1DELA

Deoxynucleoside monophosphate kinase complexed with deoxy-gmp and amp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
241
structure length
241
Chain Sequence
MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
publication title Crystal structure of bacteriophage T4 deoxynucleotide kinase with its substrates dGMP and ATP.
pubmed rcsb
source organism Enterobacteria phage t4
total genus 85
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.4.13: (Deoxy)nucleoside-phosphate kinase.
pdb deposition date 1996-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.70 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1delA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1delA01
1SVWA 3KZ1E 4HB4A 3RRZA 1AN0A 1M7HA 4M4SA 2WTUA 5HE8A 4V03A 2GHIA 2J7KA 4B75A 5FPKA 2ZS8A 4Q47A 3B13B 2R62A 4B35A 2JLWA 2OAQ1 3PUVA 5FTJA 2XOKA 3FE2A 2NO0A 3NC1C 3C41J 1RJ9A 2NOAA 2OLJA 4K81B 4OKSA 4D26A 2J59A 2AD5A 2ZRCA 4KYUA 1E2JA 2XZOA 1Z6XA 3A1UA 3DKPA 1VHLA 2H1LA 3U3JA 1OH8A 4ZIRA 2A7QA 2ONKA 3L0OA 4KAXA 1IN5A 2BVNA 3RRMA 4I1OA 4UJ3A 2QAJA 3TUIC 1JNYA 3GEIA 2N1BA 1LS1A 2OXCA 4HLUA 4Z1MD 2NO1A 4FMCF 3GQBA 1E0SA 1KI4A 1XJCA 121PA 4MUAA 2JLZA 1Z08A 2HV8A 4BZPA 4C0LA 1TX4B 4NONA 4HAWA 1KKLA 4ZO4A 1Q20A 2F9MA 4FCWA 1W36C 2B7CA 3RVBA 2YC4C 4KFTA 2ZI7A 2IT1A 3IO5A 4V02A 4IW3B 4YMUA 1E9AA 3RC8A 3IPYA 4XWOA 5KOYA 2FPKA 1FP6A 1N0WA 2J0VA 2CHQA 2RGNC 2W6ID 4IEIA 1S3SA 3RRNA 1YJ5A 3TUJC 2OO7A 4M1OA 3PENA 1SGWA 5CM8B 4E5UA 2AR7A 2W58A 1DAIA 1K5GA 3D6TB 4D2IA 3IPXA 3JVVA 2X2FA 5DGXA 2WJHA 1GAJA 3CRW1 3WBJA 2IS6A 4JVNA 2B7BA 4MRVA 4NP6A 1QHHA 4DEXA 2P0EA 4Q4HB 4C2TA 3GEHA 4P4SA 2ZR7A 3CUEF 2BJWA 5E4FA 3W6NA 4A0RA 1LF5A 3B9PA 3QF4A 1UDXA 2GEDA 2W00A 2W6JA 1W5SA 1NP6A 1PZNA 4MKHA 1HT1E 1ZM3A 4DIDA 1ZM2A 4ARZB 4WIAA 3I72A 2XTNA 4E03A 5B58C 4IXMA 4MKGA 4OJQA 4Q9LA 3OEHD 5JJKA 1PLLA 3W34A 4HZUA 4LYJA 4NYIR 1E1RD 2OHFA 5KUTA 2V6IA 2ZR0A 1WDTA 2VHUA 2WOJA 2V1UA 3DKVA 4A0GA 5EP4A 3AKCA 1BKDR 4FN5A 2H18A 3H86A 4HLDA 3FMFA 2W0MA 4EPRA 5FFMA 3P32A 4FMDB 4QBIA 3I5XA 2ZEJA 3L43A 3AVXA 3WMFA 4PTLA 3KTAA 4Q7KA 1UKZA 3X1YA 1T6NA 4TLEA 1KK3A 3ZS8A 421PA 2V1XA 3LNCA 2JLUA 1Z83A 4OK5A 1M74A 3FKSA 2ODNA 4Q9JA 1X3SA 2LWIA 4BLQA 3L0PA 1N5JA 4HB0A 2O8CB 5FPTA 3RC3A 3IHWA 5TV2A 4UXIA 1DE0A 5AUNB 3CKLA 2V9PA 3DZ8A 3MRSA 4OI2A 1GNPA 4L9WA 4IRUB 4P0TA 1XTSA 2IUTA 1H65A 3CF0A 3GLFE 1C9KA 3GJ6A 1R8SA 5HE9A 3CH5A 4GOJA 4KHZA 5FUWA 2XOKD 3WYGA 2YHSA 4Q1DA 1XCPA 5JSZB 1FL9A 1E3MA 1P73A 3PJRA 3TVTA 2ZSEA 3DVLA 2H7VA 4YC7A 4O0MA 2WAYA 2E9SA 2ZE6A 1JR3E 2FFQA 2ZAMA 3B1ZA 1V43A 3BBPA 3BK7A 3NTUA 821PA 4C0HA 5DN6A 5KNDA 4CRWB 4IVQA 3A1WA 3QG5A 3AUXA 1E1QA 2CL0X 4QGHA 5CIWA 1QDEA 1FNNA 3TBKA 1NSTA 2G1JA 5DYGA 4EKDA 1SVOA 4LJ5A 3H4MA 4ZI2A 3LLMA 3KFXA 4DLYA 5JJIA 1VECA 5DI3B 5B2ZA 4HZUB 3A1TA 4MRPA 1NLYA 4FMBB 1G5PA 4OQMA 4U5XA 4ITRC 5G40A 2OE2A 5EZ6B 3KUDA 3OFNA 5FL3A 1NRJB 2FFAA 4OQXA 4U02A 1ZINA 3SYLA 1FUUA 4GZMA 1W47A 1DS6A 4NU0A 4KSBA 1DARA 2P6NA 4JYCA 4A6PA 3IQXA 4Q1EA 1X1SA 3L8ZA 2GTPA 5EP1A 5LBIA 1PLKA 3WNBA 4MRSA 4AKGA 1NN1A 3EW9A 3I1FA 3PUXA 1KI1A 2XNDD 3LQQA 3T1QA 3VU9B 1U94A 4OQLA 4UXHA 1OXXK 4NDZA 2BEKA 2R6GA 2FSHA 2ZJ8A 5FTKA 3TE6A 3THWA 4PC1A 4A8JA 3EG5A 4M21A 2J46A 4LV5B 2W6JD 1OXUA 2F1JA 4UKDA 1DADA 5IK2A 3A4MA 1YZTA 5F3WB 3LXXA 4D25A 4LUCA 2FDCA 2C78A 3VR1A 3Q85A 5C2JB 4PC2A 2IYVA 2O8FA 5EJEA 1NKSA 4JIMA 1VTKA 2GKSA 5TVKA 5KSZA 4QFMA 3IDQA 5EE1A 4TSFD 5AJXA 3QKUA 1U0JA 1VG0B 2MMGA 1KKMA 1L8QA 2XB2A 2W2XA 1ZYUA 3QEJA 1ZU4A 3W6OA 4LC0A 3DHWC 2AFIE 3BS4A 3CX8A 1E2LA 2VEDA 4GP6A 1FX0B 4NYIQ 1FUKA 2BMEA 3HPRA 4LJ8A 3R8CA 4KODA 4Q5IA 4C4PA 3KJHA 1JQJC 4RJLA 3I32A 3OF5A 1YE8A 3GMTA 3G5UA 1Z0DA 1W2GA 3UG6A 4EPTA 5J47A 1KO1A 1U8AA 1UJ2A 2ZJZA 1XPRA 3AF4A 2F6RA 2IHYA 3AKYA 5EXTA 2Z5FA 3FKSD 2OEPA 3X1WA 4C0AC 3KXKA 4BQSA 2MSEB 3FDIA 3LY5A 5KDOA 2HF8A 2ZVPX 3SJBA 1KOFA 4TQAA 3I62A 1KZGB 3ND9A 3WP1B 3KXIA 3RHFA 3KUCA 4NTZA 1E9SA 1IN6A 2OILA 2UZ3A 1KZ7B 2H57A 2HXYA 3BB3A 1N6LA 4F4JA 5CDFE 5JCPA 4KI0A 4GMXA 4EQ6A 4O3MA 3TJZA 1EFUA 2GZHA 5GVRA 5GJBA 3EWAA 2QP3A 3T5DA 2CEAA 4CVNA 1A82A 5EE3A 4BASA 3EPJA 1S1CA 1YZUA 5FBVB 1E2EA 1GOTA 1Z47A 3KQNA 4KLNA 4JL6A 1N5KA 1KSJA 4A1FA 4TLCA 4EFNA 2H5EA 4YMSA 5DHFA 1LVGA 1QHIA 4LPSA 1LFDB 1UDWA 3AVOA 4G01B 3HPQA 2JLRA 3CRMA 1MABA 4KXFB 2QZ4A 5EUQB 1E9EA 1Z0FA 2QE7D 4CEIB 4AI6A 2RGNA 4BGDA 1GNRA 1JJ7A 3CO5A 5JECA 1WE2A 4V0LA 4F92B 1TL7C 4MGIR 4Q7JB 4AD8A 2F3TA 3P27A 3LW8A 1IBRA 1LNZA 4NCJA 4H9GA 1ZUNB 3DL0A 4IEEA 1UEJA 2VBCA 4R9UC 4ZKEA 4BFYA 2XXAA 2D2EA 3W3AA 1XXHE 4BFTA 2J3EA 2UVQA 2IYTA 3ICQB 2CJWB 3AP2A 1F2UA 1ZNXA 221PA 4A2QA 1S3GA 2VHCA 2RGCA 4Q03A 3GLFA 1C4OA 4LPKA 2ORWA 1A4RA 4A92A 1UKVY 3Q8XB 1WF3A 2YINC 5DHAA 2ECKA 4IHQA 2FWRA 1Z6GA 4PSKA 4LJ4A 1KO7A 5BN3A 3LX8A 4LYHA 2ZRAA 2ZI9A 1IONA 4TYWA 1XB2A 4QJ5A 5IK2D 1JR3A 3EPLA 4YMWA 1JXMA 2H16A 3O8DA 3L82B 2J87A 2JLVA 1FQJA 1NSFA 2EWVA 4CYMA 5JEDA 4B3DA 4TL7A 4DLSA 4DT1A 5JHHB 1GUAA 4IOJA 4LYAA 5DO9A 4DDWA 3O8RA 2OBLA 2OAP1 4DSNA 4BPBA 4PO1A 1NIJA 4PC6A 1TQDA 4XVQA 2YV5A 3NWJA 2BV3A 4K8OA 3PR1A 2ERXA 3EZ6A 1HE1C 