1DELA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp and amp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
241
Chain Sequence
MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Phosphotransferase
total genus 85
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1delA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1delA01
4YDSA 3LXRA 1RJ9A 3LFUA 4FINA 3A1UA 4PAMA 4C2TA 2VSXA 4YMTA 1AKEA 4ZI3A 5FBQB 5EXPA 1W36B 1J7KA 1D9ZA 1QHIA 1Q3TA 2BBTA 3MGCA 4KBGA 2ZXUA 3EZ2A 4V0LA 2XNDA 2IYVA 4JL8A 4MQBA 1AS3A 5AUQA 1YZNA 1MT0A 1JAIA 3AP1A 2OFWA 4UKDA 3REFA 4XWAA 1HY3A 1XF9A 2A78A 4P4SB 2C9OA 2Y8EA 5EJEA 1T5LA 2J46A 1PLJA 2WICA 4M2LA 5HCIA 5BYJA 3TUIC 2ZIAA 2GXQA 3QF4A 3NHAA 3LBNA 1JNYA 3LLMA 2GEVA 1GVNB 2AD5A 4W7SA 4C9BA 4D0NA 2IA5A 4I1SA 4W9MC 1KSJA 1GZSA 3EX7C 3AVTA 4A0GA 5DLQC 1JEDA 5E7MA 1CRQA 4LZZA 4PSVA 4TYWA 2ZI4A 4QNMA 1BOFA 5LPNA 4PHTA 1Z6AA 3QVUA 4OI0A 1DAHA 5JLJA 4M1SA 3LAWA 1PVOA 4G5QA 1OKKD 1WRBA 3WNBA 1OB2A 2DR3A 4FW9A 4TQAA 2GESA 1YR7A 4A8JC 3IPYA 4KFUA 3K70D 3ZLJA 5KNDA 2JIZD 3CW2A 4KJZA 3T1OA 2O0KA 1UJ2A 1SKYB 4FMBB 4L4UA 4AY2A 1OHHA 5AUNB 3GLIB 3PEVA 4Y0AA 5HCNA 2OLKA 3K0CA 3P4YA 2CVFA 2Z5FA 1XTRA 3E5HA 4Q03A 4G3XA 3EWSA 5J4YA 3GP8A 1IN6A 4IDQA 3U44A 3K53A 3DO6A 4URZR 3D3QA 3IBYA 1MRNA 1GDDA 4JT2A 3AKDA 4QKQA 4IHQA 4ACBA 2GXSA 2BIFA 2ZITA 2D2EA 4G01B 4UJ3A 2ZRDA 1TQ4A 1EGAA 2QMHA 3G82C 3QIAA 4Q7LA 5EZ5A 1E1RA 2F6RA 2ZRAA 1M8PA 1RRFA 4IDOA 3CX6A 4KXFB 3SU8A 3WYGA 5DHFA 3T12A 4ZI2A 5B57C 3B1ZA 2V9PA 4QHSA 1M2OB 4TLAA 4KYUA 1KDRA 1R7RA 3MSXA 4TN1A 5J4LA 3EPKA 3THYB 1E9CA 1EFRA 4KLZA 4NYMQ 4CVNA 1G18A 1JXOA 1T4GA 1YR9A 5CB8A 4F93B 1BIFA 2QAJA 4MGYR 1ZM9A 2NGRA 3Q85A 3I62A 2Z4SA 2BM0A 4HUQA 3TAUA 1SVWA 1LV7A 4LUCA 2NO9A 4RVCA 1XJ0A 1NJGA 2ZRPA 5EP1A 1E0SA 2EU8A 2H8KA 4DKXA 2WZQA 3Q72A 1K6MA 5M04A 4E03A 2JAQA 4LV5B 4MYCA 4M21A 1GRRA 3U2QA 4NE2A 4D80A 1P4SA 2JJ1A 3REGA 4FMCF 4PHFA 2RHDA 3MD0A 4O2LA 2IXGA 4PC7A 3PEUA 4ZV4A 4AYXA 1EX7A 4X8HA 4BGDA 1TL7C 1E0JA 1A2BA 2R6GA 5CM8B 4V0ME 3RAPR 1IY2A 3LLUA 4PO8A 4KVGA 2ZAMA 1XD9A 1N6KA 3GLFA 2QUZA 1FQKA 2C03A 2CL0X 3CZQA 1M34E 1QVRA 1CP2A 4PZZA 1WB9A 1FL9A 1Z6XA 4X8LA 3P26A 4LJYA 1BO6A 3GLFE 3FGNA 4XVUA 4CIDA 1SULA 4B2PA 2XAUA 2P67A 5JJKA 4KODA 1P61B 1SVMA 3N5CA 1RYHA 3TLXA 5CK4A 4Q4AB 3LQQA 2O8CA 3K70B 1Z63A 2IW3A 1W5SA 2J0VA 3CM0A 1FX0B 2QTFA 5FUYA 3ASYA 4Z8XA 3CF6R 2NZ8A 2GAAA 3CPJB 5FOSA 1UEJA 2EW1A 4B74A 5BW8A 2BDTA 2WKPA 3WRXC 2IX3A 2O8EA 4KAXA 4TL7A 2W58A 4HZUA 2V7QA 2J87A 5JWOA 1N3BA 1P6XA 3EWAA 4MKFA 2QE7D 2NPIA 1GNRA 4MRVA 4BECA 3IHLA 1AQUA 2ONKA 5FTJA 4L9SA 1OXSC 4D82A 2GJKA 4JLBA 5IT5A 3BC1A 4PC2A 2GRJA 2YZ2A 1G3UA 4C4PA 4NCKA 4W5WA 3ZIAA 2FSFA 3FFAA 1J99A 5KSPA 3U3JA 1F2TA 3BBPA 4BRWA 2B7BA 1U9IC 1II8A 2F9MA 1N5LA 2ZUBA 4QHYA 4Q9HA 2ODEA 4B76A 8OHMA 5FTLA 2VA8A 1W7AA 1SXJD 5F9FA 2DBYA 1LY1A 4OI2A 4IOLA 4OJQA 1ELOA 1HV8A 1E94E 1S1CA 3QG1A 2TMKA 4HEJA 4Q18A 3LBHA 3L0SA 3NEJA 2FN4A 3EIHA 2VTKA 4TMZA 3OIYA 3QXXA 4RJLA 5LB2A 2RGNA 4TLBA 2G88A 4W5JA 2GJ8A 2ZU0C 1UKEA 2ZRBA 1DG3A 1C4OA 2DPXA 1U2RA 2UZIR 2ZSEA 4ZDKA 2GXUA 1VG0B 2RGDA 2FSGA 4RD2A 2PEYA 1RRCA 1CJVC 1DAMA 1GRQA 4KI0A 2P6RA 4AG6A 1U94A 1FP6A 2GEUA 2ZS7A 5TDHA 1XEWY 5IF9A 3FHCB 3GLHE 5CYOA 3GJ0A 2XEXA 4OI1A 1SKQA 2C9CA 4JLOA 4QJ4A 3V4RA 3T06B 1E2HA 2GZHA 4ITRC 3AF3A 2X1VA 5L3SA 4Q21A 3C41J 1Q1QA 1L4UA 2QORA 3PFIA 3ZZTA 1Z08A 3VHXA 3OIWA 3TK1A 2XZPA 4XH9B 1KMQA 4EJSB 2ZR9A 3QEJA 3SN6A 4PHHA 5FH9A 1JXMA 1BYUA 1VCIA 4JLJA 4PO1A 4LJAA 4TMWA 3X1XA 5E3HA 1RYFA 4OJKA 3C16C 3QNUA 2GVZC 4PQFA 1DAGA 3C5HA 2I1QA 3W5IA 2XXAA 4A15A 4IVQA 2AFIE 5IK2D 3QKUA 2IYZA 2LWIA 3Q7PA 2C98A 4M1MA 2A7QA 3ND8A 2VP0A 3AM1A 1OF1A 2OLJA 1AK2A 3N70A 1ZD1A 3NBFA 4YXWD 2IYTA 1SXJB 5GVSA 2OHFA 3RYTC 4IDHA 3T5DA 1CU1A 2DFTA 2P6NA 2O8FB 5HE9A 2WKRA 2NMVA 2B21A 3BE4A 3QPUA 4J0QA 4OQFA 5J40A 2H1LA 5KSOA 4DB4A 3ZVLA 2G0TA 1KY2A 2NZJA 4US1R 1T91A 3R8FA 4JSTA 1DARA 1SGWA 3KFVA 4DT1B 1U9IA 2J41A 4D6PA 5JS8A 2JLRA 4AC9A 2ZI5A 4DSTA 1E9DA 4NYIR 5JMTA 3K9HA 3EZ7A 1HQCA 2OBMA 1XEWX 4EPYA 3CWQA 2IK8A 4O25A 1KJYA 2BM1A 2WPDA 4TMKA 2GF9A 4P0TA 3SBDA 4BE7B 5KDDA 2WMNB 5KOYA 1XZPA 2RHMA 1G9XA 4LV8B 1P3JA 1HUQA 1CIPA 4D81A 2FSIA 2WOJA 5B2ZA 4A92A 1EWQA 1XZQA 3QKSB 4LJ9A 1KKMA 2ZRIA 1S1MA 4TL9A 1FQJA 3IPXA 3X1ZA 5L3QA 4M0LA 4CT5A 1KNXA 2C2HA 2W6JD 3VKGA 4C0BA 3ETLA 5HZKA 3MWKA 2W0MA 4EPXA 3CNNA 3LRPA 4QJ3A 2ZRKA 4ZDIA 1W36C 1TQDA 3NC1C 1E99A 4AD8A 3B85A 4GMDA 1XJCA 1G19A 2EYQA 1IJFA 4A8JB 1XMJA 4Q1EA 3I32A 4BZXA 1NLFA 1TUIA 3U3OA 1XTKA 3B82A 1XX6A 3A4MA 4B6FA 5UKDA 3SFZA 3ZH9B 4TYYA 2JLYA 4OHWA 2Q3FA 4N0DA 2WV9A 3ADCA 1TF5A 4BLPA 5EZ6B 2P3SA 1AGRA 3NG1A 3DM5A 2W6IA 1Q1EA 2KJQA 4RKEA 4NH0A 3W6OA 4RSGA 1P2TA 4ZO4A 4TTQA 3IIMA 5AWFC 3TGPA 2ZRNA 2ZRFA 4URWR 1H65A 3DL0A 621PA 4LOAA 3AF4A 3TW8B 1RPZA 3A8TA 3MWLA 2XSZD 4RFSA 3HP1A 3RNLA 3CB4A 2FNAA 3TQFA 4UNPA 1XNJA 1NI3A 2Z0MA 5G3ZA 4M22A 3NC0C 3T15A 2PX0A 2OM2A 4LPSA 4TQ9A 1D9XA 4KFRA 4NMMA 4PFSA 4FCTA 3PUVA 4JS0A 4UNNA 1IBRA 2H5EA 2RCNA 3LBIA 4TT3D 3OEHA 3E2IA 1VG1A 3HPQA 3IHWA 