4A 1CR1A 4N1AA 2JLQA 1XTIA 3L82B 2IYVA 3U6BA 2VQSA 1PUIA 2PX0A 2ZU0C 3LW7A 1U0JA 3B9QA 5JEDA 1MABA 3K0EA 1DPFA 1UKZA 4LV6A 1TAGA 1IJFA 2Q21A 3N2IA 3QBTA 5BWMA 4KXFB 2JLYA 1N6OA 4MKHA 2W58A 3K0FB 3P26A 3UKDA 1V43A 3GD7A 4B3DA 2F9MA 1OB2A 2VEDA 4OHXA 2NZ8A 5EXSA 1ZIPA 4DLZA 2OBMA 1TUEA 4QFMA 4WOPA 4XJXA 2ZSBA 2ZRFA 1VG9B 3KKPA 4PC6A 2IS2A 4F38A 3ZS8A 3AVPA 3GEIA 4IXNA 2XB2A 2OHFA 3LBIA 3M0EA 3NDBB 5KOYA 2FPMA 2C9CA 4O25A 2VP2A 1R0YA 4URUR 5EP1A 1R0XA 1G5TA 4GOKA 3SYNA 2OG2A 1GIAA 1EFUA 3ONWA 1UF9A 2ZRCA 4PHHA 4YC7A 1Z0FA 3EPLA 5TDHA 1NI3A 5CJPA 1W4BA 2ZI4A 1GZSA 4PX9A 4DLVA 4ZV4A 2F1JA 1U2RA 4R2HA 2O8EB 3FGNA 2H1LA 2X2EA 4OJQA 1EFCA 3AVXA 3NTUA 4MUAA 1A2BA 2WM9B 1NF3A 3AF1A 1T5IA 1TPZA 4YMUA 2YNMA 2ZRMA 4V0KA 1SVKA 3B7GA 3RRMA 2YV5A 4HLQB 4TTQA 4KYIB 3AGPA 3PG5A 4R9UC 1KDPA 4Q7LA 5G53C 3QY0A 3EIHA 3G0HA 4ZIRB 3X1XA 1E2DA 2GKSA 4AKIA 4BFTA 1HQYE 2FFHA 1CJTC 4QRHA 3OIWA 3PQCA 5HZHA 4PHFA 1E96A 4C3ZA 3A6PC 1V5WA 4KLNA 4ACAA 1AM4D 1IAQA 1QBKC 3C41J 4TL9A 4RD2A 3A58B 1ODFA 2CNWA 2X8AA 2JLWA 2PJRA 1YRAA 1SVWA 4JLDA 3O8RA 3O8CA 3UPUA 3RS3A 3T12A 4NMMA 3I92A 4JJZA 4Q7JB 4MITA 4W5HA 5CJ2A 3TQCA 3THWB 2WJGA 1PZNA 3VR3A 3RC8A 1LVGA 3QQ5A 4JLPA 5IK2D 4OQNA 3DPUA 4FI3C 3PCRB 5AWFC 3BH6A 4U7DA 3AF3A 4GDFA 4ZCIA 4V0LA 2C5LA 2CE7A 1KJWA 3ZDQA 5KSZA 5FR1A 2QTHA 1UM8A 2WZQA 1KK1A 4P4TA 2CVFA 2ZSAA 4RFSA 4QBHA 3IHLA 3CRMA 3JVVA 3MFYA 3RS4A 1NKSA 1W44A 3WHLA 2VP0A 4CVNA 2XAUA 5AJZA 1YHNA 2LKDA 1RRCA 4KFUA 4Q1CA 3IKJA 3MUFA 4RD6A 4XIGS 4OQMA 2CE2X 4KV9A 4LJ4A 1W0KA 3BB1A 1ETUA 3GLIB 2XJ9A 4GOXA 3MRSA 4BFZA 1WCV1 2GBLC 3W6PA 1T8UA 2RGBA 2J0UB 3QENA 2HJVA 4WW0A 5CYPA 2OCYC 3TW8B 4F7WA 2C03A 1FQJA 2QAJA 4RZ3A 1D2NA 3ZYCA 1U90A 5AUPB 3LVRE 3EC1A 1ZP6A 4GMXA 2GAOA 5BW8A 2OXRA 5H70A 1Q1EA 3RWOA 1HE8B 4DEXA 2FV8A 3DKVA 3H0KA 1YZGA 2VYFA 3FHCB 2PCLA 1ZM2A 3GJ0A 4QBFA 1AZTA 5EJEA 1GNRA 2IWRA 1FOEB 2XXAB 1KGDA 5AJYA 1AKYA 3THOA 2RGGA 2UZIR 3EPJA 1YZQA 3R9WA 2GCOA 3K0AA 1OFUX 5D3MB 4BWYA 1Q44A 3A4NA 2ZIAA 4BRUA 2G0TA 1T6NA 2ZVQX 4V0OA 2BV3A 2J46A 1KY3A 4RVCA 1EGAA 2IX3A 1NIPA 3VKWA 4B44A 3BC1A 4G5GA 4OK3A 2LWIA 4HAYA 3A1WA 3K0CC 1GL6A 2GJAA 2R6FA 5CB8A 2FEOA 1I2DA 4S2EA 2GJ8A 1MH1A 4C7OA 5D3QA 2ZRAA 3CX8A 5EXTA 4DC9A 3EARA 3E2IA 2EWWA 2QGZA 2PEYA 4D80A 1E99A 1K5GA 3QPUA 4FMCF 3I5XA 1G7CA 2F43B 2WMNB 3HU3A 2HUPA 1W0KD 4V03A 4M21A 4LYAA 4G5SA 3L0SA 4M1WA 3U7HB 2B21A 3BERA 1F2TB 4TL6A 3K09A 4Q4HB 3P32A 5FPYA 4FN5A 1R8SA 3GLIE 4PC7A 1TTTA 5B2ZA 1S9DA 1A1VA 1A7JA 2V9PA 1MOZA 3WP0A 1NBME 5JHHB 1KKMA 4OKSA 2REBA 4GZLA 3AUYA 3CZQA 5JSZB 2AK2A 3CRRA 1G17A 1LW7A 3L0OA 3QKRA 2JA1A 1XCMA 5JEEA 5L3SB 4CEIA 3BRWD 2BM1A 4AURA 5EE9A 3RYTC 1VG8A 2B8TA 2V54A 3MJRA 2ATVA 2O8BA 1Q1BA 2HXSA 4BGDA 2GAAA 1E9SA 4EPTA 3TKLA 2XB4A 1SVSA 4NYJR 1KZ7B 3C4JA 1IN7A 3IIMA 1E9AA 2JATA 2QMHA 1E9CA 1ZIOA 4EPRA 4Q9HA 1WXQA 4Q9LA 3SI7A 4LBYA 4TLBA 4GNKA 4EFNA 1DAGA 3UMSA 4ZDWA 3REFA 4A0RA 2HDNB 1WBDA 1Z2AA 1XDBA 3GEHA 3K9NA 2IUUA 2VHUA 3TR5A 2OV2A 3R7WB 1IONA 1P75A 4ON9A 4TQUS 2P2LA 1KNQA 5FOSA 3C16C 2RGCA 3U7EB 2Q9CA 4JKIA 3QKTA 1KI1A 5BN5A 1RRGA 1SZPA 4D4MA 1FMJA 4PR0A 1OKKD 5CIWA 4NBSA 4QM6A 2ZI5A 1NVUQ 1US8A 2XSZA 4Y0AA 4B6EA 4EJSA 2ZYVX 2ZI9A 4Q4AB 4NZYA 3TUJC 2CLCX 1XPRA 4AG5A 4ZKEA 4B3GA 3HPRA 1KDOA 3IDQA 3DVLA 5AJWA 2DWQA 2VSXA 3TIFA 1LB1B 3SFVA 2B7CA 4HB0A 2NO9A 2L0XA 1G7RA 1GRRA 2XTZA 2ZS8A 3MD0A 3QOFA 3RWMB 2JLZA 2JLVA 2F9LA 2O8DA 2IS4A 3IGFA 1CJUC 2HYDA 3QVUA 1ZUHA 1ZW6A 2WSSD 4D6PA 5KTYA 1S3SA 2G77B 3FMIA 3MJHA 3U4QB 2V55B 2LCFA 3ECCA 2VLIA 721PA 1E4VA 1SKQA 1WMSA 1ZCBA 3DKPA 1BO6A 4OK6A 2IUTA 2JLSA 5J5CA 3UWOA 3VHXA 2XGJA 1TF7A 4WBSA 2A30A 4PO8A 1G8FA 2P5SA 4MDFA 3ICQB 2GESA 1VG0B 1N6IA 5E4FA 4M1TA 2EYUA 1R7RA 2V7QA 2QROA 2WMOB 2CHVA 4WZ6A 1KSFX 1Z6GA 3HU1A 1COWA 4PXAA 3R9XA 1FFHA 1O3YA 4LDJA 4TL7A 5P21A 1SXJA 4IDOA 1N6NA 3A36A 1E1QD 4LBWA 4ARZA 1KO1A 4PAQA 1QVAA 4QKQA 2PCJA 5JJKA 2OAP1 1J7KA 1VCIA 4A6XA 1U9IA 4DEYA 3AKYA 2OLKA 4C2UA 2QTFA 5B30A 5EE1A 1YZUA 1NL3A 2AX4A 2ZE8A 1AQUA 4LYFA 3QF7A 3TW4A 1MO3A 1I2MA 4HB3A 1W4RA 4PZYA 3DZDA 3NXSA 4NTZA 1YVDA 4LV8B 3KQLA 4F4JA 2XEXA 4UNRA 2OFXA 4NYJQ 3DL0A 1R8QA 2CNWD 2IYSA 2PMDA 1Q12A 1H8EA 3PUXA 1W36D 1MO6A 1NSFA 2LKCA 2DR3A 3K0SA 1HY3A 4I1UA 1E4YA 1E32A 3WMFA 1E2HA 3SJCA 1C1YA 3QKUA 4BZQA 1NY6A 3CRW1 5FL3A 2GJSA 2Z5FA 1XWIA 5JJIA 