1P4SA 3IEVA 2WKRA 3F8TA 3R8FA 3JVUA 4P31A 5CK5A 1Q22A 3WBKA 5KPJA 1XD2A 2ZSDA 6Q21A 1RE0A 2J7PA 2XAUA 1VG1A 4HDQB 3BB4A 5E95A 5EXSA 1AS0A 2CMKA 3QPWA 2I1QA 3HR8A 5FBRB 1K8RA 4A6XA 1MT0A 4WZAE 2RCNA 1NVWQ 3OE7A 2JA1A 3C7KA 4UNRA 4RFSB 3C15C 2EFDB 3SQXA 1Q1QA 3ZQ6A 1P75A 1HURA 2IF2A 3HDTA 4DWJA 4KFUA 2A5YB 2WOOA 3N70A 1OYWA 3ETLA 2PBRA 2C98A 2QPTA 2NTYC 3KQUA 2QPOA 4M9SA 1VDZA 1IY2A 4H1UA 4FD2A 5BXQC 1G8GA 5AJVB 3GJ7A 3T1OA 3AGQA 2JLSA 3QXJA 4ZPXA 3DM5A 4OQFA 3U3RA 2C9YA 5EXXA 1GFIA 1D9XA 4G5GA 1SVLA 5FPSA 4TLAA 5A0FA 1KSHA 2ZJAA 4TTRA 2GXUA 3T15A 3UANA 1YU9A 4BEJA 3KQKA 1OFTA 2R6FA 4QM7A 1W49A 2ZRIA 4TL8A 2GEUA 1W36D 2BBTA 2JAQA 3KDSE 1D8TA 1Q0UA 3FTQA 1OFIA 5GJCA 4TL6A 2REOA 4DEYA 3NEYA 2OFWA 3G0HA 3QKRA 4DDVA 1ZBDA 4CDGA 2QQ0A 2JLXA 3AVTA 2CL7X 3H2YA 1BMFD 4JT2A 1NG1A 5FBWB 2IS4A 3T06B 1OPXA 4LC1A 4B74A 2GJ9A 2G88A 2RGDA 1N5IA 2VP0A 2GILA 4HLCA 4JMPA 3RSLA 4LWZA 2FA9A 1XD8A 2A5FA 1Q1ZA 2V7QA 4PAMA 1N0UA 3NC0C 2BBWA 3A37A 1RRGA 2HEIA 2WSMA 3HU2A 1Z0KA 3CNNA 2OT3B 4TT3A 1YZGA 2ZYTX 4TMKA 4IXNA 1OKKA 5CDFA 2JCSA 2QTFA 4HSEA 1DO0A 5KSPA 3PUZA 1SKQA 1E9RA 4IOLA 4BWYA 1WXQA 2Z4SA 1UKEA 4NH0A 2GRJA 4JLNA 4DRZA 2WJVA 3A4NA 3MUFA 3O8BA 1JR3D 2QAGB 3MWLA 1QVAA 3W8RA 1T5LA 4D4JA 4DUGA 1COWA 5JHGB 2QPAA 1TF5A 1QBKC 1CRQA 2JLQA 4IOMA 4U00A 4PC7A 3VR5A 3B78A 3A36A 4UNNA 2ZE7A 1AA9A 2IA5A 2HYIC 1MR3F 3SBEA 2GJSA 1GZSA 3MCAA 1KDOA 1OHHA 2IWHA 1FZQA 2DBYA 2KBFA 1ZNZA 4NPHA 5IF9A 1L2TA 4LSGA 3THYA 2AKYA 2J7PD 3P20A 1R5BA 2ODBA 4TMWA 3IQWA 4TYQA 1NN5A 1W48A 1SVMA 2ZPTX 4MGYR 3OEEA 1ETUA 1F60A 2JIZA 4XTRA 1NBME 4TTQA 2P6RA 3NBFA 1KHTA 4OHZA 1XXHA 2G83A 2VRWA 4LBWA 2A3RA 4PXAA 4WW0A 3RLFA 2DFLA 3AF2A 1VG8A 1K6MA 4JBWA 5KTYA 3DEFA 4MRNA 2NMVA 1FFHA 2OUKA 3RANA 1AS3A 1Z6AA 2WHXA 2ZRJA 4LZZA 2P5SA 4JBXA 1E2GA 1AM4D 3I3SR 1EFCA 3I4LA 1YZNA 4ESHA 1CR4A 1G8YA 1IN7A 4ZDJA 1XPOA 4LGMA 1TAGA 3OHMA 3K0FB 3NHAA 4HZIA 1XMVA 3ZJYA 1KNQA 2IL1A 2Q9BA 3SJZA 3VX3A 2G0TA 2EYQA 1KI8A 1MOZA 2GF0A 4YQFA 4GSYA 1R0YA 4RD4A 1Q57A 3HJNA 5JI3E 2C5LA 2JLYA 1G3RA 5KDLA 4W5WA 3ZZUA 4NKRA 3CRQA 3RWMB 3TAHA 5LPNA 1LY1A 1J70A 1SKYE 4JL5A 1P9NA 1P60A 1VCIA 2GZAA 4KVAA 3KJGA 4PSVA 4GMDA 1XJQA 3GCGA 3CR8A 4US0R 2V4ZA 4A4DA 1U90A 1ZM7A 5J4HA 3IEUA 1YVDA 1XCGB 3C8UA 1ZIOA 4FMCB 3EZFA 5HZHA 3EZ7A 2W0SA 3O8CA 1E2MA 2JJ2A 2P3SA 3PV0A 5J4KA 4BRWA 4ACBA 2B6HA 2NQ2C 1NLZA 4EPXA 3B6EA 3EPHA 1GP2A 4Q1BA 4TMXA 4A8JC 3Q5EA 1G5TA 1KMHA 3GLHE 4N0EA 2QROA 4F93B 1EESA 2CNWD 1CF4A 2F7SA 4WBSA 4AURA 2GXSA 3H0KA 1JALA 2PMKA 4DBLC 4EFMA 2PJRA 2ZU6A 2J0QA 5IRCD 3SC3A 3CR7A 1SXJC 3R9WA 1XX6A 3MSXA 4CEHA 3VQTA 5L3SB 4RZXA 2V7QD 2IXFA 4G5SA 4M53A 4WVFA 2FSFA 5D3MA 5CITA 2ZUCA 4TT3D 4W5HA 2XZLA 4C7OA 2GNOA 3THXA 1OKKD 1Q3TA 2RKOA 3KJEA 3K70B 4CZ2A 4LV8B 1VMAA 1G3QA 2JEOA 2GVDC 1VG9B 1G6OA 4PQRA 2ZJ5A 3BE4A 1RPZA 2O52A 3GJ8A 2V3CC 4IFEA 2HLDA 2QTHA 2VSFA 1QG2A 4DLUA 4C2UA 4DUGD 4LI0A 4EIWA 1CEEA 1G1MA 1US8A 4HAVA 4QHYA 4WXPA 3LQRA 3GLGB 3QKSB 5TY0A 5FTNA 1W4RA 4BRUA 2IYLD 1M34E 2X77A 4Q18A 3SI7A 1XD9A 1G64A 2KBEA 2RGBA 4JLVA 1Z06A 4IFBA 2GCPA 3F0TA 5DISB 2WWIA 1E9CA 2CXXA 4D81A 4DJTA 1Q3HA 4UJ5A 5CJPA 1NN0A 2FEMA 3SBDA 2LKDA 1NVXQ 1WP9A 5TMPA 1NMXA 1NIPA 2DFKB 4P32A 3BH6A 3OEED 3UWKA 1KAOA 2QT0A 1OH7A 1E96A 2V54A 4PQYA 1SXJE 3DMNA 1W0JA 3SYKA 1Z28A 3EIQA 4EJSB 1W44A 3I73A 4JLPA 1RIFA 1E32A 4DKXA 3MWKA 1KJZA 2REBA 3OIYA 3RABA 2A5DA 2QRZA 1S9HA 1QHXA 3AH8A 3BB1A 4K46A 3IIKA 2F3RA 3NHBA 2VH5R 2O8EA 1B0UA 4KBFA 4LHYA 3GLIB 4TN1A 2B8TA 2DB3A 5BN5A 2JJ1A 3U7EB 3K0AA 3WRXC 2BMFA 2CK3D 1ZCBA 3K53A 1I2DA 5AUPB 4JLDA 1YZQA 1IJFA 1N6IA 3RDPA 4WA7A 8OHMA 3LRPA 2QM8A 2ZUDA 2PCJA 3QVUA 5FBLB 1Y63A 1KAGA 2YZ2A 4OK6A 4URYR 2ZXUA 2OFOA 4XD7D 4ZCLA 1IAQA 4A9AA 5CLQA 2BCGY 1XDBA 2QM7A 1CJUC 4YXWA 3ASYA 3WNDA 1ZIPA 4BLPA 3OZXA 5L8VA 4DCTA 4JVLA 1IXRC 5CK4A 2O8BB 5TXGA 3NH9A 3A1VA 2IK8A 2EQBA 2IXEA 3ZD6A 1N6KA 2F1HA 2R8RA 2O8DB 2Q3HA 2ASEA 1NY5A 1TNDA 3BFKA 2F43B 3TQCA 2ZSBA 3WNCA 5JRZA 3CZQA 1GM5A 2JJ2D 1II8A 4LDJA 3AKEA 3UKDA 1P9RA 2J41A 2PCLA 4QM6A 2QN6A 2I4IA 4FINA 4JKYA 1CU1A 5H70A 4D82A 4KU4A 1EG7A 1NBMA 3ZIAA 3U7FB 2XB4A 2GDJA 4M9QA 3TR0A 1N6HA 4MYHA 1KI2A 3VFDA 4ZKDA 5JZVA 2C03A 1W2HA 3TSOA 1OXVA 1XEXB 3W90A 2AWOA 4JZKA 5FL7A 3AVUA 4Q7MB 4LOAA 4TLDA 1AIPA 2PZGA 2CBZA 4B34A 2H92A 2SHKA 2TMKA 5B30A 3LX5A 1T0JB 2QMHA 3K9NA 4HB2A 4Z8YA 3QSYA 3ZGXA 4AWXA 5H68A 1ZM4A 2RGGA 2FEOA 3EC2A 4MDEA 2QNRA 3KQLA 3AKDA 2UKDA 5JMTA 2IS1A 5GVSA 3ADBA 3HU3A 4Q4JB 1SVKA 3QIAA 1DAHA 2OCAA 3E70C 5EP3A 5D3QA 4PR0A 3MG9A 3SDZA 2HLDD 2IC5A 5HZKA 3KQHA 4TMZA 1Y3AA 2NPIA 5KNCA 2IW3A 4Q02A 3ADDA 1GKYA 1E9BA 1JI0A 4RKFA 4WOPA 5FOUA 5BYKA 4CEJB 3RRYA 2ZSAA 2QORA 5DH9A 2FGJA 2GAAA 2AL7A 3IBYA 2JDIA 1P2TA 2QBYB 3X1ZA 4BFXA 1U2RA 1MKYA 5TDHA 1E2NA 3AV0B 2AN9A 4TYPA 4DSUA 3N2IA 3UG7A 1AKEA 3GLHA 5EE9A 1D9ZA 2MSCB 1TADA 1R5NA 3KB2A 4US2R 2CHVA 2WICA 1R0XA 2J0UA 2FMXA 1DG3A 2WBLC 1W0JD 1SHKA 4Q66C 4JKIA 1WA5A 4QXAA 4JSYA 4J0QA 3J81k 2ODEA 5JS7A 4ZCIA 4US1R 1G8PA 2WIBA 2R6AA 1KI6B 2A5JA 3E1SA 2GWHA 5CLLA 2ZI6A 1A7JA 2L0XA 1TTTA 1G19A 2CVFA 4FXPA 3TAUA 4C0SA 2JJ1D 5EZ5A 4AG5A 2GETA 