2IYUA 3CRMA 1BMFD 5CM9C 4FIDA 2WPDD 4OI4A 4B33A 3A1VA 4LY6A 3RABA 4B3FX 1X86B 1XFAA 4XVRA 4QFMA 5H68A 1XPUA 1T3LA 4PX9A 4AG5A 3JVUA 3QENA 4NYIQ 4BZQA 4ZIRB 1RRGA 2J1LA 3AF2A 4AKHA 4DEYA 5EUMA 2ATVA 1A7JA 3P27A 4A0FA 1F3OA 2AWNA 3CX8A 5JEDA 5JHHB 4M9XA 5G3YA 3W34A 4HDQB 1E2DA 1ZM2A 2VHCA 3PEYA 1H8HD 4BFTA 4U02A 3ZD7A 4JKYA 3TUZC 5BN3A 2ZR7A 2R62A 1VG9B 3RRNA 3I1FA 5DHAA 3ONWA 3X1DA 2HT1A 1U99A 2X77A 3BFXA 3IIKA 1T3HA 2PJRA 1ZD8A 3NKVA 4KSBA 1Z06A 2WWHA 1W0KA 3EZFA 4JVMA 4BRUA 3OF5A 4QBFA 1IN4A 2FV8A 5FOTA 4A6XA 4BLQA 4D4JA 4R71A 5HTKA 3PITA 4DDWA 4O0MA 1DG1G 4LC1A 1UEIA 1NN3A 4HAZA 5AUPB 2VYFA 1E79D 1I2DA 3WBKA 4AKEA 3O47A 4JLKA 3TAHA 5JWRA 4PC1A 2PMDA 1A4RA 2ZYTX 3KFXA 2QU8A 1OE0A 5KTYA 3IEVA 2C04A 1FP7A 3IKJA 2FSHA 2QT1A 2EFDB 1W5TA 3EAQA 1OXXK 3SBEA 2HF9A 4TMXA 2O0JA 5G53C 1EXMA 2BMDA 1SVOA 1JI0A 5KPDA 1DAFA 4FXPA 5HKKD 3B2EA 2XGJA 4P4SA 821PA 4B32A 4MUBA 3SDZA 3EC1A 2GBLA 3QPWA 1E0AA 1L2TA 3A4LA 3MWJA 3VQTA 3TUJC 4BZPA 2VIIA 1KAGA 3OIUA 2OG2A 4Q1FA 2PJZA 2BWJA 4QNRA 3VNVA 1IOZA 1N6PA 1Z22A 3ZZUA 3QI2A 1E3MA 4XWKA 1P7CA 3HR7A 2UKDA 1G8YA 2ZRMA 2GDJA 1GL6A 1NF3A 3QEOA 3T35A 5TMPA 3LDAA 5CLQA 1KI7A 3M1IA 3KTAB 3ZVRA 4C0AC 4DCNA 3UG6A 1US8B 5DN6D 1N0UA 1UDWA 3WNDA 1RIFA 3FKQA 2FA9A 2ODWA 4TLCA 4QGAA 1LS6A 4PC3A 4TMTA 2KBEA 2J59A 3GLIA 1WXQA 2WJYA 4OQLA 3TVTA 1KO5A 4HAYA 1D5CA 1Z0KA 3DMNA 3HYTA 4L16A 4RCYA 1SKYE 2JJ2A 3THXB 3MUFA 2EWVA 1X1RA 4QL3A 4XIGS 3GLGB 2F1JA 2R6CA 3EZ6A 3Q3JB 4LHYA 1ETUA 4B71A 3AP2A 2OE2A 2DWOA 1H8ED 3AEZA 2ZRLA 4HI0E 3VR2A 4WZBE 4PPQA 4C0QC 1J90A 2D62A 2AHOA 3WMEA 2BBWA 4C0HA 2QQ0A 1Q21A 1XD2B 5FOWA 2CE2X 1Z3IX 3GJ5A 4G5RA 3PCRB 1KZ7B 4JIMA 1WBBA 5FR2A 5EP2A 4XD7D 1KI6B 3VKWA 3K9LA 5FUVA 5JCZA 1S0UA 2N1BA 1L8QA 2QL6A 3LA6A 3THYA 2XB2A 2WM9B 4Q4HB 4BEJA 4CRWB 3QY0A 2G77B 2IYWA 2G0NA 4Z51A 1EK0A 2NTYC 1FTNA 1R8SA 1W47A 2PEZA 1DPFA 4LJ6A 1E2IA 1RZ3A 3F8TA 4LK2A 2VRWA 1KO1A 5FPSA 1AQYA 4ASUA 1QVAA 4DLSA 3G5UA 4P4TA 4EKDA 3HYRA 5EUQB 2ECKA 4IRUB 4MYUA 2N42A 1QRAA 2WWGA 3H86A 2JLWA 1E2GA 4BFSA 4DZZA 5GADl 1TEVA 2ORWA 1KDOA 2DHRA 2WJJA 3GFPA 4MRPA 1VPLA 2QBYB 3I73A 3B6EA 2F7SA 4P31A 4BFZA 2ZVQX 1ZYUA 5K8UA 1X8LA 3SC3A 3V00A 2EYUA 1C9KA 3CRQA 4QG7A 4EFMA 3WMFA 3EPLA 2A9KA 1IY0A 2AFHE 1Q57A 4QOSA 4QRHA 1HH4A 2F1RA 3BB4A 4IEIA 1NP6A 5G41A 1WCV1 2HYIC 1Q12A 4PTLA 4EJSC 4HLUC 2AKYA 4YONB 1NN1A 4TZ6A 3R7WB 1OKKA 1AM4D 1Q3HA 3N2IA 1E9AA 1R0ZA 2ODBA 1NSTA 3KDSE 2WAXA 3U61B 3ZJYA 3QJYA 1HE8B 1IM2A 4Q4AA 5A5GA 3P32A 2JIZA 3O8BA 4A2QA 1FX0A 1ONBA 3MAAC 4ACAA 2PZFA 2I3BA 1FOEB 5LD2C 2PT7A 4MDFA 1R0WA 1E9RA 2R6DA 2FGKA 2GEDA 2NO0A 1Z0JA 2MSEB 4C0SA 3CF0A 2GCPA 2KE5A 3VX3A 3QSYA 1AGPA 1OYWA 2GJ9A 2QP3A 3GCGA 1XXHE 2DY1A 4RZXA 1T0JB 1ESNA 2W0SA 2IUTA 3CX7A 3UWOA 4UNQA 2YC4C 3PJRA 2QA5A 3ZD6A 2B7CA 1MH1A 4GOJA 5GJBA 1J2JA 1NVWQ 2ZYWX 2VP5A 1IXSB 1VCNA 2FMXA 3TSOA 4DDUA 1GOTA 1X1SA 1KHTA 2FU5C 3E1SA 4Q7KA 3PUXA 4V03A 4B73A 3CH4B 3AVPA 4NCJA 3CPEA 5CYPA 4ASUD 2BKEA 1DAEA 1E2FA 2QMUA 4DCUA 1NVUQ 4HUTA 1JECA 1PZNA 2GAOA 2CJWB 2AWOA 2QPTA 2RB4A 3CR7A 2VP9A 4IDNA 5JI2E 3UWKA 5IHPA 1RKBA 1JPNA 4LPKA 4R9UC 3PIRA 1HT1E 3W6PA 1DE0A 4LYFA 3SNHA 4D4LA 4DIEA 1ZBDA 2YOGA 3PUYA 2GJSA 2ZE5A 2XOKD 4XWOA 1KSFX 2VP4A 5DSZA 4E07A 2B8WA 1N0VC 2WMOB 1ESMA 5ANRB 1MO4A 1G3QA 2O52A 4PPFA 1GNQA 3CWZA 3O8DA 1AA9A 1QHHB 5AJXA 2I1VB 2WTUA 3I4LA 2VSFA 4ZKDA 4IOKA 4OK6A 3BORA 3U6BA 1AS2A 2J0UB 2IT1A 3P4XA 4Z8YA 3FE2A 3WRYC 3I61A 1TTTA 4YLGA 4LYAA 3GFTA 2ERXA 1S96A 1UBFA 1I4DD 4C3ZA 1UKZA 5KNCA 3KUDA 1P5ZB 2ANCA 3WP1B 1TQ6A 4DUGD 4EJSA 5C46F 1CR1A 1OFTA 3V9PA 4BLTA 3PEWA 3AVUA 4DCSA 2C9YA 2C99A 2J3EA 4TTRA 2QE7A 1K8RA 3GJ3A 3U3KA 1XTQA 3QE0A 1UBCA 1T9HA 3EASA 3W90A 5CK5A 3U3RA 1KO4A 2ZVPX 2E1RA 3B60A 2CHVA 4U5XA 1WA5A 3Q5DA 1NMZA 4DJTA 4Q01A 1GFIA 2BKUA 1UM8A 1QF9A 1ZCBA 1W48A 2FEOA 4O3MA 4MKIA 5FI0B 3B9PA 1WQ1R 3KKOA 1G3MA 4C2UA 4MH0R 4LHZA 1SXJA 3TKLA 2JLXA 1YRBA 2OILA 2VP6A 1N5KA 2O8FA 1SXJE 1JR3D 1HE1C 1D6JA 1YKSA 2ANBA 4AURA 1OFIA 3TJZA 2V1UA 1JPJA 1MABB 2XJ9A 2YOHA 1MRSA 1Z47A 2GNOA 3DVLA 4P3YA 5GVRA 1KIMA 3X2SA 2JLZA 3FOZA 4DT1A 2OCAA 3SHWA 2VEDA 1YZTA 1VIYA 1E2MA 4RD0A 3BFKA 1E2LA 1UBGA 5F3WB 3L2OB 4B3GA 2OXRA 4GZMA 1Z0DA 1XWIA 2D3WA 1HQYE 1O3YA 4EQ6B 2QTVB 4JJZA 1NG1A 1FPMA 3FMFA 3SJBA 4F4JA 1CXZA 5H70A 2WSMA 4A2WA 5C4MA 3QKSA 5AK0A 1M7BA 4A4DA 4DLYA 1IN5A 2RGGA 2YVUA 4IFEA 4TSFD 3UMSA 1E69A 3CBQA 5KO2A 3NH9A 3HR8A 3TIFA 2R2AA 3DOFA 1G6OA 1NKSA 2ASEA 1EX6A 1L7VC 1F60A 4NTZA 4CEJB 2FPLA 1G8HA 3BXZA 3BGWA 1U0LA 1WDTA 1Y3AA 1SHZA 2ORIA 3BS4A 1N5JA 2DWQA 1KJZA 2IHYA 5DYGA 4ZCLA 4A8JA 4F7WA 1NBMD 1DEKA 2CBZA 2HF8A 5C4GB 1FW6A 1W0JD 2G83A 4JLVA 1F2UB 3I72A 4Z54A 1G41A 1BS1A 3CNLA 4JLPA 5HPYB 1K5GA 4GRAA 1FTSA 5JEEA 1KNQA 1M1YE 2P6UA 3KJIA 1RRPA 5FI1B 2JLQA 2WKQA 4FCWA 1XU4A 3BB3A 5IK2A 1II9A 3PUZA 2ZJ8A 4JYBA 1ZUNB 4Q00A 3K0SA 1CEEA 2ZR0A 3SJCA 1F48A 1PLLA 1UBEA 3OFND 2FX3A 2HCJB 4PZLA 4YXWA 3ZGXA 2OSBA 3BWDD 4QM6A 5FOXA 2BHRA 1TU3A 4D0LB 4URVR 2VBCA 5EE5B 4LSGA 1CS4C 3CIOA 3FTQA 4QGFA 3IO5A 3VKHA 1Z6GA 3KQLA 2FOLA 4D4MA 3OAAA 2C96A 