1DELA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp and amp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
241
Chain Sequence
b'MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Phosphotransferase
total genus 85
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1delA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1delA01
5ANRB 1GDDA 4N3NA 4BZQA 1Z28A 2GILA 4CIDA 2AFIE 2ZIAA 4IDPA 3ZLJA 1KKMA 2FSFA 3FGNA 1XXHB 1E9RA 4IHQA 2ZS9A 4RD0A 3D6TB 4PSAA 2JIZA 4Q4HB 5FTNA 1N6KA 4M9XA 4WW0A 1WDTA 4UXJA 3E5HA 1G4UR 3U7HB 3K09C 4OI1A 3GPLA 1RZ3A 1Z29A 4LHYA 4AC9A 1TF5A 4IOKA 4OHXA 4GI7A 1E0JA 2NO1A 3NH6A 4DLTA 1DOAA 4YXWD 2QP4A 3GD7A 3WHKA 5EXPA 5FBLB 4A0HA 1EFTA 1KK1A 1Z3IX 4KCGA 5JEDA 1AGRA 4JL8A 1E2JA 2H8KA 3B13B 2WPDA 1XX6A 4LYJA 5DN6D 3NVAA 2KBEA 5FBRB 5JWOA 2KB0A 2ZYVX 1TF7A 2FSGA 3JZMA 2WWIA 5FL3A 2XOKD 3SFZA 1VYUA 2GF9A 3L43A 1OH6A 1IONA 3KL4A 3KTAA 4H1VA 5H68A 4OHYA 3BFVA 1ZM7A 2OXRA 5FBQB 5P21A 1AM4D 5AR1A 2JDIA 2ZR7A 4CEJA 1T0JB 2F3RA 4NHOA 1CJUC 1U0HC 5TARA 2P0EA 1Z22A 3M4YA 1MOZA 3C41J 3W8NA 2WAXA 4YDSA 1L8QA 2GCOA 3BGWA 3DM5A 4ZIRA 3SJBA 4RD2A 5KHOC 1KDTA 1U81A 5JWHA 4C0KA 2OHFA 5AK0A 2BJWA 1OLOA 3DKVA 3HR8A 4D0GA 4S2EA 4LOAA 2QGZA 4OI2A 4FWTA 1OT3A 4EFNA 3T1TA 5KPJA 1ZAKA 2A9KA 3BAFA 4OI4A 2IUUA 4Z8XA 4KBFA 1S3SA 2HV8A 4UNPA 4RD1A 4BFZA 2QPAA 1CR4A 3PXGA 4ZCMA 2R6CA 3O8DA 1Q1ZA 2WSMA 1H65A 2J1LA 2YC2C 2ERXA 5KYKA 3GEIA 1CLUA 4ASUD 5EP2A 4OBEA 1D2EA 5A0FA 2CBZA 2JJ1D 3TSZA 1JR3E 2BC9A 3A4MA 3B9PA 5UKDA 2HT6A 3EPJA 1NBMA 1WBBA 3ICQB 1T0HB 1AZTA 4II7A 1G18A 1DADA 2ODEA 1UKYA 4EPTA 2QMOA 5LD2B 2C8VA 1UEIA 2PT5A 1XBTA 1OFHA 2OLKA 2QMEA 1R5NA 2ZRLA 1NVWQ 3H4MA 1LVGA 4ITRC 3FWYA 4QGHA 3SI7A 4DLSA 1FQKA 3DO6A 2RGGA 2CMKA 4JBYA 3IIJA 1T3HA 2ZRMA 5SZKB 4P31A 2WJYA 1IM2A 1IN8A 3NKVA 2EFCB 2ZRNA 3DVLA 2H57A 3OEEA 4G5QA 2ZRFA 1XEWY 3MWKA 1VCNA 1HE8B 3A1WA 4TLBA 3E1SA 2R62A 1VIYA 3NC0C 1VCMA 1ZD9A 5C2JB 3VHLB 4EPWA 2BMDA 4LDJA 1UEJA 2V8OA 4RCZA 5FUVA 4U7DA 1W4AA 4LI0A 4F4IA 1DELA 3I1FA 1Z5ZA 2NO9A 4I99A 1G6OA 1CP2A 3Q8XB 3Q7PA 2RMKA 3TK1A 2R65A 4PZZA 3LFUA 2Q9CA 5KO2A 2RKOA 1NSTA 1R8SA 1H8HD 1SQ5A 2GESA 4IEIA 1UKVY 4FMDF 3V9PA 4ZCLA 1XD8A 5KPDA 2AD1A 5DNYB 1NNEA 3GJ0A 4RZ2A 4HDCA 4MGKR 3SNHA 1FNNA 1E2NA 1NG1A 1V43A 3OIVA 4PHHA 4QBIA 1X3SA 1KMHB 3MWLA 3K0CA 4Q21A 5D3MB 1IJEA 2O8CB 4GOXA 2C9CA 2YNMA 4DEYA 1E2IA 1G5PA 3ND8A 2B92A 4NZYA 4QGFA 4AKGA 1Z08A 3L0IB 3SN6A 1RYFA 3CM0A 2WOJA 1G3RA 2ZSEA 3EPKA 4TMWA 3VKHA 1XTJA 2WIAA 4BLPA 4DLYA 1YZQA 3K0AB 4IVQA 1G8FA 1N2CE 2JASA 4G01B 4PQYA 2WMOB 4RCYA 2Q6TA 4DLZA 1FNMA 1JPNA 1NN5A 3NTUA 2JLYA 1P62B 4OHVA 1K8RA 3TSWA 1L4UA 2ZRAA 2BMJA 4Q9JA 2IYWA 2VSXA 4M2LA 4MYUA 2YZ2A 4V0ME 1E9EA 2GXSA 1LFDB 3IUYA 1G19A 1KIMA 4ZKDA 5GADl 4A92A 4HUQB 5J40A 3LAWA 2DY1A 3K0FA 1SXJE 3TUJC 3K70C 5FTKA 1XF9A 2BVNA 1KOFA 1OYYA 1II9A 4XSHA 2CXXA 2ZRIA 1QBKC 3HR7A 3AKEA 3L0PA 2WZQA 2GF0A 1HV8A 4M1YA 1NKTA 2QAGA 1H8ED 3X1ZA 3NBXX 3ZZTA 4QJ3A 5EE3A 5JMTA 3CF2A 5B58C 2O8FB 1TMKA 4HB3A 3SJCA 4C0AC 4C2TA 4M9ZA 2XNDD 2O0KA 4RY2A 5E3HA 4QKQA 5FH9A 4DUGD 1Z0AA 4JSYA 5BYJA 2A7QA 3FMPB 3ZYCA 2VHJA 2ANCA 2YWGA 4AYXA 4D25A 2FPMA 4NYMQ 4H1UA 3QUSA 4KITB 4AI6A 1W46A 3WYGA 4ZI3A 2VHQA 5IHPA 2X77A 2GRJA 4AK9A 4ABYA 1LS6A 2QZ4A 5AWFC 3ECCA 1U0LA 1JJVA 3OHMA 2Z6VA 421PA 3K0EA 3GLFB 2ZSDA 2XTMA 1FUKA 2HCBA 1W0KA 5FUWA 4URYR 4EPVA 1GM5A 3FHCB 2FGJA 3U7EB 3VQTA 5FL7A 1HQCA 1II8B 1ZC3A 4B3DA 1Q57A 1E69A 1QG2A 2A5YB 1N0VC 1GWNA 4URUR 2J0SA 2NGRA 1DAKA 3OIYA 2UKDA 1P60A 3QQ5A 4Q4HA 1NJFA 4V0LA 5FPKA 3WYFA 3O8CA 2FEOA 2GJAA 2ZI7A 4Z51A 2OCAA 1M1YE 2WJJA 4HZIA 3P4YA 4JLVA 1E2KA 1UJ2A 2ZR9A 4XIGS 2QMUA 2O5VA 2F7SA 4Q7LA 2C5LA 2GCPA 1VCIA 2VIIA 2WSSD 2Z0MA 1EFHA 2ZROA 3H84A 3NEYA 5FPYA 1GKUB 1GL9B 4BFTA 1YRAA 1LB1B 1KZGB 3WRYC 3EZ7A 4I1OA 2KJQA 2FGKA 2ORVA 4V02A 1P5ZB 1XDBA 1T8UA 1D8TA 4G5OA 1Z07A 4Z8YA 1HTWA 1GKYA 2REBA 1GZSA 3Q3JB 4G0NA 5HKKD 1MR3F 1W36B 3GJ4A 2XXAB 1YHNA 3FKSA 4OQFA 5C18A 2ZYWX 2HDNB 3GFPA 1F2TB 3W9YA 4HLUC 4M1WA 1NN3A 4B48A 1OXSC 1T6NA 3RANA 3A8TA 2OM2A 4M1TA 4IW3B 4B6FA 1TUEA 1US8A 2Z4SA 2VEDA 5JSZB 3GLHB 2FPKA 2GK7A 4DCSA 3WYAA 2ATXA 4MA4A 4Q1FA 2DFLA 1G64A 2ZE5A 1N6RA 4LHZA 1EGAA 3CB4A 4KSCA 2RCNA 3GLIB 2O8DB 1NIPA 2B8TA 2KSQA 5DHFA 4D26A 5GVRA 4B44A 2WJHA 2HT1A 3X1WA 1C4OA 2ONJA 1P4SA 2HLDA 3RAPR 1YR7A 3CZPA 4ZCIA 4MQBA 1WBDA 5FOVA 2RAPA 2NG1A 4C0BA 3NC1C 4IFBA 4UKDA 4ZDJA 3I72A 2V7QD 2EWVA 3SJAA 2G1KA 1GSIA 5JBQA 1G7CA 4B43A 1NSFA 3SS8A 3OIUA 1XD9A 4MUBA 2C9OA 4W5WA 4A2QA 4BASA 1FMLA 4XTRA 4HAYA 1FX0B 1RRGA 1EXMA 3GFTA 4R9UC 5FFMA 4XD7A 1TU3A 2TMKA 1S0UA 4B74A 1E0KA 2O8EB 2AKAB 4NONA 4URVR 2J0UB 3EPHA 2ZSBA 1E32A 3ZIAA 3PEYA 1E9FA 2J45A 2A78A 2HUPA 2F6RA 2W58A 2ZUCA 1NN0A 3IO5A 2VP9A 3FDIA 3QF7A 4L16A 1JEDA 2ZJ2A 3SFVA 4DLVA 2AX4A 1OHHD 1JBKA 3NBFA 5KNDA 2QM7A 4JS0A 4LV6A 5K8TA 1Z2CA 2X2FA 3LBIA 2N1BA 5FUYA 3VAAA 2WJVA 1IJFA 4GP6A 5H1YA 4DCNA 1UBCA 4AG6A 4M22A 2R6AA 2P6NA 3DPUA 4RD3A 4LJ4A 2XB2A 1HQYE 5EP4A 1M74A 1CIPA 1Z0DA 5AJYA 1E98A 3DMNA 1MV5A 2WWGA 4E03A 2W2VA 3BRWD 4KODA 