2BM1A 4Q4AB 3U4QB 3KL4A 1E69A 1R5OA 1U8ZA 1T0HB 1RZ3A 3EA5A 4HUQB 4WXRA 4CT4B 4PPGA 4C3ZA 2BMJA 2FN4A 3ND8A 4ESVA 5A5GA 4D4MA 1MO3A 3IGFA 4M1TA 1A5TA 2E1RA 3PIRA 3QY0A 2QMOA 3ZZTA 2IX3A 3C5HA 4O2LA 4DSTA 5JLJA 2I3BA 3SZRA 1OXTA 1HA3A 1TF2A 1IXSB 2GCNA 4OI4A 3TR5A 3PXGA 3NKVA 2QG6A 2VP2A 2VIIA 3U44B 1Z29A 1ZNYA 2X19A 3PUYA 5CYPA 1ZNWA 5J4LA 3AVPA 3TKLA 5AWFC 1XWIA 4TQ9A 1NY6A 5HPYB 4L4UA 2P6UA 1OT3A 4C0QC 1WBDA 2BKEA 3AP3A 2XJ9A 2BBOA 1XMIA 2IXGA 4TYNA 2ZM5A 1KSGA 4MITA 3TRFA 3O47A 4X8LA 1SXJA 1NBMD 2AWNA 1XMSA 3ADKA 5AJZA 1H8HA 5FTMA 3DZDA 1P5ZB 4EFLA 3QENA 1UBCA 4A15A 4GI7A 4M9XA 2VTKA 2ZI4A 3B1YA 4YMVA 1L4UA 1TU4A 1OH5A 4TZ0A 1UPTA 1OH6A 2VP4A 2IEZA 1KJWA 4D0NA 4ASUA 1W1WA 4DDUA 4GT1A 5EE0A 4UNQA 4QL3A 3LXRA 1HQYE 4LCBA 1VCMA 2VA8A 5L3RA 4RD0A 1RJ9B 1P6XA 3B9QA 5DIFA 1NJGA 1Z0IA 3S1AA 1CJTC 3RS4A 2CHGA 4NBSA 2OBNA 2DWPA 2OFXA 2WSSA 4ZIRB 1GL7A 2FF7A 2YJTD 4A0HA 3R9IA 1HYQA 1FMJA 1ZMXA 1P2UA 2QP4A 4PFSA 2FJUA 2N46A 4RY2A 1D2EA 1AZTA 2RHMA 3OESA 5E7MA 2BHRA 1C1YA 1E2HA 1VCNA 4N1AA 1DPFA 2ZETA 3SNHA 3DOEA 3RYTC 4QKQA 4DDTA 3TQFA 2DWOA 2O0KA 5BYJA 3KJIA 1RKBA 1S8FA 1FQKA 2WZQA 1DVRA 1LTQA 3B5JA 3FHOA 1CRPA 4URZR 3ZLJA 4LYFA 1ZVQA 4OI0A 4IJMA 4D6PA 2C2HA 1OB5A 1TUEA 2W83A 5LD2B 3U60B 4GZLA 2WPDA 3EZ2A 3RS7A 5FI0B 4DCUA 1G7TA 4XVRA 5CM9C 3WMEA 4NCHA 5DN6D 2FE4A 1XNJA 4JLBA 1E1QD 3C4JA 3VKGA 2PL3A 2NIPA 2GJAA 3NDPA 4PZLA 2BJVA 4P4UA 3VTKA 2C96A 3FVQA 3B8HA 3M4YA 1T91A 4PHHA 2R6CA 2A9KA 3LBIA 2FV8A 2QY9A 4JLMA 4B71A 1ZC3A 4G5RA 1QHHB 4P4SB 1QF9A 2ORVA 2C95A 1U81A 3U7GA 3QF4B 5AR1A 3CLVA 1E79A 3ONWA 3OFND 3NBZC 3C14C 1S0UA 2XZPA 2GCOA 3SJCA 3QXCA 2VHTA 4RZ3A 1PLJA 4DXAA 1E2DA 1YRAA 3T1TA 1E2IA 3CWZA 1MO5A 3LLUA 1AGPA 1D2NA 1XTKA 3QE0A 2GF9A 2ZYVX 3BH0A 3LV8A 3WYAA 2KWIA 2EVWX 2ZI3A 1R7RA 4LK2A 4B47A 1G16A 1V5WA 3X2SA 4E07A 1FPMA 1XZQA 5ANRB 4A36A 2G6BA 3LW7A 4LJ9A 1TQ6A 1QZXA 3HYTA 4D80A 1L7VC 4PHFA 3K09C 3LVQE 4G5QA 3U3OA 5L3QA 1UAAA 2R44A 3ZZ0A 3V9PA 2QENA 3KTAB 1ODFA 1PUJA 2KSQA 3BRWD 4LHWA 4DLTA 3GJ0A 4M1WA 1CR1A 1T8UA 3I8SA 5EXPA 1CR2A 1OJLA 4JVMA 4GPTA 3VKHA 1AS2A 3CZPA 4Q01A 1SXJD 5DYIA 1GL9B 4Z8XA 1GWNA 2J45A 1H8HD 3UXMA 2KJQA 5M04A 3EARA 4PAOA 3NBXX 3IIJA 1WMSA 5HCIA 1W4BA 1U98A 2H8KA 4ZDKA 3OAAA 1YR6A 4HEJA 1NLFA 1AKYA 1F2TA 2OZEA 3CW2A 4ASUD 4TWZA 1P62B 1QG4A 4P3YA 4UQOA 1R10A 1MRNA 3MGCA 4W7SA 5LB2A 4Q1CA 2G1KA 2YNMA 4QBGB 3R9XA 3RS5A 5SZKB 5FI1B 3H1TA 3CONA 1ZUIA 5JJLA 1J90A 4AK9A 4B2PA 3EAQA 4KYIB 3AVWA 2YOFA 2FH5B 2WSSD 5KU1A 2C8VA 1OW3B 1NJFA 3ASZA 2DFTA 4BFSA 4B3CA 4D4LA 3GJ4A 4QG7A 3ZH9B 3ZYCA 3THOA 2PX0A 3WYFA 3VMFA 1GKUB 2PH1A 4Q1AA 4U7DA 5KHOC 1PUIA 3MLEA 4IVPA 4MDFA 2ZS7A 3VX4A 4NMMA 3SFZA 1IY1A 2QQEA 3WRYC 4OHWA 4M22A 3R7WA 4R2IA 3QI2A 3EIHA 1ZC4A 4MYCA 5GJWC 1ZU5A 4XWKA 1Z63A 2HF9A 2PMDA 4F4CA 1X86B 5G3ZA 2G9NA 2XITA 2ZJOA 2AHOA 1AGRA 3GJXC 3AF1A 4PANA 1KK1A 4KVGA 1XU4A 2IYZA 4M1MA 1EX7A 2AXNA 1BO6A 2O0JA 3AGPA 4OL0A 4QNMA 1Q21A 4LBZA 1GRQA 1ZCAA 3HP1A 3TSZA 1ZM9A 3TK1A 1Z2CA 2AK2A 3BXZA 1RRPA 1WBBA 1HT2E 5JWHA 5FUVA 4B44A 5IT5A 4M0LA 3TUZC 2UZIR 1D6JA 3GFTA 1G20E 3VHLB 2QSYA 4KO8A 3W6PA 4F7WA 5KO2A 3VR6A 3CIOA 1T5IA 4GRAA 3VKWA 3BFVA 3THWB 2CE7A 3K0CC 1NMZA 4Q7LA 1NVVR 2O5VA 2ZU0C 1AK2A 4MYTA 2Z43A 3U61B 3HR7A 4Y0VA 1G4AE 2A5GA 1KSFX 2D74A 4HAZA 2QEQA 3QF7A 1IJEA 1G7CA 3KXLA 5AK0A 2X8AA 3WP0A 2PLFA 2O8FB 3R20A 4C0JA 1DAKA 2AX4A 2WKQA 2Q9CA 5DE3A 1NKTA 2ZJYA 3B82A 5FBQB 2WWGA 1OIWA 1E2PA 1G3UA 2HDNB 721PA 4FIDA 2ZTSA 1KO4A 4W5JA 5FOXA 4KCGA 4R2HA 4M1SA 3LA6A 4N0DA 2GESA 1BS1A 3AF0A 3PFIA 2VP5A 1GSIA 4Q4HA 3MWJA 2FFBA 3FPAA 4V0ME 5B57C 5C4MA 2ATXA 1BOFA 4XOIA 5SZJA 3CPEA 3B60A 1CJKC 3D7MA 4Z51A 3LWNA 4M1YA 3VAAA 4B6EA 4ARZA 2EWWA 3M1IA 2B92A 1KO5A 5BW8A 2PZEA 1II0A 3OAAD 5IHPA 1Z07A 1XP8A 2XSZA 4DB4A 2VSOA 2EFHB 3VNVA 2D4HA 3RAPR 4NZYA 2NG1A 4OHVA 1Z6YA 3SU8A 1J2JA 4ACAA 4GFDA 5ELXA 3IKJA 4PZZA 2IUUA 4AKIA 4EQ6B 1T3HA 4L16A 4QGFA 1VKJA 4JL8A 2YOHA 1G41A 1X8JA 4LY6A 1E9DA 3T12A 1P72A 4C30A 3N2EA 4B73A 2IS2A 4JT4A 3SN6A 1NN3A 3P1JA 4W9MC 3RNLA 3HU1A 3OE7D 4M1KA 1TEXA 3KKMA 3WHKA 1R0ZA 4I1VA 1N6NA 2BEJA 1G3MA 3AUYA 4DLWA 2ORIA 2Z4RA 1U9IC 1W36B 2GXQA 4FI3C 2BBSA 2XNSA 2O8CA 5DI9A 1MABB 3ECCA 1U99A 5HTKA 3PVSA 5TARA 1M7GA 1HY3A 4D0LB 2V55B 3D31A 1VIAA 3FMIA 4BZQA 2IF0A 3BC1A 3KKNA 4DB2A 4QHSA 2RB4A 2ZYUX 3I61A 2IYYA 2Q3MA 1ZD9A 3GP8A 1ZUHA 5JSZA 3OIUA 1RFLA 1ZRHA 1AZSC 1F5NA 4OBEA 2YKGA 2XXAB 5JS8A 2FU5C 1NF3A 1S2MA 3SE0A 1GL6A 1N2CE 1RVDA 2NO9A 3CF6R 3BORA 1XTIA 1F2UB 2ZRMA 1XFAA 2W6IA 2Y8EA 3GLFB 4HLQB 5BWMA 1EFHA 4IVRA 2XTZA 4DZZA 1DOAA 4DHEA 5B64A 3ZVLA 1G18A 1Q44A 2WM9B 1W5TA 3IUYA 4XWAA 3PEYA 3K9HA 2BM0A 3F5FA 5DI3A 3LH5A 2GBLA 2OG2A 4XJXA 1FNMA 4P33A 1VYVA 5DSZA 1DEKA 1NVVQ 2DYKA 4BLSA 4AYWA 2ZRPA 4DT1B 4DLZA 3KKOA 4HDCA 3C5CA 1G6HA 3K09A 4LJYA 3K8YA 3NBYC 2NO7A 2XEXA 4E22A 2DHRA 4DLVA 2ZS9A 5FOWA 4I4LA 1QHGA 2HJVA 4MA4A 1A2KC 1D5CA 1DBSA 3MFYA 1E1RA 4RD1A 1XD2B 5G53C 2ZYWX 5EE5B 3PITA 3ADCA 1P7CA 2QP9X 1UM8A 3HWSA 3I92A 3ICEA 3VU9A 1Z5ZA 2WAXA 3K0SA 1IHUA 5J4YA 2PLRA 3AVYA 1KNXA 4KJZA 2ZROA 4GBMA 4ZDWA 2HJGA 5CYOA 4ZI3A 1MH1A 