3U3RA 3KTAB 4A8JB 4IOJA 4PO1A 4FWTA 5JJLA 4DVGA 1JBKA 4MGYR 3TH5A 5LB4A 3UWKA 4I1VA 1Z0KA 1RRFA 1P72A 3GLGB 4Q7MB 2Z0MA 2ZJ8A 3S1AA 1G64A 3RSOA 3U5ZB 2ZE5A 4PPQA 1Z06A 4CEHA 2WKPA 3U61B 3RDPA 3T34A 1OXSC 2B92A 4ZPXA 2B7BA 2OCAA 3BOSA 1TQDA 5K8IA 2ZR9A 1CF4A 2QSZA 2V7QD 1M7BA 4DB4A 3P4YA 2BMDA 4HAWA 4OI1A 1DAFA 2FNAA 1XTRA 1KI3A 4LX0A 4HLUA 1GM5A 1GDDA 1ZM9A 4JLKA 4Q21A 3SJBA 2FH5B 1KJZA 4P31A 4BFWA 2QRZA 3FMFA 2GWHA 3GLFB 1GL9B 2C95A 4D82A 2O8FB 2WWGA 1A82A 5FOVA 4O2LA 3TR0A 4DZZA 3FWYA 3AB3A 1II8B 1NRJB 4DLTA 1NBMD 1EESA 4JLOA 2Q3HA 4PO9A 4LGMA 1RE0A 2ZSDA 2JIZD 2C99A 3BB4A 3RC3A 2E1RA 1Y3AA 4W9MC 4ZI2A 1UBEA 1DG3A 4LPKA 4DLYA 4DT1A 5FPTA 3OE7A 2AR7A 1J2JA 3MLEA 4RSGA 3KDSE 1MABB 5DHAA 2D4HA 4XD7A 3BH0A 4BLSA 1YE8A 4HZUA 4IVPA 4L4UA 4M9ZA 5E7MA 2FFAA 3A4LA 5HCIA 4HAUA 4D4KA 1W36C 2RGNC 4M4SA 3SR0A 4C0BA 5FBVB 1G3RA 2WOJA 1NY5A 2VTKA 3EG5A 1XZPA 1XP8A 1XU4A 2I1VB 3T1VA 3R9IA 4DDWA 3CKLA 4Q47A 4MQBA 2C2HA 1PLKA 4LHZA 3ZS9A 1IN5A 2BM0A 4Z8YA 4DRZA 1N25A 3FFAA 4P33A 1XD9A 3FHTA 4Z1MA 1OLOA 3LD9A 3KQUA 4DJTA 4NCKA 4OJKA 3GLGE 3ICEA 1NN3A 4DDVA 2O0JA 4PPNA 3HR8A 4NE2A 3AVVA 4MYHA 5KHOC 4B71A 1TEVA 1OE0A 2X77A 5KNDA 3HYTA 1E2QA 4D0LB 1E0JA 2O0KA 2W6JD 1XPUA 1KZGB 1KJYA 4E03A 2R6GA 2OEPA 5FTMA 1ZM3A 4ASUA 4D4LA 4NYIR 2ZITA 4FINA 1D2EA 1LNZA 3I32A 1P9NA 1KI2A 2WOOA 1G8GA 2QP4A 4GRAA 2ANCA 1N3BA 3GLFE 1VYTA 2VP4A 2KJQA 1IN4A 4TLEA 4URYR 3CIOA 2FGKA 3UG7A 1KI6B 1U0LA 3AQ4A 4HYYA 1H8HD 1N6HA 3D31A 1UKYA 1IBRA 4MYCA 1M2OB 5EZ6B 3C5HA 5FPSA 3W34A 4GP6A 3JZAA 1R0ZA 2KSQA 3CB4A 3SN6A 2Z83A 4OI2A 5E95A 1N5KA 1M7GA 4C0KA 4ZCMA 4KFTA 1HT1E 4HUQA 2OUKA 4PPGA 2R65A 2BC9A 3Q5DA 3K9GA 3ZIAD 1E2NA 1VPLA 2QAGC 3C5CA 4IKEA 3C14C 5FFMA 4LJ9A 3VQTA 2WJIA 4KBFA 3FE2A 2FWRA 3MMPA 4D2IA 3GJ3A 5DISB 2N1BA 3R20A 5AUQA 2OILA 5KU1A 3GFOA 2CK3D 2CHGA 4LJ6A 2BKUA 1IQPA 2IWHA 1A4RA 4EUNA 2JJ1A 2XTMA 3PIRA 5TB5A 2ZETA 2GZDA 2H5EA 4B3CA 2D74A 2ERXA 3QXCA 3G5UA 1GG2A 3ZGXA 4C0LA 3THXB 3QUSA 2H17A 3EC2A 4BFSA 5KSYA 1E2PA 5JWHA 4TLDA 3UMRA 2WTUA 3AH8A 2J0VA 2KBEA 2ZSEA 1LF0A 3BB3A 4G0NA 4QBGB 3SQXA 5J4YA 2QQ0A 4OYHA 4QHTA 5AUNB 5J47A 2RHMA 3DDCA 4B35A 4IJMA 1SVIA 5HE9A 4P32A 1FPMA 1U8ZA 1E79A 1KO8A 2ZRJA 1G3IA 3SJZA 2XZOA 1E9DA 2V3CC 3IEVA 4QOSA 4LY6A 1D6JA 2HV8A 4W5WA 2RGXA 4C9BA 3LO5A 4HB2A 3N5CA 4IVRA 1LV7A 2EFHB 1YU9A 3CX7A 2WKQA 3SBEA 3X1WA 2REOA 4MRPA 1OFIA 2GBLA 1FX0A 1WB9A 5EP4A 2ZQ5A 3SHWA 3GP8A 5CYOA 1WRBA 2PBRA 1GOTA 1XRJA 3N70A 3QKSA 4QHSA 2C98A 5EZ5A 4DSUA 3BFXA 4LBVA 1ZYUA 3K0AB 4G01B 2ZS9A 2CJWB 2QP3A 4DCSA 4NHOA 4RD1A 2WHXA 2JGNA 3VR1A 3K8YA 3L2OB 3FHOA 1G8PA 3L0IB 1KMHA 4PPFA 1FL9A 2BMEA 2ZI7A 1NIJA 4CT4B 2VSOA 3LQQA 2IA5A 2G3YA 2ZRLA 3C15C 3PUVA 4CRWB 4NYIQ 2PX3A 4MUBA 1JAIA 2CDNA 5CLLA 1QF9A 3HU2A 3U60B 2DY1A 3U3MA 2VO1A 1GP2A 4C7OB 5KPJA 4KHZA 3HYRA 1CU1A 3VKGA 4RY2A 2W6ID 2JJ1D 4TMVA 1R5OA 4BZXA 2HF9A 3KKMA 4PHTA 4YMSA 2F6RA 1NVWQ 2DPXA 4Q9IA 1WQ1R 5DHFA 2ONJA 1PJRA 4M9XA 2NPFA 5DN6D 1VCMA 4IDQA 1XEWY 4A15A 1JR3A 2Q9BA 1XTSA 3R8CA 1OYWA 2ZM5A 3K0CA 2VIIA 2QGNA 3KJEA 2FZ4A 2NQ2C 2J0QA 1G1MA 5IK2A 1MRNA 4QJ3A 3ZZ0A 2ZRPA 3CF0A 1NN5A 1FW6A 4XH9B 4M1YA 2ZUDA 2NOAA 2O8CB 1RFLA 1QHIA 4V0MA 1E79D 4L9WA 2PMKA 1YRBA 2WPDD 5EUMA 1BMFD 2WJHA 2QTVB 4CEIB 1CJKC 2OZEA 5FBQB 1DTSA 3VR5A 2YZ2A 3EWAA 2O8BB 1MO4A 2IS1A 1E2EA 1U8YA 1ZD1A 2GXSA 2QT1A 1ZVQA 5F2EA 5KSOA 1Z63A 4BEJA 3TE6A 5JS7A 2HT6A 1OXUA 1MV5A 1L7VC 1XEFA 4DLUA 4C0AC 4M1SA 4HAXA 4ZO4A 2OT3B 1Z83A 2ANBA 1SQ5A 1YZKA 3NBFA 1XX6A 3NHAA 3LNCA 4ILEA 4PQFA 4US1R 1NN0A 4A36A 3UIEA 1KDRA 2IXEA 5C4MA 3MWJA 2GXUA 2BHRA 1J99A 1KK2A 1MRSA 3KJIA 2E9SA 3FFBA 1XD2A 2EFGA 4DSTA 1XCGB 4TYPA 5F9HA 5FUVA 3AKCA 1P2VA 5GJWC 4BQSA 1DAHA 1T4GA 4X8OA 4JBWA 4MRNA 2G9NA 2IF2A 2OM2A 2XNSA 5SZJA 1WE2A 3NHBA 3O8BA 4MKIA 3KUDA 3TSZA 1US8B 3QBVA 4Q4JA 4C0HA 4NDZA 1HYQA 2CCJA 4EJSB 3MCAA 1NSTA 1DE0A 2J7PA 2BCGY 2A9KA 3OESA 1RC8A 2A78A 4JT2A 2JJ2D 3IEUA 5HCNA 4KYUA 2HXYA 1KIMA 1BIFA 5E7JA 4PAOA 1JR3D 3RSLA 1F60A 2REXB 2PL3A 3WMGA 2YC2C 3WY9A 3NBZC 4ESVA 1GKYA 4B2PA 2VPPA 3FPAA 3SOPA 4WVFA 3RAPR 2G1KA 2A5FA 4NCJA 2OCPA 4DLRA 2PEZA 1QHHA 5BYJA 4Y0VA 1P9WA 3B9PA 2IK8A 5C18A 5DNYB 4QBIA 2WV9A 4EFMA 5FL7A 3SYKA 2XTNA 5EE5B 3EASA 2AFIE 2UZ3A 3IQWA 5FOXA 3T1QA 2EYQA 3KJHA 4RZ2A 3ZQ6A 2ZYWX 1N2CE 3AP2A 3U2QA 3LY5A 4W5JA 5LD2C 4CIDA 3AV0B 