2ZR0A 1G21E 1KMHA 4RFVA 1M7HA 2OG2A 4PC2A 2J0VA 2WVJA 5D3MA 3VKGA 3B60A 4DDUA 5C4MA 1KKLA 4P3YA 3JVVA 4IDOA 1OH8A 1VDZA 3TE6A 4QBHA 4EPYA 4IEEA 3CPJB 1UDWA 2AXNA 4KFRA 4QOSA 2CHVA 2ATVA 3BB3A 3MMPA 4P4SB 1RIFA 4Z1MA 2W6JA 5FOUA 4BE7B 4GT1A 2WPDD 3KJGA 1KSFX 3K0AA 3CKLA 2QU8A 1YRBA 2VO1A 4RJLA 4QNMA 4U00A 2I4IA 3KKNA 2YOHA 4JJKA 2OFXA 1G8PA 2ZRBA 3IILA 4NTZA 2GCOB 3RS3A 1YR6A 4ZIRB 2WICA 1N25A 3K1JA 2JDID 2B8WA 4XVRA 3QXJA 3SHFA 1OB5A 1Z6AA 1BS1A 4MYTA 4GZMA 1WB9A 2OEPA 4HUQA 3SQXA 4CYMA 1HH4A 3BERA 5SZHB 2D4HA 3CR7A 4MRRA 5EQTA 2ZJAA 5BN5A 1N6PA 1YE8A 2F1RA 1S2MA 1XD2A 2EFGA 1TU4A 3U3RA 2WKQA 2GXUA 1N5IA 5EUMA 1WCV1 5GJWC 5CYPA 4A8JC 1IAQA 4UNSA 2R6FA 3K09A 1S9HA 2VL7A 4BLTA 3GQBA 3DDCA 3SU8A 1N6IA 4Q7MB 4Z54A 4HATA 3MCAA 3A4LA 2O8FA 3ASZA 3BIFA 4L8GA 1ZIOA 2B7BA 2CJWB 3AF0A 4M4SA 1E2LA 3T5GA 5J4LA 3WBJA 2NO6A 2ZE7A 2P6UA 3AV0B 3K0SA 3V00A 4QL3A 3FHOA 3L0SA 2YC4C 2IHYA 4R98A 5TB5A 1XPOA 3LBHA 1NBMD 3IGFA 1GRRA 1ZP6A 4BZXA 4I81A 4QRHA 4DVGA 3VMFA 1GRQA 5HZHA 1LNZA 2DBYA 3I3SR 3VHXA 2GXQA 4V0NA 621PA 2YV5A 2VHUA 4FD2A 1J8MF 3AVPA 4Q1BA 4A9AA 2SHKA 1ZU5A 5AUPB 3MGCA 1R5OA 1GVNB 2ZETA 3I32A 4LX0A 4ZV4A 5TMPA 4Q9KA 3V4RA 2ZI3A 4TLDA 3K53A 4B33A 1NVVQ 2F43B 5JCZA 3OEED 3GJ8A 3EW9A 1J2JA 2L0XA 2WWYA 1S8FA 4LGMA 3TR5A 4MGYR 1JR6A 1OFUX 3SC3A 2OCYC 2ZJ5A 2FOLA 2ZXUA 4BFUA 1XJ0A 3R7WA 3AVWA 3AH8A 4E22A 1XP8A 4B3BA 3GJ3A 1N0WA 1YQTA 2VF8A 2NO7A 1CS4C 4BWYA 1D6JA 1KO5A 3QXXA 3U6BA 3GP8A 4Q7KA 1Z0KA 1F6BA 5CK5A 3GJ5A 5GJCA 1T5LA 4WXPA 2QN6A 3B85A 1TX4B 2JLUA 2NMVA 1MT0A 4CGZA 4B32A 1SGWA 3BS4A 3RDPA 2GHIA 5JJLA 4TLEA 1CULC 2E1RA 2OSBA 5GJVC 3UMRA 3TGPA 3MWYW 3QG5A 3T35A 2OCPA 3CBQA 4Q66C 3R9XA 3N2EA 2ZAOA 5L3RA 3O8RA 1SHKA 4A4DA 1T9HA 3C8UA 1F2TA 4EKDA 2QTVB 4QM7A 2GCNA 4DEXA 3A58B 4XWKA 1KSJA 1CU1A 3D3QA 1KI1A 1YZKA 2OV2A 4LCBA 4A0GA 4NYIQ 3U7FB 1KI6B 2BIFA 2BMFA 4R2IA 5FTLA 5DYGA 3R8FA 2V4ZA 4GSYA 4B71A 4I1VA 1G20E 4MRSA 3TVTA 3I5XA 2VSFA 3VTKA 2O8DA 2P65A 3CO5A 4M1MA 5HCNA 1X1SA 5AUOB 3CUEF 3ZZUA 1ZBDA 4EJSC 2AFHE 3AEZA 1KSHA 2QA5A 5F98A 4W7SA 3TAUA 4ACAA 1IXRC 3W6NA 1FFHA 1M8PA 2N42A 4NCNA 3TMKA 4L15A 2QAGB 1SZPA 5BXQC 3M0EA 4RZUA 2GVDC 3SYKA 1FP6A 4B3XA 4DSOA 4DWJA 2C04A 4EAQA 5JECA 1NY6A 3K8YA 2C03A 1SXJB 1MO5A 2Q21A 1P7CA 4OI0A 1FX0A 2K5UA 1Z06A 2IC5A 5F9HA 4OJQA 2O8EA 3QPUA 2ZI9A 4ZKEA 5BN4A 1FMJA 1VTKA 1MO4A 3A1VA 4QNRA 3NXSA 5AJWA 3TQFA 4A6XA 2JCSA 4DLWA 3MJHA 2AXPA 1SVWA 1L4YA 5FOWA 1CR1A 4PHGA 4C0HA 1P73A 4MYHA 3QBTA 5FTMA 2IYZA 4K8OA 1S1MA 1U90A 1Z0JA 3TAHA 2IWRA 2ZRKA 1HURA 4DHEA 1RPZA 4BLOA 5IK2A 3L82B 2V1XA 2Q3MA 3KQHA 5A5GA 3TRFA 4HAUA 1G8YA 3KKPA 4M9SA 2IS1A 2XZLA 3P26A 2WKPA 1W0KD 1DPFA 3C4JA 2DFNA 2AN9A 4LJ5A 2J87A 1UBFA 4ACBA 1E9CA 5FL7D 2P3SA 1E99A 1EFRA 821PA 4CW7A 3K9GA 1FQJA 1O87A 1UKZA 4TMKA 3QPWA 4NYJR 1PJRA 4Q47A 2GETA 3QENA 4B73A 1PLKA 1G7RA 1QRAA 2QI9C 5CIQA 3VFDA 4JVSB 4PQFA 3LQRA 3V4FA 3SHWA 1Q0UA 1L7VC 4ZPXA 1BYIA 3VKWA 3HDTA 3DOFA 4JT2A 4WAUA 4P4UA 2ZRDA 2Q0HA 2PZEA 2J7KA 5KOYA 3LBNA 5AUNB 2EFDB 4MRVA 4TTPA 3HJNA 1WF3A 2FEMA 3S1AB 3FMIA 2ZYTX 2ZSAA 4P4SA 3NDPA 2CLCX 1NF3A 3TQCA 4NMMA 2RHDA 1TAGA 3W6OA 2OT3B 3U5ZB 2IXFA 4JL6A 2XGJA 1ZNXA 1MKYA 1NVUQ 3I61A 4HLQB 5J4YA 1SVOA 2GTPA 1M7BA 3L8ZA 1BMFA 2ZJYA 5DYIA 3RS0A 1WQ1R 1XTSA 1E0AA 3QKSA 1JAHA 5C4GB 1KJWA 3ETLA 1W49A 2QM8A 1S9DA 2W0SA 3PEWA 2ZJ8A 3PFIA 4JJZA 2YYZA 4FINA 1N6LA 3PUZA 1GP2A 1IOZA 3PG5A 1US8B 1M7GA 3PUWA 4PO1A 4LBVA 3B82A 3IPXA 1GFIA 4NCKA 2FNAA 3LH5A 1EWRA 1CXZA 1OB2A 1XFAA 2XX3A 4EIWA 1PLJA 1UKEA 3KQLA 5CK4A 4ON9A 2VP5A 2QL6A 1A2KC 1N5LA 3UWKA 3I5YA 4O25A 5B2ZA 3WP0A 3EZ2A 4C4PA 3AF1A 1CJTC 2WBLC 3AVUA 4KYIB 2VRWA 4OQXA 5IF9A 1ESMA 3P20A 3LNCA 4YMUA 4QM6A 3TUZC 1BO6A 4ZI2A 2QPTA 3RS4A 2C96A 2CJWA 1Z83A 4D82A 4G3XA 3NBYC 2W2TA 2H16A 4A15A 3ADCA 4LC1A 1GL6A 4MGIR 2XZOA 2CL6X 5C1BA 2RGNA 1W0JA 2W0MA 2PT7A 3AF2A 3GMTA 1ZD1A 2I1VB 1U9IC 3K9NA 2G3YA 3MRSA 1SKYE 3TVDA 4FMCF 5FOTA 3REGA 2YHSA 2ZTSA 1YU9A 1JR3A 1TL7C 2R6GA 4CRWB 2HXYA 4C7OB 2ODWA 2QMHA 2VHTA 3C7KA 4XD7D 1F60A 3ZVRA 1XZQA 4OK6A 1KO1A 3HU1A 5LB4A 1HY3A 4WOPA 4WXRA 4B6EA 2DCUA 3CRVA 2FJUA 2Q9AA 2R9VA 1OXTA 2ZUBA 1E1QA 1CBUA 3RABA 1IQPA 2WWXA 1ZM2A 4X8OA 3RRZA 4D4KA 1OH5A 2F43A 3ZIAD 4NCJA 2D06A 3LRPA 3R8CA 4BEBA 4AKHA 5J4VA 3DM9B 1XB2A 4RSGA 1RVDA 3N5CA 1M2OB 4KLNA 1AS2A 1IN7A 3DZDA 3F0TA 2J41A 4DIDA 1NI3A 3FVQA 2CCJA 1ZIPA 1ZUHA 4FCVA 4X8MA 4QJ5A 3QSYA 1G7SA 1X1RA 3AM1A 5FI0B 3PENA 1E79A 2PZFA 1A2BA 2QENA 2ZUDA 1KI7A 1JECA 3P4XA 2PH1A 5AJXA 4Q1DA 4OQMA 3AF3A 3OF5A 2RGBA 1D9ZA 1TEXA 1UBEA 2JLQA 2VP4A 4LJ9A 2XSZA 3K9LA 3KXLA 4MKIA 4QGGA 3KQKA 2PMKA 2O8BA 1P61B 2QP3A 2H5EA 4PC3A 1E2HA 1F48A 1EFCA 1OIVA 2LCFA 1X8KA 4LHVA 2HJVA 2ZS7A 5DO9A 4PQRA 1R0ZA 1FTNA 4YQFA 4RFSA 2AL7A 4UNQA 2HYIC 3NHBA 1S96A 2IW3A 4QXAA 3H1TA 3DL0A 4GBMA 1J70A 3F8TA 3OE7A 3W3ZB 1NG9A 1W7AA 1W5TA 3PUYA 4B2LA 5TY0A 1JI0A 2IYTA 4TYQA 1N6HA 2WKRA 5G40A 2IEYA 3QNUA 4Z1MD 2W6JD 3C16C 5EXTA 2D7DA 1KI6A 4LV5B 3I8XA 2RGAA 4ZDWA 1YZTA 4LJ7A 1I4TD 2IK8A 2BEJA 2VSOA 3LXRA 1DE0A 4NCIA 3BFXA 1MABB 3LX5A 4EPXA 