1ZOTB

Crystal structure analysis of the cyaa/c-cam with pmeapp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Lyase
molecule keywords CyaA with C-terminal Calmodulin
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zotB00
4L9MA 1LKJA 1GGZA 2SASA 1L2OC 1OMRA 1SL8A 1TNWA 3KF9A 4ORAB 2O5GA 5CSFA 3SIBA 1K2HA 5G08A 3TZ1A 3SG7A 1OMVA 1U5IA 1J55A 2LCPA 1CLBA 3OB1B 2LHIA 1TN4A 3PM8A 2FOTA 3OB2B 3VGOA 1XYDA 4PCWA 5JOLA 4PE0A 2KAXA 4USLA 1SMGA 2LMVA 1YRUB 1KCYA 3BUOB 2M7NA 1PRWA 1XK4A 1SBJA 2JT0A 3OX6A 3PN7C 1FF1A 3KEVA 1B7TZ 1AK8A 2ZFDA 2JNFA 4PHNA 3WHUB 2JT8A 2LANA 4MRXA 2FJUB 1PULA 1K94A 3A8RA 5AEQA 1GQMA 5HLOA 1ODBA 3EVUA 1G33A 1IGVA 3DF0A 3BOWB 3K21A 3SG3A 1XFZO 4N1FA 2KGRA 3VRQA 3KPXA 4YI9A 1K90D 1WRZA 1W7JB 5KU1A 2R2IA 1J1EA 1SCMC 4QJ3B 1Q80A 1QVIZ 1R6PA 1XFUO 1OSAA 1QV1A 2AUCA 3ZWHA 2KHNA 3GK1A 4YRUA 1IJ5A 1LA0A 1TRFA 1QS7A 3EVRA 3VROA 1BF5A 1NX2A 4IL1A 1SCVA 2BL0C 4MZLA 5ER4X 1M63B 4GGFC 1PSRA 1TNXA 2EGDA 2KI4C 2M49B 3VRNA 4MZJA 1B8LA 2ZNDA 5ER5A 1IH0A 1W7IB 5HKWA 3E3RA 4YGAA 1AHRA 3I5GB 2BBMA 1DVIA 1IWQA 1DF0B 1ZFSA 1SR6C 1J7QA 2WCFA 4YGDB 1KK8C 4YBHB 1CMGA 3BUWB 4PALA 3I5HB 3NSKA 4C0KA 1WDCB 2Q91A 3OHMB 2HQWA 5KTYA 2I18A 5IBWA 1F8HA 1PVBA 1LINA 3JTDB 3AKAA 1OMDA 2H61C 2KFFA 2KGBC 3RM1A 1CFPA 2LVIA 1CM1A 3LK1A 1DGUA 3CGAA 3I5FC 1BU3A 1SL9A 2KI4B 2JNXA 2AMIA 1K8UA 1VRKA 2QACA 5HKYA 1FI6A 1JUOA 1DJWA 2JZIA 1KWOC 1UURA 1E8AA 4GUKA 2LUXA 1KSOA 2M1UA 2F3YA 5HLVA 2NZ0A 1U5IB 1YTZC 1F4OA 1L2OB 1PSBA 1XA5A 4P2YB 1KSMA 2MBXA 2WOSA 1SY9A 2JC2A 3QRXA 5I2LA 4AQIA 2JQ6A 1YX7A 2LVJA 3D0YA 1SKTA 1KK8B 1IKUA 3O6BA 4CFQA 1CDNA 1NWDA 1AJ4A 3DVMA 2K2FA 1RECA 2OTGB 3BUMB 2FCDA 4GGNA 1UHNA 1S1EA 5PALA 2BBNA 1UWOA 1YVHA 4GPLB 4DS7A 3JVTC 3BQ3A 2CXJA 1ZOTB 2L50A 4BY4A 1UHHA 4XJKB 3LCPC 1KFUS 2G2BA 3AAKA 1QTXA 1GGWA 1SPYA 1G4YR 4PHJA 1DTLA 2MAZA 3SG6A 4GNKB 1CB1A 2K0JA 5F6TA 1BODA 2LAPA 1XVJA 3WHTB 3GK2A 1FW4A 3O78A 4ORBB 4M2QA 1ZMZA 2CCMA 3PATA 2K7OA 2LV7A 4YGCB 1GJYA 5K89A 3OP0A 3TDUA 4CIDA 1CMFA 4DUQA 2HF5A 2I7AA 1QXPA 3EK7A 4XJKA 5AANA 4F0ZB 4YGBB 3VRPA 1MXLC 2FCEA 2ZRSA 1CDMA 3JTDC 1DJGA 2BE4A 1HQVA 2M97A 4PE7A 2JTZA 3SG5A 3WXAA 4HRGA 2LNKA 1B7TY 1ZACA 3A4UB 1TTXA 4ZCVA 3WNXB 3NSOA 4PE4A 2M7LA 2M9GA 1AP4A 4PDZA 1PVAA 3D0YB 4I5LB 2LP2A 1M39A 4OCIA 2WORA 1K93D 3EK4A 1BT6A 2MLEC 1EJ3A 3EKJA 4QJ4B 3SG2A 2HETA 1KWOB 4C0LA 2L4IA 1A2XA 4GAOA 1KFXS 4DIRA 1MWNA 3RLZA 2KI6C 2DOQA 2H2KA 2JXCA 1JF2A 1B1GA 5AFPA 2ZN8A 4HSZA 1OQPA 2ISDA 2KNEA 2BKHB 1QLKA 3PFVA 2L51A 2SCPA 1R2UA 4M2OA 5I2OA 2K61A 1K9KA 1OZOA 2OS8B 1C7VA 1EG3A 2WC8A 2M0RA 1LVCD 1QLSA 1NP8A 1N0YA 4XYNA 1TNPA 1UHJA 2MA2A 2JT3A 3AKBA 1G8IA 4MRYA 1NCXA 1DF0A 1CLLA 2KQ6A 2MHHA 2JWWA 2WCBA 2CT9A 3M0WA 3CR5X 4A4BA 3PSRA 1WRLA 3IQOA 1K95A 1CNPA 1WRKA 2KBMA 1J1DA 1YRTB 1TCFA 3FWCA 2MRDA 4ORCB 4GBAA 1C07A 1A75B 2TN4A 1PK0D 4JWQA 1JC2A 1S6IA 2NXQA 1Y1XA 1CM4A 1RWYA 