4FXPA 4RD3A 1G5RA 4B33A 2ZI6A 5L8VA 1II9A 1J70A 1RYFA 1ZNWA 2ZUBA 3LXRA 4GP7A 4DSNA 1PLJA 3EZFA 2Q6TA 4KO8A 3LLMA 1AS2A 5JMTA 2QNRA 1F2UA 1YQTA 2AKYA 3QG1A 1GWNA 2DWPA 4TQ9A 1E1RD 3LA6A 1K5DA 3DMDA 3CF2A 4CW7A 4EPXA 4TQAA 1OH8A 1NNEA 1Z47A 4BRWA 2QBYA 4O3MA 3CPEA 2YJTD 2R44A 5EE0A 2CCGA 3W5JA 2AD1A 1UFQA 3GJ6A 1SXJB 1Z22A 3OIVA 2YWHA 1IY0A 1DOAA 3BXZA 2FOLA 5J4HA 4AIIA 3CR7A 1XXHA 3GEEA 1TQ4A 3CRQA 2PZEA 2P65A 3KUCA 4GT1A 1TADA 1Z29A 1KTVA 1Z8FA 4HATA 3TGPA 3KKNA 1U94A 3GJ4A 3QPWA 2D06A 2VBCA 3U44B 3EX7C 4AYXA 1UADA 2IYZA 5DSZA 4AI6A 2P6NA 2PZFA 2J7PD 4JBXA 1XFAA 4V02A 1E9EA 2N46A 2ATXA 2GVDC 2GCPA 5C46F 4KJZA 1GRNA 2KBFA 3A8TA 4KLZA 1LS6A 4IDPA 2VSFA 5UKDA 2F1RA 2XNDD 1YKSA 1KI4A 3SNHA 2BBTA 4U5XA 1CRQA 1OYYA 4XVUA 4C0QC 2GJ9A 4P4SA 3SQWA 3LXXA 2ZAOA 2HEIA 3EA0A 4BLPA 1FQKA 3AVOA 1S1MA 4LWZA 4BASA 3CLVA 1Z3IX 3CNLA 3K1JA 5AJVB 4PTLA 4B6FA 5FL7D 1CXZA 1XNJA 2IEYA 1R2QA 5DI3B 1XEXB 4L9SA 2ZJOA 1NLYA 4R2IA 2DFKB 1OKKA 1TEXA 1JQJC 1XB2A 3QPVA 2WWHA 4RJLA 4X8LA 1XD8A 3VR6A 3GFTA 3W5IA 2X19A 1E2GA 4CEJA 3BK7A 4PSVA 1EK0A 2H18A 3A37A 3SDZA 1QZXA 4TMKA 2UKDA 5IF9A 1JI0A 1N6PA 3VR4A 1CR2A 2A7QA 2FA9A 4XWKA 5HKKD 3TRFA 4LK2A 2FX3A 2IEZA 3I5YA 2WSSA 1UJ2A 3GCGA 2KWIA 3KFVA 4NH0A 3L8YA 4DCTA 4JSYA 1JECA 4AK9A 2W0SA 3PUZA 1SXJE 2ECKA 421PA 4OQFA 4BE7B 4DIDA 2ODWA 2QT0A 2RGAA 2V8OA 2Z43A 3A1UA 3ZVNA 1YR8A 4UJ3A 2RMKA 3TJZA 1XTKA 1D9ZA 4XSHA 2JLXA 2YWEA 5EXXA 4RKFA 3QF4A 4NKRA 4EKDA 4XTCS 2QPOA 4Z54A 1HA3A 1G6HA 2AWNA 2VL7A 1VHLA 2YINC 3EIQA 1T5LA 4AD8A 2J59A 1W47A 4DT1B 1P60A 2MSEB 3JVUA 2OBNA 1XBTA 2FN4A 1TQ2A 4FCVA 5LB2A 1L2TA 2V1XA 3LW8A 4QNMA 3CPHA 2QMEA 4HZUB 3AF0A 2D2FA 1NJFA 4IXMA 1I4DD 1XMJA 1E1QA 3CNOA 2V6JA 1YZLA 2WICA 3I61A 3K70B 3IPXA 5CDFA 2P6UA 5FUYA 3IIKA 2BEJA 4MKFA 3RABA 2F1IA 1IHUA 5KDOA 2G6BA 4HB4A 4QGFA 2DFLA 2G83A 4CDGA 4TZ0A 1W0JD 4I81A 5CM8B 5JRJA 2ZUCA 2G0NA 4P3YA 2C9OA 2C9YA 2IYYA 1KI9A 4ITRC 1AGRA 5GJCA 2PZGA 1CBUA 5KYKA 3WHKA 1G6OA 1GKUB 5KUTA 3UANA 1CLUA 1E69A 2RGNA 4ZIRA 1OH7A 4CF7A 1OIWA 5HR5A 3FVQA 3LWNA 4YDHB 1J8YF 2QU8A 4MYTA 4Q19A 2WWIA 3TSWA 4TSFD 1P3JA 3SE0A 1RPZA 1XJ0A 3BH7A 1X8KA 3GJ8A 4Q01A 2B6HA 4DSOA 3U7FB 3F8TA 4LHVA 1UDXA 2WIAA 2JEOA 1KI8A 1L4UA 3AF2A 2O5VA 2ZREA 3EZ9A 1GL7A 3CWZA 1GFIA 1JPNA 1H65A 2WAXA 4LHWA 2AWOA 3THWA 3PUWA 2RH5A 1CIPA 4B47A 4URWR 3TAHA 2BVNA 2XJ4A 2ZXUA 2CVHA 2QORA 5TV2A 1E2KA 4IRUB 2AK3A 1QHSA 1XF9A 3SEAA 2NO0A 4PSAA 1HH4A 3KZ1E 2PJZA 4FW9A 2QMUA 3EXAA 4UXJA 2AKAB 4KSCA 1Q1ZA 2J1LA 2V1UA 4PAMA 1R5NA 3AP3A 1ZBDA 2NO6A 4DHEA 4OI0A 4M0LA 1OV4A 2GTPA 1A2KC 3MWKA 5DE3A 5DLQC 3SFZA 3H4MA 3T5DA 4IOKA 3K9HA 4Q00A 1P7CA 2ZRHA 3W3ZB 4BLTA 1P4SA 1Z6YA 4A0GA 2Q9AA 3WNDA 1S2MA 821PA 2KE5A 4XVQA 4C4PA 1JEEA 1GNPA 1KNXA 1Z5ZA 1NBMA 5LPNA 4YONB 2A3RA 2J0UA 2W2VA 4LHYA 2VRWA 3TVDA 2H57A 3I62A 3VTKA 5JFGA 2JIZA 4KODA 2ZRNA 3F3YA 1EX6A 1EFHA 4A1FA 1S3GA 3OAAD 4Q18A 4LOAA 1VTKA 2IT1A 3VX3A 1OXTA 2DCUA 2QAGA 3X2SA 4JYBA 3EA5A 2RB4A 3RS5A 3ZZUA 4B2IA 5G40A 4NP6A 4WAUA 1G3MA 4EPWA 1QVRA 4QXAA 5L3VA 5AK0A 2EFDB 5FTLA 4HSEA 3GFPA 3QXHA 1GKIA 2ZYUX 2JJ8A 2RKOA 3V9PA 2FGJA 1S9HA 2WVJA 3LDAA 1ESNA 1T91A 2CL6X 2H8KA 4LHXA 2HF8A 4A2WA 5H8WA 2J5XA 5HZKA 1X8JA 1R10A 2W0MA 5A5GA 4BFUA 1E3MA 5FH9A 5G3ZA 4Q4LA 2IYXA 3MWYW 2MMCA 4JZKA 4JKYA 2A5DA 3CZPA 3FOZA 2CMKA 5GVRA 1M74A 3AVUA 5JCZA 3QKSB 5K8UA 2D3WA 2K5UA 1AK2A 3OIUA 2YOFA 1NMXA 2FSFA 1D5CA 1YR7A 2NZJA 2W6JA 1W2HA 1ZM7A 3DZ8A 1IY1A 1VKJA 1KMHB 2TMKA 3PVSA 2EFEB 3LX8A 3H1TA 1UBFA 2O0HA 2GETA 1CR0A 1TF5A 4KCGA 5C4GB 4TYWA 1UKEA 4MKGA 1F2TA 4JL6A 5DYGA 1G5PA 4Q4HA 5KPDA 1KAOA 3Q7PA 1G21E 3IQXA 4JJKA 5JWOA 3SYLA 2ZJ2A 4NONA 5E7IA 5JLJA 1H8HA 2FFQA 1ZM4A 4Q7KA 2J3EA 4Q03A 2AXNA 1SVOA 4URVR 1Q3HA 4TYQA 3VX4A 1N6RA 1UAAA 1BS1A 2GVZC 2R6DA 4RZXA 4AKEA 4L16A 4A0FA 1DS6A 3KQKA 2MSCB 3KXIA 3KQNA 4DWJA 1MO5A 4IFEA 3HWSA 3ZIAA 1Y63A 4AWXA 3PJRA 4HLCA 4Q1AA 4NYMR 4Q1DA 2ODEA 5EUQB 4H9GA 4F4CA 2IS6A 3QEOA 3U3KA 4B3FX 2ONKA 3FKSD 5DI9A 1IXZA 3OF5A 4PC3A 2MSDB 3PENA 5BQ5A 2CK3A 4K46A 3NC0C 4MA4A 3D3QA 3QEJA 2W83A 1UPTA 4JLBA 5BYKA 1XZQA 1JB1A 3UATA 3KL4A 3X1ZA 2CBZA 1ZUNB 5E3HA 2V4ZA 1FMLA 4PC2A 4II7A 2QQEA 1KK3A 4JSTA 4DIEA 3ASYA 2J0SA 1N5JA 2ZR0A 2BEKA 3FKQA 1IY2A 4PSKA 3PEUA 2QM7A 3QXJA 4AYTA 3R7WA 4Z8XA 1KSHA 4UNNA 4ZCLA 4F4IA 2PLRA 2ZSFA 4JLVA 3W90A 3SZRA 4LJYA 