4MITA 4RD6A 1ZCBA 4ESVA 4DT1B 4Q5IA 1VKJA 3W5JA 2VA8A 1XD2B 4FMDB 2NZJA 5DE3A 1DO2A 2XB4A 4V0MA 3AKDA 3CLVA 4UXHA 5KSZA 5JS7A 4URZR 2QNRA 1Z6XA 1ZUNB 2BWJA 2VTKA 3B2EA 8OHMA 2QE7A 4W9MC 4LYAA 2DYKA 1OXVA 1COWA 3GLGE 4GMXA 4AG5A 4US0R 1SXJA 2FA9A 3QG1A 1KDRA 5EE0A 1ZCAA 2CEAA 1U2RA 4JVLA 1AJEA 4TN1A 1ZD8A 5FR2A 1ZNWA 1HYQA 3CPEA 5J4KA 2VH5R 1TQ6A 1ZVQA 3AP1A 1EX7A 2XTZA 3VR3A 4B3GA 3G82C 1QVAA 2Q3HA 4OL0A 1FTSA 1XCGB 2D3WA 4JSTA 5CM8B 3RRMA 3EASA 1AKEA 1WE2A 3GFOA 2AWNA 3ND9A 4EQ6B 2DWOA 4ARZA 2GJ8A 3CH4B 1WP9A 4IOMA 1AA9A 4O2RA 4Q7JB 5LB2A 1LTQA 5L3VA 2IS2A 5KUTA 5KDOA 4XWAA 3THXB 3UANA 3EIEA 3U44B 2BEKA 1AKYA 3TW8B 1ZC4A 3UKDA 3ZS9A 1G1MA 3P32A 1LY1A 3ZJYA 4W5JA 1XXHE 3R7WB 1TTTA 4URXR 1OKKD 3GCGA 4Q18A 2WWFA 1XZPA 3LA6A 1SVMA 4Q19A 2XNSA 1ODFA 3BC1A 3IO3A 2IXGA 3T1QA 1NKSA 2BKEA 4HDQB 4A8JA 1S4QA 4LJ6A 3QVUA 3ICEA 3OEHA 4GMDA 1VIAA 4RKEA 1KSGA 3WMFA 4LJYA 2RGEA 1DTSA 4JLJA 2PJZA 3HWSA 4FXPA 2PEZA 2OLJA 1Q12A 3ASYA 3P1JA 1Q21A 2P6RA 5JZVA 1P9NA 3PUVA 1XCMA 3PVSA 3S1AA 2FH5B 2ZANA 2H17A 2EFEB 2C9YA 3BK7A 1NLYA 1VG9B 1G3MA 1I4LD 1UF9A 2CK3A 3RHFA 1EESA 4YLGA 4US2R 2XOKA 4DZZA 5DLQC 2WWWA 1T5IA 3KJHA 5FPTA 2FE4A 1SVLA 2ZEJA 4DCUA 4JMPA 1W36D 2LKCA 5E95A 3SDZA 3X1DA 1E2EA 4O0MA 3AQ4A 1VECA 5EXXA 2ZI5A 5F2EA 4V03A 1ZW6A 1P2UA 2Z5FA 1C1YA 1ETUA 1IY1A 2VP0A 4M21A 4YC7A 5DISB 2CCGA 2A5GA 4TLAA 3T12A 3R9IA 2XJ9A 4IDQA 3EX7C 3TSOA 2IA5A 2OO7A 3VNUA 4DRZA 1JXOA 4AWXA 1V5WA 5BQ5A 1NL3A 4QFMA 2NIPA 3QF4A 1LW7A 4KFTA 4EPRA 5JHGB 4JIMA 2JAQA 3IKJA 2CHGA 4M1SA 1CJVC 4LPKA 2J7PD 3U7GA 2P5SA 4Y0AA 1LS1A 4AURA 4ERNA 2BDTA 1DAFA 3IHLA 1TQ4A 3ZGXA 3THWB 2J46A 4ASUA 1X86B 1YKSA 4G5GA 3NHAA 2G1JA 1OPXA 1BYUA 4I1SA 4PHFA 3TW4A 3RNLA 4PHTA 4KHZA 521PA 1XEWX 2FSHA 1II0A 2O8BB 1XU4A 3K0CC 3U4QB 3BWDD 1FPMA 2GBLC 4JLNA 3MWJA 4B3FX 4C7OA 1G5TA 3PCRB 2DHRA 1JJ7A 5JI2E 4NBSA 1MRNA 1R4AA 3C14C 2CVFA 3U61B 1GILA 2X19A 5CIWA 5SZJA 1IY2A 2BJVA 3WMGA 2A5FA 3PEUA 3WNBA 2F3TA 3KB1A 1XRJA 4HB0A 1KI3A 2XTNA 5H8WA 4RKFA 4JBWA 2GK6A 4Q1CA 1IN5A 3WNDA 1OH7A 1QHYA 3QXSA 1TQDA 1CEEA 3B1WA 3VR5A 2PJRA 4JLMA 2Q9BA 1KHTA 3Q5EA 5EE1A 1TF2A 1D9XA 2VPPA 2MSEB 2J5XA 1JAIA 2EVWX 3LXXA 2JEOA 4OHWA 5IK2D 3WHLA 3ZQJA 2JLZA 2PLFA 2ZAMA 4XVQA 2UZIR 3K70B 2CVHA 4N0DA 4UJ3A 5L3QA 4TWZA 1R0WA 3ZQ6A 2R6DA 1Z2AA 2MMGA 2G6BA 4QJ4A 2JIZD 3EA5A 3LLUA 1VCOA 4J0QA 3W8RA 4PFSA 3B1VA 3IBYA 1U94A 3Q85A 1EFRD 3KUCA 3O47A 3AVXA 1RJ9B 2NTYC 2FDCA 2FWRA 3CWZA 3M6AA 3QY0A 1EX6A 4YDHB 4B47A 3TKLA 1G291 1BOFA 2QAGC 2D7CA 3ZVMA 2BCGY 1ZNYA 1S1CA 3I8SA 3W6PA 1IN4A 3SQWA 2I3BA 2ZRHA 3QEOA 1KO8A 4LJAA 3MG9A 2D2EA 1P75A 1E4VA 3AVQA 3QKSB 4TZ6A 1NMZA 3KUDA 1G17A 3QXCA 4DSUA 3PQCA 1XJQA 3PUXA 2A30A 1KTVA 2OBLA 1LF0A 1QG4A 3LO5A 4I4LA 1R7RA 3K9HA 2QUZA 2LWIA 4G5SA 2IWHA 1Y63A 1OJLA 4G1UC 1GNRA 1MABA 1Z6YA 2C78A 3CX8A 5EP3A 3F5FA 3LDAA 4DT1A 1RRPA 5G53C 4IXMA 2IHBA 3T15A 5K8IA 2ZVQX 5EE5B 1NY5A 4OK3A 4XJXA 1E3MA 1DVRA 3TLXA 1Q3HA 1HUQA 4TT3A 4L9SA 3LW8A 3HP1A 3LX8A 5TVKA 4C0QC 5DHAA 5FR1A 1T8TA 1E96A 1P2SA 4KAXA 2OXCA 3RC3A 3FE2A 5KNCA 5J4HA 1W48A 2ZS8A 1X8LA 3EA0A 2C2HA 4X8HA 3TBKA 5KTYA 1U0JA 3D7MA 4A0RA 4TLCA 2HCJB 3CNNA 4Q9HA 4MGZR 5EUQB 5CDFA 4K81B 2Q3FA 3OIWA 1OYWA 3MFYA 2ZPTX 4GNKA 1VMAA 3QKRA 5G41A 1Z0FA 5FOSA 1Z47A 2WV9A 3NIBA 2V1UA 4EQ6A 4GZLA 221PA 2YJTD 1AZSC 2QGNA 1ANKA 1KO4A 1SVSA 1TUIA 3GLFE 3IDQA 3U3OA 1JR3D 1W47A 4D2IA 2RGCA 1R10A 4BFYA 3THXA 1P72A 3U44A 1ESNA 3UMSA 4QGAA 4NE2A 1A4RA 5B30A 3T1VA 1QF9A 5J5CA 4P0TA 4Y0VA 2A5DA 2PZGA 1E1QD 5DSZA 4DLRA 3WMEA 4JL5A 5HCIA 3D31A 4C30A 3VU9B 1GOTA 1Q3TA 2BM0A 4WA7A 3B78A 1IY0A 1BH2A 4PPGA 5TXGA 2A5JA 5JS8A 1KI8A 1W4RA 4KJZA 2IS4A 4US1R 4DIEA 3VX4A 2H92A 2X8AA 2JLVA 1YZLA 1PUIA 5EXSA 2NPIA 5BW8A 1E79D 3HYRA 5KSYA 2QBYB 1W4CA 4YONB 3E70C 2QSZA 1U8YA 3B9QA 4HSEA 4O2LA 3FMOB 4XH9B 4RFSB 4B35A 1D2NA 4OKSA 4HZUA 1OW3B 3GEHA 3MUFA 1I4DD 3BORA 5CITA 4LHXA 2J3EA 2XSZD 4TL9A 3UATA 1U9IA 4KSBA 4NKRA 1F3OA 1NP6A 4Q1EA 5HE8A 3BD9A 2AK2A 1FZQA 2FFHA 1PV4A 2QRZA 5LD2C 2R8RA 1J90A 4GL2A 1DG1G 3REFA 1Y3AA 5TDHA 1A1VA 3NDBB 3I62A 5E4FA 4D0NA 1RYHA 2ZYUX 4CEIA 4JLOA 1J7KA 2JLSA 2IT1A 4HI0E 2W83A 3GLHE 2FU5C 3VR6A 2G83A 1SULA 1B23P 1KDPA 3AGPA 1VYTA 2GZHA 1M6NA 4IKEA 3SBDA 4B76A 4C0SA 3GLIE 2N46A 5L8VA 2IX3A 1E4YA 3QE0A 2PCLA 5EZ5A 1CF4A 1MO3A 3CX7A 3U3KA 3OAAA 4PAMA 2IYYA 4NP6A 5FBVB 5CLQA 4XSGA 1GNQA 4BZPA 1G5RA 1ONBA 2ZRPA 4URWR 5L3SB 5KSPA 1E9DA 1VG1A 3THWA 3WRXC 2WOOA 2ZI6A 3OZXA 2W6IA 3UG7A 4QHYA 3Q9LA 2QE7D 3KDSE 2KI5A 1GAJA 2NZ8A 3LD9A 1EK0A 4L5BA 4C3ZA 1COWD 1DS6A 1KK3A 3EXAA 1NN1A 2QT1A 4FCTA 1XEXB 4TL8A 3ZVLA 1SXJD 4A0FA 4B34A 3U4QA 2OE2A 1Z6GA 3KXKA 3ZD6A 3UIEA 2WTUA 4H9GA 2XEXA 4F38A 1E1RA 1IBRA 2IYSA 2MMCA 3A4NA 5FTJA 2OAP1 3OFNA 1IHUA 2AWOA 4ARZB 4K46A 5JJKA 4JYBA 2ZJOA 4POAA 1CJMA 1ZM3A 1J8YF 5AJZA 5JCPA 5LPNA 1YZGA 2G77B 4PZYA 5J47A 1JNYA 5E7JA 1NJGA 3R9WA 5BN3A 2ECKA 2B7CA 2F1JA 2JJ2A 4AIIA 4DB4A 4XVUA 1N6NA 5HPYB 4PO9A 2HF8A 1E9SA 2CHQA 1FP7A 1MH1A 4GDFA 2GJ9A 2PX3A 2QPOA 1G6HA 3EAQA 3I92A 4NCHA 3ZS8A 4DDWA 5IDVA 3EARA 1RRCA 3C5CA 