4GFDA 3RSLA 3RC8A 4TYPA 1DS6A 3K8YA 2DB3A 1X8JA 3GEIA 4A0HA 3HU3A 1IY1A 3OE7A 3GPLA 4WVFA 1RFLA 2Q3MA 2WIAA 5G40A 3CONA 1RVDA 1NMXA 1U0JA 1SZPA 2OV2A 2XTMA 2IS4A 4LJ8A 5CITA 2AKAB 2FGJA 4MGKR 2N46A 3B5JA 3H0KA 6Q21A 2HXSA 5AJZA 2ZRJA 1XBTA 2VP2A 2J7PD 2DCUA 4C0KA 4ZIRA 1DAIA 1YHNA 1ZCAA 3CUEF 2MMCA 4POAA 4NCIA 4ZCMA 3N2EA 4JLDA 4IVRA 3JZAA 4NCHA 2PCLA 2WJHA 2YWHA 1Q1BA 1G4AE 4Q5IA 3SQXA 1HA3A 2W6JA 4D25A 1TUEA 1S9DA 1R10A 1PUIA 1XPRA 2OAQ1 2G9NA 2G6BA 5JWHA 3RS2A 3ADKA 2YC2C 2GZDA 2P5SA 1FFHA 2NO6A 2C78A 2ZROA 4K8OA 4P33A 3THWB 1KK0A 3FB4A 2I4IA 1UF9A 1YZQA 2J0QA 2RKOA 3WBJA 2XITA 4LRWA 3A4NA 1KMHB 4ARZB 1AJEA 2CE7A 4M4SA 4B6EA 5LD2B 1QG4A 5JSZB 4I4LA 1OXVA 1CKEA 2BCJQ 2X2FA 2Q21A 3C8UA 2V54A 1E2EA 2VF8A 3FMIA 2XSZA 3KXKA 2FE4A 2QMEA 5FPKA 3X1YA 4DCVA 2XTNA 1FNNA 4AK9A 3SOPA 5DGXA 4RZUA 3NBYC 4PQRA 3OAAD 5SZJA 2B6HA 2L0XA 4OK5A 1NG9A 1KZGB 1OXUA 2RH5A 2ZJYA 1DBSA 1G6HA 2ZJBA 3OE7D 2Z83A 4IOJA 4OL0A 3L8YA 4GP7A 1NN5A 4I1UA 4OQMA 4P32A 3MMPA 4TT3A 2CCKA 1GTVA 1SVLA 1ZM7A 5SZKB 1BMFA 2ZJ5A 3KZ1E 3RSOA 5FBWB 4E22A 1T0HB 4DSOA 3VMFA 4IXNA 3BH6A 3ADBA 1KDPA 5FBVB 1GUAA 1N25A 2OZEA 3KTAA 2FWRA 1X6VA 2EFGA 2ZE8A 1G3IA 1US8A 1W46A 4B35A 4LCBA 3R20A 4DRZA 3EC2A 2WWIA 1KI2A 1GG2A 1OFHA 4EPVA 4V0NA 3NH6A 5KDLA 2GVDC 2CHGA 5JHGB 3RS3A 4QBHA 3K1JA 4ZDWA 1QHNA 1TAGA 5KPJA 4LDJA 1ZUHA 1H8HA 1OJLA 1NRJB 4BFYA 4KU4A 2CCJA 721PA 3THXA 5D3QA 2WIBA 4KYIB 3FFBA 3SI7A 1NVVR 3GLGA 5L3VA 1QDEA 1IAQA 2KB0A 2ZI6A 1XP8A 2YWGA 1XEFA 2F55A 3VR6A 2WWFA 1N6OA 3GLGE 1FMLA 3CRW1 1CR0A 1R8QA 2WWYA 1YR6A 2ZTSA 1JEEA 2A2ZA 5FOUA 3D7MA 3EW9A 5DISB 4BFVA 2RAPA 3RDPA 1HEIA 1XD2A 3NEYA 4UJ5A 4XTCS 2A3RA 4OHZA 4EFNA 3QBTA 3H1TA 4TTPA 1WE2A 3AB3A 5FPTA 5JFGA 2A5YB 1KI6A 4KSCA 1E79A 1ZUIA 3SYLA 4OHVA 2JDID 3FKSD 3B78A 4Q4HA 5KDOA 3G0HA 3IQXA 3IEUA 2PZGA 1N6HA 4KHZA 4I99A 4R7ZA 4BEBA 2NIPA 4Q7JB 2F43B 1ANKA 1PLKA 1XTIA 2HV8A 2FH5B 1XB2A 3UK6A 5EE1A 3AP3A 3VHLB 3ZZ0A 3F3YA 3OEED 2CHQA 4B3DA 5HKKA 3QBVA 4R2HA 1YJ5A 4P4UA 2BJVA 1G8GA 5A0FA 3M4YA 4MRNA 4HAUA 2QBYA 1M6NA 5FR1A 1X8KA 3KQUA 5IDVA 2P2LA 4PO9A 2D06A 1EG7A 3BB1A 1ZNZA 5E95A 4QM7A 3RWOA 2ZPTX 5L3RA 2GZAA 1XTJA 3WMGA 4KITB 1XCGB 1R0YA 4II7A 2NPFA 4I1OA 3AVOA 1JQJC 2BOVA 4JVSB 4LHXA 2ZSDA 4B3CA 2QTHA 2W2TA 3GJXC 3X1WA 4B2IA 2ZRCA 4TMVA 1TMKA 2ONJA 3R7WA 3PENA 2PLFA 1E2JA 1VHLA 1ZAKA 5DN6A 3BERA 4WXRA 5C18A 3QQ5A 1G3RA 4QGHA 3ND9A 1DELA 1AS0A 1QHYA 3TR5A 4GOXA 3I3SR 2ZJAA 3GQBA 1R5OA 4C30A 4DBLC 4C7OB 4LBYA 3U3MA 1U8AA 4HZIA 4RZ2A 1S4QA 2J9RA 5FFMA 5JECA 2ZRGA 2C77A 2BEKA 3CNOA 1E2PA 4DXAA 3GLHB 4PZYA 3PUWA 1Z0AA 4N3NA 3CR8A 3T61A 4ABYA 4L5BA 2VO1A 1UKVY 2VQSA 4HATA 1H8EA 4NZYA 4Z1MD 3J81k 1TQ2A 4AI6A 2GHIA 4NL4H 2LCFA 2HXYA 1NVVQ 2KBFA 1RE0A 3MWYW 1BKDR 2QAGC 4IVPA 1ZIOA 2BBSA 1C1YA 1W1WA 1E4VA 2QQEA 2WSSA 3GEHA 4JBWA 5DYIA 4GT1A 3ZVMA 1MO3A 4XD7A 2QMOA 3GJ7A 4K81B 4LX0A 1WBDA 5TB5A 1UDXA 2B8TA 4G5GA 4Q4JB 3R9IA 2ZETA 4YMUA 3EIQA 1QZXA 4PC6A 1ZMXA 4DEXA 2ZM5A 1DOAA 2H57A 4CDGA 1MV5A 1ZD9A 3KKPA 2CJWA 2G3YA 4AYTA 2GCOB 1GRNA 3QKTA 1Z0IA 1XTSA 2QI9C 2VHTA 1ZVQA 2D74A 3LWNA 1LS1A 4NKRA 3LQRA 5JRJA 3S1AB 2X8AA 4BFUA 2GK6A 4EPTA 1JAHA 2QT0A 1L4YA 1NY5A 2AD1A 2FFBA 1NKTA 3DOEA 4BFXA 2NO1A 3H4MA 5B64A 3LW7A 2OO7A 2ZI7A 3H84A 3IQWA 1QHHA 2EFEB 5AJWA 1DADA 4F92B 3HPRA 2CNWD 4GNKA 4A0RA 3CF2A 2ERYA 1OT3A 2PH1A 2J0UA 3DMDA 3H2YA 3KQHA 1E2NA 1ZU4A 2CXXA 3ZVNA 2IS2A 5TXGA 2P5TB 1XRJA 1GKYA 1ZM4A 2Q9BA 1W2HA 2X2EA 1R5NA 4URYR 2CDNA 4A2PA 3R9WA 3SJAA 4MKGA 2CK3D 5FTMA 3GLIE 2C8VA 1N6IA 4DHEA 5BXQC 4H1VA 3A6PC 4HAVA 5BN5A 2YYZA 2D7CA 1UFQA 2GILA 3K0AB 4DDVA 1TNDA 1VMAA 3LVRE 4AYWA 1OH5A 1P75A 3RVBA 2ZU6A 5L8VA 2AN9A 2F3TA 3C7KA 3AQ4A 1DAKA 2RGAA 3CZPA 2WSSD 1U0HC 5J47A 1QHXA 3GMTA 1Z28A 1Z6TA 5JS7A 4BLRA 2WHXA 1AZTA 3TSZA 4LV6A 4M9ZA 4TWZA 5EXSA 5F2EA 1FUKA 4E09A 2R9VA 2OAP1 2OEPA 4Q1CA 5KSZA 1VTKA 2ZRHA 5FL7D 1Y63A 3MG9A 4D4KA 4DB2A 1U90A 4GMXA 4M9QA 4IW3B 1P60A 4NU0A 3SFVA 1TX4B 1S8FA 1YR8A 3D31A 3LW8A 4MGIR 4NDZA 3U60B 2IS1A 1FMJA 4KFSA 1MABA 4BQSA 4RKFA 3RS7A 1JBKA 1GNPA 3LNCA 3TW4A 2CLDX 1NMYA 4M53A 2FDCA 2FPMA 4PAQA 5K8IA 2EQBA 5FBLB 1X3SA 3LY5A 4HAWA 4FMDB 3LD9A 2XOKA 3EIEA 1EFCA 1NLYA 1GITA 3AVVA 2OUKA 2IUSA 4PPNA 4UNRA 1XD8A 4IJMA 1KO7A 4EQ6A 1Q44A 2QRNA 2FFQA 1RW4A 3QG5A 1ZU5A 3M6AA 2R44A 2OFOA 5BQ5A 5K8TA 4DWJA 3ZS9A 5JJLA 3VR5A 3U4QB 1Q22A 2ZJZA 5TV2A 4B3BA 5BWMA 4Q4LA 2FG5A 4Q66C 4XSHA 3JVVA 3W8RA 4M1OA 4HB2A 2CL6X 1WMSA 4FCVA 1R6BX 3WY9A 1DTSA 4WZ6A 4EDHA 3IBGA 2REOA 4OQNA 2PBRA 3B1YA 3TH5A 4URUR 3P1JA 3Q9LA 1UPTA 3QPVA 5EP4A 3EZ9A 3VX4A 4CEJA 3CLVA 2ZANA 2BVNA 5JJIA 3A36A 1E9FA 4MA4A 5F98A 4DUGA 2DYKA 1CBUA 4CEIB 1KDTA 1Z83A 4S2EA 1E2KA 4LJ5A 3EA0A 1M7GA 1F2UA 4D2IA 2Q6TA 3NIBA 1S9HA 3AKYA 3FMOB 5LBIA 4NYJR 3OIVA 1I4TD 1PJRA 1DVRA 1M74A 3QXSA 4LJ4A 2GCNA 2ODNA 4G0NA 3SYKA 4YQFA 4HAXA 1COWD 5J5CA 2IUUA 5DE3A 1OH6A 2CCGA 3HJNA 3NBXX 5CIWA 1IJEA 3GD7A 4LBVA 1CULC 2DFLA 1TPZA 3HU2A 3RC3A 2D4HA 3MFYA 121PA 4OQXA 4S35A 3EARA 4MKHA 2H92A 3B1XA 2ZYVX 4ESHA 3PVSA 4GDFA 1R5BA 2BMFA 5FBRB 3RRZA 2PT5A 1JR3A 