4PANA 3B1ZA 4EAQA 3OEED 4AKHA 2C77A 5EE3A 1P2TA 4R71A 5FPHA 1VYUA 3EW9A 3VNVA 3AKDA 3OIYA 2GZAA 3Q72A 5CIQA 3CH5A 4Q4AA 5FBLB 1KO5A 2BJWA 5JZVA 1G4UR 1CP2A 3V4RA 1P62B 1L4YA 4L8GA 4C0SA 3BJIC 1NVVR 4V0NA 1XD2B 5FBRB 2ZJBA 2PLFA 3JZMA 3PEYA 3ADCA 1EX7A 1WDTA 2QUZA 1W49A 5DIFA 4BUJA 3PEWA 1L8QA 3Q85A 5KSPA 3SC3A 1AS3A 5J4VA 2NPIA 3T35A 2CXXA 2ZRBA 2RCNA 3HJNA 2YOGA 2I4IA 5H68A 1NLFA 4MRRA 3NH6A 3MG9A 3U3OA 2ZANA 3NC1C 3SJAA 1YZTA 1Z2CA 4B32A 1GVNB 2DFTA 2OE2A 1S0UA 2J45A 4M1KA 3W6OA 3H84A 2O52A 4YDSA 1RJ9A 1TUIA 3B82A 1TX4B 4S35A 4EQ6A 1T3HA 3KKOA 1XTQA 5JECA 4EIWA 3WNCA 2HCBA 2DYKA 3HDTA 2BKEA 2P67A 5CLQA 4M2LA 4V0ME 4DUGD 2W6IA 4Q1FA 4RFSB 4TMTA 1GSIA 3FMPB 3Q3JB 2IYTA 2OBLA 2RGEA 1U8AA 5AJXA 4B43A 5AUOB 1CKEA 5L3RA 4D25A 2AHOA 1XMVA 2NO1A 2ORWA 5DN6A 2BMJA 4AC9A 4M22A 1OPXA 1II0A 2ZROA 1S8FA 4I99A 1HE1C 2FMXA 1GILA 4AYWA 1W7AA 3REGA 2C8VA 1M34E 1YR6A 5L3QA 1MT0A 4B74A 4HLDA 5JBQA 3A1TA 4X8HA 3W6NA 3LVQE 1KI7A 4NYMQ 1FP6A 3GMTA 5GVSA 2WWXA 5JCPA 1Q0UA 3BD9A 4TMWA 3ZVLA 1UEJA 5JI3E 2NO7A 4UNSA 2ZE7A 4D4JA 4LJ8A 1CJVC 4BEBA 2WPDA 4F92B 3J81k 2ZRKA 4A9AA 1E2LA 1G8HA 1XXHB 1BMFA 4J0QA 3ZLJA 4G5RA 1GITA 1G7SA 2GEVA 1RIFA 3B6EA 4QHYA 4JVSB 5FTJA 4JLAA 5EQTA 4YQFA 5A4JA 1NLZA 5GJVC 5A0FA 4DDTA 2ODBA 2UVQA 4G5QA 3NEYA 1IXSB 4UQOA 3TBKA 3PITA 1Z6TA 4TTPA 5KNBA 1KK0A 2GCOB 3WRYC 1R5BA 5TY0A 3OEHD 2FG5A 3BBPA 2HCJB 4OHWA 2BOVA 1D2MA 1T3LA 2FDCA 1DELA 1O87A 5JWRA 1ZNYA 4QL3A 2OAQ1 2GILA 4DLWA 3GLGA 3VNUA 3EZ2A 2W2TA 3IBGA 1ZAKA 1G20E 3GJ7A 4P4SB 3UMFA 4RCYA 4BFXA 5FUXA 1MKYA 2QY9A 4E5UA 4JIMA 5DO9A 2SHKA 4OHYA 1NVVQ 4LSGA 1E9RA 5KO2A 1BYUA 3LRPA 2H92A 2FF7A 1KOFA 2AFHE 2J87A 2NG1A 2QE7D 5M04A 3B1YA 1AZSC 3NKVA 3WYFA 1IM2A 2JJ2A 4CEJB 3OFND 1VYVA 4M9QA 3WBJA 3GLFA 2O8FA 3CUEF 4OK5A 4W7SA 3BIFA 1TF2A 3VAAA 4ACBA 1OHHA 3WYAA 1ZCAA 3TVTA 1Z6XA 3KQHA 1VG1A 3B8HA 3B85A 2QN6A 5CITA 121PA 3VU9A 4BLOA 1ZD8A 1VDZA 1TU4A 1WA5A 2ZPTX 2Q0HA 3NIBA 3QKRB 1QG2A 4I1OA 2JDID 4WIAA 2NMVA 2FEMA 4I1SA 1ZUIA 2IYRA 1ZC3A 2XZLA 1BKDR 1XXHE 2A5JA 4IOLA 3QF4B 4WA7A 2WIBA 1QRAA 1HEIA 1YZNA 4TTRA 5SZIA 1Z0DA 3RS7A 4FCTA 3CM0A 4AY2A 2VP9A 3RS0A 4FD2A 4Q48A 4WZBE 1E1RA 2W00A 5IT5A 2DHRA 3Q9LA 1DADA 2P3SA 3RHFA 2J9RA 1UKVY 2OXCA 3C7KA 4ZDJA 1SHZA 2YC4C 4TYYA 3SU8A 2KI5A 3BS4A 4H1VA 1G3QA 5FOWA 1TNDA 3T1TA 4Q02A 3THYA 3I8SA 4NCIA 1AA9A 1NMZA 2CHQA 3B13B 3B1XA 4NL4H 4PZLA 3AEZA 4XOIA 3PR1A 4JLJA 4YLGA 521PA 3PEVA 4KFSA 3TSOA 2IUSA 4E07A 3DEFA 4L15A 1DARA 2F3RA 4IOMA 2C78A 2QMOA 5HTKA 4A2PA 4WZAE 1G7TA 2YWGA 3AM1A 5ANRB 1EFTA 3GLHA 3AP1A 3PFIA 1X1SA 3IIJA 1P6XA 1KMQA 4B3BA 4RKEA 4KVAA 4TT3D 1R4AA 1W36B 1R0WA 2QZ4A 5TVKA 2EVWX 4M1OA 3CBQA 3QVVA 4B75A 2XNDA 3ZVRA 4OQLA 5G3YA 1OHHD 4IFBA 1GNQA 3LV8A 4HDQB 3RANA 1LY1A 2O8DB 2AD5A 3BGWA 1T0JB 4G3XA 4JBYA 3I72A 4OI4A 1KI6A 4QC2A 5F98A 1Z0AA 2BBSA 4LC0A 2CL7X 2FPLA 2VHJA 2DWOA 4ZI3A 1RW4A 1WF3A 5FOUA 4OBEA 3GQBA 3W8NA 1IJEA 1JQLB 1AKEA 2GF9A 1I4LD 3W8RA 2P6RA 2YWFA 2G1JA 2YHSA 2OCBA 2QG6A 3F0TA 3H2YA 3T15A 1PLLA 1TMKA 2A2ZA 2ZVPX 5SZKB 5LDDC 4IDNA 1FNMA 3CR8A 1A5TA 1VIAA 2MMGA 3AGQA 2CLDX 4OHVA 1SGWA 4Q9KA 4TN1A 1G41A 4MGZR 2Z6VA 5IDVA 1FZQA 2BCJQ 2FPKA 5HKKA 1M6NA 2XITA 4N0EA 4ZKDA 1FP7A 4OL0A 4LBZA 3AVTA 4HI0E 4YMTA 4A8JC 4KAXA 3B1VA 3RRNA 4ERNA 3VFDA 3O47A 4GZMA 1IXRC 1DAEA 1Q21A 4M53A 3THXA 2ZRIA 5DGXA 1C4OA 1S96A 3IO5A 4TLAA 2IYUA 4URZR 2X1VA 4ARZB 4ZDIA 621PA 3TUIC 1RVDA 5B57C 3V00A 1UEIA 3BE4A 4B34A 4DCVA 4LRWA 5CDFE 1EFRA 4R7ZA 2B8WA 5IRCD 1WBBA 3GJ5A 4Q1BA 4D81A 3HR7A 4BLQA 4EPVA 4PQYA 4QM7A 1FUKA 1X6VA 2R8RA 2GZHA 3A1SA 1ZJ6A 4WXRA 3L8ZA 3QG5A 4FMDB 2ZI3A 5HE8A 2QAGB 3EPHA 1E0SA 2AN9A 1E0KA 1G18A 5C2JB 3WYGA 1Z07A 1DG1G 5B64A 3KXKA 4MRSA 2J7KA 2GDJA 3U7GA 3B1WA 1N5IA 2ODNA 1X1RA 2IYLD 3FYHA 2H16A 1CULC 2ZU6A
chains in the Genus database with same CATH superfamily