3PV0A 2A2ZA 1D5CA 1XTQA 2DPXA 4EUNA 5EJEA 1RW4A 1VPLA 3FKQA 1W2HA 4C0JA 2ZREA 4A8JB 4HAWA 5AUQA 3W5IA 3SYLA 2FSIA 3EZ6A 4Q4LA 1U8AA 3GEEA 2QSYA 1RJ9A 3MAAC 5G3YA 3LW7A 5EE9A 3CW2A 1KI9A 1CTQA 2QQ0A 4QHSA 2E9SA 5TV2A 4PAQA 2G0NA 1E9BA 3OEHD 4PX9A 1ZMXA 3W34A 3AVTA 2EQBA 5EP1A 4IOLA 4F4CA 5FBWB 4P33A 3D8BA 3DMDA 2UZ3A 1ZNZA 2ZU0C 1G41A 2QORA 3U60B 2BBWA 1OE0A 4NYJQ 1YR8A 4W5HA 1CJKC 4UNNA 4NH0A 4FWIB 1KK0A 2CK3D 4LC0A 3FKSD 3JZAA 3WY9A 1PLLA 1Z63A 2WIBA 1JALA 4HUTA 2F9LA 2ZVPX 3G0HA 1SVIA 2EYQA 4UNRA 1DBSA 5IRCD 3EC1A 1TPZA 4F4JA 4LPSA 4RZ3A 1NIJA 3EIQA 1E0SA 1E9AA 4UJ5A 3F3YA 2GDJA 2YOGA 3KFXA 4FCWA 4QHTA 1KI4A 4B2IA 1BIFA 4JVNA 4V0KA 1K5DA 2P5TB 2PX0A 3FB4A 3UG6A 2ORWA 3QF4B 5KDDA 3RYTC 4IRUB 1DARA 3T06B 1I2MA 2H18A 5G3ZA 2ZRCA 2E87A 4HAZA 4WIAA 2HLDD 2G9NA 1NVXQ 2REOA 3BH0A 4QG7A 4XOIA 4GPTA 3ADDA 2BOVA 5DI3B 1NBME 1JXMA 2FG5A 5CB8A 2NQ2C 4TMXA 1B0UA 2GEDA 4LBZA 4CEHA 3P27A 3B8HA 4PPFA 2WHXA 4WZAE 2FPLA 1HT2E 3AP3A 4GP7A 2IUTA 5CYOA 5HZKA 5GVSA 4HDOB 3R20A 1E94E 2VP6A 4YMSA 4PC7A 2VQSA 1AK2A 3SOPA 5C46F 3KFVA 1KYIA 1VHLA 2Z4RA 4IDHA 4HLUA 5LDDC 2G88A 3B1XA 2DB3A 4KU4A 4OHZA 2NOAA 5BWMA 3W90A 1E2PA 5GJBA 2WJGA 1W36C 2EYUA 4JLPA 3LWNA 5CLLA 1SKQA 3KJEA 3CONA 4Q4AB 3L8YA 2IUSA 3MJRA 4FMBB 5FOXA 2REXB 1TEVA 3RS7A 1VG0B 4RVCA 1EFUA 3AP2A 5DGXA 3WXMA 1OFTA 721PA 4LBWA 2C95A 3A1SA 4D4LA 1EG7A 3HU2A 3CH5A 3VU9A 4A6PA 2FN4A 3AKCA 3AKYA 4XWOA 1RRFA 3IEUA 4EJSB 5L3QB 3G5UA 2QTHA 3TH5A 2ZRGA 4PSKA 4GOJA 4KI0A 2W2XA 1DEKA 1WMSA 1XMVA 3B1ZA 4LY6A 3HYTA 4YMVA 2GWHA 2IS6A 1ZM9A 1GIAA 3LLMA 4U02A 2OCBA 5AJVB 2QEQA 3AVYA 3LVRE 4M9QA 1W2GA 2AHOA 2Z43A 3BBPA 2FFAA 2F1HA 4PXAA 2C99A 1U8ZA 1HE1C 3BH6A 1KZ7B 2JLRA 2QG6A 2QROA 1T4GA 4FMCB 2J0QA 1KI2A 1KY3A 1XMIA 4DSNA 2V6JA 2B6HA 2GBLA 4UXIA 2P67A 3KKOA 1U99A 5JJIA 4KVGA 2IYQA 1UBGA 1UDXA 1P2VA 5B57C 1I2DA 4CT5A 1QHHA 2AD5A 4PR0A 4AYWA 2EW1A 2QAJA 2ERYA 3BE4A 3SYNA 2C98A 1NMYA 2IF2A 1GG2A 2J9RA 3CF0A 1FW6A 4D81A 3EG5A 2VYFA 3TNFA 4BFXA 4CF7A 5K8LA 3THYA 1WXQA 5LBIA 4BUJA 4CDGA 3FHTA 1SHZA 4PC1A 5FPHA 4ESHA 3UPUA 2UVQA 1HT1E 5E7MA 4FI3C 4LUCA 3PEVA 4Q03A 4LK2A 4D0LB 4D6PA 2QY9A 3KKMA 3WBKA 3IIMA 1GKIA 4PAOA 3C5HA 2I1QA 1IXZA 5L3SA 4MDFA 4S35A 3Q72A 2W00A 4NYMR 3AB3A 1XMSA 3LV8A 1G3IA 1D2MA 1N0UA 4HLDA 4LJ8A 4C2UA 5JFGA 4JKIA 1QZXA 2OESA 3SJZA 3TIFA 1F2UA 4LYFA 4TT3D 5SZIA 4A82A 3QBVA 1XMJA 4IFEA 2CNWA 5CJPA 2FX3A 4LRWA 4YMWA 2ONKA 1XEXA 1YZNA 1PVOA 3RLFA 3CNLA 4ZDIA 3GLGA 2QP9X 4M0LA 4JLKA 3DZ8A 1QHIA 4FIDA 3QKRB 1C9KA 4Q4JA 2VP2A 3NEJA 3CR8A 3RS2A 5D3QA 5DIFA 3SR0A 3KQUA 1TNDA 2OFOA 3SEAA 1KO7A 2P2LA 2CLDX 4C0LA 2XAUA 2XJ4A 3B7GA 4TSFA 3DEFA 1J99A 2IL1A 4D4MA 1X8JA 5IT5A 4RD4A 1YR9A 3DKPA 1W4BA 2IYVA 2ZM5A 1KJZA 1N3BA 1HEIA 3I73A 1XPUA 2G0TA 1KAOA 1GNPA 1DAHA 1MO6A 3BJIC 4BFSA 3TJZA 5A4JA 1YVDA 2OBMA 2ZSFA 2R44A 3CRW1 3AVVA 2QRNA 3NBZC 4D4JA 3LQQA 5E7IA 2WM9B 1T3SA 2DWPA 2ORIA 3T34A 1KDOA 4TYWA 1XXHA 4WBSA 1OXUA 1RC8A 3BB1A 3CIOA 3DHWC 3CRRA 3RSLA 4BGDA 5F3WB 2VBCA 4YXWA 2EU8A 4HB2A 1U98A 4TYYA 3ONWA 3QI2A 4KYUA 3UMFA 4JYCA 4OK5A 4Q48A 2BHRA 3B1YA 4LSGA 2OAQ1 3UXMA 4MUAA 1DAIA 1WA5A 5DN6A 3RSOA 5JHHB 4KLZA 4HZUB 3QIAA 5CB6A 2VHCA 4Q1AA 1XTIA 1W1WA 3BB4A 3X2SA 3EZFA 1YJ5A 2MSCB 1ZU4A 4LV8B 3U3JA 2RB4A 2A3RA 1OV4A 1KAGA 4BLSA 2V6IA 4PO8A 2RGNC 2HJGA 2PL3A 1CRQA 3SZRA 4PPNA 1GL7A 1NLZA 3CZQA 4CEIB 3UWOA 2XZPA 3PITA 4L4UA 1Q1BA 4TQAA 4HEJA 2IYLD 1OIXA 3IHWA 4BRUA 2CDNA 1P3JA 1AS3A 2BCJQ 2FF7A 2YVUA 2D62A 2YWFA 3PIRA 4BFVA 2CL7X 1XEFA 2WJIA 2IYUA 2GNOA 4IXNA 1QHGA 2PEYA 1XNJA 1ZUIA 2FFBA 4R2HA 4TYPA 1P9RA 3NWJA 4IVRA 4PSVA 3MD0A 4AY2A 1E2QA 2VF7A 4L9WA 1A7JA 4M1KA 2ANBA 4JZKA 4TQUS 1NRJB 4OQLA 3ADBA 5CM9C 2DR3A 4A2PA 5DI3A 2GZDA 5FUXA 1G7TA 3OAAD 4DDTA 1KY2A 1JEEA 3CRQA 4GOKA 2JGNA 4TMVA 2JJ1A 1WRBA 3DOEA 1E2GA 1GRNA 2GKSA 1FUUA 2OFWA 3FFBA 1KNQA 2GEVA 4CZ2A 3AF4A 1XTKA 1K6MA 3QKUA 4FN5A 4RZXA 1O3YA 2YKGA 3WNCA 1ELOA 1N6OA 1R5BA 1TADA 2OBNA 5HE9A 5B64A 3I4LA 2GAAA 1XJCA 2ZRJA 121PA 1CR0A 1E2MA 2W6ID 3EWAA 3IIKA 3QKTA 4NU0A 4ZO4A 3SBEA 3THOA 1GUAA 1DAGA 2BMEA 1E2FA 4TMZA 3BXZA 5H70A 4X8LA 4U5XA 1DAEA 1A5TA 5CJ2A 2KBFA 2Y8EA 4B3CA 5KU1A 1E1RD 4MYCA 4TMTA 2GXAA 2PMDA 3FYHA 4QBFA 4Q4AA 1Z8FA 3TR0A 3H0KA 4PC6A 2F9MA 3OFND 4M53A 3WP1B 1ZYUA 4IDNA 4PZLA 3NH9A 3RVBA 1UM8A 2BBSA 4MKHA 4HAXA 2PCJA 3N70A 2HF9A 1UFQA 4EJSA 1R8QA 2JJ2D 3A36A 1XCPA 4AYTA 1XWIA 4JLBA 1H8HA 4DCVA 5KDLA 3RWOA 4G5RA 5HR5A 2V3CC 2KWIA 3T5DA 1G9XA 2YWEA 4BRWA 5FI1B 1M34E 3K70D 1NLFA 1W44A 2OUKA 3PR1A 4N0EA 2CE7A 2RGXA 3FFAA 2XITA 4LWZA 4UQOA 4B2PA 3IBGA 3U2QA 1AGPA 3Q5DA 4LBYA 4HYYA 2JA1A 4Q02A 3HU3A 3QPVA 4V0OA 4KV9A 4F7WA 4O3MA 3HPRA 5KNBA 3ZZ0A 1QHSA 1SXJC 4TQ9A 3VR2A 2O8CA 4N1AA 4IVPA 4JLAA 2O52A 4M1OA 1UPTA 4EDHA 6Q21A 3IQXA 4Q01A 3KKQA 3QEJA 4KO8A 4F93B 4LYHA 4C9BA 3HPQA 1GITA 1G3UA 1FL9A 1L2TA 1QHXA 2H7VA 4MKFA 3T61A 1BMFD 1RKBA 4MH0R 1QHNA 4HB4A 4E5UA 2BKUA 4JT4A 4NL4H 4P4TA 2IYRA 3FPAA 3MSXA 3KTAB 3IQWA 1MRSA 3BOSA 4PANA 4A1FA 1G4AE 2RGDA 4CEJB 4F92B 3LVQE 5JI3E 3AVOA 2H1LA 1JPJA 4TYNA 3H86A 4TTRA 2ZU6A 4DJTA 