1KQMC 4MEWA 2NCOA 4DRWA 1ALVA 2BECA 2COLB 2P6BB 1XFXO 5B8IB 4R1EA 3CWGA 1M31A 4C0JA 3FWBA 5JJGA 1NX0A 5AERA 2Y1MA 2LE9B 2K2AA 1K96A 2Q4UA 2BKIB 3NSLA 2CBLA 1QIVA 3DF0B 3LK0A 2JRFA 1DMOA 1A4PA 2LMUA 2OTGC 1TIZA 2BCBA 4OR9B 1CDPA 4JQ0D 1WDCC 4N5XA 2I2RE 4AOMA 2H61A 1EG4A 1A29A 3BUNB 2LHLA 2PALA 2PRUA 4WRIA 2JULA 2NLNA 5CSIA 3C1VA 5CPVA 1RTP1 1A75A 2KFGA 2LLUA 1V1FA 4TNCA 1IQ3A 1M45A 2M3WA 1OZSA 1DJZA 3EKHA 2NCPA 1OE9B 1AJ5A 1C7WA 1EXRA 4YGEB 2D8NA 2KI6D 3O2PA 1J7RA 1H8BA 1DJHA 2BCXA 2ZN9A 1MXEA 2BL0B 2LLTA 4OVNF 3VRRA 1EH2A 2GGZA 5D7FA 4AQJA 3I5IC 1Y1AA 2BE6A 2Y5IA 1V1GA 1FPWA 2OS8C 3EK8A 2PVBA 4MSPA 2HPSA 5CSNA 1B8RA 5J3XA 1BG1A 1YUTA 5FYXA 1BR4B 1S5GY 1SNLA 2VRGA 1NCYA 3OX5A 1B9AA 2KOTA 2HQ8A 1NIWA 5CSJA 3CR2A 5I8NA 1MHOA 2KAVA 4D1EA 1UUSA 2LLSA 3F45A 1PALA 3DVEA 5D69A 2CNPA 4I5NB 1M46A 3KHEA 2G9BA 1NUBA 2OPOA 1QX2A 1YURA 2V53A 1QVIY 4Q04A 1CTRA 1IG5A 2L5XB 1SRAA 1UHKA 1IQ5A 1CDLA 2K7DA 2LVVA 2O60A 1Y0VH 2I94A 3PALA 1TNQA 3TUYB 1JFJA 1KFUL 1SR6B 3IQQA 1UP5A 4WQ3A 3SG4A 2L0PA 1F55A 2L4HA 3I5FB 1J7OA 2F2OA 1F54A 4N1GA 1IJ6A 1JSAA 1AUIB 2K7CA 3TDZA 5GQQC 1N65A 2A4JA 3TDIA 3MSEB 1CKKA 1CFCA 4MZKA 3TS5B 1TCOB 1JFKA 3I5HC 2KBIA 3BYAA 1BLQA 3BOWA 4MLWA 1OOJA 2M29A 1AVSA 1QASA 2IS9A 3SJSA 2E30A 4DCKA 2ZKMX 2PASA 1B8CA 1TOPA 1S3PA 3CTNA 4MBEA 4CLNA 1WLZA 2EC6C 2KFHA 2F8PA 4MN0A 2JXLA 3TUYC 1K9PA 1NPQA 1S26D 2KQYA 2ZNEA 5DKRA 1NX3A 4NDBA 1KQVA 3HX4A 1SYMA 2M8UA 3I5IB 2QPTA 3I5GC 1WY9A 3ICBA 1QX5B 1QX7A 3O4YA 4HRHA 3CZTX 4ETOA 3CS1A 1B4CA 1HT9A 1YVLA 4FTGA 2AAOA 1DJXA 1F71A 4P5OE 2JU0A 1D1OA 1S6JA 1K9UA 3ZNIA 2LVKA 1JBAA 1F70A 3FS7A 1RJVA 1YUUA 4OKHA 1UHIA 2KSPA 2KYFA 2WCEA 4I5KA 3HCMA 4FQOA 2CTNA 1BOCA 2E6WA 3CR4X 1YR5A 1IRJA 2F33A 1XFWO 2EHBA 1BMOA 1XFVO 2PSRA 3FIAA 1ZUZA 1YUSA 4U8DA 1NCZA 4NDCA 1DGVA 3LL8B 1J7PA 5BPJA 5I2QA 1BR1B 1QV0A 2LMTA 1S36A 2K7BA 2WNDA 1LA3A 1SCMB 3H4SE 1RROA 2ZRTA 2LM5A 2MLFC 2K8MB 2LUCA 4GFTA 1LXFC 1B47A 4MVFA 2MJWB 4M2PA 4CFRA 2RGIA 4UPGA 1KK7Y 2JOJA 3EVVA 4PE1A 3IF7A 3CLNA 3KO0A 5DKQA 3NXAA 1NSHA 3NSIA 2L2EA 1MQ1A 1CLMA 4JPZB 1SW8A 1RFJA 2Y1NA 3AAJA 2GGMA 1X02A 1QATA 4CPVA 3TS5C 3DVKA 1DJIA 4WQ2A 1SK6D 1SL7A 2EC6B 2Y4QA 3LLEA 1JWDA 3D10A 2BCAA 2PMYA 5HYDA 4I5JA 4GGFA 1XO5A 3SIAA 1S6CA 3BUXB 1QJTA 1NYAA 4BY5A 1N2DA 1S5GZ 1MR8A 1L7ZA 4E68A 1FBVA 2KAYA 1KQMB 1RK9A 1WLMA 2GV5A 1DT7B 3BXKA 3DD4A 1H4BA 4OV2A 1Y1UA 4A4CA 1CFFA 1MF8B 1F4QA 2LP3A 1KK7Z 2LC5A 2F3ZA 3GK4X 2JPTA 3DVJA 4QJ5B 1KFXL 5AXIA 5KSZA 1XK4C 1Y6WA 1BJFA 5TNCA 4PHMA 1JF0A 1NX1A 4NQGA 4ICBA 1EL4A 1FI5A 4PHKA 1A03A 1DJYA 3JVTB 5HKZA 5DKNA 2JTTA 2L98A 3PLFB 1QIWA 3GOFA 2B1UA 2KDHA 2KYCA 4NDDA 4YI8A 3PN7B 1XFYO 1YX8A 2F2PA 4ZCUA 1CFDA 2M1KB 4HREE 1ALWA 1MUXA
chains in the Genus database with same CATH superfamily