1K6MA 2XZPA 1Z35A 4LMAA 5JZ9A 2AGVA 5K0LA 4F85A 1OJ7A 4PE7A 2IXGA 1G3UA 4LYGA 4H1WA 4TKVA 3L3BA 3KJGA 3K9BA 1ZG3A 2CN1A 1NYAA 4HEJA 1F4OA 5GOTA 2QRQA 1FYDA 3ZJ5A 5CB6A 5E0KB 3OPYB 1XVAA 3FIAA 1DEHA 2WNIA 4TKZA 3NDJA 1KS2A 3WP1B 3IILA 2QR3A 1P7VA 2GEUA 4ERXA 3EVTA 4KXUA 3HKBA 4A6EA 3PI6A 4ABYA 5BW4A 2K0JA 2P0EA 5GINE 4YMWA 3B78A 4MH0R 2JGDB 3A4IA 1RHUA 5I7HA 3VRRA 1IIBA 1RZ3A 2QRNA 5BSMA 5EKDA 4W8GA 4F91B 3QH4A 1U31A 1HWYA 2EQBA 2DBZA 1CFCA 1TT5A 1PR9A 2JAPA 4TSKA 2P6MA 2CEAA 3TDKA 1FS4A 3WXMA 4G1EB 1AKQA 4JYCA 3BHMA 4WDQA 4RTPA 1NAHA 5DMHA 1FS5A 2J9GA 1EVEA 3QX9A 4JI6B 1XMXA 3I2FA 3M3DA 1JSAA 3DM9B 1SG0A 3E5HA 1IJBA 1LJUA 1Z8DA 4LVCA 1KDTA 3CR2A 2B99A 2CLIB 4EQ6B 4CQMB 3DDHA 3AFIA 5FTWA 1E2FA 2Y5IA 1LDMA 3O0TA 2JHGA 2POQX 4DLLA 4V38A 4PYQA 5JZOA 5BURA 1ZRHA 1LNQA 4RENA 2GHIA 4ZGGA 2AW3A 3HGQA 1FX0B 5BSKA 4KMOA 3W5SA 4RTLA 1FTNA 1T1SA 3DWEX 1Q1QA 2ZAGA 2Y05A 1PQ4A 2GT1A 4IINA 3EIFA 3LBHA 4IZIA 3UKJA 5L7WA 4HXGA 4MV6A 2F43A 3OI7A 5BWOA 4MJXA 1S1CA 1FRQA 3PXGA 3L9XA 3OX5A 2ZB7A 4H0FA 3D7MA 1R66A 2GZSA 1NWCA 3P7MA 3T9EA 4DV2B 4Q9DA 1Y1KE 2X22A 3P4XA 1FRZA 2ON6A 3V46A 3D4OA 1H8ED 1JJVA 1ISHA 3CPJB 1YI1A 1ADYA 3T0GA 3BDAA 4GPEA 1OX5A 5K03A 1QV1A 4O2AB 4EF4A 1KYYA 1NZDA 5D7BA 4FC7A 1TGVA 4D97A 2MSNA 5BVGA 1UANA 4II2A 3VOSA 5J23A 3JQ8B 4AZ3A 2AKEA 3LT1A 4OQXA 4IKPA 2KX7A 1ZLXA 2QZSA 1MDFA 4KK3A 3R3JA 3IMFA 3O3CA 5CB4F 1V9CA 4BLUA 3NT4A 2OFOA 1E89A 4JLNA 4QDZA 4PV7A 2E4XA 3STXA 3GPCA 1H05A 1V47A 4JUBA 2QENA 2JGKA 1LRLA 1ZZEA 4MHOA 3ZCVA 1G16A 2YS6A 3CR3C 4ZTZB 2ADFA 2RHOA 1KYIA 3E3OA 1ZJZA 2PS0A 1D9XA 1OT3A 5IYZB 3EEBA 4Z1MD 3VVLA 4H08A 3DM5A 2NU7A 1Y33E 3K4HA 1SNYA 3ZJVA 5DU2A 2VF8A 1SB9A 2JVKA 3B38A 3W9YA 4HXYA 1JAHA 2O4CA 4JVNA 3OD1A 3Q8XB 1X15A 1N78A 4LXQA 2TECE 1NYRA 3KAPA 3OQHA 4CODB 1UXKA 4DKXA 3KTOA 3O4YA 1A03A 4X41A 3I5AA 1R74A 1YI0A 1II8A 2HGSA 3UK7A 2QV0A 1L4BA 1HNNA 2EGHA 2JKVA 3K0FB 3UKDA 1L5SA 2VNHA 4HZGA 3SR3A 5KIAA 2DBRA 1VG9B 2L2EA 2H9YA 1ZJJA 2CUZA 4NEGA 2QEBA 4URUR 5DT2A 1OTHA 5JPCA 4GVPA 4OJQA 4RSMA 4MRYA 4ENQA 4HHEA 1E2DA 4BFTA 5CA1F 1HQYE 4QRHA 1LDYA 4C3ZA 1E96A 4MVJP 2KGRA 3IL2A 5ALRA 2CNWA 3HYLA 2VDVE 3A0UA 1VJDA 3UPUA 4QGSA 4W5HA 1PZNA 4BO8A 4U2GA 3N0WA 1O94C 2UVDA 3Q3HA 2GUGA 1Z4QA 3ANYB 3V8NA 2D0DA 4H6XA 1NPDA 1KK1A 1JPUA 1I13A 3RS4A 1RJGA 4BYMA 3OQVA 5DLPA 2M9GA 5DPMA 4LG1A 3WAJA 4IFTA 2OHXA 3BB1A 2R47A 5C4IA 2CWWA 1A9QA 4FYWA 3IALA 3ZYCA 3CZ9A 3EC1A 2GAOA 3ANLA 1YS7A 5TQ2A 2L51A 4DEXA 1YQEA 3NT2A 1GR1A 2HSGA 2BFDA 2GAIA 3C8MA 1JKFA 1OFUX 4M1QA 3CZMA 2JL1A 1QIHA 1NW9B 4QU8A 2ZZMA 3HXQA 1EFVB 4V0RA 4ZZ2A 3RU3A 2I8AA 2Y93A 3E84A 4M86A 1YB6A 2PEYA 4RMIA 5KTKA 3U1TA 4LDZA 4QD3A 3QPUA 4FMCF 4KHPB 5FWXB 2WMNB 1SUWA 2EC6B 3FSRA 3U7HB 3PPVA 5KWEA 1LQUA 3N7HA 4W5QA 1FQOA 2WNDA 5JHHB 4GZLA 1U2GC 1FFSA 2IUEA 3ROPA 3ABQB 2CMDA 5JEEA 2VCYA 2BM1A 1D6SA 1BGVA 2XTAA 2UZ1A 3FCSB 3QVSA 2EKQA 2P9ZA 2OAGA 4CJXA 4I46A 1GGEA 3BMCA 1IONA 4XWWA 1QNFA 5K3OA 4K2AA 4MS1B 3WL6A 1SBYA 5BORA 1FMJA 4QM6A 4B6EA 5KOIA 5J2UB 2CLCX 3GPBA 3TIFA 3TZBA 1Y4ZA 2I29A 1U02A 4LQCA 2IPXA 3PGLA 1NQUA 3WAKA 4HFNA 1ZW6A 3DD4A 3FTFA 4G84A 4TX1A 5M3BA 1TZKA 5IFKA 1TF7A 4PO8A 4AJOA 1YA8A 4IHJF 1N6IA 3PC8A 2WMOB 1EE1A 3E9EA 4B46A 1NJ8A 5FUBA 1NV9A 4QODA 2OAP1 1U9IA 4X85A 2OLKA 4MZLA 3C5EA 3EXG1 5F7ZA 5HQ3A 1IHDA 2PGJA 4XIIA 3PGXA 1Q12A 5GZ3A 1MO6A 2LKCA 5A06A 3SJCA 4WJLA 1NY6A 3O4JA 1E1NA 1YOBA 1MAUA 3EDCA 3SF8B 2PKRA 4O2BB 4MX8A 3SYMA 2ZSKA 5ENDA 4CEHA 3CS1A 4IHAA 4P5PA 3RDPA 2B92A 4BXOB 3DZJA 8ADHA 4QJ5B 4LX0A 4HLUA 2FH5B 4D82A 3RARA 5K0BA 1XDGA 5FOVA 4ZVUA 3FWYA 2OO5C 1NRJB 3VBCA 1XTPA 3K0KA 3GVHA 5HRCA 2ZIZA 5AOCA 3ZX5A 1IUKA 3T94A 5H9WA 2ZUWA 4I66A 5LZ2A 4KLCA 2DPHA 3A10A 3V4SA 2JFYA 2B94A 1SOMA 2PRYA 4D4HA 3AI1A 1PZXA 1TNWA 2C2HA 1PLKA 2GF2A 3EZGA 2ROQA 3NWPA 5EIBC 3KQUA 1O6ZA 1QONA 1YS1X 4RLSA 4KQJA 4MK4A 4CLDA 1C3LA 5B4UA 2G9ZA 1DKMA 2ID9A 2GO1A 3H1AA 2IXDA 4ASUA 5J1SB 1PX2A 2L2QA 2O50A 2O2DA 1JR4A 3GJTA 1JQBA 3MT8A 3D31A 4LMPA 3K8ZA 3SN6A 1I7DA 4J0FA 4L3WA 1P2DA 5FI2A 1CRZA 2JC3A 4YS6A 1QO0A 1PX0A 3W4IA 1FDTA 3MMPA 4I5KA 1JUDA 5A3JA 5KU1A 5CFOA 4E2XA 3FRJA 2IWHA 1A4RA 2GZDA 1XGKA 3UWSA 5M2QA 3G5UA 3ZGXA 2O7SA 4M46A 2GCIA 1OXMA 3HYCA 3EN0A 2WTUA 4QBGB 2PL1A 1LQTA 4O4IA 1BMDA 1Q7GA 5J47A 4B35A 4C4YA 2F3SA 3WLHA 2PGNA 4W5WA 3CX7A 5BUQA 3LTEA 1W87A 1WY5A 2GBLA 3SEZA 1S8AA 3QKSA 3WWYA 1HYGA 4NHOA 1YS6A 3H5IA 1KMHA 1TT7A 1QZTA 2VSOA 3AXSA 2Q5IA 3GAMA 3P9RA 4RK1A 5A2GA 3PALA 1TLLA 2VSQA 4Q39A 3CCBA 3ACDA 1L5NA 3VYVA 2J85A 4YMSA 1SB8A 4Q9IA 3H2IA 5DHFA 2P11A 2EF0A 3OMLA 4JB0A 1Y1UA 3AU8A 3DL7A 3SSOA 5HRUA 3R5KA 3LCMA 2XD4A 2NV0A 3X44A 4C22A 4N3BA 1WZNA 4G5YA 2LR0A 3KQSA 5FWNA 3UAGA 4YLYA 4QUHA 1MAVA 4DR4B 2DULA 1H69A 1L7VC 2OCKA 1SQ5A 4PQFA 1YR5A 2M0RA 3IVGA 4UHBA 1OZSA 4HDRA 2GPSA 3OQMA 1Q16A 3A7EA 