1P9WA 2RHMA 2FMXA 3KZ1E 1ZM4A 4DBLC 3RS5A 4M8NE 3VNVA 2IYXA 3MLEA 4JLDA 2D2FA 4D80A 1F5NA 1H8EA 1KNXA 4KBGA 1DAMA 2ZQ5A 2D74A 4NPHA 5FPSA 4OJKA 4AKIA 2OILA 1TQ2A 4CEHB 3BH7A 3O8BA 4TTQA 2XNDA 3A6PC 1JQJC 4DUGA 4QBGB 3CNOA 4Q9LA 4ILEA 1LF5A 2F55A 3QVVA 3L2OB 4I1UA 2IEZA 1DO0A 1JB1A 1N5KA 2DWQA 3A1UA 3H2YA 3EC2A 4BPBA 3RWMB 2V54A 5CDFE 1NVVR 3GJ6A 1W0JD 3LY5A 2B21A 4B75A 2IF0A 1G3QA 5KSOA 2GJKA 2AK3A 1XPRA 4NDZA 3CWQA 3L0OA 2C77A 2BM1A 3C15C 4DKXA 3ZVNA 2DFKB 2QT0A 2FV8A 2O0HA 2YWHA 4MRNA 1KJYA 1SKYB 2HYDA 1RFLA 1QVRA 3JVUA 4AKEA 3VR4A 2IBMA 1SVKA 1ZINA 4Q00A 1OFIA 3ZH9B 1PZNA 2YINC 2WAYA 1R2QA 3A1TA 2WWHA 2ZE8A 4BFWA 4E09A 1E6CA 1X6VA 5BYKA 1AS0A 1G8HA 2HXSA 3OESA 3GLFA 1G8GA 1VHTA 2J59A 4JBXA 5JWRA 2NPFA 5K8UA 2EWWA 4E07A 4WZBE 1K5GA 1OKKA 1II8A 3QOFA 2GAOA 2IXEA 4YMTA 3X1XA 3EWSA 2ODNA 3ADKA 4HAVA 2GJSA 4GRAA 1G16A 2CE2X 2WSSA 3KQNA 3ZD7A 4TL7A 3N2IA 4PTLA 1T3LA 3KJIA 1VG8A 3IEVA 3UK6A 4MDEA 1XTRA 2CL0X 1Q44A 1P6XA 2ZJBA 1LV7A 3PJRA 3EPLA 4FW9A 2R2AA 1IN6A 4NYIR 2JLXA 2YOFA 3CRMA 1P2TA 2ZITA 3M1IA 3IPYA 4KVAA 2HEIA 2JATA 1KGDA 2BBTA 1JQLB 5ELXA 5HKKA 4DXAA 3AUXA 4DCTA 2ZJZA 1T91A 4A2WA 3CPHA 1ZJ6A 2PLRA 1RE0A 1Q1QA 2AR7A 3GJ7A 4WZ6A 3ZDQA 1Q20A 1QHHB 2BV3A 4BECA 3OE7D 4F91B 4BEJA 3U6KA 2PBRA 3T1OA 1VYVA 3B6EA 1CR2A 2QTFA 3VX3A 3CF6R 4IJMA 2XXAA 5DH9A 3EIHA 3GJXC 2GA8A 2LKDA 3Q7QA 3X1YA 1HA3A 1R6BX 2GEUA 3THYB 2ZE6A 3E2IA 4QC2A 4P32A 4R71A 3RRNA 2OZEA 4OQNA 3KXIA 5JEEA 1NMXA 1CKEA 3NG1A 2WMNB 3TUIC 3W3AA 1Q22A 4EFLA 2BBOA 1FOEB 1W5SA 2KE5A 4AD8A 5JRJA 1N5JA 1CRPA 4IOJA 5JSZA 2V9PA 1UADA 3GLHA 5M04A 4HLCA 4TZ0A 1OF1A 2F1IA 2CLSA 4BLRA 4KFUA 3RRYA 4BQSA 1PUJA 4LHWA 1IXSB 4R7ZA 4MRPA 1AQUA 3GLIA 1GTVA 4KFSA 2V7QA 1OIWA 3K0FB 2MSDB 2EFHB 3QXHA 1F2UB 2FFQA 1Z6TA 2J7PA 1E2DA 3FMFA 5JRZA 4LZZA 4BLQA 2GVZC 2JLWA 4DDVA 4JKYA 4GFDA 1DG3A 1QDEA 1R0YA 4XTCS 3VR1A 3A37A 3GLGB 2NO0A 3AGQA 2O0JA 3B5JA 4JVMA 4CVNA 5DI9A 1A82A 2X2EA 4DC9A 1ZRHA 4ZDKA 1KMQA 2VLIA 1KK2A 3CX6A 4Q4JB 1BKDR 2CNWD 1UAAA 5JLJA 1OXXK 2X1VA 4EFMA 4DSTA 2Z83A 3KX2A 2QQEA 3U3MA 1Z0IA 2ODBA 2RH5A 2ZI4A 2QBYA 2GZAA 2JJ8A 3EZ9A 2AKYA 4PPQA 4Q9IA 5EZ6B 4A36A 1OHHA 4DLXA 1Q1EA 1R0XA 2J0UA 3FOZA 2CCKA 1EWQA 5HTKA 3KB2A 3J81k 2ASEA 3FTQA 4TSFD 3SE0A 4DLUA 1AIPA 4WVFA 4DB2A 5F9FA 3BFKA 3RC8A 2DFTA 1AN0A 2V55B 4MKGA 4KXFB 3AUYA 4TL6A 4CT4B 1AQYA 1YZUA 4OYHA 2FZLA 1S3GA 3QJYA 1OSNA 2FZ4A
chains in the Genus database with same CATH superfamily
4U7FA 1PL7A 2R8EA 2FSFA 3FGNA 1X7WA 1E9RA 1XXHB 4MUXA 2W11A 1I7QB 1KQMC 3E5HA 3KKZA 3AJDA 5LZ7A 4H1HA 4R2LA 3SY8A 4MDYA 1E64A 3B38A 3EIWA 4JL8A 1SQFA 5LU9A 4P7KA 3ER9A 4TMFA 5E4YA 1W76A 2JVIA 3BDAA 3UGKA 4AMUA 1LS8A 2BFMA 4B7XA 4DDHA 4LNUA 4YMHA 3ZWCA 3RK4A 5TARA 1CZHA 4P6VF 3BGWA 3JD1A 5JSYA 4I4CA 3U4CA 1DWQA 4LOAA 4DYDA 5C3UA 4D3XA 4BNDB 4G4IA 1P1CA 3WHUB 5GIPE 2HV8A 2Q7OE 5A3SA 1U65A 4JB8A 1F2VA 1Q1ZA 2J1LA 4MEWA 3GELA 3EPJA 1T2CA 2MSLA 3BK2A 1G18A 1UKYA 4WXYB 2PT5A 1JFRA 4N18A 1BAPA 2C4MA 2YBEA 4DLSA 4YT2A 2I66A 3HJRA 1OBOA 2VJLA 2PDAA 4PIMA 1IM2A 1A0OA 2H57A 3VZDA 1NM5C 2NV0A 1XV5A 1TYEB 4N5HX 2CHFA 2VF4X 3OY2A 4KWTA 1KYWA 1TQHA 1SR6B 3BCSA 2RMKA 1XTUA 3K20A 1NNLA 5KVQA 4IEIA 4KDFA 3P9ZA 4CLXA 8LDHA 4FOTA 1M34B 1QIDA 2HU8A 3WL5A 3EMKA 1HG0A 3QHAA 1RYFA 3CM0A 2L19A 3RRJA 3REQA 1EIZA 1MFZA 4E5NA 3K0AB 1FJHA 4CL8A 2PX6A 5KS2A 4GQIA 4F06A 4CMBA 4D97A 4Q9JA 4M2LA 3R3HA 1M1ZA 1P1BA 4P3XA 1U0BB 1IM5A 2ZN9A 5BN5B 4CMHA 3CZTX 4F1KA 3R40A 1BXKA 4ZCSA 1NKTA 1MF7A 4ZOEA 4HB3A 1C7FA 4M9ZA 1KMNA 1LDBA 5BYJA 3ZYCA 2B78A 2O7VA 3HN6A 1UMDB 3CUKA 4H1UA 5JJBA 3C8ZA 1WG8A 3LWBA 3FCOA 2IZ0A 4BN4A 3GDOA 3ITDA 3DY9A 1JJVA 4H1TA 2ZJ1A 2P0YA 3VR4D 4HDRA 2VH1A 5FL7A 5JZBA 3V4LA 5CVVA 4MCAA 5KYXB 4C4TA 1VPWA 1D03A 2NU6B 4IH9A 3R5TA 2QVLA 4EW2A 4BB6A 2QMUA 3R0ZA 2C5LA 5FPYA 4CLRA 5I3ZA 4EKYA 4LXYA 1RCFA 3AR6A 1OAOC 4ORAB 4H0FA 2Y1WA 4G2TA 4NAUA 1HTWA 5HHTA 2AR0A 2HDNB 2SCPA 3FTFA 5FI5A 1MX3A 2IY8A 4M1TA 1YV9A 3ROZA 1WVIA 4A6DA 5DM70 5EIXA 1DMSA 3GLHB 4CLHA 3A9UA 3WYAA 4L4SA 3RHZA 2O8DB 2Y66A 4N76A 1EFKA 1I0ZA 1RC0A 1ND6A 3QNWA 1P5RA 4BVLA 4FX5A 3R3VA 4S0ZA 3HZOA 3ZU5A 4O4LF 1FX0B 5KAMA 4R9UC 4H27A 1QP7A 3EVTA 3SSOA 2HDOA 3IO5A 5DHRA 3AM3A 4YRGA 4H60A 1ISJA 1IBLB 4LV6A 5K8TA 3R74A 3I5AA 2AZ4A 2G7MC 1VI5A 2XB8A 3MJSA 1MIHA 2OGUA 3UJ6A 1LRJA 2Q3DA 3EY9A 5BNWA 1NUTA 2W6JA 5IKMA 5HYDA 1OA1A 2C61A 2P5UA 1Y8AA 3KKNA 4HS4A 3WMWA 3HJGA 1E3WB 1LBTA 3BQMB 1VJRA 1CEQA 1Z6AA 4UU1A 1ZOPA 5BWBA 1VA4A 4PPYA 4WCFA 4MRRA 2HSZA 3OF2A 1R8YA 3LS2A 1JTVA 5EKXA 2JAXA 3FWHA 4QDXA 1DC6A 4M4SA 2OQRA 4CKBB 1LZLA 1FNBA 3O4RA 3F67A 4XDGA 4LISA 2ZI3A 3V7WA 1KZ1A 2QACA 2F43B 4R7TA 4KPFC 1DQRA 3Q2KA 3A6LA 1RXIA 3R7WA 3C1OA 2QY6A 5COBA 2KGRA 3TUYC 4RKWA 1D6JA 4Q04A 5LWHA 1PWEA 5JBNA 3JZDA 3U7QA 5CDHA 1VLMA 5HFNA 3R9XA 1T9HA 5BOVA 1GCOA 3DEZA 2GCNA 1DFGA 3C6QA 2BIFA 2V4MA 5AI6A 5CT8A 3CNHA 3QW2A 2DY0A 4EF4A 5H02A 2V8BA 2E4AA 4EJSC 4W7SA 2JHPA 2RIPA 2IUEA 4K1LA 2X40A 1RU3A 2CF5A 3L01A 5AHOA 3GJSA 3ODPA 3GARA 1RMTA 1MO4A 1SHUX 1P5HA 4MGHA 1JHRA 4DLLA 1M2GA 1K3FA 2D1FA 3QJ5A 