4FWTA 3U7GA 3L0IB 1D2EA 3A1TA 1S3SA 4AKIA 3L0OA 5EE3A 2PMKA 2GXAA 4CEHB 1CF4A 1JR3E 1UKYA 4D26A 4HLDA 3KB1A 3R8CA 1NN0A 5C2JB 2OBLA 1ZP6A 3C5CA 1OXTA 1SVSA 3FHOA 2ZS8A 1LB1B 3K9NA 2VHJA 3AUXA 5KYKA 2A5GA 3VU9B 4GZLA 4UNSA 3NVAA 4MRSA 1U8YA 1TU4A 2JEOA 5CLLA 3UKDA 5FL3A 2A5FA 2QM7A 3M0EA 4US0R 2QN6A 4B43A 3TSWA 3FDIA 3T1TA 2HYDA 4PSAA 1VECA 4H9GA 5KUTA 5AR1A 4Q19A 3T5GA 4QHTA 5FTKA 3A1SA 4LJ7A 1DO2A 1XMVA 2D2FA 2OCPA 1ZC4A 3A1WA 5GJVC 1T3SA 1E32A 4TSFA 4M9SA 4PXAA 3ASZA 3PG5A 4O2RA 3SEAA 4DLZA 1A2KC 3B8HA 1G7SA 1TF7A 2GTPA 1KKLA 1A1VA 3T34A 1II0A 2ZSFA 4IXMA 4HLUA 3RHFA 3NHBA 3U5ZB 3THWA 2UVQA 2Z43A 1G21E 3K09C 1MOZA 3VR3A 5J4KA 1P2VA 1OH8A 2O8DB 1P2UA 1WF3A 2ZEJA 3B1VA 1NBMA 4HB3A 4IFBA 4DCTA 5TVKA 1W0JA 3WNCA 4TYQA 3PXGA 3WYAA 5FTNA 4Y0VA 2IYSA 3W6NA 1NBME 2R8RA 5AUOB 4N0EA 1KMHA 1E9SA 4ARZA 1UAAA 4JJKA 3UANA 4L9WA 2A5JA 5JSZA 2W2XA 2ATXA 1U98A 4B3XA 4JKIA 2F1IA 4NYJQ 4PR0A 3VTKA 4TQUS 1KI4A 4UXIA 3RLFA 2O0HA 1XCMA 3TMKA 3UG7A 2YINC 3OHMA 2JASA 2AR7A 5DI9A 1ODFA 3BRWD 3RANA 3OFNA 4B44A 3JZMA 1E1QD 2OXCA 1ZNYA 1P9NA 1JJVA 1R0XA 2VL7A 1FZQA 2QAGB 4R2IA 1XPOA 3L0PA 3LO5A 4JBXA 1XDBA 2CVHA 4DDTA 4MYTA 4V02A 2RGNC 4EAQA 2HDNB 4XTRA 4JLAA 2IC5A 4V0OA 1D2NA 2NOAA 3PV0A 2XNDD 2NO7A 4KBFA 1W2GA 3RS4A 3Q8XB 3UPUA 4EPRA 1TEXA 1NLZA 3DKVA 3K9GA 5CIQA 4D0GA 3EXAA 1J8MF 1KI9A 4U7DA 1VCOA 3O8CA 2PCJA 3CRRA 4HSEA 3LH5A 1W4CA 2FJUA 2J7PA 4KLNA 3I8XA 4JLNA 3O8RA 5D3MB 4PQYA 3FMPB 3KKQA 4V0MA 5EP3A 2JLUA 4TL8A 2FEMA 4DLUA 4G5SA 5H8WA 4HB4A 4N1AA 1YVDA 5IRCD 1G17A 4G1UC 3T1VA 3CKLA 3K0EA 4Q1AA 1Q1ZA 1ZM3A 2QG6A 2ZI9A 4NP6A 1EFTA 4RD4A 1Q0UA 3KQNA 1LNZA 1G64A 3GJ8A 4FN5A 1Q20A 3BIFA 3VFDA 4FD2A 4HLQB 1KK3A 4Q7MB 5JBQA 1E0KA 3QKRB 4ZCIA 2YOFA 4HDOB 2OESA 5FOVA 5LDDC 4KFTA 4RZ3A 3QXHA 2XZOA 2PZEA 5DI3B 2C5LA 1Z5ZA 3KQKA 3LV8A 1GAJA 4FMCB 2PL3A 4G5OA 1SVKA 4PAOA 1OHHD 3NWJA 2D7DA 1E98A 4WW0A 3BFVA 5BN4A 5BYKA 4A9AA 1DO0A 4A36A 1XEXB 2IXEA 2EVWX 3QXJA 1LVGA 4DSNA 3K0FB 2OT3B 2RGEA 2O8BB 1XXHB 4WOPA 2YHSA 3C14C 1S2MA 1ZNWA 2XNSA 2F43A 2PLRA 3K09A 1Z07A 1KGDA 2BMEA 4L15A 4LHWA 1LFDB 4GPTA 4DVGA 3GEEA 3AH8A 4OK3A 1BYIA 1OIXA 1E1RD 1G16A 1IN7A 4YMWA 4L8GA 3ADDA 2QY9A 1RJ9B 5KNBA 4UXJA 1ZRHA 1VIAA 1EFRD 3EA5A 1N5IA 4B2LA 1F5NA 2RGXA 1IQPA 1ZNXA 5A4JA 3AVWA 1OSNA 4US2R 4M8NE 2MSDB 4TLEA 3SE0A 1IONA 5CDFA 4JL5A 1MO6A 4CZ2A 4F4CA 5AJYA 1XMIA 1SVIA 2YV5A 4JVNA 3W3ZB 2O5VA 3EPHA 3AVXA 2BBOA 1VYTA 2ZYUX 4C0JA 5CDFE 3AVQA 3IIJA 1CLUA 1EWRA 3NBZC 4EUNA 2HCBA 1P2SA 3I8SA 1B23P 4BFWA 3QOFA 3FHTA 1AKYA 3BOSA 2JJ1D 4CGZA 3QF4B 1NNEA 5EE9A 3RRMA 4B75A 1GILA 1HURA 1NY6A 1R4AA 4M1TA 2QP9X 4RD3A 2DWPA 4HB0A 4WZAE 4LWZA 1P62B 4IKEA 3DZDA 4DLWA 3QVVA 4C7OA 1E6CA 2DFNA 3AVYA 4Q9LA 2JLVA 4LYHA 2AK3A 3TR0A 3TVDA 2CLCX 1Z0FA 4X8MA 5GJCA 3GLHA 5FUWA 3AV0B 1T6NA 2ZE6A 4BUJA 5C1BA 3BJIC 1B0UA 2VPPA 1W4AA 1G5TA 4IEEA 4XSGA 3RS5A 2ZJOA 1N6NA 1CJTC 4QBGB 3ICEA 1GL9B 1E4YA 1P9WA 2ZSAA 3MLEA 1W4RA 5TY0A 4ILEA 2QP4A 3KX2A 4TLDA 5E7IA 2QPOA 1VYVA 2QGNA 2AL7A 2IWRA 4C0LA 4DLRA 1QBKC 1Z6YA 4DLTA 2V7QD 3HDTA 2ZQ5A 3U44B 4JVLA 2BCGY 4Q47A 1Z2AA 4WXPA 2JDIA 3FKSA 4Q4JA 4CT4B 2J5XA 2IS6A 4AIIA 5KU1A 2IHBA 2VSOA 3KJEA 1NSFA 3PR1A 1R2QA 1TADA 3AKCA 1JB1A 3OEEA 1XMSA 3ZIAD 2BEJA 2GCOA 3AKEA 4UXHA 4RCZA 1P9RA 3W8NA 3AGPA 4CW7A 3IDQA 2HEIA 5ELXA 3FWYA 2ORVA 2R65A 4FWIB 1YRAA 3U6KA 2BMJA 4DLVA 2FFAA 3S1AA 4QC2A 4BASA 2VHQA 4JT4A 4F91B 3I5YA 4XVQA 2HUPA 4HUQB 1VG8A 3KKNA 2ZUCA 3AF0A 4GI7A 3DM9B 3D8BA 2YKGA 1NIPA 1QHGA 3V4FA 2W2VA 4MITA 3AF1A 4RD1A 3T1QA 4ERNA 1ZW6A 1A82A 3BH7A 1KO8A 3EPJA 1P72A 3NTUA 3I92A 3ZDQA 1TF2A 2R6FA 4Q9IA 2IYLD 3Q7QA 3EG5A 5DIFA 4JMPA 2REBA 1U8ZA 2Q9AA 3WP0A 2UZ3A 4I81A 1CR4A 1N6LA 1LW7A 2YWFA 4A6PA 2YWEA 3DPUA 3FVQA 4OKSA 3FPAA 3HU1A 2YNMA 2LKDA 3GLFB 2R6AA 2EFHB 4A1FA 1V43A 2HJVA 4EIWA 3U7FB 1VKJA 2HT6A 5FUXA 1VHTA 4IOMA 1Z2CA 2RGCA 3TQCA 3LVQE 1G1MA 3NXSA 4AWXA 3L82B 1FUUA 3K0AA 2DFKB 1YU9A 3CH5A 2BJWA 4Z1MA 2VH5R 2REXB 3BK7A 3IGFA 4F38A 2XX3A 2QRZA 1LF5A 3GFOA 5JRZA 2O8CB 3LXXA 2V6IA 4X8OA 1GM5A 1BH2A 3PQCA 2JCSA 4BPBA 4I1VA 1Z8FA 5HZHA 4Q9KA 5SZIA 2J0SA 2RMKA 2W00A 3KL4A 4GSYA 1LF0A 1ZIPA 3A58B 1N0WA 2XTZA 3D6TB 2O8EB 2H18A 2Q3HA 3IO3A 4HZUB 1CTQA 1HT2E 3F5FA 2IYQA 1FNMA 1YZUA 2WBLC 1G291 1NIJA 2FZ4A 1UADA 3B13B 3QUSA 2V55B 4JYCA 4GOKA 3W5JA 3UMFA 3VNUA 2QM8A 5KSYA 2G1JA 3CO5A 3R9XA 5J4HA 3UMRA 3WHLA 1G7CA 1Z29A 4H1UA 3KJGA 5JI3E 5CB6A 5P21A 4LBWA 2GBLC 4K46A 4LHVA 5H1YA 1F2TB 1JALA 3A37A 3DZ8A 2GETA 5E7JA 4QXAA 2G1KA 1II8B 4IDPA 2WWWA 4MYHA 2JGNA 2EWWA 2P65A 2ZE7A 5LB4A 4KVAA 2GJAA 4OHXA 2CMKA 1PUJA 1J70A 4DIDA 2AK2A 1KY3A 2QSZA 4YC7A 1VDZA 1U81A 3ZS8A 4ZPXA 2V1XA 1CJKC 4JL6A 1YQTA 4CYMA 1KTVA 3U4QA 4DLXA 4LI0A 4Q9JA 4WIAA 2CNWA 3IUYA 4F4IA 1E9EA 4QGGA 4A82A 2IYRA 3GJ4A 3WYFA 3KJHA 2H17A 2E9SA 3L8ZA 4JSYA 4B47A 2XB4A 3RWMB 4KV9A 4OYHA 1KAOA 4PSKA 1GP2A 5FPHA 3WHKA 3LX5A 3CPHA 2IXFA 4EPWA 1KYIA 3B7GA 2CK3A 1EESA 4YMSA 1E2QA 521PA 3TE6A 2AXPA 2Q9CA 2QROA 5HE8A 4XJXA 221PA 4CEIA 2CEAA 5B30A 2XZLA 3DEFA 3L43A 2WJGA 2QENA 5GJWC 2ZSBA 1J8YF 2V6JA 1OLOA 