3TOXA 3OC0A 4J49A 3LT4A 1JTFA 4MQLA 3HYSA 1PCXA 3NNDA 3ZDXB 3RSLA 2OC4A 1XF1A 2YXDA 4F5ZA 1NOJA 3FY4A 1NJ6A 4ZOCA 3KLPX 2R7AA 4ER3A 3WGUA 3V2LA 3SYKA 5TGZA 2M98A 3NVMB 3LHSA 4HNRA 3IERA 3JCZA 4YJGA 4IGEA 4WTOA 2NUTA 3JU3A 1Z4HA 1R2UA 3UO9A 3SIWA 5HIJA 2AKYA 4BNUA 3PL1A 1E1RD 3LA6A 4CW7A 1K8QA 3VNAA 3HJUA 5HX7A 1WBJB 2VUUA 2DJIA 3WZMA 2BFNA 1I36A 2HJSA 4HATA 4IJQA 3NVKI 4AUEA 3P2OA 1T24A 3KB8A 5BN4B 2J7PD 3U39A 1L1QA 3KETA 2F1RA 1MENA 2BR4A 2EJVA 2IOFK 5TE9A 1D2HA 4B6FA 1BX0A 3S44A 2EHBA 1OKKA 1JQJC 3BTOA 4GUAA 1Y4SA 4IWXA 3U49A 4PSVA 3A37A 2F67A 2NXNA 2WPNA 1CR2A 3B86A 2JFPA 3DBRA 1O95D 3WLFA 2KWIA 1MIOB 1TUZA 4DCTA 3KUUA 3UV7A 1MVNA 1YR8A 1TYAE 1N1DA 4YAIA 3L0ZA 3RF7A 3TS1A 1VHLA 4Z3KA 2H0RA 10MHA 2MSEB 2CZCA 4N18A 4QNMA 3EVUA 2D2FA 1I4DD 3CNOA 1E1QA 1YZLA 2YN2A 2OZVA 2VK8A 5CDFA 1RKUA 2GZ1A 1UDBA 2BEJA 3TIVA 2ZUCA 4HDNA 1XZGA 2IYYA 1A8QA 5KTSA 5K99A 2IODA 1G6OA 1QIMA 3G2QA 4WLVA 5AERA 3EVFA 1V8FA 3X3HA 3GFSA 3M6VA 2YXEA 2WAXA 2AOXA 2NN3C 3O3OB 1M6HA 4B47A 3GEMA 3OO1A 5JASA 3DT8A 4AOMA 3T7AA 3TG8A 3DFFA 4PSAA 3CGWA 1M83A 1MB0A 2BZ1A 2V1UA 2OTCA 1R5NA 4MW7A 1WOYA 4ZOEA 3UJAA 2NO6A 4M0LA 3SC4A 2YV3A 5DE3A 3STVA 4BLTA 2E37A 3K4QA 4LHYA 1JEQB 4B80A 4TMFA 1GA4A 4A1FA 1S3GA 2QJWA 4LOAA 3AHEA 3II6X 3JPYA 3H4IA 4WAUA 1YBVA 3LE8A 1OWLA 1XOIA 1T29A 5JAIA 2JJ8A 3QWAA 2ILTA 1WMAA 3JQQA 1R10A 4BFUA 5FH9A 3A9SA 2H4JA 1RTKA 4Q4LA 3MWYW 1CQIB 1M74A 5K8UA 4EITA 1F0YA 1DC8A 3D4NA 1Z7YA 2FWAA 4AROA 4KCGA 5E4JA 3R0JA 3DNMA 1BE1A 1CUSA 1RXCA 1CVIA 1S5GY 4JI0B 1Q3HA 1DPGA 4TYQA 1JLMA 2X9GA 3FF4A 1Y3IA 1J9ZA 3U80A 3NV9A 3QEOA 3C1UA 2XADA 3OEWA 3T3NA 3WWOA 2Q6VA 5EWMB 2QUJA 1LC0A 3TQSA 3LC0A 2J0SA 4E1AA 2BEKA 1YMVA 4UE2A 2LHLA 1OI2A 3RUIA 4AKHA 2PBFA 3AHDA 3EXEA 4IX9A 2R6JA 5T4EA 3GDGA 2DKNA 2O59A 1ZJWA 5A03A 2ZG6A 2X41A 3DMYA 4JEIA 3BWEA 3JZDA 4AY6A 1E7SA 1UMBA 5K3EA 1MB4A 3UJBA 2JEYA 1WR8A 2C07A 3UUFA 1XTQA 1R00A 2IGTA 3M89A 1UBTS 3V8BA 3FMPB 4U1RA 1K7CA 1JE0A 4G8BA 4YCBA 1UBSB 5CCBA 2WZCA 2AHOA 1OPXA 4OJTA 4MRXA 4EFDA 2L0PA 3GMTA 1GGVA 4BEWA 5B1EA 2G1UA 2PKQP 1SL7A 3U40A 4BEBA 1C2TA 1W73A 3MB8A 2Y68A 3RIHA 3MOGA 1GITA 1J00A 4HX9A 4DBVO 4ORCB 3P9YA 2W2NA 1T2DA 1E1LA 4MIEA 4AQJA 1JH8A 5JG7A 4X45A 1GM0A 5M29A 4J0IA 3F4LA 3T0IA 3PXCX 3KVYA 3K5WA 4ZOLF 3IV9A 1LCIA 5KO2A 3IPLA 4MKZA 3NKVA 3KT6A 5B3JC 3PTLA 5ECGC 1AURA 1ZCAA 2PANA 3KQHA 5JJ5A 2YXBA 2Y92A 2QD1A 3FUTA 3NIBA 4WIAA 2ACVA 1ZUIA 4DUZB 1OLXA 4AXXA 3Q6MA 4TTRA 2FZVA 1VSQA 4HREE 2XLCA 4L6IA 4H3KB 4P7BA 5BNTA 2YC4C 4PBTA 2R87A 3V7FA 3O1LA 4WXYB 4JLJA 4L4ZA 1A2OA 1V3VA 2DUWA 4K9MA 4A2PA 1G7TA 4RGVA 3LS2A 4IIJF 1CQJA 2JAHA 4TT3D 1R4AA 2VJPA 2IHVA 2QZ4A 4RM2A 4OJYA 1KEKA 1Q1AA 2O8DB 4H77A 5KNCH 1TMYA 4PU0A 1CQPA 3AJ8A 5C53B 3HJRA 1PU2A 4JJ7A 1KDVA 1FP4B 3H4SE 4IDNA 2MMGA 2YUTA 2H59A 4MGZR 5H81A 1JHOA 2HDHA 4NV0A 2GYWA 5ALHA 4URZR 2H65A 1UEIA 3DQZA 3LRXA 4R31A 1HL3A 3FSEA 1X6VA 4MAMA 3CTNA 5BSEA 3DV0B 2OZLB 5B64A 3AI3A 3BSYA 5D8DA 2NLOA 2VH5R 3QPDA 2GV5A 3W2TA 5CSFA 5K0JA 4WFIA 2F1HA 2YY7A 1MBZA 4NIMA 4P35A 3DYBA 1R16A 5TARA 1YKGA 2NGRA 2XAAA 3G8BA 2YHAA 1MEOA 2C0PA 1P7ZA 4E5YA 4NPAA 1CW2B 4B7UA 1QF7A 4C5CA 2CD9A 7REQB 1UDRA 3VVCA 3Q8LA 8GPBA 2IEIA 2VJAA 5EKUA 1XJCA 4FBLA 1GNTA 2FU5C 1IIOA 3WKEA 3TAUA 3O8NA 5KJFA 1A2QA 3CKMA 4JB2A 4TS4A 3VZQA 1S4QA 1KVSA 4RGBA 1GRQA 2AMFA 2ZEJA 5DP2A 4QTYA 1DJIA 3OKPA 4YXWD 4YDRA 1N2BA 2LMUA 3C3PA 3A6EA 3ZWCA 2RHDA 3LK6A 1RAFA 4LRUA 4PNEA 3UG6A 1EAMA 4YRQA 1F48A 3DXXA 4L75A 2KLDA 4Z51A 1KO7A 3MILA 4PHMA 4YJ2B 1E3EA 3IXLA 3PJDA 3L5OA 1LX7A 3V4OA 1I1QB 4TUYB 4K1XA 4YRTA 2H2WA 4TV8F 1EI9A 3KSDO 4WN3A 4ONEA 4J94A 4HG2A 2PS3A 1Q2XA 1CB0A 4L3VA 4HNQA 3VH1A 1NSHA 5HOQA 4NU0A 1U0NA 3FKSA 3B3AA 4J7XA 1V48A 1K8ZB 2QUHA 3NR2A 5FPQA 5CDYA 4JLMA 5SZHB 3L0PA 4EJMA 1K6XA 4CG3A 3RKRA 4JMPA 1QYXA 2AR0A 2G04A 1QOQB 2JFWA 4Q7QA 4PTZA 1UJCA 5GADl 4LC1A 4KQ6A 4RYDA 4MCAA 5E1MA 3HP1A 2H0QA 5HFJA 4KXMA 3IJEB 1YDMA 3HBAA 5HLOA 4CKWA 4NXNB 1CEEA 5L7YA 1O03A 1NMEA 1WB5A 3T61A 2OCXA 3FB1A 1R18A 1LS1A 1FTSA 2B3TA 3FA2A 3U6KA 2I2FA 1WP9A 2W2OA 3IF7A 4EKEA 2WF7A 4M8IA 4NNJA 5AI5A 4US0R 3AF4A 3B8EA 3NWJA 3HBLA 1E59A 3AR6A 3FZNA 4BKUA 5F7XA 3HG7A 1X8LA 3RYIB 3OMXA 5CT9A 3L7MA 3MJDA 1JJ7A 2AL7A 2CNNA 2ZTLA 1V39A 3L46A 1UXIA 1UKBA 1A4XA 1NX0A 4RD4A 4MGKR 1F3OA 4Y2UA 5BY2A 3GLHB 3KP1A 1IL0A 