4L9MA 1LKJA 1GGZA 2SASA 1L2OC 1OMRA 1SL8A 1TNWA 3KF9A 4INXA 3DZTA 4ORAB 2O5GA 5CSFA 3SIBA 1K2HA 5G08A 3TZ1A 3S0GA 3SG7A 1OMVA 1U5IA 1J55A 2LCPA 1CLBA 3OB1B 2LHIA 1TN4A 2QEHA 3PM8A 2FOTA 3OB2B 3VGOA 1XYDA 4PCWA 5JOLA 4PE0A 1T14A 2KAXA 4USLA 1SMGA 2LMVA 1YRUB 1KCYA 3BUOB 2M7NA 1PRWA 3D77A 1XK4A 3UO9A 1SBJA 2JT0A 3OX6A 3DXLA 1DELA 1QWVA 3D78A 3PN7C 1FF1A 3KEVA 1B7TZ 1AK8A 2ZFDA 2JNFA 4PHNA 3WHUB 2JT8A 2LANA 4MRXA 2FJUB 1PULA 1K94A 5D3OA 3A8RA 3B6XA 5AEQA 1GQMA 5HLOA 1ODBA 3EVUA 1G33A 1IGVA 2WCKA 3CYZA 3DF0A 3BOWB 3K21A 3SG3A 1XFZO 4N1FA 2KGRA 3VRQA 2QEBA 3KPXA 4YI9A 1K90D 1WRZA 3IVTA 1W7JB 5KU1A 2R2IA 1J1EA 1SCMC 4QJ3B 1Q80A 1Z4HA 1QVIZ 1R6PA 1XFUO 1OSAA 1QV1A 2AUCA 3ZWHA 2KHNA 3GK1A 4YRUA 1IJ5A 1LA0A 1TRFA 1QS7A 3EVRA 4OZDA 2WC5A 3VROA 1BF5A 1NX2A 4IL1A 1SCVA 1XFRA 2BL0C 4MZLA 5ER4X 1M63B 4GGFC 3R72A 1PSRA 1TNXA 3RZSA 2EGDA 1ORGA 2KI4C 2M49B 3VRNA 4MZJA 1B8LA 2ZNDA 5ER5A 1IH0A 1W7IB 5HKWA 3E3RA 4YGAA 3D75A 1AHRA 3I5GB 2BBMA 3FE6A 3O4XA 1DVIA 1IWQA 1DF0B 1ZFSA 1SR6C 1J7QA 2WCFA 4YGDB 1KK8C 4YBHB 1CMGA 3BUWB 4PALA 3I5HB 3NSKA 4C0KA 1WDCB 2Q91A 3OHMB 2HQWA 3OBVA 2I18A 3V2LA 5KTYA 5IBWA 3CZ0A 1F8HA 1PVBA 1C3YA 1LINA 3JTDB 3AKAA 1OMDA 2H61C 2KFFA 2KGBC 3RM1A 3CZ2A 1DC1A 1CFPA 2LVIA 1CM1A 3LK1A 1DGUA 3CGAA 3I5FC 1BU3A 3S0BA 1SL9A 2KI4B 2JNXA 2AMIA 1K8UA 1VRKA 2QACA 5HKYA 1FI6A 1JUOA 1DJWA 2JZIA 1KWOC 1UURA 1E8AA 4GUKA 2LUXA 1KSOA 2M1UA 3BFBA 5FI6A 1IIOA 2F3YA 5HLVA 2NZ0A 1U5IB 1YTZC 1F4OA 1L2OB 1PSBA 1XA5A 4P2YB 1KSMA 2MBXA 2WOSA 1SY9A 2JC2A 3QRXA 5I2LA 4AQIA 2JQ6A 1YX7A 2LVJA 3D0YA 1SKTA 1KK8B 1IKUA 3O6BA 4CFQA 1CDNA 1NWDA 1AJ4A 3DVMA 2K2FA 4JKTA 3CABA 1RECA 2OTGB 3BUMB 3DYEA 2FCDA 4GGNA 1UHNA 1S1EA 5PALA 2BBNA 1UWOA 1YVHA 4GPLB 2YGUA 4DS7A 3JVTC 3BQ3A 1P28A 2CXJA 1ZOTB 2L50A 4BY4A 1UHHA 4XJKB 3LCPC 1KFUS 2G2BA 1SSEB 3AAKA 1QTXA 1GGWA 1SPYA 1G4YR 4PHJA 1DTLA 2MAZA 3SG6A 4GNKB 1CB1A 2K0JA 5F6TA 1BODA 2LAPA 1XVJA 3WHTB 3GK2A 1FW4A 4JD9A 3O78A 4ORBB 4M2QA 1ZMZA 2CCMA 3PATA 2K7OA 2LV7A 5HL1A 4YGCB 3S0EA 1GJYA 3PM2A 5K89A 3OP0A 3TDUA 4CIDA 1CMFA 4DUQA 2HF5A 2I7AA 2BAPA 1QXPA 3EK7A 4XJKA 5AANA 4F0ZB 4YGBB 3K1EA 1MXLC 2FCEA 3VRPA 3S0FA 2ZRSA 1CDMA 3JTDC 2WCJA 1DJGA 4IJ7A 3OGNA 2BE4A 1HQVA 2M97A 4PE7A 2JTZA 3SG5A 3WXAA 4HRGA 2LNKA 1B7TY 1OOFA 3Q8IA 1ZACA 3A4UB 1TTXA 4ZCVA 3WNXB 3NSOA 4PE4A 3SS5A 2M7LA 3B86A 2M9GA 1AP4A 4PDZA 1PVAA 3D0YB 4I5LB 2LP2A 1M39A 4OCIA 2WORA 1K93D 3EK4A 1BT6A 2MLEC 1EJ3A 2WCMA 3EKJA 4QJ4B 3SG2A 2HETA 1KWOB 4C0LA 2L4IA 1A2XA 4GAOA 1KFXS 4DIRA 1MWNA 3RLZA 2KI6C 2DOQA 2H2KA 2JXCA 3CDNA 1JF2A 5DICA 1B1GA 5AFPA 2ZN8A 4HSZA 1OQPA 2ISDA 2KNEA 2BKHB 2QEVA 1QLKA 3QMEA 3PFVA 2L51A 2SCPA 1R2UA 3N7HA 4M2OA 5I2OA 2K61A 1K9KA 1OZOA 2OS8B 1C7VA 1EG3A 2WC8A 2M0RA 1LVCD 2WCHA 1QLSA 1NP8A 1N0YA 4XYNA 1TNPA 1UHJA 2MA2A 1OOHA 2KLDA 2JT3A 3AKBA 1G8IA 4MRYA 1NCXA 1DF0A 1CLLA 2KQ6A 2MHHA 2PQLA 2JWWA 2WCBA 2CT9A 3M0WA 3CR5X 2L2CA 4A4BA 2ERBA 3NHIA 3PSRA 1WRLA 3IQOA 1K95A 3EG5B 1CNPA 1WRKA 2KBMA 1J1DA 1YRTB 1TCFA 