3RS0A 1OB5A 4OHYA 2SHKA 2P0EA 2F3RA 2AX4A 3LX8A 4LGMA 1G4UR 5L3SB 1KI8A 4EFLA 1KOFA 1M7HA 2LKCA 3MJRA 1JQLB 1W49A 4M1KA 1VYUA 2NG1A 1KSHA 1OV4A 1W4BA 1GIAA 4WA7A 3TRFA 2ZUDA 2WVJA 4DC9A 4CF7A 5FL7A 1G20E 3U7EB 2WJIA 2IBMA 5AJVB 5JZVA 5EXTA 2IYYA 3GJ6A 2FPKA 4TZ0A 3AUYA 2OCBA 1EFHA 2W6ID 2XXAB 1HTWA 2C95A 4JBYA 5J4VA 1D2MA 4CEHA 1N2CE 2YJTD 2MMGA 3KUCA 5EE0A 4MGZR 1GL7A 1GSIA 3C4JA 3TNFA 2QNRA 4Q1BA 2GKSA 3ZQJA 1W44A 3W9YA 2IEZA 1IHUA 3SHFA 3VU9A 1VCMA 1IXZA 3DKPA 1T5IA 1E9BA 2J45A 1V5WA 2F1HA 3HWSA 1G7TA 1YZLA 2Q0HA 2Z4RA 4Q02A 3C15C 2EFCB 1G5PA 1CJUC 1YZGA 3CRVA 2WWXA 2JA1A 4NCNA 1G7RA 1D8TA 1MR3F 4GL2A 1SHKA 4ZKEA 4YMVA 3FYHA 2H7VA 2KSQA 4Q1DA 2XJ4A 4TL6A 3OEHD 3K70C 1SQ5A 1T8TA 1JJ7A 2IEYA 2ZI3A 4R98A 1MO5A 3ECCA 1KSGA 2WOOA 1NL3A 1ZC3A 4PPGA 2GK7A 1N6RA 2F9LA 3DHWC 1KK1A 3UXMA 1AN0A 4QBIA 1I2MA 3VR1A 1CJMA 1G8PA 1AIPA 4URXR 2MSCB 2JLSA 2BC9A 4MDEA 1GKUB 3AGQA 3MRSA 2FF7A 2VF7A 4RY2A 2O8DA 2HLDA 3B9QA 4LYJA 3TBKA 2V8OA 1HYQA 1YE8A 2ZAOA 4KCGA 5EXXA 3ICQB 1NVXQ 4WAUA 2JATA 4NHOA 4V0KA 5L3QB 3DDCA 1OW3B 2HJGA 4TYNA 1GKIA 1LTQA 1MKYA 4GP6A 4ESVA 1F6BA 3BD9A 3OESA 3U7HB 2CLSA 1OIWA 2AXNA 2IL1A 4FMDF 1COWA 1KI1A 3B1WA 4MRRA 3I5XA 1YZKA 5F9HA 2A5DA 1ZJ6A 1W0KD 5K8LA 4BWYA 1I4LD 5CJ2A 1AZSC 5B58C 4HLCA 2V4ZA 3E70C 2QAGA 2QEQA 2QSYA 4M1WA 2K5UA 3IILA 5DNYB 1KJWA 4PHGA 2CL7X 4RFVA 2VHUA 4NONA 2GF0A 4JZKA 3WXMA 2GWHA 1W36D 1IN8A 3KXLA 1KK2A 4JLMA 1S3GA 1PV4A 1A5TA 3F0TA 2OBNA 4B48A 1NJFA 1E96A 2KI5A 2KWIA 2IWHA 1OH7A 1JR6A 1RC8A 3NDPA 4RFSB 1T8UA 2WAYA 4OBEA 1CR2A 5JCPA 1O87A 2BV3A 1WP9A 1OFUX 2RGBA 3P20A 4GBMA 3VR4A 1XJQA 5CJPA 1K5DA 2OCYC 2QZ4A 4QJ5A 5D3MA 4KO8A 3MCAA 4RD6A 4FI3C 2FZLA 1KI3A 3MJHA 2ZREA 4UQOA 4YDHB 3BAFA 5SZHB 3SJZA 3QXCA 4NBSA 4PANA 2J7KA 4W5HA 5EQTA 3VAAA 4WBSA 3K0CC 5TARA 3NDBB 2ZJ2A 4M1YA 4ON9A 1CRPA 3SZRA 4XOIA 4HDCA 3QKRA 1OYYA 3BH0A 2PX3A 3QF7A 2V3CC 2QPAA 4ZDJA 2Z6VA 1IXRC 2HLDD 5DI3A 4B34A 1P73A 1EFUA 2VLIA 2QGZA 5DO9A 4DSUA 4U00A 3SYNA 3ZQ6A 2OFXA 1OPXA 1G8FA 3UATA 4BLOA 1G5RA 1XCPA 2JJ8A 2NQ2C 3SR0A 4MUAA 421PA 2WJVA 2X19A 2H16A 3ZYCA 3KXIA 2JJ2D 3Q5EA 3OZXA 1ZINA 4LC0A 3RRYA 1XEXA 2GA8A 4HYYA 4BLSA 2FFHA 2IF0A 1OIVA 3KKMA 2A30A 4Q48A 3SS8A 2IF2A 3K0FA 5DH9A 5FPYA 2IYXA 1XXHA 5KHOC 5E4FA 3THOA 2O8BA 3KB2A 4NPHA 1GWNA 2E87A 1SXJC 3W3AA 4E5UA 2ZS9A 2W83A 3SQWA 4AKGA 4NYMR 1QG2A 2B92A 3UIEA 4LBZA 1QHSA 1E1QA 5HR5A
chains in the Genus database with same CATH superfamily
4YDSA 4BQEA 1RXUA 4CLHA 4D6XA 4YMTA 3WA6A 1NRWA 3V1NA 5LZ2A 2O50A 5DNVA 4R5MA 3REFA 1T15A 1AG9A 3OZIA 4KPEC 2C29D 1CQXA 2C9OA 1RQNA 1NJSA 4B3HA 2XYGA 3OC0A 3WLMA 4YMGA 1IPEA 4XIYA 3AVTA 4UTOA 4TYWA 1ZQ9A 4G5QA 1OKKD 3CZTX 1FP2A 1YR7A 2GESA 4BIIA 1QIMA 1PNTA 1QDUA 4I1PA 3CSDA 3ZHTA 2WTBA 4KJZA 1NVDA 2BW0A 4L4UA 5GPBA 4JBNA 3ZCPA 3DL2A 3UJ7A 4EABA 3GP8A 3DO6A 1O95A 5DGDA 1E1LA 1VGRA 5LP1A 3HH8A 1UMKA 3QIAA 4UFPA 1P91A 4ZI2A 4X71A 4ITVA 3LX4A 4TLAA 4KYUA 3MSXA 1G4HA 4AJ1A 4QG3A 4NYMQ 1RJVA 2BM0A 3A3KA 1SVWA 4RVCA 1SEPA 1TK2A 1NVGA 1K8QA 5I5GA 2I1WA 2A4MA 4ER6A 5ILOA 2NAPA 1SC6A 2E4WA 4A23A 2NN3C 3GLFA 3UY4A 2E2WA 4LJYA 3FCEA 3N6XA 4Y2UA 2XAUA 4AL4A 5JJKA 3E58A 3T1YB 2O8CA 1LJ8A 5CBPA 1CNFA 1FX0B 4G36A 2EARA 3CA8A 4ALMA 4B74A 1MT3A 1UAYA 4QDXA 2WNIA 3QLTA 2CKMA 3ZDAA 5H5JA 4V1CA 4O2BB 2BGIA 4GC5A 1AF4A 4D82A 2GJKA 4D42A 2I65A 3T9FA 1VL2A 3UOAB 4CG1A 4BRWA 2GGSA 3I9JA 5E0OA 2B1UA 1SRAA 4OJQA 2ZUEA 1P2DA 1AHPA 1XYDA 2TMKA 2H4WA 3EXEB 2OD9A 4OBWA 3WISA 3TIVA 4QREA 1Q80A 3EAFA 4DDHA 1MA0A 1VG0B 2VDOB 5TEWA 1LD3A 4WTOA 2WFLA 1GRQA 2FPPA 3PRHA 3GN1A 4ALLA 2QTCA 3R6DA 4ZVVA 5TDHA 1XKTA 3FHCB 4UAJA 2QW1A 5CNMA 3EJ6A 1PHPA 3RYIB 3C41J 1Q1QA 5BYAA 1B2LA 3SN6A 2G5CA 2RBEA 3IMEA 4DCGA 4PO1A 2V7UA 1Q50A 1DAGA 3EN0A 2ZJ0A 2VDVE 4JC0A 1M33A 2QJRA 3L6UA 1BFUA 3ND8A 4HDRB 1P0IA 1FTQA 2EW8A 3RYTC 4D44A 1KK7Y 2LIVA 1BH6A 3HNOA 1FA9A 1I5RA 2K87A 4YJGB 2POCA 1D5WA 1T5OA 1U0NA 4M1EA 3ZXIA 3HCPA 4D6PA 3RVRA 3NUZA 1WXDA 4U2FA 1ECPA 1ESCA 3H1GA 3ID6C 3NO4A 5B2ZA 4WPGA 3BK1A 3DUFA 3P0IA 1F8YA 3C70A 1TN4A 4FDAA 3CNNA 1TFUA 3IV6A 2ZRKA 3LDHA 1GGNA 3K0BA 3NC1C 3QVKA 4GMDA 3PQ3A 1WY9A 2H00A 5HOQA 3OO0A 1U7UA 3WLIA 4BLPA 3R5SA 1E5LA 3Q88A 4YJ3F 4QPNA 1L7XA 3CTMA 3ZBPA 3K1AB 3MWLA 2JAWA 2Z0MA 4RJKA 2OM2A 2FPIA 4RE6A 1Y7PA 2PWPA 4JS0A 1MEEA 4RXUA 5T4HA 2JHFA 5CM9C 3JV7A 4Q0MA 1L5ZA 5H68A 3QENA 4NYIQ 2KLDA 2YXDA 5EUMA 4O6VA 2AWNA 2DSTA 3DXLA 5DYTA 4GYKA 1U5BB 4HG2A 1Y89A 2B4KA 5LC1A 2L98A 3QELB 1E8DA 1VJ0A 5JJBA 1WLYA 4BRUA 2NT4A 4D4JA 1P4GA 2X8WA 1DG1G 3OP1A 2AR0A 3OX2A 2JULA 3QMPA 1RWQA 1DJZA 3HGMA 3NSIA 1YJ8A 2DCMA 1QS0A 5G53C 3N0TA 1JI0A 4PQGA 5C34B 2C2WA 3EC1A 2GBLA 3QPWA 3ONFA 5TT0A 2R96A 1KAGA 1RLOA 1P74A 5CW2A 3TLGB 2DPGA 3M6UA 1QAOA 1GL6A 2RD2A 1UOQA 1NF3A 3SD7A 3LDAA 1HLDA 4E51A 1K2VN 4C6SA 3ZE2B 1CUUA 3RFXA 2Q5QA 2E21A 1RCUA 4WZBA 4XLLA 5TT1A 1MA3A 2E5LB 4TV9F 2BBWA 3NV9A 1UURA 2OQRA 4MV0A 3GJ5A 2NZVG 4JIMA 3RH0A 5D1NA 2WM9B 3DGFC 3BL5A 4FFLA 1IWOA 2KI4B 4YS6A 2B82A 2ZKMX 1W47A 2PEZA 2DP4E 1K9PA 2W6MA 4G9GA 3RIMA 4K6HA 5JNLA 2WUFA 4L8FA 4ZYLA 