2RGEA 3NG1A 1DAGA 3V00A 2EU8A 4CF7A 1COWD 1OLOA 3IO3A 4YLGA 5HCNA 2C9OA 1S1MA 5EP2A 4DLXA 3NIBA 4KSCA 1XEWX 1E94E 3VR3A 4FWTA 3WY9A 2ZE5A 1OHHD 2XSZD 4X8MA 2QAGC 2VSXA 2WJYA 2G77B 1B23P 3GFPA 1SULA 1I2MA 1KY3A 3UK6A 3H84A 2ZRBA 3CRRA 4I81A 4IKEA 4JLJA 3ZQJA 1FX0A 1F3OA 4H1VA 2JIZD 1CS4C 2ZRFA 4Q00A 3DOFA 4LHXA 4B33A 2RAPA 3BD9A 3D3QA 1MO4A 3Q7PA 2A30A 1IN4A 2D06A 1G7SA 1X6VA 4L9SA 3DDCA 3HYRA 2VHJA 3ZD7A 4KFSA 2OXRA 3E2IA 5KNBA 2D3WA 1XCMA 3QEOA 2GAOA 1G8HA 3FYHA 1YR7A 1ZAKA 3D8BA 3EXAA 4I1UA 5CB6A 4NCIA 2BC9A 3UMRA 2ONJA 5GADl 4GP7A 2EFGA 4EPVA 1LB1B 3FHTA 4RZ2A 4V0OA 1OSNA 1BH2A 4ILEA 4AG6A 4HUTA 4V0MA 4FWIB 1N6OA 3QKRB 4BFVA 4AC9A 3DM9B 1J8MF 4EPWA 2QGZA 2GVZC 3QXXA 4Q19A 3B85A 2YWFA 5BQ5A 4B6FA 2ZIAA 4KBGA 4AKEA 3NXSA 1N0VC 2VF7A 3UMSA 1G17A 3QOFA 1G291 4ZCMA 1HH4A 1VIYA 4B48A 4L5BA 5J5CA 2KB0A 3A8TA 3UMFA 3K0CA 3LBNA 2J5XA 1UEIA 2J0SA 1IY0A 1JPNA 5E7IA 1ELOA 4KLZA 1IOZA 3SHFA 4JBYA 1CIPA 3TLXA 4PO9A 4DCVA 2YC2C 4IDPA 4MUBA 5CJ2A 3ZVRA 5JEEA 2QTVB 1A1VA 5H8WA 1BYUA 2XNDA 3AP1A 2NPFA 3ZDQA 1MV5A 2CLDX 4POAA 1J99A 2OLKA 4BLTA 1ANKA 2IYQA 3PEVA 4CEIA 1TPZA 1RRCA 5J40A 4NYMQ 2HCJB 1E98A 3QBVA 1H8EA 4BLOA 2ANBA 1EFTA 1TQ2A 2YWGA 1JEEA 2MMCA 3FMPB 4QNRA 4X8OA 3SJAA 4BECA 1YHNA 2VPPA 5FOVA 1E2KA 1XEWY 2ANCA 3CM0A 3BJIC 1G21E 1EXMA 1CKEA 1JBKA 1E6CA 1NMYA 3NEJA 1UFQA 4MKIA 4Q21A 3WHLA 3FB4A 3ZVNA 2WV9A 3C16C 1HTWA 1YZLA 4O25A 1SVIA 2DR3A 4IOKA 4TLBA 2G0NA 2CCGA 3REFA 2CJWA 2I1VB 2P5TB 4TSFA 4Y0AA 1G7RA 5F98A 1EWQA 2N42A 2DFNA 5LDDC 3THYB 1T8TA 1XRJA 4HATA 1OV4A 1XBTA 1MO6A 4B3BA 3PEWA 2IYSA 1XTRA 4HYYA 3PCRB 1VCOA 2VYFA 3BIFA 1U0LA 4V0KA 5FUYA 3TVDA 4URVR 1XXHB 2FG5A 3DMDA 4FW9A 2FNAA 1GKIA 3NH6A 2QUZA 4LBVA 4LJ6A 3K70C 1P9WA 2NZ8A 2W2TA 1KI9A 2RHDA 2K5UA 1KMQA 4HB3A 1JAIA 3GJ5A 4PZYA 4B32A 4E09A 3CBQA 2FSGA 2D7DA 1EX6A 1TMKA 1GRNA 2VL7A 3FKQA 2C99A 5C18A 3SR0A 2XTMA 3VR2A 1HV8A 3VR4A 2VLIA 2XGJA 2ZJBA 4R98A 4ZDIA 1ESNA 2VP6A 1E0JA 2ODWA 3K0EA 3P26A 1WB9A 4XIGS 1DAEA 1JB1A 3KKQA 1U9IA 5P21A 1KTVA 2EYUA 3IIMA 2IYRA 2V6JA 2FSIA 2F1IA 4BLRA 1P3JA 1SVSA 4PQFA 1WQ1R 4C9BA 2GEVA 4DSOA 1HEIA 5FH9A 1OB2A 4DLRA 1KDTA 2A78A 2QMEA 1RYHA 2JASA 4CT5A 4JLOA 4RFSA 1E0KA 1KO8A 4XTCS 1O87A 2R65A 4RD6A 2ZITA 2FZLA 4EJSC 1FP7A 3MJRA 4JVSB 2BWJA 2X2EA 2C9CA 4PO8A 2WWFA 1L4YA 1N6RA 1KMHB 2LCFA 5BN4A 3QPUA 2GXAA 3TH5A 1UBGA 2QE7A 4TQUS 2ZQ5A 2IHBA 4ON9A 3E5HA 2RH5A 4PX9A 4RSGA 4YXWD 4HI0E 2D7CA 1W4CA 2EFEB 3FFAA 2F1RA 2Q9AA 5FTLA 1DAMA 2XJ4A 2YWHA 4L15A 4UNPA 5FR2A 4CEHB 1NVUQ 4HDOB 1Q1BA 3TW8B 3SEAA 4A82A 1GTVA 1XTQA 2WKPA 5G3YA 3REGA 5D3MB 4RVCA 2QU8A 5DNYB 1CJVC 4FMDF 4QC2A 4X8HA 5G41A 1HE8B 2QI9C 1CXZA 4C7OB 3Q3JB 1TQ4A 2ZE8A 3THXB 1QHNA 1YR8A 2VF8A 1R0WA 3U6BA 2IYWA 1P2SA 3QXHA 3GLGE 2R2AA 1N25A 3IHLA 1UBEA 4GOXA 3FFBA 4LJ7A 4BEBA 1N5LA 2CVHA 3ZIAD 2OM2A 1OYYA 1Z0JA 3Q72A 1W46A 4Q9KA 3RS0A 4HAUA 3TSWA 1QHSA 3FOZA 3P4XA 3PUWA 1Z8FA 1H8ED 3MWYW 5FUXA 1FW6A 4BZXA 2WJIA 3F3YA 5FL7D 1PVOA 1KJYA 1KGDA 1US8B 4QHTA 4GNKA 4JLKA 1OE0A 1F48A 4Q1FA 4M8NE 3Q7QA 1N6PA 4Q4LA 1R8QA 1GRRA 3VHXA 1KI7A 2H17A 3MJHA 1OFUX 1XMJA 1NI3A 3BAFA 2BKUA 2HT6A 3T1VA 1OF1A 4ZV4A 4I99A 1DAFA 3UIEA 2IEYA 4XSGA 3TIFA 4OYHA 2V8OA 4TTPA 3W9YA 1UKYA 5C1BA 3GLIE 4TMTA 1GG2A 1YRBA 5K8IA 1P2VA 1F6BA 1YQTA 3B7GA 4AY2A 1XF9A 1I4TD 4F38A 4IDNA 4Q9HA 2IUSA 3EPKA 4II7A 3JZAA 3PEUA 2RGAA 1EFRA 2HYDA 2QAGA 4RCYA 2WJJA 1S9DA 1ZW6A 5JCZA 3AF3A 2JDID 2O8EB 3AM1A 1KK2A 1Z3IX 3L2OB 4NHOA 2KE5A 1OIVA 4JLAA 3K0AB 3GFOA 2P65A 4MGZR 1HQCA 3ZVMA 2Q6TA 2WIAA 4PSAA 4AYXA 4KV9A 5SZHB 2AKAB 1LV7A 5IDVA 4TYYA 1JEDA 2VQSA 1KYIA 1HUQA 2REXB 4Q9IA 4QRHA 4B3GA 4JJZA 3LBHA 2CLCX 2GK7A 4EPYA 4XSHA 4G5OA 1IM2A 1FOEB 1MRSA 1NG9A 1RRFA 1KDPA 1G4UR 1KY2A 4R7ZA 1GVNB 3KB1A 5DLQC 2ZI5A 3W8NA 1ONBA 1X1RA 2AD1A 2B21A 1CBUA 3K9GA 4B2LA 1JPJA 2NO6A 3CNOA 3LFUA 4DIEA 1KIMA 2PEZA 4MRRA 3Q9LA 3U6KA 1II8B 3I5YA 3M6AA 1QHYA 1EK0A 2FOLA 4NCNA 2NGRA 4DCNA 2R6DA 4LV6A 5FR1A 3K9LA 3L8YA 5CB8A 2BDTA 1JXOA 3I8XA 3K0FA 5FPHA 3WXMA 1I4LD 4CW7A 2GBLC 3QQ5A 2Z6VA 3T61A 3WMGA 3U7HB 1RC8A 2CCJA 2YWEA 1J7KA 3T34A 5AUQA 1T3LA 2KI5A 4DC9A 5KDDA 3M0EA 2AFHE 3GJ3A 4A2WA 2FFHA 1BMFA 4QOSA 1W0KA 4YONB 4NE2A 5LB4A 1T4GA 5L3VA 5JFGA 3FGNA 4BFUA 2PEYA 3IILA 3SFVA 4MGKR 2XX3A 3A4LA 1FTNA 2OV2A 2PT7A 4S35A 4XVUA 3K1JA 3FHCB 1QVRA 1JECA 4GL2A 3FMOB 4RD2A 5EQTA 1U0HC 4DCSA 2PJZA 3B1WA 5AJYA 1CR0A 4QGAA 1SKYB 4B76A 3EIEA 3RSOA 3SS8A 621PA 1KDRA 3CH4B 3AQ4A 4ERNA 2ZR9A 4D4KA 4Z54A 2YOGA 4LJAA 1E2QA 1J8YF 2PT5A 2ZREA 2JGNA 3LDAA 2P2LA 5FPYA 1CP2A 2WJGA 1ZD8A 3ZS9A 4NYJR 5UKDA 4R71A 3KKPA 3V4FA 1GDDA 2WWHA 1X8KA 4S2EA 5L3SA 1E4VA 1YR9A 1NNEA 4LRWA 4CGZA 2QL6A 1KK0A 3GLHB 2J9RA 3GD7A 2FZ4A 3QBTA 4V0NA 5KSOA 4OQNA 1BYIA 2YYZA 2P67A 1IN8A 2J0UB 521PA 1Z2AA 3B1VA 1XTJA 4G3XA 5H1YA 1JQLB 3AB3A 3MMPA 3N5CA 3IBGA 1EFRD 1G8FA 3LVRE 4O2RA 2ZRNA 4ABYA 1KI3A 1CULC 1UADA 2E87A 2HUPA 1G9XA 1TUIA 3FWYA 3U3KA 2WVJA 4JYBA 3TMKA 2OCBA 5A4JA 2YVUA 1E99A 3GLGA 2W2VA 1TF7A 1UBFA 1R6BX 2WPDD 2QGNA 2MSDB 3QKSA 4HLUC 1N3BA 4G1UC 5GJVC 5K8LA 1JAHA 3CX6A 4BFZA 1AQUA 5C46F 5FOSA 2C77A 1AQYA 1YKSA 2FGKA 