5FI2A 3FWCA 3NGVA 2MRDA 4ORCB 4GBAA 1C07A 4PT1A 1A75B 2TN4A 1PK0D 4JWQA 1JC2A 1S6IA 2NXQA 2JPOA 1Y1XA 1CM4A 1RWYA 1KQMC 4MEWA 2NCOA 4DRWA 1ALVA 2BECA 2COLB 3B87A 1W9ZA 2P6BB 1XFXO 5B8IB 4R1EA 3CWGA 1M31A 4C0JA 3FWBA 5JJGA 1NX0A 5AERA 2Y1MA 3SS3A 2LE9B 5I94A 2K2AA 2KLEA 1K96A 2Q4UA 2BKIB 2K60A 3NSLA 2CBLA 1QIVA 3DF0B 3LK0A 2JRFA 1DMOA 1A4PA 2LMUA 4HREE 2OTGC 1TIZA 2BCBA 4OR9B 1CDPA 4JQ0D 1WDCC 4N5XA 2I2RE 4AOMA 2H61A 1EG4A 1A29A 3BUNB 2LHLA 2PALA 2PRUA 4WRIA 2JULA 2NLNA 3BJHA 5CSIA 3C1VA 5CPVA 1RTP1 1A75A 2KFGA 2LLUA 1V1FA 4TNCA 1IQ3A 1M45A 2KPHA 2M3WA 1OZSA 1DJZA 3EKHA 2NCPA 1OE9B 1AJ5A 1C7WA 5FI7A 1EXRA 3D74A 2D8NA 2KI6D 4YGEB 3O2PA 1J7RA 3FE8A 1H8BA 1DJHA 2BCXA 2ZN9A 1MXEA 1OOGA 2BL0B 2LLTA 4OVNF 3VRRA 1EH2A 2GGZA 5D7FA 4AQJA 3I5IC 1Y1AA 2BE6A 2Y5IA 1V1GA 1FPWA 2OS8C 3EK8A 2PVBA 4MSPA 2HPSA 5CSNA 1B8RA 5J3XA 1BG1A 1YUTA 5FYXA 1BR4B 1S5GY 1SNLA 2VRGA 1NCYA 3OX5A 1B9AA 2KOTA 2HQ8A 3VB1A 1NIWA 3R1PA 1TUZA 5CSJA 3CR2A 1C3ZA 5I8NA 1MHOA 2KAVA 4D1EA 1UUSA 2LLSA 3F45A 4INWA 1PALA 3DY9A 2BNXA 3DVEA 5D69A 2CNPA 4I5NB 3UNWA 1M46A 3KHEA 2G9BA 1NUBA 3D76A 2OPOA 1QX2A 1YURA 2QDIA 2V53A 1QVIY 4Q04A 1CTRA 1IG5A 2L5XB 1SRAA 1UHKA 2P70A 1IQ5A 1CDLA 2K7DA 2LVVA 2O60A 1Y0VH 2I94A 3PALA 1TNQA 3TUYB 1JFJA 1KFUL 2GTEA 1SR6B 3IQQA 1UP5A 4WQ3A 3SG4A 2L0PA 1TWOA 1F55A 2L4HA 3I5FB 1J7OA 2F2OA 1F54A 4FQTA 4N1GA 1IJ6A 2WCLA 3R1OA 1AUIB 1JSAA 2K7CA 3L4LA 3TDZA 5GQQC 1N65A 2A4JA 3TDIA 3MSEB 1CKKA 1CFCA 4MZKA 3TS5B 1TCOB 1JFKA 3I5HC 1OOIX 2KBIA 3BFHA 3BYAA 3SS4A 1BLQA 3BOWA 4MLWA 1OOJA 2M29A 1AVSA 1QASA 2IS9A 3SJSA 2E30A 4DCKA 2ZKMX 2PASA 1B8CA 1TOPA 1S3PA 1LS8A 3CTNA 4MBEA 1WLZA 2EC6C 2KFHA 4CLNA 2F8PA 4MN0A 2JXLA 3TUYC 1K9PA 1NPQA 1S26D 2KQYA 2ZNEA 5DKRA 1NX3A 4NDBA 1KQVA 3HX4A 1SYMA 2M8UA 3D73A 3I5IB 2QPTA 3I5GC 1WY9A 3ICBA 1QX5B 1QX7A 3O4YA 4HRHA 3CZTX 4ETOA 3CS1A 1B4CA 1HT9A 1YVLA 4FTGA 2AAOA 1DJXA 1F71A 4P5OE 2JU0A 1D1OA 1S6JA 1K9UA 3ZNIA 2LVKA 1JBAA 1F70A 3FS7A 1RJVA 1YUUA 4OKHA 1UHIA 2KSPA 2KYFA 2WCEA 3FE9A 1OW4A 4I5KA 3HCMA 4FQOA 2CTNA 1BOCA 2E6WA 2FJYA 3CR4X 1YR5A 1IRJA 2F33A 1XFWO 2EHBA 1BMOA 1XFVO 2PSRA 3FIAA 1ZUZA 1YUSA 4U8DA 1NCZA 4NDCA 1DGVA 3LL8B 1J7PA 5BPJA 5I2QA 1BR1B 1QV0A 2LMTA 1S36A 2K7BA 2WNDA 1LA3A 1SCMB 1DQEA 1RROA 3H4SE 2ZRTA 3NHTA 2LM5A 4F7FA 2MLFC 2K8MB 2LUCA 2P71A 4GFTA 1LXFC 1GM0A 1B47A 4MVFA 3S0AA 2MJWB 1Z2CB 4M2PA 4CFRA 2RGIA 4UPGA 1KK7Y 2JOJA 3EVVA 4PE1A 3IF7A 3CLNA 3KO0A 5DKQA 3NXAA 1NSHA 3NSIA 2L2EA 1MQ1A 1CLMA 4JPZB 1SW8A 1RFJA 2Y1NA 3AAJA 2GGMA 1X02A 1QATA 4CPVA 3TS5C 3DVKA 1DJIA 4WQ2A 1SK6D 1SL7A 2EC6B 2Y4QA 3LLEA 1JWDA 3D10A 2BCAA 2PMYA 5HYDA 2H8VA 4I5JA 4GGFA 1XO5A 3SIAA 4KYNA 1S6CA 3BUXB 1QJTA 1NYAA 3CZ1A 4BY5A 1N2DA 1S5GZ 1MR8A 1L7ZA 4E68A 1FBVA 2KAYA 1KQMB 1RK9A 1WLMA 2GV5A 1DT7B 3BXKA 3DD4A 1H4BA 4OV2A 1Y1UA 4A4CA 2PYQA 1CFFA 1DEKA 1MF8B 1F4QA 2LP3A 1KK7Z 2LC5A 2F3ZA 3GK4X 2JPTA 3DVJA 5EL2A 4QJ5B 1KFXL 5AXIA 5KSZA 1XK4C 3PJIA 1Y6WA 1BJFA 5TNCA 4PHMA 1JF0A 1NX1A 4NQGA 2L5YA 4ICBA 1EL4A 3L4AA 4PHKA 1FI5A 2QEOA 1A03A 1DJYA 3JVTB 5HKZA 3B7AA 5DKNA 2JTTA 3R1VA 3S0DA 2L98A 3PLFB 3B88A 2WC6A 1QIWA 3GOFA 2B1UA 2KDHA 2KYCA 4NDDA 4YI8A 3PN7B 1XFYO 3L47A 1TUJA 1YX8A 2F2PA 4ZCUA 1CFDA 2M1KB 3BFAA 1ALWA 1MUXA