2CXJA 4KQ2A 1FMTA 2Z56A 1GSAA 3F6BX 3QYPA 4PTLA 2JAUA 3BXHA 4LHSA 4EJ6A 3BZBA 4WOCA 4JU8A 2JIZA 1JPVA 4MDFA 1R0WA 1TECE 3PQ6A 3QSYA 5K3FB 3WK6A 3PDIA 2GJ9A 2A1TR 2PKXA 3KAPA 1W5EA 4G4GA 5K0ZA 4L5YA 3MNFA 2M97A 3D3KA 1FB5A 3ROFA 1MH1A 3D4LA 3SXUA 2C5HA 3DVKA 4XQGA 3WZMA 1I3NA 3AVPA 2R47A 3ZWCA 4L78A 1JRLA 4MS4B 7MHTA 2G08A 1KSFX 1HMPA 2BF7A 2B8WA 1Q17A 2E85A 2VYCA 3LMKA 4ZYVA 4RIIA 3PNOA 3HJBA 1WXGA 5LU8A 3MJ4A 4Q39A 5J3JA 1I4DD 3ZR4B 4MI3A 4KHPB 3FJOA 3DZJA 2C9YA 1K8RA 5FNVF 4DR4B 1GFIA 1NFRA 4GBJA 5BN1A 3LGXA 3RTDA 4C2UA 4GLLA 2WJZB 2VP6A 2KW5A 4XB6B 1GV1A 3F71A 4EMSA 1WOMA 1SD5A 1QRTA 4P3YA 2Z8YA 1AXGA 5HJ2A 2FRDC 4RD0A 2R1UA 1WR8A 2A0YA 4R83A 2RGIA 3TRIA 1QH9A 2QTVB 3OQ6A 2II6A 1XLWA 3FN4A 1AKUA 3O4YA 2GN8A 3PJEA 4FQ5A 3NH9A 1I6LA 1ZD2P 3LKZA 2Y1MA 4M7OA 2Q7XA 4UVDA 2FPLA 3BXZA 3BGWA 4OA5A 3OFKA 2H2IA 4PT1A 3VR3D 1U9ZA 4QDTA 3EGXB 4XYBA 3FB1A 4Z54A 2XMBA 3VC2A 3CNLA 2J30A 1Q0LA 2CSXA 4EI7A 3UJNA 2P6UA 5MHTA 3INRA 1II9A 1F48A 1PLLA 3ANSA 3A9RA 2WA2A 3SHTA 5LKAA 1U2DC 4I5LB 1SEVA 1TAHA 3CONA 2Y5IA 4G97A 4NXNB 3LKDA 3RGWS 1YZHA 3H0KA 3QA3E 2HXSA 2Q2QA 3EVCA 2HDHA 4YRCA 1L4MA 3CUTA 5JUWA 1WY7A 5SV2A 2MMCA 4NDBA 3FUXA 4JLDA 4F12A 4OHKA 3HKCB 1VJGA 2VR1A 1FE8A 2W6JA 4P5OE 4IWNA 4HTFA 1KK0A 3ELUA 3FYSA 5IARA 5HX7A 4L5CA 2JT0A 1QB8A 2POQX 3BIXA 1A0OA 2X2FA 4Z9BA 4UHJA 4DCJA 3PGMA 1EFVB 1KGSA 1FNNA 3SQNA 1DT7B 2X5NA 2B6HA 4UD6A 5T4BA 1SD1A 4HWKA 1NAHA 3EZNA 4Y2HA 1GPLA 5FWDA 2CCKA 4PAGA 4G09A 1T0HB 1JIIA 1N25A 4PE4A 4DRZA 1EWYA 1KFBB 5BT8A 1V0JA 1XKQA 2CCJA 4YK7A 2LP4Y 5FP0A 4NQRA 2WU3A 5A6SB 4XAQA 4CQLB 3L8HA 4BHTA 3ZG6A 4C2AA 3KPJA 1FMLA 1R8QA 4YRUA 5DISB 4BFVA 3PRJA 3RDPA 3O8NA 3QBTA 2B78A 5BN4B 3P0JA 3L7JA 3SYLA 3CVVA 2F43B 4BN4A 4LF9B 1KP3A 3NTVA 4P3NA 3IMGA 2CHQA 1M2WA 1QVVA 1DKMA 4FFSA 1Q14A 4N6GA 3B1FA 3RRFA 3KJNA 1MB0A 3PC6A 3RWOA 5TF4A 2H52A 3AHIA 2I7DA 4H7HA 4L08A 4B2IA 5B3LA 4R1UA 3GK2A 1MC8A 1E2JA 2PT6A 2ZIVB 4QGHA 2ZSUA 3ND9A 1VI5A 4GOXA 2I9PA 3GP3A 1U8AA 2OXFA 1PQUA 2ZRGA 5EWJA 4DXAA 1W7JB 4BBPA 4L5AA 3NSLA 4LRUA 4AMVA 3CYFA 4GXRA 1AHRA 2ZVDA 1RE0A 3WL8A 3JALB 3PU6A 1ZIOA 2QQEA 2WSSA 3MTQA 4OKIA 1EZ4A 5DICA 3BGVA 2GAFA 1PSBA 1AVSA 1HT0A 1EB8A 1NXQA 3ZXSA 2DFVA 1J06A 2IHJA 3IVGA 1M2KA 1Z0IA 1ZWKA 4C6RA 4IDBA 4BFUA 4R51A 1T24A 4X91A 1QIDA 1Z4PX 2D1SA 1UPAA 4O1HA 1OT3A 3KQHA 1U7TA 4M60A 1JKFA 1HI9A 3L1HA 3E1KA 3N05A 5KBYA 2C8VA 4DHEA 2EJCA 3HJHA 2Q29A 4XRGA 1H4BA 3ZEIA 2JCVA 5L8VA 3KR0A 1J00A 2H4HA 4O4IA 2VPWA 2D59A 3G8DA 2EF1A 1FUKA 3X2EA 2Y1GA 4Q1CA 3MG9A 4W4TA 1U90A 4MWGA 3CZ0A 2HK6A 1C0PA 4KFSA 4ZVTA 1UM9A 2C7VA 1CP3A 4OTZA 4IJMA 1J2UA 3I5AA 4D3ZA 2Y1OA 4FDMA 3OJEA 3O31A 1Y80A 4LOIA 5JJLA 1FP4B 1QF7A 3JVVA 3UK2A 2CYBA 1A5ZA 4R8MA 1Y42X 3TH5A 4KMRA 3NB0A 4DA7A 4DUGA 3F7MA 3NV7A 4MDYA 1O2DA 4S2EA 3CHYA 3Q6MA 4D2IA 3GWGA 4F85A 5JOLA 1IWQA 2H85A 3AZOA 4B4OA 4PALA 3TFOA 1X80A 2OVFA 1MJFA 2HJRA 3G2LA 2B94A 5ARBA 2C4VA 1EK1A 2H92A 4RGQA 4GH5A 5FBRB 4E08A 1XHFA 1CF4A 1JR3E 2QJTA 3RT9A 5CH8A 2VHJA 3JYQA 1E7QA 2V97A 2CWDA 4UBNA 3E27A 3UKDA 4BRZA 1W9ZA 1IRXA 4NPAA 3EFEA 1J8DA 1L5KA 4U63A 3PC7A 3A1SA 2VRCA 5BNWA 1N2HA 3LZCA 1RXCA 3TS1A 1CM1A 3DJFA 1UK8A 3B8HA 3RAFC 2GTIA 1PJ8A 3T34A 1S6JA 2CXRA 2BNXA 2GPNA 4NBVA 1P2UA 2ZEJA 3B1VA 4HB3A 3H9QA 1JKXA 3PXGA 2D5BA 3DLAA 2CSUA 3UJ3X 4BC0A 4O4HA 2PMWB 5HL1A 5CFMA 3OPYB 1H2XA 3IB6A 4FLFA 2IPOA 5AD1A 3SVTA 2HREA 3RASA 5I4BA 3AEQA 3GGJA 3MB8A 2BKVA 5DGIA 2IC5A 1L7BA 3KAJA 2C2YA 3QEMB 1CT9A 4GS5A 3PATA 2EDCA 3CRRA 5KYXA 3C87A 1KTIA 3CZRA 5CDTA 3EQ8A 5TNCA 4G0YA 3CKLA 1EFTA 5K51A 3WIVA 2PPVA 6ABPA 1LWNA 3WIBA 1E5VA 2XT0A 4FMCB 4HNGA 5IBWA 3EXFB 1WDMA 2PR7A 3HXMA 4MYRA 1ZL0A 2CJYA 2B9VA 2Y71A 3P2KA 3L5KA 5JO9A 1UZAA 4Q6BA 4XYLA 1IN7A 4L8GA 1GZ3A 1DEAA 2GV5A 1WEHA 1VIAA 3OZGA 1VL0A 5A4JA 1I5OA 3JZDA 3K9WA 1IONA 1YS6A 1X02A 2D1YA 2OB1A 3DDOA 2JJ1D 1BXZA 3L6CA 1JZSA 4K1XA 3TLMA 1E6CA 5TE9A 5ABPA 2X9VA 2PU5A 3AV0B 2O2IA 3TLCA 2ZE6A 2GPJA 3PHGA 4L4ZA 4QBGB 2GX6A 1GUDA 4ZVLA 1RFGE 4Y2TA 3JZIA 2QGNA 2QJFA 3UJ6A 4C0LA 2ZQ5A 4B46A 2BCGY 4F96A 4Q4JA 2QACA 5KU1A 2YIDA 2VSOA 5A1TA 1JWAB 4YGXB 4KO2S 4MVJE 2V9CA 3AKCA 3OPQA 3UFXA 4UXHA 1P9RA 2RK3A 4LKRA 2BFEA 4QVIA 2AI2A 2NZWA 2ZUCA 2W2VA 1X7WB 1A82A 1EFKA 4BY9E 1ULSA 4MPJA 1JQAA 3MB5A 1XRPA 2Q9AA 3O4XA 5DBIA 1LW7A 1K93D 3FPAA 1MMFB 1DXHA 1VSQA 2ATCA 1J7PA 3KJQA 5HFJA 5FUXA 1UJ4A 2REXB 3BK7A 2QRZA 3DAFA 2XWBF 3LQ2A 4MCAA 2AEJA 4PCUA 2C00A 2LXNA 5MGNA 2Z04A 1APBA 2V55B 5BWNA 3WO1A 1DIHA 1E5DA 4AZ3B 3NJRA 5CX1A 4ML3A 5E0KB 3TTXA 1L8OA 3VISA 1TNXA 1KMMA 2UXBB 4Q7EA 3AILA 2AK2A 5L3ZA 1G33A 4FNGA 4BX0A 2RONA 2WB4A 2F3PA 5TQ2B 4B3IA 4UU7A 5FWXB 2XYVA 1ODIA 1PT7A 2ZNDA 3VMMA 1E3IA 1Y4DE 1YGPA 2XIQA 3DMRA 4PSKA 3O82A 1RSZA 2CK3A 1MENA 4B8WA 1TIBA 2HJSA 5B30A 1TE2A 3T7EA 3D7KA 1KAEA 1N0YA 4QJ4B 1J8YF 2V6JA 4UBKA 4DMFA 2E6KA 3EVGA 1KI8A 1XFUO 1ISHA 3TW0A 5IEJA 1VGQA 2I67A 2Y1KA 5K1ZA 4M1KA 1T8WA 3N58A 3TRFA 1VJ5A 4HSZA 3B3JA 5AJVB 2FPKA 1DQRA 1T25A 5H0IA 1JHQA 4R3WA 2LUOA 4HVAA 1TA9A 2FWNA 5E1DA 4OREX 5EE0A 1Q19A 1GL7A 1ZK2A 4B4VA 3ZQJA 2JGJA 