4NCKA 3L0IB 4A2PA 1GNQA 2Q3FA 3CF2A 1X8LA 3NDBB 2DWQA 4URUR 2ZVQX 4D0GA 1CTQA 5LD2C 4PPQA 1IXZA 4B3XA 3AVQA 4EJSA 2WMOB 4UNSA 1DELA 3EA0A 1OIXA 4M2LA 2WWXA 4A8JB 3L0SA 1VYTA 1LS6A 1WCV1 3GPLA 2WWYA 2OBMA 3QUSA 5CIQA 1E79D 1EWRA 3CB4A 2DCUA 1TU3A 4PHTA 4KITB 4GDFA 3GLIA 2QT1A 1W4AA 3LD9A 3OIWA 2QMUA 3LAWA 2O0HA 1SXJB 4C0BA 2X1VA 3EZ9A 2BIFA 2G3YA 4G0NA 1G5RA 1R2QA 4OK3A 3W5IA 3QXSA 3SYNA 2Z83A 4YMTA 4PC3A 1UF9A 4AIIA 5F9HA 1VHTA 2CL6X 4PPNA 3BH7A 1OXSC 1DG1G 2FPLA 4JSTA 1XJ0A 1ZD1A 2GJKA 1EGAA 2CNWA 4C0KA 5K8TA 4IDQA 3CPHA 2J1LA 1S4QA 1FMLA 3PG5A 3U2QA 1W0KD 3T5GA 4CIDA 4OJKA 3RS3A 4RD3A 5TB5A 3EWSA 3X1XA 1WRBA 1M7BA 1SQ5A 5HKKA 2O8BA 1R4AA 3S1AB 1IQPA 1T3SA 2CLSA 2HXSA 4LX0A 1DO2A 4UXJA 2O8DA 2ATVA 4F91B 3AVVA 1II9A 4B3FX 4QGGA 1S96A 2C04A 2OSBA 3MD0A 2F43A 4N3NA 1ZP6A 4MQBA 4A0FA 5EUMA 3U5ZB 4IDHA 1E0AA 2FX3A 2OESA 2GJ8A 4RFVA 1Z22A 4QBFA 3BWDD 1M2OB 3TNFA 3A58B 1NL3A 1PV4A 4TZ6A 1E9FA 4LBYA 2BMDA 2A2ZA 1GITA 5C4GB 4MKFA 5KSYA 4F4IA 2JATA 2DPXA 5FOTA 1CLUA 2AXPA 1Z6TA 1TEVA 2IYUA 2PZFA 4PHGA 4GOKA 4YDHB 1XEXA 2QRNA 2ZRDA 1QRAA 1VYUA 3SQWA 3BGWA 3W3ZB 1JJVA 3BERA 4PPFA 1P61B 1DTSA 3VNUA 5AJWA 1FTSA 2BCJQ 4NYJQ 4B2IA 2R9VA 1Q12A 5JWRA 4QJ3A 4L8GA 3QKTA 4OI1A 3UPUA 3K70D 4BUJA 5E3HA 1E4YA 3JZMA 2CDNA 3MAAC 4RZUA 1ZJ6A 4FCTA 2RGXA 1YZKA 2PX3A 1OFHA 2HT1A 4WZ6A 4OHYA 3QG1A 3BFXA 5JWOA 4Q4JA 4IDOA 2GA8A 4TMVA 2ZRLA 1Q1EA 4BE7B 2IYXA 2ZJ2A 4Z1MA 3P4YA 4HAXA 4B43A 4CEJA 3QNUA 3LO5A 1M6NA 3Q5DA 3QVVA 2NZJA 4EAQA 2DY1A 4EUNA 1LW7A 4I1SA 5E7JA 3W5JA 3AEZA 1XZPA 4WAUA 2QBYA 4RKEA 3CX7A 2GCOB 2BOVA 3CNLA 4LHZA 2GZDA 2GK6A 3PQCA 3OIVA 4Q48A 2CK3A 4AYTA 5JRJA 4NL4H 3UATA 4FCVA 4M9ZA 1JR6A 4EDHA 3RS2A 1GILA 4BFWA 2FPMA 1G3IA 3BOSA 5F9FA 1LF0A 1AJEA 2D2FA 1SHZA 4XD7A 4NYMR 1T9HA 1U8YA 5L3QB 2Q21A 2ERYA 3TGPA 5KYKA 1KI6A 3DO6A 2ZAOA 3G82C 5JI2E 2ZUBA 3CWQA 2ZSFA 3QJYA 2VHQA 2IWRA 3NVAA 4PAQA 3EC1A 2EW1A 3GEEA 5J4VA 3EX7C 1RW4A 4TL9A 3A6PC 3DPUA 4DVGA 4QJ4A 4QBHA 4Q4AA 3U4QA 1E2FA 1W7AA 2QSZA 1ESMA 3EASA 5AUOB 3V4RA 1SZPA 4HUQA 4AKHA 2OCPA 3KFVA 4URWR 1O3YA 4P4TA 2CE2X 3OEHA 2ZANA 1PJRA 2AK3A 4OHXA 3X1DA 1D2MA 1XPUA 3SOPA 2Z0MA 1M1YE 4URXR 1BIFA 1F2TB 2IBMA 5HR5A 2OCYC 3QPVA 1GIAA 5KPDA 4LHVA 2WMNB 3KX2A 1XEFA 2QA5A 4WZBE 2LKCA 5JBQA 2ZRGA 3U44A 2EFCB 1CJMA 4MH0R 4YDSA 2CCKA 2ZRHA 5HKKD 3B2EA 3B1XA 4HAYA 4RCZA 3UWOA 1I4DD 2JJ8A 2RMKA 3CRVA 2ZRKA 3A1SA 4KFRA 1VPLA 2D62A 1K5DA 5F2EA 3TW4A 1A2BA 4JS0A 3U3MA 3RWOA 5K8UA 2F55A 2B8WA 2Q0HA 4XH9B 4JJKA 2HCBA 2WWWA 3CPJB 2F9LA 2VP9A 5SZIA 3SHWA 3T35A 2VO1A 4MYUA 1M8PA 1Z0AA 3R7WB 1RYFA
chains in the Genus database with same CATH superfamily
1V2GA 1M45A 1XMPA 3ON5A 4K9MA 4ENQA 3CCFA 1JMYA 2C2GA 4B35A 2OAQ1 5FTJA 1Z4OA 5F1PA 3C41J 3WLJA 3L0OA 3GVCA 1X7XB 1DV1A 4GR9A 4J29A 4RMJA 3OJCA 1LS1A 1B4CA 3WX0A 5HM6A 4RX1A 1RLTA 4HR7A 2G1PA 4LXGA 3NBKA 2YC4C 3GDWA 4F2WA 4XZ3A 5EEHA 1E9AA 4O3FA 2FPKA 3D3JA 2XCSB 3Q0IA 5FI6A 4FYWA 1YJ5A 3MA0A 5CM8B 2YWJA 3BK2A 2QK4A 5LMNB 2JH9A 2WJHA 1ENZA 2XGGA 4Q9NA 5FCDA 1U5AA 5E4FA 2W6JA 2J48A 4H4EA 3PE3A 2XTNA 4C03A 3LZDA 5JJBA 3E3NA 1NC1A 3K6JA 3ZUGA 4BB6A 1P5RA 1G38A 5FBKA 3BIWA 3WHIA 1T6NA 3DF0B 3ORRA 1BG1A 1Q19A 3SVLA 2X42A 2D2IA 4AF6A 3P97A 4L6CA 1KAHA 2O8CB 4MGEA 2V9PA 1GNPA 1XTSA 2RH8A 1U7XA 3H75A 4Z4CA 2GARA 4TRNA 3GJ6A 3KPJA 4OJMX 4ENWA 3I5FB 1E3MA 3I83A 3TVTA 1PR5A 1CQJB 4R1EA 5KYNA 1XFWO 2FFQA 2ZAMA 4KO2S 3AQIA 1FRZA 1QRUA 4ZT2A 1NSTA 5AHRA 4FFRA 4LXXA 5JU6A 5IAEA 3RTCA 4MWBA 3GLUA 1U11A 4MW5A 4EI9A 1RZRA 3PQ6A 4BQEA 4BY5A 3PRKE 1Y7IA 4MJ7A 3UT5B 5LBIA 3I1FA 4KR9A 3PUXA 2EW2A 1OXXK 3LQFA 2O2IA 4M21A 1B8OA 1WBJB 4I7EA 3RS8A 3PNMA 3I1JA 1NOJA 1GPWB 3PJIA 1YIOA 4WE3A 4PC2A 2WCJA 4UUNA 1NKSA 2ZZMA 5JAPA 3NBMA 1JU3A 4NJEA 1GG5A 3QNMA 3NM6B 4I66A 4RYDA 3E9RA 4KODA 4WRRA 1JQJC 3OF5A 2XUAA 3G5UA 2PDAA 4MB0A 1U8AA 3IDAA 1PE0A 1ZGHA 1C07A 1A4UA 1A8SA 4C0AC 4BQSA 2VAXA 4KE8A 3DTVB 2E5FA 5HKOA 2CV2A 4DRWA 4OF4A 5CDFE 2ZQYA 1AKWA 1FYFA 1J7JA 1GU7A 4MV6A 2J30A 4OH7A 4L2IA 3MUOA 4BASA 1I7PA 3I05A 4G01B 3LK7A 4A27A 1O9BA 1H0SA 4KXFB 5H4GA 3EUEA 1SJ9A 2DTDA 3R5KA 3AIMA 3CO5A 1SVNA 3FPLA 4WBNA 5AIBA 3I5GB 2VHXA 1TM4E 3K1ZA 4GUAA 5F7ZA 3AP2A 5HG0A 3QYFA 4RF3A 5DHAA 2ECKA 2BGWA 4L6IA 4PSKA 3V6LA 2AZTA 1CQPA 2VJYA 4JV5B 4CR6A 1SH7A 2EIXA 5L6LB 2EWVA 4DDWA 4Q3EA 4W1RA 2VF5X 3JVUA 4RHEA 3U49A 3DF9A 2Q29A 4REQA 4N54A 5A05A 4B7CA 4BVBA 5C53B 2C97A 3HR8A 5CW1A 3PUJA 3RYIA 4DY4A 1BJRE 2GTHA 5EXDA 1N2JA 3JZIA 2PBRA 3OMLA 4LFAB 3KQUA 1Y7LA 1PJ2A 3KBOA 3UUGA 2UUAB 2EKZA 1QTIA 2DHQA 3ZC3A 4CM7A 4DWWA 2M7LA 2ZXFA 3OM8A 3CU5A 3G0HA 3L05A 1FFSA 2JLXA 2M6SA 3PKIA 5F2KA 4DLKA 3TDNA 4RPIA 2BHNA 1AQ6A 1HDZA 1N0UA 4LY9A 1FBVA 3NFYA 4TMKA 1Q11A 1GGHA 2HF7A 5L6MB 4FR0A 2QTVA 1FJHA 4FLEA 3WV5A 2I6QA 1WB5A 3LCPC 1JJIA 5FT9A 4AU1A 5BRAA 1TF5A 3ACBA 2FQYA 1QBKC 2A3NA 2ZZKA 4RJKA 3ZGLA 2BTEA 1CY7A 2DBYA 3OU6A 4YJGB 1Z5VA 1B8VA 4LXQA 4ENVA 1LLCA 3RU7A 3IQHX 2UUPA 3M4NA 1E7WA 3BJEA 2JAUA 3R7AA 1R64A 3WJ2A 3U4CA 3ZYZA 1F4VA 4ZVNA 2VQEB 1Y4UA 4DQXA 4A3SA 1SB9A 5JAQA 4IV0A 2XT9A 3SX0A 2QU7A 4JI7B 3QKWA 2W9XA 3FMVA 4R5HA 4I5IA 3KJGA 3GCGA 