1UOQA 3E48A 1PEDA 2R11A 4K8OA 2IWRA 2ZRKA 5JNTA 3HMQA 2WQ7A 2ZAGA 2IS1A 1EZ1A 4GPD1 3A06A 2DFNA 4PLHA 1HL7A 1E99A 4TMKA 5G0TA 4A91A 4NYJR 3QYPA 3VFDA 3BUXB 3NOXA 5F4BA 1EQAA 4CR8A 3HNRA 5AW4A 1RKQA 1IL0A 2IXFA 3P52A 4ZGBA 5I9NA 3KUXA 3QKSA 4INOA 4ARIA 4MW7A 2JWWA 1F8YA 2BI4A 1QNLA 3GOFA 1N6LA 1QYWA 3PUWA 1OLXA 2QIPA 4LBVA 4DQDA 1NQUA 3F6EX 2I7CA 1BDBA 3KQLA 5CK4A 5CCEA 3UMMA 3VZBA 1JKJA 4YACA 3BJZA 5IF9A 3KS9A 3P20A 1XSEA 3L8CA 3T5MA 2QPTA 4HC4A 2ZFDA 1N8TA 3KWLA 2I9KA 3C3CA 2QHXA 1CF2O 4AY6A 4ZO8A 2P71A 2E4WA 2J3LA 3ZVRA 4NBTA 1DAOA 3MT8A 2JEZA 5CTAA 2DZDA 3OQIA 1R0BA 2LCIA 1XB2A 4XLLA 1UHKA 5AXIA 1NQVA 3ZG6A 3HYSA 3DZDA 4FSDA 2VYCA 3VKUA 2J9XB 1X1RA 4IRMA 2RH9B 3BQ3A 3CS3A 5CDUA 2PHZA 3SEFA 2GNPA 3CINA 3T1NA 4FR0A 3KLNA 3NEPX 1VP3A 5AK4A 5IG2A 3RT9A 1RJVA 3WWZA 4RF5A 3MC1A 3N2GA 3CZ0A 1DQZA 4KQFA 4XR9A 4FDLA 2NU7B 4LJ7A 1PQUA 4NCIA 2ZK7A 2I65A 3GO4A 2PRIA 3WGTA 1H2WA 3CUTA 1QX7A 3OZIA 1CUHA 5JS7A 4CM6A 2XAAA 4LGCA 4YN3A 3U16A 2NTVA 4UMFA 4F96A 2OPBA 3MXTA 1U7DA 4JVLA 1Y3DE 1ADGA 5JAZA 2VH5R 4FR2A 4B6SA 2B8EA 2PUJA 4IHJB 2LDXA 4BO4A 2LZ0A 1WP9A 4XFKA 1XFXO 3LY9A 4BV2A 5FTWA 2NCOA 2X8BA 1LK7A 4WKGA 5AFSA 1TTTA 2WWFA 3WGQA 2BL4A 1OZGA 2IXGA 1EUDA 4GMDA 3WMFA 2XCTB 4EZBA 2PEZA 1Q12A 3P1JA 3PUVA 3PVSA 2P11A 1NLYA 4GKKB 1LJ8A 3HFGA 2K8MB 2B1GA 2H9YA 5DLQC 1YVHA 3JTMA 3WGMA 2ZEJA 2PSHA 4DEVA 5ICFA 3QRXA 3VZPA 5HVNA 2FFRA 2PYQA 2P2GA 4D74A 4KJXA 3EX7C 4HRAA 4XDZA 1CJVC 2Q3LA 3THWB 1J2RA 2N1MA 2FRDC 2YMQA 2OQ2A 4ARSA 1CC1S 1NFQA 3UCEA 4JAVC 4A5OA 1VOTA 1KARA 3BWDD 1FPMA 4BNLA 1QJCA 3MWJA 1G5TA 3PGVA 5JI2E 2HD4A 5EMKA 2NSYA 2CKMA 3WMGA 5DTMA 1W1IA 5ALLA 4QJIA 5JUWA 1KOGA 1DWUA 2HRZA 3NB0A 1I1QB 3QFHA 5CFPA 1H22A 1VLJA 1L4BA 2VPYA 1NUBA 4WKCA 1YJAA 3GNLA 1M67A 1PZFA 1PF7E 2HWUA 4G41A 2JIZD 3EA5A 3M83A 4O2BB 1QIMA 3O47A 1TN4A 3GT7A 4YDHB 4MUFA 2WM2A 3V6LA 5BSUA 2D2EA 3WDLA 1BHSA 1XJQA 1T5HX 2A30A 2YXLA 4BB0A 1QG4A 4GVXA 3GGDA 3ONDA 1X2BA 1L5MA 5K8IA 4TZKA 1E3MA 3WLLA 3H2JA 1SG0A 5AXCA 3JQ7A 1QGYA 3VTAA 1GSHA 5K01A 1PD0A 1WPQA 1WUYA 3RC3A 2W6NA 1NVMB 2PKWA 4Y18A 3G1TA 4GNKA 2VXBA 4G5YA 3JQGB 2FOTA 1T2VA 5JDCC 5KYYB 4D2IA 3IAS6 3OP0A 4ZVPA 3KQWA 5KB3A 3ILSA 5BVHB 3A25A 3AU8A 2P9ZA 4ARBA 1HTTA 3RD5A 1P4JA 2RE8A 1CS0B 4KJZA 3CLKA 2Z9BA 4JUFA 3IEKA 1U8YA 4O2LA 4TL9A 1IG5A 2YASA 1SK9A 3PDJA 1J90A 4ZYXA 5EHQA 3GFRA 3I62A 1BKYA 3SP1A 3AFHA 3AFNA 3SXPA 4GE3A 1CY0A 1KDPA 2AOXA 4IKEA 4EECA 4C5AA 2OCDA 1ORGA 5L8VA 1EWYA 4NQGA 5GZ6A 4UC0A 1X7XB 4PAMA 2KI6D 2PT9A 4O08A 3CCCA 5T64A 4X64B 2DQ4A 2JCGA 4XUGB 4RJKA 2PTGA 1H2ZA 3ZVLA 3ZD6A 1T3ZA 4F38A 1Z56C 2IYSA 1TJ5A 5D3KA 3TRJA 4DN6A 4JA2A 4LKRA 3GMSA 3QRWA 4HR7A 1JDPA 2DE0X 1YZGA 2YHIB 1JNYA 3ZKWA 5AD1A 4PG4A 4XWGA 3UK0A 4AIIA 1N6NA 1JI3A 3WLMA 3EARA 5K3OA 1MEJA 4DV2B 4B80A 2DPXA 5F5XA 4C0JA 3QWAA 3S40A 2FFJA 4MUGA 2Y6VA 3SYLA 4NXNB 5FNVA 4RW0A 3CW2A 1CTQA 2FQWA 2BH2A 1GPMA 3AVTA 2EQBA 3EQ6A 2LRHA 4L4RA 2ZU0C 5EEHA 1WULS 3CWCA 4FWIB 6ADHA 1RXVA 4UREA 3I2JA 3G0HA 1DINA 4P35A 1I0IA 3GG2A 1BQ3A 3KQMA 2PZBA 2GQ0A 1KI4A 3UK1A 2CV2A 2ORWA 4M89A 3ZV4A 3D8UA 1P8JA 2JF0A 1V8OA 2FG5A 4MX8A 1RSZA 4TMXA 5AW0A 3EXIA 3DLHA 3KPJA 1Z15A 4JQSA 1X15A 4L2IA 4IDHA 3GWGA 4Q4AB 4FMBB 2JKVA 2C94A 2FWIA 1PCXA 3AKCA 1K3TA 4F8JA 1CK4A 2IKSA 4R51A 3AO0B 3G3EA 2YXDA 4Z0TA 3SR4A 4REQB 4MVJI 3L02A 3ABRB 2R4UA 4NMLA 2IVZA 4H59A 3IAM1 1WZUA 3D7NA 5GONB 2Z43A 5I4CA 1I80A 4Z0NA 1Z5OA 1MQ1A 3E9RA 4FMCB 4EO9A 5IDQA 1UBGA 3HSSA 4L57A 1WETA 2ZKMX 4RTJA 1RKUA 2YTZA 4DM7A 4BKPA 3Q7EA 3EVDA 3ICPA 3EVVA 4ETMA 4NFYA 4D0LB 3N59A 4J2TA 4OYYA 5TS3A 4ISCA 3UBMA 4W63A 1RXUA 1QHIA 4UEJA 3EIFA 5J5AA 1TNDA 2GYUA 3PT5A 3VDXA 2J0EA 2A58A 1JEJA 3HBLA 2BTEA 3F6BX 1V2GA 2HB6A 5F52A 1S6JA 2NXWA 1MO6A 1EA7A 2VUUA 2D8MA 2ZSFA 3CRW1 1X8XA 2YXEA 4U9HS 2NN3C 1CY1A 5JSUA 5E7IA 2ORIA 3EXG2 3G5TA 2E85A 3BB1A 2OO3A 2IHNA 2FZGA 3CZ2A 2P1DA 2WKSA 2WE8A 4MUAA 4LJRA 4M55A 3ISTA 2FDRA 1FP1D 3CHYA 3NS7A 1OREA 2Y1DA 2RGNC 3NOOA 2LANA 3DE5X 1OOHA 1RADA 3CZCA 4H7EA 4TM7A 4IJ6A 3HFSA 4L22A 4EH1A 3MJ4A 2YVUA 2YWFA 4IXNA 1K89A 4XPIA 2DBRA 1Q5PA 2XQIA 4RTNA 3VOAA 5CFQA 3N0TA 1KEPA 4OD0A 3HUFA 4ER0A 4GOKA 1TKCA 2JJ1A 3OX1A 3QKUA 3DZCA 2JGDB 3CZMA 1CQWA 1XJCA 4HQRA 3SC2A 2DERA 2PWPA 1GUAA 2BMEA 3GQVA 3I53A 3DV0B 4E6EA 1LBHA 3AF5A 3BHJA 3O4IA 4EEXA 1EG2A 1SM4A 4AROA 3IKLA 1I3LA 1NBIA 1FFGA 3N70A 5I5GA 3D0RA 3WGJA 4R81A 2BBMA 2PUCA 3PPXA 1FDOA 2R4TA 4WPGA 3WZMA 4EP1A 3F5SA 5EJFA 4D44A 3W9UA 1KA9H 1T5TA 4E13A 4A1OA 2O8CA 3ZHTA 4IV5A 3L0CA 1OOGA 3PS9A 3NXKA 1THTA 2NYAA 3K15A 3B6IA 2LVJA 1G4AE 3OHPA 3HXQA 3OP1A 2NZUG 3OT4A 3W6ZA 3BGOS 3N0VA 1KP3A 2JI6A 2P40A 3ELUA 4HRHA 4E2WA 3D6HA 4M88A 1ZVMA 3KVOA 4ESOA 4BNTA 3LGAA 1AD2A 3R41A 1IB6A 4DUGA 2F90A 5HZGA 4I1UA 4RA6A 1IPFA 2GSDA 3I04A 1G3QA 5LYJB 2DFKB 2QZSA 1E3QA 5CFMA 1SVKA 6YASA 2C9DA 2HXSA 5AOVA 4OX9Y 3OKFA 4WZBE 5BRNA 3TI9A 5KOIA 3EWSA 2QX9A 2GJSA 4MHOA 5C8VA 1FFWA 2KS6A 4ZRNA 3ZD7A 3N2IA 3EHDA 3ADPA 1LV7A 3EPLA 2AUCA 2WAAA 3D3WA 3G5LA 4N8EA 2KFGA 4JD9A 3AEKA 2RH4A 1PEYA 4GPEA 3T1OA 1VJ1A 2NVBA 3GJXC 3X1YA 3THYB 