chains in the Genus database with same CATH topology
4L9MA 1LKJA 1GGZA 2SASA 1L2OC 1OMRA 1SL8A 1TNWA 3KF9A 4ORAB 2O5GA 5CSFA 3SIBA 1K2HA 5G08A 3TZ1A 3SG7A 1OMVA 1U5IA 1J55A 2LCPA 1CLBA 3OB1B 2LHIA 1TN4A 3PM8A 2FOTA 3OB2B 3VGOA 1XYDA 4PCWA 5JOLA 4PE0A 2KAXA 4USLA 1SMGA 2LMVA 1YRUB 1KCYA 3BUOB 2M7NA 1PRWA 1XK4A 1SBJA 2JT0A 3OX6A 3PN7C 1FF1A 3KEVA 1B7TZ 1AK8A 2ZFDA 2JNFA 4PHNA 3WHUB 2JT8A 2LANA 4MRXA 2FJUB 1PULA 1K94A 3A8RA 5AEQA 1GQMA 5HLOA 1ODBA 3EVUA 1G33A 1IGVA 3DF0A 3BOWB 3K21A 3SG3A 1XFZO 4N1FA 2KGRA 3VRQA 3KPXA 4YI9A 1K90D 1WRZA 1W7JB 5KU1A 2R2IA 1J1EA 1SCMC 4QJ3B 1Q80A 1QVIZ 1R6PA 1XFUO 1OSAA 1QV1A 2AUCA 3ZWHA 2KHNA 3GK1A 4YRUA 1IJ5A 1LA0A 1TRFA 1QS7A 3EVRA 3VROA 1BF5A 1NX2A 4IL1A 1SCVA 2BL0C 4MZLA 5ER4X 1M63B 4GGFC 1PSRA 1TNXA 2EGDA 2KI4C 2M49B 3VRNA 4MZJA 1B8LA 2ZNDA 5ER5A 1IH0A 1W7IB 5HKWA 3E3RA 4YGAA 1AHRA 3I5GB 2BBMA 1DVIA 1IWQA 1DF0B 1ZFSA 1SR6C 1J7QA 2WCFA 4YGDB 1KK8C 4YBHB 1CMGA 3BUWB 4PALA 3I5HB 3NSKA 4C0KA 1WDCB 2Q91A 3OHMB 2HQWA 5KTYA 2I18A 5IBWA 1F8HA 1PVBA 1LINA 3JTDB 3AKAA 1OMDA 2H61C 2KFFA 2KGBC 3RM1A 1CFPA 2LVIA 1CM1A 3LK1A 1DGUA 3CGAA 3I5FC 1BU3A 1SL9A 2KI4B 2JNXA 2AMIA 1K8UA 1VRKA 2QACA 5HKYA 1FI6A 1JUOA 1DJWA 2JZIA 1KWOC 1UURA 1E8AA 4GUKA 2LUXA 1KSOA 2M1UA 2F3YA 5HLVA 2NZ0A 1U5IB 1YTZC 1F4OA 1L2OB 1PSBA 1XA5A 4P2YB 1KSMA 2MBXA 2WOSA 1SY9A 2JC2A 3QRXA 5I2LA 4AQIA 2JQ6A 1YX7A 2LVJA 3D0YA 1SKTA 1KK8B 1IKUA 3O6BA 4CFQA 1CDNA 1NWDA 1AJ4A 3DVMA 2K2FA 1RECA 2OTGB 3BUMB 2FCDA 4GGNA 1UHNA 1S1EA 5PALA 2BBNA 1UWOA 1YVHA 4GPLB 4DS7A 3JVTC 3BQ3A 2CXJA 1ZOTB 2L50A 4BY4A 1UHHA 4XJKB 3LCPC 1KFUS 2G2BA 3AAKA 1QTXA 1GGWA 1SPYA 1G4YR 4PHJA 1DTLA 2MAZA 3SG6A 4GNKB 1CB1A 2K0JA 5F6TA 1BODA 2LAPA 1XVJA 3WHTB 3GK2A 1FW4A 3O78A 4ORBB 4M2QA 1ZMZA 2CCMA 3PATA 2K7OA 2LV7A 4YGCB 1GJYA 5K89A 3OP0A 3TDUA 4CIDA 1CMFA 4DUQA 2HF5A 2I7AA 1QXPA 3EK7A 4XJKA 5AANA 4F0ZB 4YGBB 3VRPA 1MXLC 2FCEA 2ZRSA 1CDMA 3JTDC 1DJGA 2BE4A 1HQVA 2M97A 4PE7A 2JTZA 3SG5A 3WXAA 4HRGA 2LNKA 1B7TY 1ZACA 3A4UB 1TTXA 4ZCVA 3WNXB 3NSOA 4PE4A 2M7LA 2M9GA 1AP4A 4PDZA 1PVAA 3D0YB 4I5LB 2LP2A 1M39A 4OCIA 2WORA 1K93D 3EK4A 1BT6A 2MLEC 1EJ3A 3EKJA 4QJ4B 3SG2A 2HETA 1KWOB 4C0LA 2L4IA 1A2XA 4GAOA 1KFXS 4DIRA 1MWNA 3RLZA 2KI6C 2DOQA 2H2KA 2JXCA 1JF2A 1B1GA 5AFPA 2ZN8A 4HSZA 1OQPA 2ISDA 2KNEA 2BKHB 1QLKA 3PFVA 2L51A 2SCPA 1R2UA 4M2OA 5I2OA 2K61A 1K9KA 1OZOA 2OS8B 1C7VA 1EG3A 2WC8A 2M0RA 1LVCD 1QLSA 1NP8A 1N0YA 4XYNA 1TNPA 1UHJA 2MA2A 2JT3A 3AKBA 1G8IA 4MRYA 1NCXA 1DF0A 1CLLA 2KQ6A 2MHHA 2JWWA 2WCBA 2CT9A 3M0WA 3CR5X 4A4BA 3PSRA 