2V4ZA 5J4HA 3B7AA 3CG4A 1ZIOA 3EZ7A 4RK7A 3RF6A 5G4LA 3O8CA 1B41A 3R7BA 5A5DA 3W8DA 3T7DA 1GP2A 4Q1BA 4TMXA 4E3WA 1HE5A 1W96A 4L4XA 1ORRA 4PLWA 5U9CA 4X63A 4DABA 1C7WA 4R01A 5L3SB 1HG1A 4FVTA 5CITA 2GN2A 4N47A 4UU1A 3KJEA 1L7DA 4LNUB 4NBUA 3GFBA 1PKEA 1DKRA 1U3VA 2HQRA 2HLDA 1B8NA 2B20A 3T7IA 2WFZA 3GLGB 1UZAA 1GNVA 3UMYA 2KBEA 3O31A 2FPIB 3Q5GA 1GZHB 1XCJA 2XB9A 3K92A 1CY0A 3GEMA 2F00A 5EQDA 5DVZA 2H2KA 2GLTA 3EDQA 1W44A 3CSSA 4O4IA 6ADHA 1LGYA 1XK7A 3UEOA 4O4JB 2BJHA 3UXYA 4LHYA 3CSDA 4F46A 4DSZA 3RDPA 4DM3A 3AHDA 1AGNA 3QW2A 8OHMA 4WOKA 3O78A 1WXHA 5T8KC 1R6VA 1KAGA 2ZXUA 1K6JA 4ZCLA 3F7OA 2G9QA 3DEYX 4QUEA 3CH6A 3HXLA 4GGFA 3A1VA 1XA5A 3IMEA 3A3OA 1OQPA 3N5KA 3WV4A 4BX9A 2BGNA 4B4UA 6GPBA 1IJKA 2XKBA 4JBIA 2DKFA 3C4VA 2FP4B 3M5WA 5ARDA 2C03A 5JSQA 3CVWA 5AKXA 4HNVA 5D3KA 4B34A 3KAQA 5B30A 4R6WA 1DXOA 1VPVA 1ZBQA 3OZDA 4HB2A 1BE6A 3AKDA 1V26A 2JIBA 1MIHA 3QIAA 4WEOA 5EP3A 2X9GA 2K87A 5KAMA 1CUAA 4KR0A 3A1NA 3BSYA 5TMEA 4DE5A 2V0GA 2C3PA 3T5MA 3OCVA 2AL7A 5TDHA 1O97D 2E2WA 4GPIB 1WW2A 4QUHA 1QORA 5AM4A 4US2R 3K9FC 1WPXA 4PO3X 3QWBA 3LIIA 2KM1A 1CUBA 4LDZA 4INJA 1MXFA 4I14A 2A9QA 1WHTA 5JNLA 2NU9A 1L4EA 5CT8A 1OREA 3PIRA 2LE0A 2VRNA 1LK5A 3PXGA 2VZLA 2MIIA 1QOPB 2ZPUA 4KXUA 2EL9A 4JH0A 3O47A 3NT2A 2B61A 5AJZA 1WZEA 2O9JA 5J3XA 4M9XA 4YMVA 4DDUA 5CVJA 5BSHA 1Z8HA 4ZO8A 1BQ4A 4Z86A 2CHGA 1T2CA 4E88A 2BFWA 1AZTA 1LXFC 3ZDFA 3UAOA 4AN0A 4U0JA 4DLAA 1W85B 3JQQA 3OHPA 3L49A 2JULA 4C5CA 2VAMA 4C0WA 4CIYA 3EZ2A 2ZYIA 2R60A 2ZVJA 1FNBA 2BJVA 3NIDB 2I4MA 5JSKA 2P9EA 3TFQA 2C57A 3V4LA 3QYAA 4MS4B 5GP1A 1RZUA 1K0FA 5B4UA 1JW9B 1DF0B 4EA6A 1R4NB 4HXEB 5IKXA 1IBSA 5LXTB 1L7VC 4OUDA 3O3NB 4KXYA 4IS3A 3VKHA 5BSEA 4JBNA 2X2PA 1GR1A 2BFDB 4K6CA 5F33A 1TPYA 3Q3HA 2XTJA 2CXTA 3FWPA 1FUYB 2B9EA 3A2LA 4GBJA 3MGCA 1SUBA 3IOMA 5KKAA 2BUCA 4ES6A 2GM9A 4UAJA 4DJDC 4TN5A 2PZBA 2WC8A 2BL0C 4YALA 3CX4A 3ZYCA 2PH1A 1PJBA 3PVZA 2RJ3A 4ZXPA 1S01A 1LD3A 3RSCA 1IY1A 3WA7A 4KC0A 4M1EA 2H85A 4XWKA 1Z63A 1F5SA 5IARA 3B88A 3AEXA 5BP7A 3D9QX 4EA7A 4NC9A 4EVIA 1CYDA 1X8XA 3M1YA 2EG5A 4QOHA 3HP1A 1N2HA 1ZM9A 5CFMA 5FUVA 3GA0A 4CHTA 3EEBA 2OV8A 2H0RA 2EP7A 2B36A 3ND6A 4GRAA 4GICA 1XL0A 4OR9B 1CETA 3SG3A 1FLAA 3HJCA 1KSFX 3UH0A 4C0JA 4PG7A 3B51X 4D8TA 4I50F 3DEAA 1E2PA 1G3UA 3AX6A 3E53A 5K0GA 1KO4A 3I9V6 4W5JA 1IFXA 2BZGA 4YJ2B 1YX8A 3TJMA 2ECFA 1BS1A 1S8NA 1SBZA 3AF0A 3IB3A 6CHYA 4D9GA 1W8IA 4ZT6A 3D7MA 1YS6A 5GGXA 4IHKA 3M1IA 1SK9A 1DEAA 2CZQA 3AFIA 4NU5A 4HWGA 2QRVA 4BXOA 1YB2A 2BFPA 4MDFA 3SN6A 3WQQA 4M0CA 2B83A 2LHIA 1LQ2A 4MR8A 3LSYA 1U9IC 3CTMA 5DI9A 1MZPA 4KWIA 1X0VA 2M1KB 2JNWA 2HJSA 4G0UA 1A2QA 4Q9AA 5I9SA 1A5AB 3N87A 2VPZA 4QUBA 3CF6R 3NAZA 3AZOA 1OGYA 2XTZA 4JJEA 4NPCA 3NXKA 4DR4B 1LLQA 3H6KA 2WM9B 4MINA 5BN3B 3RUDA 3IP1A 1Y6FA 2P2NA 4RTQA 1CRZA 2O5GA 1K0UA 2EZ9A 3H42B 2BDUA 3OPMA 3RC1A 4N03A 2ZS9A 3HA2A 1N5OX 1O9GA 3HWSA 3HM9A 3V5NA 3ZWXA 3E0QA 1KNXA 4R2JA 3B36A 3T5PA 3I12A 3B52X 1QWVA 5HCNA 2NTNA 2B1RA 2B1JA 1LRJA 5I8WA 4IIJA 3KZMA 3LHKA 2WIJA 4G26A 5K3FA 1I2MA 4BO0A 4LHXA 2PZLA 2RAPA 4N5NA 1F71A 3WKAA 3FBGA 4L9SA 4J4BA 1EFVB 5GV8A 3I53A 1P2FA 1MC8A 3CUUA 1DG9A 4XPZA 4AG6A 1BH2A 3RHSA 1NCZA 2K2QB 3CTNA 5CCDA 3B85A 4CFQA 1IMOA 4CTKA 3K0CA 3O91A 1OOEA 1KC3A 5E7IA 1TZ2A 3F6EX 1OZHA 3ZCSA 3LPCA 1IAVA 5GZ6A 3L06A 2BFMA 4BECA 3JD4A 3DP9A 1YF3A 3UB3A 3C16C 1Y5MA 2H61A 2V4UA 4ILKA 4Q05A 5TVGA 3R6TA 5JMPA 5SY6A 5ESRA 2DVMA 4YI3A 4B3RB 2QSUA 3HCDA 2GN6A 4KN5A 1K97A 1XELA 4I2NA 4LBVA 3EEYA 1GU1A 2O1EA 3RSHA 3GGCA 2QR3A 3P9XA 1VIMA 3SR0A 3NKFA 5D2CA 5DX8A 2C5BA 1ZACA 1OBOA 4H2DA 5CX1B 2FSIA 3MGGA 4RVDA 1TZCA 1WQ1R 3I2KA 4C9BA 4ZYVA 2CUNA 3DAHA 4MUIA 2NVWA 4F1KA 2D4AA 3AJRA 5AXAA 4PYOA 2CBLA 4RHCA 1W4CA 3WZ2A 2F1RA 1DAMA 2BMWA 1NQWA 2VAWA 1Q1BA 3TW8B 3RTDA 5JV5A 4RVCA 1QPGA 5DNYB 2VF8A 4NBNA 4HDKA 3R8XA 4BNGA 1VSQA 3FOZA 4FKZA 1TA9A 1XF1A 1XRPA 5CXXA 1CS0A 2XXJA 1PFVA 3DXZA 3EH2A 1ZDMA 2QWXA 3EMVA 4QU8A 5EHZA 4ZALA 4D9FA 3K9QO 3IAUA 2VK8A 2CMGA 4HDRA 3M6WA 3GLIE 4G1EB 2I6SA 1QVZA 4WDQA 3B7GA 3I0ZA 4Y2QA 2N1MA 1EFRA 2DPMA 2YV3A 1S9DA 4YBZA 2WNDA 4FDMA 5BN5B 2AKAB 4TYYA 2JTTA 4B3GA 3LBHA 4XAQA 4L76A 2EJWA 4J1QA 2ZI5A 2ZAYA 4FDTA 2GSDA 5BUCA 4GVXA 2B21A 2WU3A 4LQ4A 3CNOA 3BQNB 4UTNA 5PALA 1Q50A 3VV3A 3N2ZB 2IZ7A 4QQKA 3VDQA 3WMGA 2CCJA 4IZHA 4WSOA 5IC4A 5AUQA 4AQJA 2NXNA 4KWCA 4W9RA 3OPYA 3CCCA 3KHTA 5JFGA 4IKOA 3MOGA 1RWQA 2IEDA 3FF4A 3CTPA 2AMIA 2OOKA 4CIAA 1SKYB 1CY4A 3P2KA 1J8YF 1P2DA 1U04A 2LVVA 3ONFA 3P0RA 5AKHA 3IF7A 2ISCA 5AKLA 2RGUA 4LTDA 1DEXA 3IALA 4TUYB 3IP7A 3C3XA 3ELYA 2X7HA 4UTOA 1NXWA 3RFFA 1QVIY 5A4JA 3QKSA 2OBYA 1YUMA 5K8LA 5AVZA 2G7MC 4DCGA 2PRKA 4NCKA 1KAEA 4J16A 1OXBB 4B3XA 3ITDA 2XE6A 4MYDA 4Q3OA 1N7GA 4MZJA 1TU3A 4OU5A 3B1FA 4YACA 1ML4A 5I4BA 2LHLA 4FOPA 1E61A 3LBYA 3I9JA 2FPLA 1NBWB 4QA9A 1EGAA 3NMUF 1IC6A 2J1LA 5AVXA 4RZQA 4QGBA 4BGVA 2I55A 2BEUA 1SQ5A 4M9CA 2WFAA 1IQPA 5CPBA 3SG7A 2LBPA 4DQLA 4F91B 5JOLA 1Z7YA 2OSBA 4MQFA 1D4OA 3SK0A 2VJKA 3BWDD 1PV4A 4QDUA 4EEKA 2AXPA 2ET6A 2IYUA 5M7EA 5J3JA 1DBWA 5DJ5A 1IZ7A 1I0IA 1JJVA 3DB2A 4LYYA 4XARA 1LI5A 2BCJQ 4NS4A 3HG7A 