3H5IA 5JEEA 4GAEA 2EP5A 3QNMA 4MVJD 2CDBA 5A2GA 4IOJA 5BORA 4EF5A 3E9EA 2BSXA 4QYXA 3ESAA 3TGLA 2HJ9A 1PUJA 5MGBA 2QV0A 2OYCA 1F2UB 3NHZA 1AXGA 4JJGA 4ZOBA 2Y3IA 3SQDA 3VR1A 2IDKA 3B5JA 4EMSA 2HGSA 2QRLA 4HFJA 4R2MA 4NENB 3LPMA 3L4JA 5EPOA 3DYIA 3LQ2A 4J0IA 4RM2A 2JJ8A 4F45A 3BJHA 2B83A 4LSMA 4DR7B 2OZPA 2ASEA 1AOXA 3OHMB 1XDSA 3RUAA 1V16A 3PX2A 1V47A 1JA1A 1AQYA 5BUQA 4QAJA 3PQ6A 5ANRB 4CIDA 1DC4A 2QYTA 1KKMA 3IP8A 4KXLA 4IHQA 3OB2B 1H3FA 3CWGA 4RXUA 4D8WA 1ZUWA 3EGDB 3FZYA 4M7WA 3EISA 1YF3A 2RARA 3GVXA 4DXHA 2KQ6A 5L95A 2KBEA 2HSEA 4F2WA 1TF7A 4NJEB 5H68A 4FYIA 2ZR7A 1CB0A 5JO0A 4BO3A 1EXNA 3E2PA 1L8QA 6PFKA 4Y1RA 4XYGA 1P5FA 1FU7A 5JWHA 4JJAA 4K6KA 2LMTA 1NTRA 3BGDA 3ELYA 5EMMA 2E21A 2ODQA 4HEQA 4KYVA 4BFZA 4CMGA 3BTOA 1PSDA 5HS6A 4UUAA 4FHZA 1EE9A 4IWYA 3ZHSA 2WCKA 5KCZA 4YP6A 2ZIFA 3S8YA 4QGHA 4L51A 4MVFA 2YIMA 2IUFA 2GLTA 3OEEA 4AP5A 2WM8A 4TROA 4TLBA 1QXPA 2R62A 1VCMA 1UEJA 4RCZA 3WQHA 1GY8A 4CN8A 1TYDE 1VMEA 3DOUA 3U13A 4HPJB 4IDBA 1UKVY 1XHLA 1JEYA 2Z57A 2A0XA 2AD1A 2WPNA 3SNHA 1KMHB 3MWLA 1RLMA 2QI9F 1D2RA 4GOMD 4GOXA 3E35A 2PSJA 3MZ0A 3ZDYB 3E0XA 3LQYA 3TFWA 3GRPA 8ATCA 1M0EA 1TKRA 1FP4A 5KNBD 1XTJA 5ALUA 4HH3C 1P2BA 2Q5FA 5T5QA 5LC1A 3ZIUA 3RBAA 1HE2A 1QV6A 3HN2A 5HW0A 2YCLA 1A95A 2W7TA 5IBPA 1SJ9A 1SXJE 2BVNA 1JVNA 2CXXA 3W04A 2HPZA 2WI8A 1QLJA 3X1ZA 4E3WA 4HK4A 2NXQA 5LQSA 3G0BA 3DH0A 4WV3A 4ZCTA 3PNKA 4JSYA 1Z2NX 2FMTA 1WRKA 2ASVA 3BL6A 3K0EA 4CKZA 3GLFB 3OC6A 2C2GA 4URYR 3FHCB 4GDMA 1HQCA 1E69A 4ENTA 1REQB 1B0AA 4MI3A 2HMVA 1Q92A 1S2DA 2K7ZA 5SY9A 2B7LA 1ADYA 1B43A 2QD1A 4YCMA 3RU9A 1EFHA 4EGFA 3BHIA 2L4HA 3BMQB 2AOUB 1DC7A 5AVSA 1UUSA 1I24A 3D1JA 4BX3A 4OGGA 1J8VA 2KJQA 5I47A 5L7TA 1T8UA 1D8TA 5C35A 2QD4A 1KS9A 4ALJA 2LNDA 3DMPA 4QE3A 4IGAA 1F2TB 3HTXA 3PP8A 1L2OC 2BMAA 4R9SA 1TUEA 2Z4SA 3T38A 1SRAA 4Q1FA 4LHZA 3CB4A 3K5HA 2HO4A 3REOA 2QTGA 3H5AA 2IZ1A 4RZIA 2HLDA 3R7NA 1N2ZA 3RAPR 2QR3A 2NTJA 3EKJA 3I72A 4KIUA 1GSIA 3KNZA 4N9QA 2C9OA 3GDFA 2CT8A 5ALGA 3CO0S 1QR6A 1GXSB 1IHDA 1CZOA 2CLHB 4P36A 1UK9A 1NXOA 1C07A 3NIFB 3ZIAA 4AZWA 1A5BB 3EXFA 4BUCA 1BR1B 3RSZA 3VBCA 2QM7A 3E5NA 4DCNA 1UBSB 3G5AA 3JQEA 1HQYE 3Q15C 3JWGA 4P08A 4G4JA 2HK8A 1G21E 3EXHB 5C80A 4D92A 4PC2A 3EF3A 4XRRA 2UYCA 4LRXA 2ZYSA 4QOSA 1B1GA 5E6SB 4GX2A 5DBHX 5GTDA 1CUFA 4WTOA 1ICEA 3CKLA 2HIMA 5TQ2A 3P9QA 3Q88A 5SY4A 3KVNA 4L02A 2G1AA 1MW8X 1V1JA 2Q28A 5IKPA 3DEHA 3A1NA 4X92A 2ZJAA 1TZKA 2VK1A 4K9OA 1XD2A 1SHLA 1N5IA 3HJCA 2EIHA 2O8FA 1Y1TA 1U63A 1UAYA 3DXYA 3T5GA 4NJOA 1SA0A 1XFWO 1I6LA 4RACA 4EY8A 5HZHA 5B5SA 1LNZA 2R86A 2YV5A 2PU5A 4Q1BA 3MGCA 4LX0A 5TMPA 3AAKA 2YCBA 3GJ8A 4KN8A 1NJSA 5C7IO 3SC3A 3H2SA 4ZOLB 4D9IA 1G42A 4WZBA 2C9MA 2XODA 1B4DA 5LOVA 4KXVA 3GRCA 5HWSA 2NMVA 4FUTA 2C4UA 1LDGA 3CLUC 3QG5A 3CBQA 3I23A 4A4DA 1RQNA 5AJUA 1C4XA 4AUKA 1VKOA 1W59A 4Q9DA 2OV2A 4NABA 3TRKA 2Q6IA 4QDTA 1ISFA 4YYZA 1DC1A 2Q50A 1CQJB 1VXOA 3GZTB 2RJNA 3ZXXA 1X1SA 1Y6GA 1ZBDA 3R5SA 3TAUA 2HQ1A 3EQ8A 1M8PA 4OHKA 3PM2A 2QAGB 1SZPA 1PG2A 2J3DA 1MLDA 1TAHA 5HF8A 1U9YA 1ZX1A 4ZYVA 5HLVA 5CXUA 5DBEX 2FZCA 5TQ0B 3A1VA 1VTKA 1ITZA 1JMKC 4NOKA 3UC5A 4W1QA 2VDWB 4DLKA 4C4SA 4BMNA 2OHVA 1K94A 4Y2HA 3L4BC 4YO8A 1AGNA 4MO2A 1G8YA 4D1YA 3SK0A 5JOQA 5CSFA 4LRQA 3G0DA 3GK4X 2BFOA 5F7ZA 4Q3CA 4I46A 5CIQA 2NWQA 1SZDA 1DC3A 2GAFA 3DCYA 3PDIB 1SNLA 2R751 2AHRA 3IUNA 1J39A 4L3OA 4L5IA 4JL6A 2R7LA 2OQVA 3PXXA 2UXDB 1E0AA 1KBOA 5C4GB 3T7TA 2C8LA 1W49A 2TN4A 1S9DA 3HABA 2VUIB 4GI3A 1PTKA 5REQB 1Y6QA 4LWQA 2CVZA 2BFBA 3WB2A 1UINA 3WNVA 1LGYA 4YMUA 3E03A 1U8EA 3GZNA 4MICA 4B4VA 4PFQA 3DF0A 1MVOA 5FOTA 2XW6A 1YTZC 4KWIA 2ODWA 2Z2YA 4E5YA 1KZ6A 1QU2A 1KPIA 3NVDA 4XI9A 2ZUBA 3DAPA 3ZHVA 2D06A 3DAYA 3SC4A 1WLYA 1M2OB 3EVUA 3M5WA 5B37A 4QJ5A 5FI0B 1OBHA 4TXNA 1GPJA 3OQPA 4EA7A 4RH0A 2XWPA 1X8KA 3H11B 1U8TA 1GUBA 1ISHA 2AOWA 3CUUA 3EZYA 4GRIA 1N9GA 1JJBA 3DL0A 3F8TA 2L42A 4EMUA 4BGEA 1ULSA 3AESB 4RVOA 1FE8A 2ZPUA 2D7DA 1NGSA 3IIIA 3EZNA 1KMMA 3CZRA 1YZTA 4NLLA 1I4TD 3RQIA 1PQ4A 1XE3A 4M9CA 4MITA 4RZQA 4F46A 2QMZA 3W5JA 1BXRB 2HMUA 3A1DA 4DQKA 3B2EA 1PP4A 8OHMA 2DYKA 5C1OA 1SXJA 2FA9A 3A2KA 4U2DA 4F6LA 2PLNA 1ZNWA 1D1OA 1CUWA 2B25A 1G2QA 3H9CA 4JSTA 2IPLA 3W4IA 5FO0A 4BDSA 2AWNA 4IIGA 4M2QA 2VZ8A 5KUTA 5GY7A 1P0MA 1LQUA 4RGVA 3EIEA 3IV6A 3N2NA 1G1MA 3P32A 5F1KA 3W6UA 2L17A 2FZWA 1V4NA 1C3YA 4IILA 5DF1A 2PVCA 4DILA 1VIAA 3T9BA 1JVSA 5JY1A 4KLAA 2EFEB 1VG9B 4EBBA 2X9QA 2HUNA 2JFPA 5EMLA 5AW5A 4MRXA 4AP6A 4WK0B 4Q93A 1HX7A 4ZYLA 3DTVB 2HRCA 2EKZA 5G2OA 2V74B 2W6MA 3TE7A 2Z5FA 5BQOA 5C1IA 1DMOA 1IRIA 1ETUA 3BMNB 2C5AA 3NXAA 2IA5A 1C7VA 3DCJA 4FI3F 4M0EA 1RLUA 1HQVA 2QG9A 3U7GA 3IHLA 3IEPA 3ZGXA 2WTEA 3ACCA 3BREA 1OPXA 1L7XA 1CB7A 3RNLA 2WUGA 4OLAA 4JLNA 3ZLUA 1U1IA 3PCRB 2YNMC 3KAQA 4W6ZA 3C39A 1KFKB 4R2WA 2CVFA 2D2VA 2XLCA 4Q39A 5AEQA 3H13A 4TMYA 2C4HA 2AI1A 3RYHA 1F20A 3B1WA 3RPEA 2Q9BA 3T7SA 1ATIA 3K1EA 1G4HA 4C2BA 4E2ZA 2AFIB 2LVIA 2R6DA 2VYVD 4PFSA 3RVOA 3KUCA 2NTYC 4Z3OA 4LVUA 2YJZA 1G21A 1C7ZA 2XTAA 3SQWA 2ZRHA 4C7KA 3WIEA 3B12A 4WNAA 1U2TA 3HI4A 2OBLA 1R7RA 2IZZA 