1KU0A 2I4NA 4I19A 2QXUA 1KE1A 2FTKE 5LUBA 1V5WA 1G7TA 4YHBA 5LMCA 3TL3A 1QLKA 4XUCA 2BELA 2PBLA 1LLQA 3IDAA 5JAPA 4TL6A 4RXMA 5JYEA 1SELA 4BY5A 2Z1NA 4YIHA 2Q3BA 1CJMA 1UQRA 1SKBA 1PJ2A 1CS0A 5BSUA 4NHOA 3RV3A 4PE1A 3LFTA 4UM9B 3PHBE 1ADGA 2AXNA 2R4TA 2PX2A 4EW3A 2BAGA 2V4ZA 5ALLA 4NE7A 3IILA 2CY0A 2VHUA 3WB1A 1SC9A 1NCYA 3VI3B 4W8HA 2LC5A 3KYDA 1OFUX 3B87A 3P20A 4NARA 2XVYA 4D9EA 3BULA 1RPAA 3OO1A 4NBKA 5EQTA 3ESXA 5TARA 5ERXA 3BMNB 5FUBA 4M1YA 3CLSD 4FBLA 3HDVA 4BVFA 3I9FA 3ZQ6A 5EAIA 1XCPA 4FB4A 8AT1A 3HABA 1ODSA 4BLSA 1SBZA 1C9JA 2BKAA 2PQ6A 3VR2D 5JG7A 4MBEA 3C74A 1YU6A 2M6LA 3FCYA 3U80A 2QXTA 1S6CA 1UHIA 3B53X 2H0RA 1D9ZA 3EZ2A 3ZKWA 4CNBA 4EB0A 4ZWNA 3KWFA 1W87A 5BYJA 1ENPA 1JNYA 3JASA 4FDTA 2IVFA 3KYCB 1QTQA 4KLAA 2GEJA 1DO8A 2JANA 3Q1LA 1Z6AA 3ZWVA 3B6XA 3TTYA 3LAWA 2DR3A 3KVNA 4TQAA 3Q3HA 3QYFA 5KNDA 3ZLJA 2X40A 1UJ2A 4FMBB 5I7SA 4YYZA 4NOJA 1QH1B 5JRDS 4NH4A 4H60A 3K53A 4F06A 1PTJA 1B14A 2H1VA 4MRAA 2V58A 2BIFA 3FLEA 3G82C 1M8PA 1RRFA 2C5EA 3THYB 1E9CA 4NR0A 1C3VA 1D2GA 4I7EA 1I10A 3TAUA 4Y1RB 4G41A 1N4AA 1Z75A 1I14A 4MMZB 4AO7A 1U5CA 1PQ4A 3KP1A 2H3EA 1FNCA 2HWKA 2IXGA 4PC7A 4BGDA 5CM8B 3HJUA 4X8LA 2ZIWB 3D0YB 1R2UA 3TJMA 3VKUA 2WSIA 4DA0A 3P2YA 2HWXA 1Q83A 2GAAA 2BEVA 3JTDC 3E9DA 2JFGA 1XG5A 2ZFDA 2XDWA 3EWAA 3PI6A 2HNKA 1T5BA 1I7PA 2V6MA 3TKYA 4DA8A 1PYDA 1D04A 1II8A 3L47A 3ER6A 4NNJA 1OUMA 4EAAA 4B6RA 1LY1A 3ZHBA 4IOLA 4F5DA 1LSOA 4HEJA 2Q91A 2YQZA 3TTUA 1E6WA 2VTKA 1GYPA 3OIYA 4OLJA 2RGNA 4TRJA 1U2RA 4P54A 3CCBA 1ZMRA 4B8YA 4YMLA 2ZS7A 4HDAA 3KBOA 3CSSA 3O4HA 4JJIA 5HW0A 3SBXA 3E7XA 4Q21A 1L4UA 2K0JA 3RQIA 3G7UA 5AM4A 1PR6A 1AP4A 4TKMA 2ZSJA 5B8IB 5FH9A 5LIPA 3X1XA 4JA2A 1WUIS 3EVVA 2KGRA 1NVFA 5B36A 4IVQA 1R3UA 4WESB 1JG4A 2HWWA 3EVUA 4FBGA 2C98A 3FUWA 1AK2A 3BCHA 2COEA 2R7KA 1ADFA 3GIDA 2IIQA 1QH0A 2PY6A 2L18A 4DB4A 2Z9CA 3DCYA 1DARA 4TSRA 1TMOA 2G0AA 1SQSA 1QP0A 3GBVA 4EPYA 3URKA 4QYTA 1RAEA 5I8PA 3F67A 1KKUA 3V4SA 2WTNA 3C6MA 3SDBA 1FQJA 5L3QA 4CGYA 4F5EA 3MWKA 4EPXA 2X4LA 5TQJA 2J9ZB 3O83A 1E99A 3S3TA 1TUIA 1XX6A 3ZH9B 4C4RA 5KJ6A 4WJKB 2RKBA 4NH0A 4RSGA 1PG2A 1DZ3A 4N82A 3WQHA 2BFFA 1G2OA 3DL0A 3A8TA 1T14A 4LPSA 4KFRA 4TUYF 4PFSA 4ZC1A 2WCMA 4JP3A 2YZNA 4HDNB 1T8SA 3SC2B 2V3VA 2G7ZA 4PIPA 5BSRA 4MA5A 4ZIRB 4PNEA 4DNFA 1TD1A 4DEYA 2PZ8A 5KWSA 1HL3A 5F33A 5BMVB 3I1FA 5DHAA 5IJZA 4N03A 3WQQA 1GPJA 3I30X 4Q9DA 4R71A 4DDWA 3TAHA 4DQUA 1TO6A 1OE0A 1JMKC 1QYVA 2FSHA 3G88A 5M29A 1RM5A 4TMXA 3MTEA 2WNDA 3UBMA 3BSYA 1HFKA 3QUCA 2QTGA 3USCS 3A4LA 5HF5A 3TZEA 3T7TA 3SS3A 2OS8B 3ZLBA 2W42A 2OZVA 3ZZUA 3QP9A 3HR7A 3EZXA 4EHHA 1JHYA 3HB0A 1NX0A 4UEOA 4YGCB 5GQQC 1PJBA 4KRYA 3F5DA 1K63A 2WIFA 2GSDA 3E5RA 1RYBA 2ATEA 4G2TA 2RH4A 2V5UA 4C0QC 3GNQA 4K9SA 2G71A 4P7JA 4E70A 4DY4A 4YV7A 1PWXA 4CRWB 2Q3CA 2G77B 1W1UA 4LIPD 4UCQA 4YGYA 4GMGA 5GAJA 4LK2A 4WY2A 1Z2DA 4IXDA 1K98A 4CPDA 2ZCUA 1PWYE 3V3KA 3R3VA 4MSUA 4MUXA 2JGAA 2DGDA 3D4NA 2F1RA 2QL9A 1WCWA 3WGMA 3AUKA 2MJLA 4EJSC 2ZIXA 2Q1SA 3NDJA 1Q3HA 3S2YA 3N2IA 1R0ZA 2ODBA 2OTCA 3CN9A 3RJ5A 4JWQA 4YAGA 2PZFA 4KFCA 3X2FA 4ZQBA 3WGQA 4R54A 4AMYA 3KV1A 3CF0A 1KH3A 2ZZNA 5TX7A 3MYRA 1JAXA 4IIJA 3QE4A 1YCFA 1VCNA 2FMXA 3TSOA 3JD0A 5EMNA 1E2FA 3CR4X 3AEXA 2QRHA 3QFHA 4IDNA 2JI8A 3PEFA 4R8RA 1HT1E 2W11A 2VP4A 3MM4A 1VRKA 1QGUA 4DMLA 1VP3A 4D5EA 4YLGA 5ALUA 1G2QA 3BIOA 4YUXA 2WD7A 3HJGA 4TV8B 1TQ6A 3AHGA 4F60A 3KUXA 1KJ9A 3ZW9A 1XTQA 3QE0A 1WZUA 1KF0A 3LIIA 5AI9A 3B60A 3Q12A 1SBCA 3SG3A 1W48A 5FI0B 1SXJA 3N8HA 2QMZA 2LV8A 5IMBA 2O8FA 1JR3D 1HE1C 4HNUA 1MAUA 3ITDA 1LPAB 3VJRA 2JLZA 1SPXA 2DM6A 5EI5A 2X41A 4DS3A 3L2OB 2R8OA 3TM4A 1XWIA 3RHSA 1JDPA 1KYVA 4INJA 1O3YA 1FPMA 3FRJA 2FQYA 4BNDA 2XBMA 1SBYA 5EHQA 3C6XA 5JNRA 3GGCA 3KTOA 4WXYB 4IMJB 1V25A 3HJCA 1RS0A 4XQ0A 2G63A 3NFYA 4ME6A 1BS1A 1H42A 1FF9A 1KNQA 5FI1B 4LVUA 5IK2A 2WY2D 4O63O 2AN3A 2I34A 4F72A 2REQB 3PI7A 3CWGA 3IO5A 2O3TA 1JVBA 3OAAA 4UCWA 3ISVA 3ANMA 1O0CA 1M46A 1MJGA 1LVHA 1FPQA 3V9AA 4D8TA 3A10A 3MBIA 4RHCA 4FZJA 3PTAA 3SQXA 3GDFA 2JOJA 2P4UA 1JHXA 1JB9A 3ADKA 2JF0A 5CB4F 3EFBA 3WAJA 2QN1A 3PPYA 1V6AA 5JDCA 3KOOA 2NUAA 2L4IA 3Q1KA 2QVXX 1CTRA 2LUCA 3EXHB 2XSZA 3HHPA 5JOQA 1ZEMA 2XTNA 4G6ZA 4J0IA 4E46A 3STWA 1EI9A 3FLMA 3RKSA 4IUBS 1PYGA 3GT7A 1VKRA 4OQMA 2HQSA 4F0JA 2D54A 1GFZA 3RSOA 3PYXA 2DQZA 4LF7B 5K4GA 1X7YA 3R20A 3W1VA 1KEZA 2AG6A 2CHGA 3V1YA 2ZIFA 2OQVA 5KPJA 1TAGA 1B0PA 3VM6A 1EH2A 1TTHA 4B4KA 2KFHA 4AZVA 1N34B 1DWPA 2Z2YA 3D5EA 3VR6A 5LR6A 3TTSA 2BCXA 2I9KA 1XD2A 5FPTA 5FBZA 1MVOA 5IEBA 4MHTA 1OTYA 4PLTA 3CLTC 2VC2B 3G0HA 1ULAA 5KDOA 4MVJD 4PLZA 5DTIA 2P9EA 3I3OA 5EZSA 4R2HA 1U3GA 1EIZA 5J2UF 4HAUA 2VTDA 2CVQA 5BQ3A 5LWQA 1ZGHA 2VS1A 2WCFA 3S2FA 1D0VA 1JQ3A 3AVOA 4B3CA 3D43A 3O8OA 1RYZA 3BOWB 3DCNA 5DN6A 5C18A 2P2YA 4RDHA 4EUEA 1Z0AA 4KX3A 4C2BA 1Y4ZA 3L1VA 2I66A 2VQSA 3MJEA 2GHIA 4NL4H 4DADA 3KSRA 2QLLA 2ZOSA 2BFAA 2GBFA 2XA1A 4H15A 1Z0UA 4GT1A 4RZQA 4KXLA 3OLWA 1R6DA 4DA4A 4M99A 4RKWA 3DBRA 1KHHA 2B5WA 4AYTA 2I22A 4B85A 4CKXA 1U8XX 1QR2A 4DZRA 1NY5A 4HGNA 5ELMA 2E4YA 3I34X 5HQJA 1Y4SA 4FDUA 