4QJ3A 4S1TA 3K70D 1JXAA 3EOBI 3BIJA 1AV6A 2DT5A 2ZUUA 1PR3A 2R8BA 1SL9A 4B43A 4CEJA 2GFIA 2PX8A 4EB6B 2LUOA 4WADA 1LLUA 5T4HA 2K60A 3UV6A 4UBJA 4B09A 1WDCC 1T2VA 3LUAA 3FZGA 3UATA 2ID7A 1MTOA 2IDMA 5CGQB 2GRAA 4MROA 1A69A 4IGIA 2FR0A 2ZN8A 4GUDA 3VPGA 2EW1A 5LQAA 4H59A 1UZLA 2F48A 2VJQA 3DOCA 2V7WA 5LQRA 4XIYA 5IMBA 1YI0A 3KFVA 3DB1A 4HGZA 3OTOB 5K3SA 2G4LA 2NZVG 5HVNA 4L5JA 5DHRA 4BV2A 2CCKA 3DBLB 3AFMA 3FFXA 1NX9A 3D02A 1Y7HA 2JAWA 2Q0HA 1JAYA 4JJKA 4K6GA 1WULS 4AZ0A 4XPIB 1BS2A 4GO1A 3UUEA 2HSWA 4KWHA 3GGDA 4U2GA 1SXQA 2D0IA 3KJZA 3IR5A 3DKPA 2HK6A 2BELA 4X1OA 3ZWVA 1Z4HA 2FRDA 3TUIC 4B4KA 4HLUA 4AFNA 5KNCH 4PU0A 1T5SA 1EIWA 5FHQA 1EWTA 2QD4A 4YLYA 4Y2XA 3AWDA 2ZTVA 2XCLA 3RC8A 4U5QA 1XRNA 2NU7A 2OO7A 5AW4A 3LDFA 1GAJA 2OYCA 1OI7A 3NO4A 2Z56A 4MW2A 1TYBE 4W1PA 3W6NA 1TWOA 1WETA 1PZNA 1CP3A 3ZHVA 3O2NA 3WI7A 3ILXA 2Y0DA 2YYAA 5B58C 1XQYA 3EIFA 1SC6A 5K0NA 3P9CA 3GZNB 1CDMA 1I7LA 5K09A 4J4TA 1SBNE 4K9RA 3TDKA 4NMHA 4X90A 4JENA 4II2A 4GDMA 3R3UA 2QDKA 2LWIA 1QKJA 4UUOA 2XQFA 3WKBA 2UZ0A 4L9WA 3ACDA 1C9KA 2FTKE 4HXYA 1UFVA 5FLKA 1W19A 2CWDA 4M0EA 4KQCA 1UJBA 4DR6B 2E9SA 5KNDA 2ZP1A 2V7GA 2QVZX 5LLDA 4CFRA 3TBKA 4RLQA 1EJ2A 5DYGA 1EP1B 1KXJA 2WI8A 3BA6A 1UOPA 2W6PA 2VQFB 2ZDGA 4FMBB 2PQ2A 3KUDA 1I5EA 4GLOA 1E8DA 4NU0A 3IHKA 4AF7A 2QMQA 3UMGA 2NXWA 5F77A 2WRZA 3EFHA 1Q1NA 4QLOA 2JZIA 1M2HA 1WZ2A 3FTFA 3GCWA 4ETNA 3W5BA 4Q4DA 4XFKA 4JIGA 5IK2A 2X3FA 3DE6X 1L7AA 2AAOA 1WRLA 1FTQA 1RYYA 1I7SB 3DXFA 1KKMA 3RREA 4QTUB 2BL0B 4BB0A 5F4BA 3G6KA 4W5NA 2GM4A 2BMEA 4B4VA 4C4PA 4YR7A 5CB4F 4CM4A 4WPGA 1Y8RB 4G1BA 1D09A 5J47A 3T38A 1UJ2A 1I33A 2C20A 3OTIA 3D1LA 4MV0A 3WSVA 3AW8A 5I7UA 1IB0A 1QTXA 1XVTA 1ZUZA 4Z3OA 3N7UA 1YVUA 1HLFA 1KOFA 1SCAA 2ODTX 4K9KA 2QR2A 1JQEA 2BBMA 4I4CA 3VH2A 4POOA 2HXYA 3BB3A 3EBLA 1DGQA 5GVRA 5B5SA 2H31A 4EO7A 3DBHA 5FHRA 5BSVA 1I13A 2I3GA 1FEZA 1K4MA 2I6GA 3AVOA 1APBA 2IXTA 1Z0FA 1D7AA 3VZSA 4EF5A 1AMUA 1U1IA 1UQRA 5JFTA 4ZREA 4GZ3A 5EHXA 1UFKA 4BFYA 3GI1A 3NUQA 1WM1A 2WSLA 4J1TA 3FH0A 3G68A 5HOEA 3ICOA 1KO7A 4CG0A 3O03A 1DIAA 1UHIA 1S6JA 3L8DA 3MIZA 5G4KA 3WB1A 3D64A 2OBLA 4PO1A 4RVNA 4AULA 4X92A 3R8FA 5A6SA 2DHDA 3GRPA 3IESA 4DQDA 2C2ZA 5E95A 5F3DA 1H0KA 1K8RA 2IYNA 2YJ5A 1MHTA 4FHCA 1OTYA 1Q1QA 1FXUA 2HNBA 5U1PA 2WJWA 1LI7A 1X1QA 1WJGA 4MPRA 2QEOA 4UBIA 2VDMB 3IXLA 5G02A 5HIJA 5FV4A 4WCVA 3T15A 3KQKA 4BKMA 1ORTA 2X86A 4LVOA 2AOTA 1A3CA 3MT7A 2OTCA 2QRGA 4FR5A 7GPBA 3ESCA 3AVTA 2CL7X 3H2YA 3HLKA 4IH4A 4DGQA 3HA5A 2HREA 1FSGA 4F4FA 5EJIA 2FEAA 2V7QA 4LSZA 1C3OA 1R66A 1ZI9A 3KU4A 1N2GA 1PJSA 5KSPA 2H48A 1ODIA 4OMFG 2V0CA 3OU2A 2CN1A 4FT4A 3LDUA 3W8RA 2OHVA 4P3XA 4MYSA 1W94A 4U00A 3FGOA 2XCTB 1IJBA 1P4HA 1UUSA 1RP1A 1KFKB 2ZT6A 3BCUA 3THYA 3QV2A 1B0ZA 5JNVA 1XLTC 3DG9A 1XXHA 4U4AA 4UCXA 2JCVA 4YPOA 4RANA 2ZWAA 3GB9A 5BVGA 3EVGA 4KNYA 4ZDJA 1PX2A 5BV1A 1BX3A 2OECA 4KE9A 2ZWMA 4C88A 2JCYA 2CXNA 3BM5A 1KZ4A 2IH2A 3T9EA 1P60A 1V71A 1VCIA 3SPXA 3WGVA 3ELDA 4RTJA 3UJAA 2WJPA 4QLBA 3G2LA 2WY2D 2CNWD 3LBFA 2R00A 2QTWB 3I52A 4EFMA 3SC3A 2HA3A 3LIPA 1Z13A 3ZY3A 4OQQA 4EHBA 4WVFA 1RPTA 1RMQA 1BU8A 1CF9A 1QWOA 2IVFA 4IINA 1JC2A 1A04A 4PQRA 2AZXA 3GBPA 2O5RA 2A57A 2CNOA 4FYJA 3NNNA 3DH0A 4LI0A 3ZE6A 2JXLA 3VR5D 5DGTA 1JUOA 2FJYA 1NVGA 5FNZA 4IFBA 3R7DA 1YUTA 1A8HA 4IIYA 4JI6B 4DBLE 4B5LA 2VSNA 4PQYA 1QQAA 2RAFA 3ER8A 2BH2A 1ISFA 3TTXA 2HIMA 1S9HA 4K46A 3NHBA 2VH5R 5F5XA 4X6YA 4OVNF 1MC1A 2XH8A 3IJEB 4JWTA 1FFYA 4JLDA 1Y4SA 1EMDA 1FJXA 3ZW9A 1L7NA 3DVQX 3V4ZA 4JZYA 3MJTA 1IAQA 5CLQA 4YXWA 1AF4A 4BLPA 3AR7A 4DCTA 1R0BA 1V35A 4EHNA 3UNXA 4IHAA 1S6YA 1RXEA 3L93A 4DQ0A 4QM6A 4EL5A 4ITUA 5DN9A 2WHQA 1EG7A 1OFVA 4WX2B 9MHTA 1CG6A 2J9ZB 4ZYUA 2CBZA 3H11A 3EKHA 1VPDA 2HPZA 4MQMA 3R76A 5KX5B 1C3VA 2LUCA 1P4RA 2K7DA 2ZUTA 2AFHB 2O48X 3D8UA 1EFDN 1QG6A 3LYHA 5H83A 3SJ7A 3SSAA 1NMEA 3DL2A 1HDIA 2QNBA 2GAAA 3RTEA 1W34A 5ICEA 1FY2A 1QZTA 4TKUA 3QRXA 4BAUA 5KTPA 4L6AA 1O1YA 3GLHA 1HORA 3L1UA 2J0UA 5CCBA 2Y6UA 1VL1A 2WBLC 3KSZO 4XM0A 3J81k 4US1R 3N8HA 1R9GA 4QD3A 1XROA 1TT5A 5E9QA 3Q3EA 3USCS 1T0PA 3SS7X 1I94B 3WGJA 4WXRA 3ZW7A 3UJDA 2QIPA 5JLJA 1S3PA 1TF2A 1IXSB 4B84A 2DSNA 2LP4Y 4PHKA 3AOEC 1U7WA 4XEUA 4G5FA 1NRWA 1NW5A 2XYRA 1S5GY 4AZ3A 1FFBA 1PQYA 1ZUWA 1DQZA 2QJFA 4C20A 3Q8MA 5HGXA 5CRIA 3D2LA 3AERA 1QLJA 2XV1A 1OH5A 2O50A 4PICA 1B0PA 2WD7A 3QJGA 4OLHA 3B9QA 4H6XA 1Z0IA 1H1LB 4ME6A 3BMCA 4P35A 2OFXA 2WSSA 4II3A 4A0HA 4M8KA 5I9MA 2BHRA 1OQAA 3RYTC 4DDTA 1DGVA 4P93A 3NRJA 5EFOA 1QONA 4BGUA 3ZZ1A 4LMPA 3ESAA 1LUAA 5BRJA 3E15A 2JGDA 3ES9A 4D6PA 4JR1A 2BF7A 1HNZB 4DLPA 1Z5GA 3WNQA 2FMUA 5T6MA 4RDHA 4V0QA 1U0OC 3S0AA 1G21A 4CF4A 3RODA 4R3UC 3QZUA 1D1PA 4MWZA 1E1CB 5LZ2A 3C3DA 4NCBA 3NBZC 3OPYI 5HKZA 1E2DA 2COLB 3JYOA 4QJIA 4B3MB 3KT6A 2ZI3A 3PLFB 1QIKA 1HO3A 2M6RA 3C1OA 2A5LA 4KYTA 4PHFA 3PHCA 4WNAB 2QZ9A 2KSQA 4LHWA 4RPCA 1YBAA 1OJLA 2BFBB 4GPTA 5KTMA 1NU6A 4D9NA 3VROA 3HB7A 3UJPA 4QOEA 1Y82A 3PT5A 2GO7A 1PJ3A 1UHHA 1IG3A 4K6FA 5FI1B 1ULTA 3EAQA 2AVDA 5AM2A 3ONDA 3GEBA 1ZFNA 3ASZA 2EHBA 3S1SA 4HSGA 1PUIA 3VX4A 1ZG3A 1WDCB 3L02A 2A35A 3INNA 5I7RA 2QQEA 3P4UA 3QFHA 4TWIA 3R0VA 4DMRA 4NDAA 2A33A 2ZJOA 3QPBA 1ZGJA 4KKVA 1Q21A 1P5HA 5JADA 3TSZA 3TK1A 2HIGA 3KV3O 2WKSA 2X8JB 3TUZC 1T3GA 1WEHA 3R1OA 3WC4A 4D8WA 3JQEA 2JCXA 1VL8A 1YQQA 3PM8A 1ZCJA 4CV1A 4UZFA 1W581 3V9AA 1WUIS 1ZI8A 2G06A 5HILA 3LA6A 3MC1A 4CF3A 3GV0A 2GAFA 3O4HA 4EI7A 2BYTA 1YAHA 3B60A 1CD5A 3L8HA 3WL3A 4L8YA 5FLYA 2P3QA 3WB9A 1SB8A 3R23A 5JH7B 5A0TA 3VNVA 3A7EA 4ACAA 4ZCRA 3BDIA 2DH6A 4EQ6B 2VT6A 2VG8A 3O4XA 3N2EA 3DF0A 3OMXA 4EATA 3W5VA 2EHJA 3TLKA 2NSDA 5BV0A 4PTZA 2O8CA 2PH5A 2W2NA 5CYFA 5ESXA 5C51B 1AUPA 1QB7A 1XKQA 3HM2A 1ZUHA 3QTBA 5TQJA 1AZSC 2E4XA 2W93A 2CFCA 1O95D 1CQJA 5COBA 1DMSA 1N2CE 3H4IA 1F20A 2Y8EA 3E7DA 3IAHA 2Z2ZA 2M8UA 1V39A 3I0NA 4JXXA 2G8NA 3FNFA 3F3MA 1CFZA 2A9PA 2DHRA 4BVLA 3UT5A 2UYGA 3BT7A 1XD2B 1WVMA 3G0CA 3EIOA 3BYZA 5NULA 4KJZA 1ODLA 5H3LA 3HABA 2EJUA 1GVHA 1S1MA 1Q77A 3VAYA 3GGOA 2GYWA 3EMBA 1XKTA 5FORA 2G8LA 3RU2A 1JS1X 4YCCA 3A2NA 5FKJA 1PTJC 3WLIA 3CRRA 4KPUB 3VAZA 4N9QA 2FFJA 2CYCA 1E6UA 4DMMA 5AVSA 3E7PA 4AWBA 1XCMA 4RNCA 1I80A 4N3GA 2D8MA 2RG1A 2IEAA 3DTVA 5KHAA 4X7RA 1LB1B 1YA4A 3FHTA 1A4XA 3CIFA 1N6OA 2QGZA 3AHJA 1J2YA 2HKIA 1GPLA 3ESQA 3KLNA 4DG8A 5DASA 2HH9A 3UYKA 1IULA 4MZLA 3HACA 5J5CA 5B4VA 2J0SA 5DCWA 4ISBA 1NX2A 4YAEA 4RBNA 1XFZO 5HKWA 1N2BA 1EAMA 3CMCO 3RLIA 3TIGA 4R5MA 2D8NA 2N47A 2RDMA 1TQ2A 2JC3A 5DP2A 2H5IA 5KZMB 3SIWA 3CJTA 3S5JA 4AMVA 1SVIA 2PG3A 4HNQA 2CCGA 1FPWA 1KRWA 2FCDA 2P5TB 4Y0AA 3HQ4O 4GE0A 2KQ6A 3SIAA 3BIFA 4UVIA 1U0LA 5AJUA 3NHZA 4JGGA 4XWYA 4QU0A 5IBWA 2NZ2A 3F78A 5TE9A 1JDZA 5I7WA 1F4QA 2BTOA 4AJ9A 1QQ5A 1TMKA 3PFBA 3BGSA 2IGBA 3MTQA 4ZI7F 2YY5A 2IYRA 3E5MA 4GM1A 4ZC8A 4PQFA 2P62A 3II6X 5FH9A 3QXGA 4DLRA 1E0KA 1SBCA 4CMEC 1KWKA 3P5BA 4Z3KA 2PTHA 2C9CA 4HQKA 3NIFB 1S3FA 4GYKA 3A0RB 4RSGA 3S3TA 4I36A 5FTLA 1N92A 1C3ZA 4LZOA 1YR8A 3QXHA 1IXKA 3TD2A 3GRCA 3RS0A 2Y0BA 3DFZA 3F3YA 2PYZA 4QHTA 3EGXB 3MJHA 1XMJA 2BKUA 4PGGA 1Y7TA 3VPCA 4RSHA 4WCFC 3NSIA 3SP1A 4TTPA 1KE1A 1YDWA 2XBMA 2XBUA 5BORA 3IMCA 4HVAA 5HKYA 1VFPA 3NAMA 2JDID 2KOTA 3MRTA 5C5DA 4L0DA 3JQRA 2XTAA 4HGPA 3ONVA 4S0XA 1Y6GA 3TXYA 4YJGA 4YAGA 4F9TA 4EPYA 3JZFA 2FWNA 1ZWLA 1FOEB 1NRXA 1QRDA 1QK4A 1GVNB 2HMUA 5JOQA 1BE0A 5DX0A 2OGWA 1ONBA 3ZE2B 3BEOA 4OFWA 3GFQA 1NVFA 5REQB 2G07A 3EJWA 1L1EA 3WQRA 3RFTA 4F72A 4QQ8A 1YK0A 4G5YA 5KC9A 3OKCA 3FMOB 3KZVA 2OZPA 3RSOA 5K4GA 3AO0B 3PX2A 3OCUA 5JS2A 3H18A 3WO0A 3MLBA 1GDDA 3O8QB 5L3SA 1UBMS 3ZY5A 3OUZA 3NB0A 1RBMA 3G17A 3NATA 4LNUA 1P77A 1PZFA 3RKSA 5A4FS 2HDOA 2ZKLA 3WIVA 3F47A 5DMXA 1UIMA 4O08A 4BL5A 4TTAA 1T24A 4UHEA 2HU2A 2FJ0A 3GLGA 3TDUA 4B4DA 1J2RA 1FJ2A 3MIIA 2NX2A 2VF4X 5F4ZA 3HL0A 2VDWB 3C5WP 1EK1A 1IYZA 2FPIA 1VPWA 2WG1A 4A2PA 3NDBB 1XHEA 3AVQA 1L3CA 3DHEA 3CGWA 3URKA 1R50A 4KOEC 1VGRA 4O4JA 3ZR4B 3WGQA 2XIJA 1S4MA 4YMTA 1OXSC 4EJFA 4C0KA 4W1SA 3C3AA 3HGMA 1FMLA 4A8HA 3U2QA 1CFPA 1JX6A 4X6XA 3O74A 1DO2A 2P1RA 1Z75A 2IZ1A 1VLZA 5EUMA 3GLQA 3DZTA 4F0ZB 1NL3A 4BTEA 2E4VA 2YZNA 3P0FA 2FP4A 4RABA 2JATA 4OXNA 3BGWA 1USUA 1U1EA 2GM3A 2D5AA 1FTSA 4UHDA 1PJTA 4A1OA 3RQIA 3MAGA 2GA8A 3KELA 2E4YA 3M5CA 3QVVA 2MU1A 3QRWA 3PFFA 2XPCA 4D3ZA 1V5EA 2GK6A 4E5KA 5K6TA 3ESBA 1DQRA 1QPBA 4E6PA 1OTXA 1BFDA 4OV6B 4XD7A 1V7ZA 3M5PA 4PXSA 1A7AA 2QZJA 3L1KA 3QJYA 3NS7A 3O0TA 2Y71A 2HW8A 2Q7XA 1Y8AA 3ZHCA 1VZ3A 4DVGA 2E89A 2E18A 1DQPA 2IXAA 3MQ4A 2GN8A 1YRLA 1DQEA 4LW8A 5CEJA 2OCYC 3QPVA 2DHCA 4OCIA 2D0DA 4LHVA 3R9XB 2C4WA 3JWEA 1RQGA 2NNLD 1S89A 3CLSC 3EUWA 5CXUA 3A1SA 1VPLA 5FD8A 4A0QA 1NNUA 4BQQA 5JW6A 1RRPA 2KPHA 1Z0AA 4PV7A 4P36A 3WIDA 1FTYA 2J7KA 5GY7A 3B13B 3PUVA 1E7QA 3ED1A 2J59A 1J4AA 4N76A 1SBIA 4TRMA 5I3ZA 5KOHB 1ODKA 3PUHA 1IN1A 5KI6A 1E0SA 1MIOB 1T2EA 1W85A 3Q41A 4LG1A 2O8NA 1Q20A 5BR1A 2ZYAA 3RVBA 5T41A 5JJCA 1SA0B 4V02A 4IW3B 1N0WA 3BK1A 4JCOA 3DZJA 3TUJC 1BHJA 3PJEA 5LLSA 5B2EA 2OZLA 1BJTA 3EXFB 4E70A 2CSXA 1OI2A 3WBJA 2OD9A 3RSZA 3UYLA 3TS1A 5JTUA 4MS4A 2W71A 3KD2A 3PT9A 2M97A 2OGUA 3FCEA 4A2CA 1HT1E 4YRAA 4OKIA 5AKEA 5DNCA 1DF0A 5D5HA 2CF6A 5BMVB 2Q1WA 3OEHD 4LYJA 2WE7A 1R4NA 1WDTA 4OY3A 5DNVA 3IE1A 4J75A 1Y9EA 5LXTA 5B3KA 2C82A 3H86A 2M9GA 3P32A 4QBIA 2ZEJA 3KKKA 3LNCA 2P2GA 3VOAA 1Z83A 2BFDA 3IUBA 1JTFA 4H7PA 1DE0A 2E6WA 3AUSA 1R8SA 3ZBPA 4YRSA 1D0SA 4KHZA 3PR2B 3WYGA 2BE4A 4F9GA 2BLNA 1BVHA 3E5RA 1AQLA 3IIIA 3DZKA 3KDPA 4WA8A 3BBPA 3CMMA 1V43A 1YOBA 3O9VA 3RIGA 4CRWB 3PX7A 3PSHA 1LC3A 3ZKAA 2W5UA 4EKDA 3RJ5A 1QZ3A 4JFRA 2EAUA 2AJ8A 4E3ZA 4MRPA 4J91A 4OQMA 5G40A 2J32A 5BNWA 4RE6A 5BWOA 2QTNA 1DKLA 1QFSA 1YXMA 4XCQA 3CQ9A 1Y6JA 2FW9A 1PLKA 3NVDA 4L9RA 3LL4A 1GY8A 1V8PA 1UK6A 2BEKA 1L5FA 1YDFA 1AMOA 2UYQA 5EL0A 1C0LA 3NUZA 1L8LA 1JR4A 4GPBA 4X3OA 5EJEA 4FBLA 3QKUA 2F8LA 1AVTA 3QEJA 2AFIE 3C8HA 4YJ2A 4BLWA 3G8DA 1PR1A 2HEGA 4G24A 4DJEC 2HPHA 3VHRA 2W90A 2ZVPX 4ND6A 2A0FA 3FM9A 4LVCA 4ONEA 2DKNA 5JCPA 4O3MA 2VA9A 3Q6IA 5CFZA 5GJBA 2WF7A 1L5HB 3T5DA 4DA4A 3FPGA 1Z7EA 5FBVB 1TVKB 2PVSA 4KXLA 4EFNA 4D5EA 1VI6A 4DQVA 3SGLA 1SU4A 1FFWA 3QX8A 4D92A 2OD2A 4FDAA 1J7RA 1B2RA 3EDOA 5BN3A 1Y8ZA 3LX8A 3KYDB 4E15A 3EPLA 3V2UA 1JXMA 3JQ9C 2MAZA 3BILA 3BSWA 3HI4A 2XD4A 1NYRA 5ALJA 2BV3A 3TGWA 2WKRA 3P5SA