1GNRA 1MABA 2WWVD 3GLQA 2VJMB 4AJNA 3AI7A 3ZE0B 4C06A 4BQNA 5EE5B 4HDNA 2QTZA 3ME5A 1E62A 2XV1A 3HP1A 5E2BA 3CF4G 1CIJA 1JIUA 3F96A 4A0RA 3V8MA 4Y2XA 5EZYF 4IJUA 1W6RA 2PX5A 2A9FA 2PS3A 1F3LA 1UCFA 2VBFA 2O2EA 5EJGA 221PA 3GPCA 2E48A 5T3YA 2I80A 4LE1A 5JANA 3L04A 4P0TA 1JZTA 3WMEA 1NZJA 3PKZA 3JXEA 1W4RA 2JNXA 3KEGA 3SF8A 2H92A 5L3ZA 3KLMX 3QYAA 1E79D 2P30A 5BNFA 5JD4A 1BFDA 1W4CA 2FMUA 3B9QA 1XQYA 1YVPA 1JEQA 2BAGA 5FI3A 1AKWA 1I1HA 4KSBA 3BD9A 4MRYA 1ULAA 3UJAA 4GL4A 2VZ9A 3RT1A 1Q15A 1U28C 3OOWA 4LN1A 2FU5C 3DHNA 5F3DA 1BMDA 3OOYA 5D5PA 1M6NA 1T1GA 1GSOA 3CT6A 1FRVA 1ZESA 2KHNA 4URWR 1FXSA 2HN9A 3A6DA 5DDIP 1XVVA 2ERBA 3WRXC 3SLGA 2PQ2A 2NV2B 1IWOA 1A9RA 1XA5A 4C3ZA 4HADA 4YUVA 4ZV7A 3QLUC 4W8GA 3LHSA 3R7SA 4Q16A 4K46A 1SR8A 4O63O 3LKZA 2JI9A 3NSOA 3MSEB 5E7JA 3D3JA 3H1GA 1TYCA 4EVQA 3WGUA 2A1TS 3EAQA 1FLDA 3WA7A 1FLVA 2I03A 4ZZ2A 1D5CA 1HDXA 5LXTF 3DBHB 4ETIA 4OKHA 2FJ0A 2QSYA 4O4LA 3WAGA 3GAMA 3AYZB 4QHSA 4BX9A 2CXSA 4NDAA 1KQVA 1H2YA 5FBWB 2CFIA 4BVJA 3T5PA 1X13A 2IXTA 3O3MB 3FE6A 5K0JA 3EGEA 1CJKC 4HDKB 3ABIA 4DG8A 1HOTA 2GCEA 3Q8KA 4WQMA 1DTWA 1KK7Y 4IO0A 3TNJA 4GLJA 1N3LA 4N47A 4GGOA 4DJDC 3I3OA 4B2IA 5IZCA 1Y1SA 3ZWNA 5CLHA 4QODA 1FEZA 3IT3A 4IIDA 1LBSA 1KF0A 2WT9A 4CEHA 1I4EB 2NTNA 1IVNA 4MWZA 2NSLA 4BMVA 3B1XA 3D6NB 4Y98A 5CFLA 2FYTA 1SKQA 3EZXA 1WBJB 3LYUA 4HRYA 1AKVA 1JR4A 1X19A 5CPFA 3WXAA 3WOVA 4NK5A 3TLEA 4KTTE 2OCBA 2BDEA 1JT2A 2NLNA 4M9QA 1XZMA 3FN4A 1HE1C 3X3HA 2QROA 2XI4A 3KKOA 2Z8YM 4FQ7A 1IU9A 4QU5A 1P2VA 1NULA 4FYJA 2ERYA 3IVAA 5EKDA 4X20A 3GU3A 5LP6C 3NKLA 3TTTA 3O3CA 2YVAA 7ABPA 4QT0A 2QN9A 3LV8A 3HKCB 3DWIA 4HLDA 3RB8A 2V3VA 5SZIA 4WDRA 2RGRA 4Y2PA 4X5OA 1YFZA 3TLJA 5DZSA 1O08A 2E49A 5LDHA 4XX0B 2OFOA 1KO7A 3LT4A 4TSFA 4I9FA 5FX2A 2R68A 5IT5A 1T9GS 4RD4A 2C5HA 2WYHA 3PD7A 1TT7A 2H5LA 2CUZA 1GNPA 1SZCA 1GTG1 4KO1S 2ZUVA 4BVAA 5EQJB 3LQQA 4UZSA 2DWPA 1AF4A 2XMZA 3D3NA 5B12A 2YFKA 2H2WA 2ZZKA 1U98A 2OHJA 3PYLA 2XMPA 3ONWA 4OK5A 2VT3A 4G5XA 3RRXA 5CB6A 1EM8A 5THXA 2J9FA 5IEJA 4CKWB 2WCFA 1XVLA 4EY4A 2HJGA 3ROGA 4ZT7A 1Z5PA 3SQNA 3AR3A 3QUQA 3OX5A 4IRXA 3KYCA 3ZHBA 2CL7X 2WLTA 3VBEA 1P9RA 4HD8A 2I99A 4HDAA 2JQ6A 1XMQB 5AVQA 3STWA 1B42A 4OQLA 3KYIB 1S6YA 3LUAA 2ZP1A 1FS4A 2JNFA 4RCVA 4CM4B 1UANA 3AF4A 4CR7A 3RVMA 2B4KA 2XD4A 3D6FA 1TMGE 3EWAA 3ANTA 3LMKA 2MA2A 4YJHA 4QICA 4FOSA 3ZBUA 1SCMC 4FONA 2O1XA 1H9BA 3EQZA 1R00A 1KDYA 4G0OA 1T5OA 4PZEA 4BRWA 3KSRA 4LF6B 3E23A 4XCQA 4YLYA 4KGDA 2RGXA 3VAYA 1ZN7A 3FE8A 1W9MA 1O95C 2JGFA 6Q21A 2HCFA 3NAGA 4UEQA 2WD9A 5DW0A 2XYVA 1HEYA 4OQDA 3AVOA 3TMYA 3LYHA 4X1KB 3UWMA 3VNVA 4YJGB 1VM6A 5IU6A 2JI4A 3LKVA 1QS0B 4B7UA 1UJNA 2O54A 2KX7A 2CKDA 2OILA 2YMLA 4B8YA 4FTWA 4ILEA 1SKTA 3HP7A 1U8UA 2IEZA 1N5KA 4OPMA 3IS3A 3GJ6A 1L3BA 3PX7A 3K6RA 2GJKA 1MAWA 1A27A 4RV9A 3MWGA 1A71A 4MRNA 1GG5A 3JRWA 2L4IA 2HYDA 2KFHA 5I94A 3FYUC 3OH8A 3O9MA 1BQ4A 2V6GA 4QUJA 2FQQA 2YV4A 2C5FA 5DM0A 3TZ6A 2HNAA 1X02A 1DG9A 2O6LA 1OKKA 5H80A 4JUIA 1TVEA 1P1FA 5E1MA 4Q3NA 5TJHA 4O4HB 2ZJBA 2YXNA 5A2QA 3C8HA 2YOFA 4RJIA 1IJKA 2D5AA 2JAUA 4JR2A 3KB8A 2K60A 2AA3A 4KVFA 1ZJ6A 4CKCB 4F86A 3GJ7A 1QHHB 1RLTA 1JDUA 3QVMA 4DUYB 1DRUA 2QTFA 3EG5B 3ZWPA 1E6WA 1CRWG 3G02A 4YPOA 2HF5A 3BHMA 4P32A 2DLNA 3ZDDA 1IHOA 3FETA 3W0LB 4G1MB 3QEMB 4DMKA 5CYFA 4LHWA 3MBKA 1GGMA 1WUHS 3DZGA 1OIWA 5TQVA 4D5EA 2HRBA 3D02A 3GPDG 4AY5A 4CVNA 3BDVA 1ZRHA 2CNWD 3K9FC 3U3MA 1Z0IA 4G4GA 1H3NA 4WESA 4BYGA 4KR7A 5BUCA 1DJYA 5BVGA 2JJYA 4MPJA 5LUAA 3AUYA 1YZUA 1S3GA 3QJYA 1GDDA 4N3NA 1WVMA 1QBGA 3F2IA 4Q4HB 2AG8A 1MZPA 4U7WA 3KU1A 4OI1A 1YUNA 5B4UA 3DXXA 5ALXA 3O0TA 1DOAA 1ESCA 3GD7A 1OOFA 5EJ6A 1AJ5A 3ZX4A 3PFHA 5FL3A 1NUPA 3KTAA 1CNMA 5H7XA 5CD1A 5T67A 2EOAA 2RH8A 1PX0A 4NBWA 4C0KA 4XEUA 3OMWA 3ACBA 3BAFA 1B4CA 1LPAB 1U9CA 3O8DA 4ZGGA 5KYKA 3C45A 1AK9A 1TCOB 3WVNA 3TIXB 3D76A 5LD2B 1ZITA 2C8VA 3CLUD 3I30X 1XBTA 1P45A 2OLKA 3AIKA 1YJ8A 2V03A 3L5KA 5JYEA 2HXGA 1GGWA 3D5QA 3NKVA 4U7PB 2ZRNA 5CX1A 3DVLA 3IJ5A 1G1AA 1HE8B 2G8LA 2SBTA 1VIYA 4MINA 4CUZA 2BMDA 2QPLA 4NBNA 1E2UA 1ZD5A 3ORSA 3I6MA 5ICSA 3PFNA 3COYA 1SQ5A 2LPMA 1DEOA 4ZT3A 5KPDA 3F4BA 1BW9A 1LW6E 1AUIB 2GZMA 3ODGA 4OHBA 1MZVA 4E4RA 1KTIA 1Z08A 2ZSEA 2OHIA 5DTQA 4BLPA 1QB8A 4A03A 2FSVC 1YA6A 4J0DA 4I4IA 3G59A 2JASA 4PQYA 3CTPA 4ECAA 1P62B 1W88B 2DXIA 1XI2A 2YZ2A 2D59A 2GXSA 1QE5A 1I3KA 1U0SY 2QVBA 3K0FA 5DK6A 3MOGA 2GHTA 4MSPA 4XSHA 3AETA 4MW5A 3SBXA 1H8ED 2IFTA 3OUTA 2WC8A 2OV4A 4ZZIA 3WDKA 2ZN8A 2DUJA 2BPOA 4R8SA 1A77A 2FPMA 4RSHA 3UN1A 1JG6A 2Z6VA 3VHXB 4ORBB 1W0KA 2XA2A 4X66B 4L7QA 3VQTA 2RHCA 3BRQA 2VTVA 2Z08A 1QG2A 2A5YB 2G25A 1A69A 5L4SA 2WTXA 1Z5GA 4NV0A 3F4KA 2GVNA 3NIDB 5FPKA 4WQ2A 4LIPD 1UJ2A 4XIGS 1RXWA 5I9MA 1B8OA 4ENPA 2DGDA 2WW8A 4QXQA 1LB1B 3G1UA 1KZGB 1X2EA 3EZ7A 4RKYA 1STOA 2W93A 3USES 3IQGX 2A35A 5FLEX 4BJ1A 3GJ4A 1TT5B 3IPAA 3K0KA 2P75A 3OBIA 1T6NA 4NOJA 1HLPA 1SK8A 1THMA 2PZJA 3GA5A 4TS9A 4LQLA 4PSUA 3SX4A 2MCFA 1W85B 1G64A 1M5UA 3CN7A 5ITZB 3W3AD 2PUAA 1C7RA 2WJHA 1T0BA 3PRYA 1A9OA 1WBDA 5B36A 4O2BF 2EWVA 2G1KA 4WY8A 4EITA 1N75A 2WFZA <