3RT7A 4TLCA 4DNPA 2OZKA 4FOSA 3IQOA 4I5IA 4FKZA 1CDLA 4JQOA 1BR4B 2JJYA 4R98A 3QMMA 3BMQB 1K7XB 2YJ3A 4EA9A 1Y8RB 1ELOA 2D1YA 5KVAA 4XD7D 4EW3A 3I2GA 3JQCA 3OQIA 4EQZA 3N8HA 5ELXA 3LDGA 2XODA 1CEYA 5JVDB 3OJ0A 4J7AA 2NNWB 5K8TA 1DRKA 3T1YB 2QAIA 3FG9A 4OKHA 4YROA 1NYQA 1RDFA 4QJIA 1NVFA 3OPVA 4RFLA 3T5GA 4A8JA 1AKMA 4F93B 2F4NA 2EATA 4OO3A 5AK6A 3WL5A 3RVPA 3BUXB 2Q4EA 4B6PA 2C5BA 1XDUA 1TCAA 3F9RA 3ZZTA 3ZHBA 3W5AA 3FCEA 1V2HE 2HLPA 1EHIA 3SFTA 4XCVA 2ZJAA 4EI7A 2ZYDA 2D8NA 5LXTB 2GBPA 4RELA 5SYAA 2WSYB 3VOAA 4QPCA 2Y8EA 1KY2A 5BSTA 2FY8A 1T0UA 1INLA 1UPAA 3K92A 5AMXA 3OWXA 3D10A 4WACA 3OD5A 3AHHA 4NOMA 1XQ9A 4AY3A 2NZ8A 4WLFA 4J0JA 5CG2A 1DC5A 2P8JA 3ZS8A 1R0YA 4BJ3A 2BFBA 1ID8A 2OB2A 3IVAA 1GZSA 1SIOA 3TOCA 2ZBFA 2O8EB 4X1IB 1NNLA 1DUIA 4MUAA 4BX9A 5M34A 4C7BA 2J6BA 3IUBA 1RAHA 1T5IA 1YV9A 3B7GA 1PR1A 3X1XA 4UU8A 3FNHA 4R8SA 2GHQA 1TJ4A 4EUKA 4PXYA 2JNFA 4BP3A 4O1MA 3C5VA 4X1OA 3THWB 2WJGA 4RHCA 3PB3A 3WLJA 4OQNA 4O2AF 2XB9A 4FI3C 2XD9A 1HTBA 1N32B 1QMPA 4C20A 3LM8A 1RWYA 3UJ8A 1LBSA 1KJWA 4MS4A 4RDIA 5KSZA 2QTHA 2AFHA 1WHTB 1BVRA 2WTEA 5A6SA 1ZD4A 3UMMA 1F17A 2H2AA 2RGBA 5JXWA 4R1OA 4ZYXA 4UCQA 3RJ9A 4PYRA 1J2TA 2HIAA 4M1ZA 5CLIA 2Q5JA 4NQGA 3E48A 1QV0A 2VYFA 1OW4A 3HVKA 1GZ6A 3UGKA 3A9TA 2XXAB 3N8IA 1D1SA 4MKXA 4D9FA 1LKJA 4ESOA 3AI7A 5L6LB 1M1XB 5C1PA 4I5GA 1QGYA 4HAYA 4GXTA 4WZAA 3DFKA 3BCSA 3EARA 1E99A 2PV7A 3I5XA 2JH8A 4K8RB 5H82A 5EHGA 1Y1TA 3GLIE 1F51E 1S9DA 3ZV7A 1E8MA 3Q3IA 4DV1B 3D02A 3GRFA 5JSZB 3CRRA 3GLVA 4DN6A 3E0XA 4ZO7A 3RTGA 4AJ9A 1Y48E 1SVSA 4FQOA 2O3JA 3AR9A 2P9GA 3CBGA 3QWHA 5HGXA 1L9XA 2R86A 2GZRA 1XDBA 2VHUA 3HFGA 3H7AA 2Q9CA 3QKTA 1VZ3A 5JQGF 4KW7A 1US8A 2M29A 3TUJC 1V3UA 3L0YA 1KWKA 2VSXA 3EGVA 4BUCA 4L74A 1WRLA 4KXVA 4XR9A 1MNQA 1IUPA 3IGFA 5ESWA 5KTTA 2O3SA 4HVAA 4W1SA 1EXNA 1JMVA 4ZREA 3P0IA 2X5JO 1QLSA 1NF9A 1VP3A 4Y1EA 5DBGA 3SIBA 2DPGA 5E9WA 4K05A 4M1TA 5DCUA 1R7RA 4Q6WA 3OU2A 3U3ZA 1M45A 1UM9A 5B30A 5EJ4A 3TW4A 4HB3A 1TW2A 4XVCA 1U0SY 4JDUA 5EZSA 2IYSA 1HY3A 1T35A 4U2DA 3WMFA 2LVJA 3SF0A 3VJRA 3CRZA 2NSLA 4BUZA 1XWIA 3DTVD 3UWKA 2BF7A 1LDEA 1EGQA 5BQ3A 4RQAA 3P2EA 1Z06A 5LP6C 3OOYA 2N9UA 3QWIA 4KWTA 3QEAZ 4Y6PA 3T9DA 3RLIA 4YT4A 4JT8A 3N0RA 3EVRA 3TR0A 3PKZA 2C7GA 2ODPA 1Y37A 3RC3A 4PTYA 4LPKA 4DT1A 3OE7A 2FG6C 3TQQA 1IZ7A 1N4DA 3EVDA 5FD8A 3A4LA 4G4GA 3PPIA 1DAOA 4LSMA 4RACA 1G3RA 4P80A 2HU5A 4AMYA 3V4VB 1OX6A 1I80A 1C9DB 2FPUA 1AUPA 4P33A 5AW6A 2G4VA 4N0PA 1E3QA 3D7SA 4MULA 1GCOA 4PPNA 4KL8S 1GQOA 1CFZA 3NI2A 3WQSB 1GSAA 4PG5A 2E4WA 1X7YA 2ZB3A 2CUNA 4F0JA 3KEMA 3DMRA 1P9NA 1G8GA 4NZPA 1VYTA 2HRZA 1T0IA 2UYQA 4URYR 4HP8A 3KZXA 5ALTA 1N6HA 1NMQA 1U80A 4C29A 5JALA 1QP8A 1ZHOA 1HT1E 1P4AA 3K9GA 1E2NA 2HPSA 2XH8A 2P41A 3PHJA 3ZDRA 4FS8A 3O82A 1C1HA 4NG4A 4RIHA 5J2UF 2Y9MB 3UAXA 5TPZD 1QZUA 4Z4HA 1P5FA 3H2SA 5CP8A 2CSXA 1C3VA 1U2DA 5FV7A 3OP0A 1BXGB 2PUCA 2ZYIA 3HDJA 4F9TA 3LO5A 1Q84A 2IZ1A 4UUQA 3GUZA 4S05A 2XWBF 5EP4A 1JIKA 1EK2A 5JH7B 3AY3A 3N0VA 4D9KA 3GZNA 1N3IA 4G01B 1ARZA 3NHMA 5A3QA 2YIDA 4CIAA 1O4WA 2FETA 2WHPA 2H2KA 3FHOA 4CT4B 4LJKA 3UGJA 2O7QA 1QF9A 3MJ4A 1GP2A 2IU3A 4C7OB 3WA7A 2W6ID 2V7BA 3AW8A 1EDOA 2OD7A 1XDZA 1WPXA 1XA0A 1XTSA 2QGNA 4KYVA 4O2BF 3S4YA 3S2IA 2O2YA 4ZVVA 3EMBA 4YUYA 4AY5A 4OV2A 2D54A 3T3HA 3GRRA 2XY4A 3RLZA 1RQ2A 4PX2A 2BL4A 2GXSA 1A29A 1WMDA 1RK9A 1LZKA 1M34A 2PZKA 1U9ZA 2JANA 5H7XA 2MHCA 3CLTD 5EI5A 3LNCA 4K6GA 4MUHA 1DKNA 3H9CA 3FVVA 3P45A 3FFBA 4DSTA 3H5WA 3BM5A 1I2CA 1JXQA 1C14A 2WJ3A 2C5AA 4C0HA 2BCGY 1YQXA 3CEAA 1KOJA 2XF2A 1LV8A 4CGYA 2A0XA 3GW8A 1QK3A 1WB4A 2XMSA 1C4WA 3QUCA 2PUWA 4WXEA 1YRTB 1TFUA 3GU3A 4A2CA 3HKDA 1DTWB 4I0WB 3F45A 3TTSA 2CLEB 3KT8A 1AS2A 3FYUB 2DFVA 4O8CA 2CCGA 2AD1A 1UFQA 4KTTE 1DKLA 4OHPA 4AB1A 2RI0A 4BGEA 1DXYA 4JBXA 2HN9A 5IBPA 1P0MA 1NQWA 2GCPA 1GRNA 4B4KA 4FHFA 1LS6A 2H8GA 3BUNB 5ITSA 1UQUA 2HR1A 1WP4A 4EW1A 4C0QC 1RS0A 1Z4PX 3JWPA 3FTPA 5AJVB 4PIVA 4DARA 2KW5A 1NLMA 1ISJA 1FZTA 4MPDA 4BY4A 4J76A 2VHYA 1BQ3A 4X3PA 3D78A 5LYYA 3PXDA 3NHIA 4KR7A 4MR8A 1L1FA 5BRNA 3A26A 3ZVNA 1K5HA 3HV0A 4CFYA 3CW8X 3QF4A 1MLDA 2ZN8A 5COBA 1A9SA 3T3PB 1W47A 4YAOA 1JQKA 2HQ1A 3LW8A 3C6KA 4IXMA 1A9OA 4Z0HO 5LJIA 2Q27A 2LAPA 4MJ7A 4DGQA 4DPKA 5C8XA 1IMJA 3ECAA 1KI9A 1GFZA 3PC2A 1GKKA 3HVHA 5HR5A 3DONA 3TSWA 4U7JA 1WAMA 3BH7A 2RONA 3HJGA 4MW4A 3Q9UA 