2WU4A 1W73A 3WGUA 1ZQ1A 1CZLA 2NXWA 1KQVA 1U1CA 3ZVNA 3H9EO 3JQGA 2XLCA 3CE6A 4XM2A 2XY4A 2WYWA 1Y5LA 4JI3B 4X7RA 3HR4A 2TSYB 4WBNA 3G49A 4DIOA 3FBWA 2WSSD 2NTEA 5GINE 1Z6TA 4JB3A 2WC1A 1JT9A 2C4UA 5JPIA 1X13A 2EP5A 5EFZA 4U8HA 4X00A 3P9ZA 5BSFA 5A0TA 1IXYA 3B3GA 2QQFA 2W6ZA 1JBEA 3D8TA 3D31A 3UNXA 3RS7A 2CNKA 3VU3A 1U2EA 4CM4B 1QX4A 1GZUA 3IBTA 1XL1A 2G36A 1EFCA 5BQ5A 3WVNA 4G2NA 5DGTA 4B3BA 2FG5A 2B4AA 1X3LA 4WZ6A 3FPJA 3SFTA 3O2JA 4URUR 3A9WA 1Z4IA 2L0PA 1GGWA 3E5NA 1TW2A 3R0XA 3NZEA 1ZDMA 3EH2A 5F98A 2P9YA 4CEIB 1KDTA 2B83A 4PNHA 2R60A 4I55F 4XJSA 4BB5A 3GLSA 4OMFG 1ZUNA 3FCXA 1WXEA 3KUKA 3MIZA 2VWHA 2NP7A 5C8DA 4GE3A 4UPGA 2PT5A 2IZ7A 2DUJA 5I2LA 4P38A 1S3SA 5JBIA 1PBNA 3H5AA 1ZKDA 2ZS8A 1L4FA 4MRSA 1UBTS 3L40A 5ISMA 5FL3A 5GIPE 4HS9A 3OUTA 5JMPA 2O2CA 1WKCA 5DSTA 2ZGVA 2D2FA 1T3SA 3UK0A 4MO2A 3VSDA 4D4HA 4PRYA 1TD9A 3PG5A 3LTNC 4UW9A 3R0ZA 5F5XA 1IK6A 2LUXA 2H1HA 4HLUA 1RI2A 4KZPA 4E32A 5J4KA 2C2MA 3AG6A 4IFBA 1GZ4A 2Y1DA 4JJKA 1RBMA 4MAAA 2F1IA 4PR0A 3EVZA 5DMHA 3FDXA 1B1GA 3W05A 1ZNYA 1TUJA 2PU7A 4I08A 1SM4A 1L1FA 2RHWA 2PZKA 4MYTA 1NW4A 3GFBA 5HEKA 3PV0A 3JARA 1IPFA 2C0PA 3R76A 3COWA 1TU0A 5CIQA 9GPBA 1BAPA 1GCGA 4B45A 4IXTA 3U3XA 4QJ5B 3R3SA 5E2AA 5F52A 1ZM3A 3DB1A 1Z0SA 1Q20A 1QIWA 1L7AA 4OUDA 4D9NA 1MBZA 3WGNA 1SR8A 1RI3A 5HS6A 5KCZA 3HB1A 3PGLA 2D7DA 4EQZA 4A36A 4A03A 8ADHA 3OZBA 4LISA 2DWCA 2Y1NA 1Z07A 3IV9A 4OXNA 4J0DA 4TS3A 3V97A 2X58A 5JAQA 1G16A 4DUYB 1MZPA 4MI9A 5KNBA 3K5WA 1XMQB 4B2LA 4ARUA 4BTLA 4OR9B 3U4DA 4RFLA 1SVIA 1YZYA 2YV5A 4JVNA 2O5VA 5D5QA 4C0JA 3ZDEA 1P2SA 2Z4TA 4RULA 2C7PA 3MQ2A 4Q15A 4X3OA 4WZAA 3RRMA 2P78A 2HX1A 1EYZA 4HL6A 4WXMA 3QVJA 2HA6A 5DZSA 4QPZA 3TSYA 4WNYA 3BREA 1P9WA 3ZX5A 2ASVA 3QJGA 2QIPA 3PS9A 3SLRA 4I5GA 3KSBC 1P17A 4X5OA 2HM7A 5LA6A 3G8YA 3CNHA 2VZ9A 3IDQA 4TMFA 4B3MB 4DLVA 1DQEA 2JI7A 3A9TA 3T5CA 4FGJA 3T1QA 4P7BA 1KO8A 3L6OO 3VPSA 4HRXA 2GK4A 4HC4A 5IAEA 1NYLA 5HLOA 4EYQA 4JMPA 1N7GA 2OXIA 3LZ6A 4OLAA 3MGBA 4NMXB 1MCZA 1Z2CA 2H2HA 5HKWA 4FFMA 5DT9A 4MZKA 2C0CA 3EHEA 4Z1MA 2CFSA 4MRMB 2WZBA 4X8OA 1BH2A 4IYJA 5JH7A 2J0SA 1QIEA 2ZSIA 1J09A 1OGJA 1RC1A 2XTZA 1CWUA 1QFXA 1YZUA 2BKXA 5AKGA 3QUSA 1Z17A 1E3TA 1OI2A 5LQCA 5I01A 3VNUA 2B1RA 1HX7A 4BVKA 4H1UA 4AT1A 5CB6A 4BLVA 5P21A 4CV0A 1I0ZA 2CC2A 5A5DA 3OCUA 3V7NA 5CLFA 4OU4A 4AJHA 2BFOA 3RVNA 4RTPA 5EGSA 5DTJA 2VUHB 5K0NA 4YC7A 4CKCB 3F6PA 1Z4HA 2VXOA 1LPOA 4DLXA 4Q9JA 3IUYA 4QGGA 5CNKA 4R8VA 3W2EA 1YJQA 4J16A 2X4DA 4DCCA 3BVPA 2KPHA 4LF8B 4DMMA 3RC1A 4HRVA 1SQFA 3CURA 4PPYA 3DCIA 4IHJA 4JJGA 1R88A 3PPIA 1CQIA 1OB5A 4LGMA 1S1EA 2QDIA 1X1DA 3N28A 1RXYA 3QU9A 3M3HA 2B6NA 2IXDA 5CEJA 4LVCA 5JAOA 5JZVA 4MQEB 5KTPA 2RC5A 1V16B 3OLXA 3QTTA 5ARCA 3V7YA 3OVMA 4GM1A 1BVYF 2P9TA 2PG3A 3CINA 1IXZA 1T5IA 1ATIA 3MS4A 8ATCA 4NF2A 2WWXA 1XZ8A 3F9RA 1JIUA 4I4NA 3GPCA 3OPXA 4QBIA 5G08A 3JCZA 2OCXA 4JOQA 2ZBDA 4BNNA 3K2QA 4EVRA 5JD4A 1XK4A 3V4ZA 5EXXA 1RR6A 2A9PA 3D5QA 4FZ3A 3GRZA 4YP1A 3GLKA 4KQGA 1PWZA 3WJ1A 2FR0A 4DIFA 1XPJA 3E70C 1C81A 3F47A 3AHEA 2YBDA 3WLOA 1USUA 1CW2B 4JLMA 1NMSA 2NU8B 1SL7A 3KFLA 3F78A 4OBEA 1M6VB 3C1VA 1WD5A 1KSMA 4FI3C 3DBVO 3N2GA 4MKRA 4NZZA 3BAFA 3VGPA 5DFAA 4CIAA 4QYMA 3SZUA 3CRZA 2YJ5A 1N5DA 1QZTA 2AX3A 4DV2B 4ZVMA 4OAQA 4I8IA 4UTVA 4BLOA 2WJVA 2O5EA 1CF9A 4BC1A 1XEXA 5AVKA 2FFHA 3SS8A 2PWYA 4Q48A 5EOVA 3PNSA 1NDUA 1GARA 1XXHA 1T5HX 3R3HA 2XQVA 5JU6A 5FWYA 1OBHA 3ZU2A 1QG2A 4KG7A 1E1QA 5ALGA 4MEAA 5H7XA 3FTNA 3KLOA 4V0LA 1FFEA 1NTOA 1HY3A 3WAGA 2FMHA 4H1WA 1HTTA 1S2NA 2FW1A 5B7NA 4YRBA 3S0FA 2IA5A 1FS5A 4U9UA 1OREA 1QWSA 2DOQA 4J0HA 3GXOA 1SN7A 1ZKMA 4I3HA 2O0KA 2OCDA 4WLOA 4N5DA 1K5PA 3KYIB 2SBTA 2V65A 1JHVA 5AH0A 2D2EA 4B6GA 1BS2A 4KXFB 2HPAA 4PZDA 4F56A 1UBNA 4MGYR 2NGRA 1ONSA 4FHCA 2WYOA 4CLXA 1NLMA 1WCIA 1KC3A 2G09A 3H65A 4GE0A 3AEKB 5HBRA 1YR3A 4NBNA 3KJZA 4JJ7A 1TL7C 1A2BA 1AKMA 1XZDA 1Z4KA 1FL9A 3B38A 3P26A 3GLFE 3BHMA 2GYVA 4G9EA 3TLXA 3T9BA 5K7SA 1UPFA 3KV3O 4Z8XA 4XIFA 3GC6A 3RLIA 1BFDA 4KAXA 1N3BA 4U2KA 1RHRA 4GWGA 2BEUB 3V42A 2OPOA 4DARA 2P6PA 4L5JA 1GTL1 3NJ4A 2VJYA 3ZIAA 2FSFA 3FFAA 5KSPA 1F2TA 4PLPA 1BNCA 2VT7A 4OQQA 2GBPA 4MRXA 3KZKA 2HR1A 2PRIA 4OI2A 4JKTA 4QJIA 4W1PA 4CLRB 4FHZA 2Q3LA 1KBQA 4TKUB 2IXTA 3NEJA 4RLFA 4Y2JA 2BONA 5ENDA 3HEAA 4TN5A 2OK7A 3JPYA 2UZIR 4I5DA 2QEHA 1YV9A 5JJ5A 1TC2A 2CLLB 5C1PA 1W88A 5DNEA 1CDPA 1QRUA 1FP6A 3KB8A 3QJ5A 3C48A 2C9CA 1WW3A 4O2AA 4ITRC 4N12A 5BWCA 4MCHA 1FDWA 3SG4A 2BSQA 1USKA 5EMKA 3TL2A 3MPUA 3QLUC 5G4KB 4C08A 1S8OA 3DT8A 4AUEA 2DR0A 3U4AA 1ZOPA 4KMMA 1MHPA 3D8NA 2WYIA 4MW6A 5IAOA 2DQKA 1WDCC 1HF3A 1PD0A 4CU2A 1KY2A 1JMYA 3R9KA 2VTVA 1ZGCA 3ROGA 2IK8A 5KDDA 4DIMA 1CIPA 1NPDA 4HFRA 1GFSA 3LG2A 3T99A 3UBTA 3QQPA 2ZDHA 1PJSA 4DQXA 3ETGA 2VTBA 3R1PA 3A4MA 2ZRSA 3ADCA 5FXMA 3S0AA 3EMKA 2UZ1B 1KWOB 5LBUA 4QD3A 2L4HA 3TW8B 1YDWA 4Z86A 1OJ7A 5F2KA 1Z4OA 2KPOA 3TNDA 1C7ZA 3WL4A 4TRNA 2MA2A 3VBEA 4OI4A 2YGUA 1ESEA 4MVJF 4L6AA 4G1MB 4QFMA 1TNWA 2I6QA 4KN6A 4LN1A 1A8PA 3R3WA 2I76A 4B31A 1V3VA 4OGGA 1ZM2A 1RMQA 3TUZC 1I6KA 2R62A 5D3OA 3X1DA 1E1KA 1ONPA