2VDUE 1IQUA 3EZ9A 3EGXB 1S3FA 4WH0A 1JPNA 2Q7OE 1EA5A 2B1IA 4B5LA 1D1QA 2ZXUA 2FVYA 4QPPA 4FEGA 2AKAB 1P5RA 1ZXBA 1JQEA 1OD6A 1ZBDA 4EKIA 1Q17A 5IXSA 3MWKA 3BSSA 3UYLA 3D3WA 5AHWA 3UCEA 1FMCA 2NUPA 821PA 4XVQA 1JEEA 2XCLA 2QVCA 4AJPA 3VTKA 1XFZO 3WDMA 3RC9A 3C48A 5FFFA 4B2IA 2FMKA 2R4TA 4G8DA 2WVJA 3P96A 4FFRA 2CXRA 3ZHZA 4QTTB 4I55B 2NU8B 1FW8A 4BQFA 4CLOB 3K1ZA 3DBLA 4QFCA 2NVWA 3S8EA 4BAUA 1Z0ZA 3NPMA 3AVUA 2AF3C 4A4CA 5LNK1 1RI3A 4JUDX 4F6LA 4P0PB 3WWCA 4EUSA 2DGDA 5LKAA 3DDOA 1TF5A 4L51A 5CH3A 1CQXA 2QM0A 3WLSA 1FJXA 5E7IA 3M8KA 3JR7A 2ZLBA 5FO0A 3LGXA 1XT6A 1I2BA 5K0SA 4FB5A 5I3CA 3HWSA 4Q1AA 5EUQB 4KOEC 3ZZ1A 3OOEA 1UPTA 4Q37A 4FGLA 1Z0UA 3KL4A 1WCWA 1EE2A 4M60A 4KDFA 2XHZA 4CKBB 5B3AA 4JLVA 1WVMA 1J1EA 2GZAA 4L22A 3UAVA 1XRNA 1G60A 1RYDA 1W49A 1J49A 3ZK8A 4HFRA 4QXRA 2OGTA 3UFXB 3AM5A 2DCMA 3T35A 1K5PA 3NH6A 2CLOB 4JCCA 1LPSA 3UNWA 1Y1LA 1YFLA 3E8MA 4JC4A 5EWJA 1DKRA 1SC1A 2LTAA 4S35A 1T3HA 3WNCA 1QATA 4RFSB 3Q3JB 1U8AA 2WG2A 4BQQA 3OQBA 5DN6A 3UJPA 1YH3A 2O0MA 2YWDA 1MPXA 3FS7A 1THMA 1ADJA 3ZE9A 1R0LA 2WTBA 1I10A 4HGNA 1G7SA 1RIFA 3CE6A 4XAQA 2OPHA 1UHKA 1L2OC 3H16A 4ZV9A 1TQ8A 1XRRA 5IT4A 3C45A 3O7MA 1D2MA 2IOYA 3CLHA 3WYEA 4HS9A 2VG8A 3VNUA 1NX9A 2NP7A 1J39A 3GNQA 1A8IA 2R8PA 1CY8A 2FN8A 2AFHE 2XYHA 2WJ6A 2JJ2A 2XUJA 3RYCA 1GR0A 1N77A 2R25B 3AHCA 3B52X 3ZWKA 3IQDB 3OCVA 3WYAA 2NZUG 1JL3A 121PA 1QS0B 2OVBA 1U1EA 3KT3A 3WB1A 2A1UA 1Z8HA 2RH4A 3W7BA 3MOSA 1QFXA 2C31A 1IFXA 2VP9A 5E6UB 4WZBE 3MJEA 3Q9LA 4I4TB 3EQ6A 5KYXA 4TYYA 4PLCA 3KJFA 3T1TA 3QEKA 1AA9A 3B1XA 2JGAA 5CAEA 2CV0A 3DEFA 2O48X 4WZAE 3ET4A 1BDIA 4LYEA 3IIJA 1KMQA 1I51A 3GK3A 5BMVA 3NOVA 3RS8A 4N49A 4DSZA 4MVJA 4OQLA 5CTJA 3LV8A 2FPRA 4NQRA 1LY1A 4G3XA 2PUAA 1Y4AE 5CDGA 3CZRA 2VHJA 1RW4A 2Q2NA 3W8NA 3AEQB 1IJEA 4W5RA 1AU9A 3E9MA 4P6VF 4ECAA 2OCBA 2PMCA 5KMGA 3QU2A 2QL5A 3BVPA 1VIAA 2A9JA 1CZKA 1QCZA 2Z6VA 1L8XA 2CB9A 4W6QA 4N8SA 4GVXA 3L8GA 3O47A 5EXDA 1IXRC 4RESA 1C4OA 2QE6A 2R60A 1XE3A 3ZLVA 3MELA 1VRKA 1QTIA 4XB6B 2NVUA 1CIJA 1PNTA 4NJMB 2MLFC 2CXHA 1G8SA 5K0ZA 3QXGA 1Z07A 3HEMA 1Z4IA 1PK7A 3E0QA 2H4FA 2HA2A 2RKBA 1CULC 4DCCA 4GBGA 1T3SA 5FPKA 1DIRA 3JZFA 1HE5A 1DBRA 2V7VA 1H66A 2PZ8A 3EA4A 3U4GA 3DAFA 3R6WA 3M4ZA 1UFOA 3HCEA 3ECSA 1Y1RA 1U1IA 1J1ZA 4BMNA 3T1OA 1RJFA 5C5IA 2RB5A 2IL1A 1R3UA 2I3AA 4DKJA 2CBGA 2OD2A 2Q9UA 2PS1A 1J33A 1BXRB 3W5BA 3EIOA 1GTVA 3QEMA 2FJ0A 2NP6A 2PSJA 4JS0A 3MWDB 4GAEA 1E5DA 4U2CA 2EX4A 1NHGA 1UDWA 2Z9DA 3B5EA 4HNAA 3MCWA 2V6IA 4UU1A 1U99A 1PSBA 1J7RA 1DO0A 4MWEA 5DW0A 5FUWA 4M2PA 1TD9A 3WLRA 2VPQA 2RAPA 2GGMA 4ZICA 1JFKA 3FCXA 4FCWA 1RAAA 2H4YA 3R5FA 1W9MA 1C2YA 1F1JA 4XYGA 5PNTA 4CG2A 1KIFA 3UC9A 3FUXA 1HYEA 4GMDA 3NFYA 3N07A 1TIKA 2BFCB 4ANFA 5KVQA 4HUQB 3PQ2A 1XMOB 3AKEA 3ILHA 2ZJ5A 4OX9Y 1JVBA 3OURA 1E1CA 1QR6A 2P9FA 3CC8A 1OF1A 3U44A 1THGA 4W9NA 2EJWA 3H2BA 2J31A 3ZPXA 4N7RA 1XQ6A 2XOKA 4DIUA 1E62A 3C3JA 2J6IA 3TLEA 2JIOA 3Q0IA 2DSNA 4X93A 3CONA 3TLMA 4K2HA 5IAOA 2OZPA 1ZNZA 4PHCA 3PUIA 3DOEA 1XTJA 1XCPA 1UHNA 5CPFA 4AICA 4DTIA 2BKHB 4EL5A 3E1SA 1F5NA 5DN9A 4LZZA 1TO1E 4R8KA 1ZIDA 2YMPA 3TZEA 2EKDA 6REQA 4GU5A 3M70A 3D4LA 5KAMA 3ADKA 3K2EA 2BMWA 4WWHA 4NI5A 4HT3B 2QI9C 2WM2A 3HJBA 2QR5A 2HHLA 1DMOA 4RETA 4NULA 5DRTA 3TBFA 2V7EA 1Z0IA 1X7ZA 2ETVA 4C0XA 2ERYA 1Z7BA 2VHTA 3KOXA 1RM4A 2FE4A 5HKOA 5JPDA 2VP6A 4UVGA 1CE8A 2H1CA 1PG0A 5ER6A 2UUBB 4BMCA 6AT1A 3JAKA 3AVYA 2FJPA 3AVWA 4RNCA 4MNTA 4KE7A 4PZ0A 2EU8A 1XC7A 2WBLC 2Q5HA 3T4UA 3NORA 1DKUA 1ZNXA 1QHHB 1W48A 1PV4A 4XWOA 3A1FA 3GHHA 5DHRA 4UNQA 2CCKA 2QRVA 3PATA 1VHTA 4G9BA 3M6AA 5CVVA 2R1VA 5DTRA 2ES4A 5HCUA 1VPEA 4HWSA 5CEFA 4WXPA 2BFEA 3QE0A 4G5OA 4U7PB 2B37A 3GUHA 5REQA 4F46A 4P2GA 2GN4A 2JQ6A 1MR3F 5DTIA 2RD2A 3VO8A 2G88A 2PUHA 3CRVA 4OXNA 2X0DA 3EPPA 4TWZA 5C1BA 1SVLA 1IU9A 5TEVA 3K9LA 4YJ2F 1HQVA 5AVTA 1H4VB 3O8OA 2V96A 4B84A 1QVWA 4TUYF 4Z0TA 2PZLA 1KRHA 4BNYA 1M1NB 1IMOA 4WRIA 4RHXA 5DMXA 4G1UC 3VNBA 3O93A 1LTQA 3NC4A 3KD3A 5H4HA 3I5IC 5E1OA 3HCPA 2HNBA 4XIJA 2WWYA 2ZRTA 1N65A 3ONEA 3OU7A 2P71A 3FWPA 5BSVA 1RYEA 3ZHQA 2M6SA 3WFJA 3F6SA 1JR6A 4I4LA 3RVBA 5EA2A 1QG4A 3OTGA 2H4WA 1MABA 2ZKLA 4TVOA 1S6CA 4FR5A 4TRMA 8MHTA 4E13A 2FR0A 2JZCA 4A16A 1MX3A 3IFSA 4ZJZA 5I7UA 3KKPA 2IS2A 4BVFA 4WE3A 3C6MA 3SX0A 3WADA 4EKNB 1PTJC 4O25A 2C2YA 1EFUA 1ISRA 2R0QC 2F1JA 1GU7A