1WRLA 3IQOA 1K95A 1CNPA 1WRKA 2KBMA 1J1DA 1YRTB 1TCFA 3FWCA 2MRDA 4ORCB 4GBAA 1C07A 1A75B 2TN4A 1PK0D 4JWQA 1JC2A 1S6IA 2NXQA 1Y1XA 1CM4A 1RWYA 1KQMC 4MEWA 2NCOA 4DRWA 1ALVA 2BECA 2COLB 2P6BB 1XFXO 5B8IB 4R1EA 3CWGA 1M31A 4C0JA 3FWBA 5JJGA 1NX0A 5AERA 2Y1MA 2LE9B 2K2AA 1K96A 2Q4UA 2BKIB 3NSLA 2CBLA 1QIVA 3DF0B 3LK0A 2JRFA 1DMOA 1A4PA 2LMUA 2OTGC 1TIZA 2BCBA 4OR9B 1CDPA 4JQ0D 1WDCC 4N5XA 2I2RE 4AOMA 2H61A 1EG4A 1A29A 3BUNB 2LHLA 2PALA 2PRUA 4WRIA 2JULA 2NLNA 5CSIA 3C1VA 5CPVA 1RTP1 1A75A 2KFGA 2LLUA 1V1FA 4TNCA 1IQ3A 1M45A 2M3WA 1OZSA 1DJZA 3EKHA 2NCPA 1OE9B 1AJ5A 1C7WA 1EXRA 4YGEB 2D8NA 2KI6D 3O2PA 1J7RA 1H8BA 1DJHA 2BCXA 2ZN9A 1MXEA 2BL0B 2LLTA 4OVNF 3VRRA 1EH2A 2GGZA 5D7FA 4AQJA 3I5IC 1Y1AA 2BE6A 2Y5IA 1V1GA 1FPWA 2OS8C 3EK8A 2PVBA 4MSPA 2HPSA 5CSNA 1B8RA 5J3XA 1BG1A 1YUTA 5FYXA 1BR4B 1S5GY 1SNLA 2VRGA 1NCYA 3OX5A 1B9AA 2KOTA 2HQ8A 1NIWA 5CSJA 3CR2A 5I8NA 1MHOA 2KAVA 4D1EA 1UUSA 2LLSA 3F45A 1PALA 3DVEA 5D69A 2CNPA 4I5NB 1M46A 3KHEA 2G9BA 1NUBA 2OPOA 1QX2A 1YURA 2V53A 1QVIY 4Q04A 1CTRA 1IG5A 2L5XB 1SRAA 1UHKA 1IQ5A 1CDLA 2K7DA 2LVVA 2O60A 1Y0VH 2I94A 3PALA 1TNQA 3TUYB 1JFJA 1KFUL 1SR6B 3IQQA 1UP5A 4WQ3A 3SG4A 2L0PA 1F55A 2L4HA 3I5FB 1J7OA 2F2OA 1F54A 4N1GA 1IJ6A 1JSAA 1AUIB 2K7CA 3TDZA 5GQQC 1N65A 2A4JA 3TDIA 3MSEB 1CKKA 1CFCA 4MZKA 3TS5B 1TCOB 1JFKA 3I5HC 2KBIA 3BYAA 1BLQA 3BOWA 4MLWA 1OOJA 2M29A 1AVSA 1QASA 2IS9A 3SJSA 2E30A 4DCKA 2ZKMX 2PASA 1B8CA 1TOPA 1S3PA 3CTNA 4MBEA 4CLNA 1WLZA 2EC6C 2KFHA 2F8PA 4MN0A 2JXLA 3TUYC 1K9PA 1NPQA 1S26D 2KQYA 2ZNEA 5DKRA 1NX3A 4NDBA 1KQVA 3HX4A 1SYMA 2M8UA 3I5IB 2QPTA 3I5GC 1WY9A 3ICBA 1QX5B 1QX7A 3O4YA 4HRHA 3CZTX 4ETOA 3CS1A 1B4CA 1HT9A 1YVLA 4FTGA 2AAOA 1DJXA 1F71A 4P5OE 2JU0A 1D1OA 1S6JA 1K9UA 3ZNIA 2LVKA 1JBAA 1F70A 3FS7A 1RJVA 1YUUA 4OKHA 1UHIA 2KSPA 2KYFA 2WCEA 4I5KA 3HCMA 4FQOA 2CTNA 1BOCA 2E6WA 3CR4X 1YR5A 1IRJA 2F33A 1XFWO 2EHBA 1BMOA 1XFVO 2PSRA 3FIAA 1ZUZA 1YUSA 4U8DA 1NCZA 4NDCA 1DGVA 3LL8B 1J7PA 5BPJA 5I2QA 1BR1B 1QV0A 2LMTA 1S36A 2K7BA 2WNDA 1LA3A 1SCMB 3H4SE 1RROA 2ZRTA 2LM5A 2MLFC 2K8MB 2LUCA 4GFTA 1LXFC 1B47A 4MVFA 2MJWB 4M2PA 4CFRA 2RGIA 4UPGA 1KK7Y 2JOJA 3EVVA 4PE1A 3IF7A 3CLNA 3KO0A 5DKQA 3NXAA 1NSHA 3NSIA 2L2EA 1MQ1A 1CLMA 4JPZB 1SW8A 1RFJA 2Y1NA 3AAJA 2GGMA 1X02A 1QATA 4CPVA 3TS5C 3DVKA 1DJIA 4WQ2A 1SK6D 1SL7A 2EC6B 2Y4QA 3LLEA 1JWDA 3D10A 2BCAA 2PMYA 5HYDA 4I5JA 4GGFA 1XO5A 3SIAA 1S6CA 3BUXB 1QJTA 1NYAA 4BY5A 1N2DA 1S5GZ 1MR8A 1L7ZA 4E68A 1FBVA 2KAYA 1KQMB 1RK9A 1WLMA 2GV5A 1DT7B 3BXKA 3DD4A 1H4BA 4OV2A 1Y1UA 4A4CA 1CFFA 1MF8B 1F4QA 2LP3A 1KK7Z 2LC5A 2F3ZA 3GK4X 2JPTA 3DVJA 4QJ5B 1KFXL 5AXIA 5KSZA 1XK4C 1Y6WA 1BJFA 5TNCA 4PHMA 1JF0A 1NX1A 4NQGA 4ICBA 1EL4A 1FI5A 4PHKA 1A03A 1DJYA 3JVTB 5HKZA 5DKNA 2JTTA 2L98A 3PLFB 1QIWA 3GOFA 2B1UA 2KDHA 2KYCA 4NDDA 4YI8A 3PN7B 1XFYO 1YX8A 2F2PA 4ZCUA 1CFDA 2M1KB 4HREE 1ALWA 1MUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9M A;  1LKJ A;  1GGZ A;  2SAS A;  1L2O C;  1OMR A;  1SL8 A;  1TNW A;  3KF9 A;  4ORA B;  2O5G A;  5CSF A;  3SIB A;  1K2H A;  5G08 A;  3TZ1 A;  3SG7 A;  1OMV A;  1U5I A;  1J55 A;  2LCP A;  1CLB A;  3OB1 B;  2LHI A;  1TN4 A;  3PM8 A;  2FOT A;  3OB2 B;  3VGO A;  1XYD A;  4PCW A;  5JOL A;  4PE0 A;  2KAX A;  4USL A;  1SMG A;  2LMV A;  1YRU B;  1KCY A;  3BUO B;  2M7N A;  1PRW A;  1XK4 A;  1SBJ A;  2JT0 A;  3OX6 A;  3PN7 C;  1FF1 A;  3KEV A;  1B7T Z;  1AK8 A;  2ZFD A;  2JNF A;  4PHN A;  3WHU B;  2JT8 A;  2LAN A;  4MRX A;  2FJU B;  1PUL A;  1K94 A;  3A8R A;  5AEQ A;  1GQM A;  5HLO A;  1ODB A;  3EVU A;  1G33 A;  1IGV A;  3DF0 A;  3BOW B;  3K21 A;  3SG3 A;  1XFZ O;  4N1F A;  2KGR A;  3VRQ A;  3KPX A;  4YI9 A;  1K90 D;  1WRZ A;  1W7J B;  5KU1 A;  2R2I A;  1J1E A;  1SCM C;  4QJ3 B;  1Q80 A;  1QVI Z;  1R6P A;  1XFU O;  1OSA A;  1QV1 A;  2AUC A;  3ZWH A;  2KHN A;  3GK1 A;  4YRU A;  1IJ5 A;  1LA0 A;  1TRF A;  1QS7 A;  3EVR A;  3VRO A;  1BF5 A;  1NX2 A;  4IL1 A;  1SCV A;  2BL0 C;  4MZL A;  5ER4 X;  1M63 B;  4GGF C;  1PSR A;  1TNX A;  2EGD A;  2KI4 C;  2M49 B;  3VRN A;  4MZJ A;  1B8L A;  2ZND A;  5ER5 A;  1IH0 A;  1W7I B;  5HKW A;  3E3R A;  4YGA A;  1AHR A;  3I5G B;  2BBM A;  1DVI A;  1IWQ A;  1DF0 B;  1ZFS A;  1SR6 C;  1J7Q A;  2WCF A;  4YGD B;  1KK8 C;  4YBH B;  1CMG A;  3BUW B;  4PAL A;  3I5H B;  3NSK A;  4C0K A;  1WDC B;  2Q91 A;  3OHM B;  2HQW A;  5KTY A;  2I18 A;  5IBW A;  1F8H A;  1PVB A;  1LIN A;  3JTD B;  3AKA A;  1OMD A;  2H61 C;  2KFF A;  2KGB C;  3RM1 A;  1CFP A;  2LVI A;  1CM1 A;  3LK1 A;  1DGU A;  3CGA A;  3I5F C;  1BU3 A;  1SL9 A;  2KI4 B;  2JNX A;  2AMI A;  1K8U A;  1VRK A;  2QAC A;  5HKY A;  1FI6 A;  1JUO A;  1DJW A;  2JZI A;  1KWO C;  1UUR A;  1E8A A;  4GUK A;  2LUX A;  1KSO A;  2M1U A;  2F3Y A;  5HLV A;  2NZ0 A;  1U5I B;  1YTZ C;  1F4O A;  1L2O B;  1PSB A;  1XA5 A;  4P2Y B;  1KSM A;  2MBX A;  2WOS A;  1SY9 A;  2JC2 A;  3QRX A;  5I2L A;  4AQI A;  2JQ6 A;  1YX7 A;  2LVJ A;  3D0Y A;  1SKT A;  1KK8 B;  1IKU A;  3O6B A;  4CFQ A;  1CDN A;  1NWD A;  1AJ4 A;  3DVM A;  2K2F A;  1REC A;  2OTG B;  3BUM B;  2FCD A;  4GGN A;  1UHN A;  1S1E A;  5PAL A;  2BBN A;  1UWO A;  1YVH A;  4GPL B;  4DS7 A;  3JVT C;  3BQ3 A;  2CXJ A;  1ZOT B;  2L50 A;  4BY4 A;  1UHH A;  4XJK B;  3LCP C;  1KFU S;  2G2B A;  3AAK A;  1QTX A;  1GGW A;  1SPY A;  1G4Y R;  4PHJ A;  1DTL A;  2MAZ A;  3SG6 A;  4GNK B;  1CB1 A;  2K0J A;  5F6T A;  1BOD A;  2LAP A;  1XVJ A;  3WHT B;  3GK2 A;  1FW4 A;  3O78 A;  4ORB B;  4M2Q A;  1ZMZ A;  2CCM A;  3PAT A;  2K7O A;  2LV7 A;  4YGC B;  1GJY A;  5K89 A;  3OP0 A;  3TDU A;  4CID A;  1CMF A;  4DUQ A;  2HF5 A;  2I7A A;  1QXP A;  3EK7 A;  4XJK A;  5AAN A;  4F0Z B;  4YGB B;  3VRP A;  1MXL C;  2FCE A;  2ZRS A;  1CDM A;  3JTD C;  1DJG A;  2BE4 A;  1HQV A;  2M97 A;  4PE7 A;  2JTZ A;  3SG5 A;  3WXA A;  4HRG A;  2LNK A;  1B7T Y;  1ZAC A;  3A4U B;  1TTX A;  4ZCV A;  3WNX B;  3NSO A;  4PE4 A;  2M7L A;  2M9G A;  1AP4 A;  4PDZ A;  1PVA A;  3D0Y B;  4I5L B;  2LP2 A;  1M39 A;  4OCI A;  2WOR A;  1K93 D;  3EK4 A;  1BT6 A;  2MLE C;  1EJ3 A;  3EKJ A;  4QJ4 B;  3SG2 A;  2HET A;  1KWO B;  4C0L A;  2L4I A;  1A2X A;  4GAO A;  1KFX S;  4DIR A;  1MWN A;  3RLZ A;  2KI6 C;  2DOQ A;  2H2K A;  2JXC A;  1JF2 A;  1B1G A;  5AFP A;  2ZN8 A;  4HSZ A;  1OQP A;  2ISD A;  2KNE A;  2BKH B;  1QLK A;  3PFV A;  2L51 A;  2SCP A;  1R2U A;  4M2O A;  5I2O A;  2K61 A;  1K9K A;  1OZO A;  2OS8 B;  1C7V A;  1EG3 A;  2WC8 A;  2M0R A;  1LVC D;  1QLS A;  1NP8 A;  1N0Y A;  4XYN A;  1TNP A;  1UHJ A;  2MA2 A;  2JT3 A;  3AKB A;  1G8I A;  4MRY A;  1NCX A;  1DF0 A;  1CLL A;  2KQ6 A;  2MHH A;  2JWW A;  2WCB A;  2CT9 A;  3M0W A;  3CR5 X;  4A4B A;  3PSR A;  1WRL A;  3IQO A;  1K95 A;  1CNP A;  1WRK A;  2KBM A;  1J1D A;  1YRT B;  1TCF A;  3FWC A;  2MRD A;  4ORC B;  4GBA A;  1C07 A;  1A75 B;  2TN4 A;  1PK0 D;  4JWQ A;  1JC2 A;  1S6I A;  2NXQ A;  1Y1X A;  1CM4 A;  1RWY A;  1KQM C;  4MEW A;  2NCO A;  4DRW A;  1ALV A;  2BEC A;  2COL B;  2P6B B;  1XFX O;  5B8I B;  4R1E A;  3CWG A;  1M31 A;  4C0J A;  3FWB A;  5JJG A;  1NX0 A;  5AER A;  2Y1M A;  2LE9 B;  2K2A A;  1K96 A;  2Q4U A;  2BKI B;  3NSL A;  2CBL A;  1QIV A;  3DF0 B;  3LK0 A;  2JRF A;  1DMO A;  1A4P A;  2LMU A;  2OTG C;  1TIZ A;  2BCB A;  4OR9 B;  1CDP A;  4JQ0 D;  1WDC C;  4N5X A;  2I2R E;  4AOM A;  2H61 A;  1EG4 A;  1A29 A;  3BUN B;  2LHL A;  2PAL A;  2PRU A;  4WRI A;  2JUL A;  2NLN A;  5CSI A;  3C1V A;  5CPV A;  1RTP 1;  1A75 A;  2KFG A;  2LLU A;  1V1F A;  4TNC A;  1IQ3 A;  1M45 A;  2M3W A;  1OZS A;  1DJZ A;  3EKH A;  2NCP A;  1OE9 B;  1AJ5 A;  1C7W A;  1EXR A;  4YGE B;  2D8N A;  2KI6 D;  3O2P A;  1J7R A;  1H8B A;  1DJH A;  2BCX A;  2ZN9 A;  1MXE A;  2BL0 B;  2LLT A;  4OVN F;  3VRR A;  1EH2 A;  2GGZ A;  5D7F A;  4AQJ A;  3I5I C;  1Y1A A;  2BE6 A;  2Y5I A;  1V1G A;  1FPW A;  2OS8 C;  3EK8 A;  2PVB A;  4MSP A;  2HPS A;  5CSN A;  1B8R A;  5J3X A;  1BG1 A;  1YUT A;  5FYX A;  1BR4 B;  1S5G Y;  1SNL A;  2VRG A;  1NCY A;  3OX5 A;  1B9A A;  2KOT A;  2HQ8 A;  1NIW A;  5CSJ A;  3CR2 A;  5I8N A;  1MHO A;  2KAV A;  4D1E A;  1UUS A;  2LLS A;  3F45 A;  1PAL A;  3DVE A;  5D69 A;  2CNP A;  4I5N B;  1M46 A;  3KHE A;  2G9B A;  1NUB A;  2OPO A;  1QX2 A;  1YUR A;  2V53 A;  1QVI Y;  4Q04 A;  1CTR A;  1IG5 A;  2L5X B;  1SRA A;  1UHK A;  1IQ5 A;  1CDL A;  2K7D A;  2LVV A;  2O60 A;  1Y0V H;  2I94 A;  3PAL A;  1TNQ A;  3TUY B;  1JFJ A;  1KFU L;  1SR6 B;  3IQQ A;  1UP5 A;  4WQ3 A;  3SG4 A;  2L0P A;  1F55 A;  2L4H A;  3I5F B;  1J7O A;  2F2O A;  1F54 A;  4N1G A;  1IJ6 A;  1JSA A;  1AUI B;  2K7C A;  3TDZ A;  5GQQ C;  1N65 A;  2A4J A;  3TDI A;  3MSE B;  1CKK A;  1CFC A;  4MZK A;  3TS5 B;  1TCO B;  1JFK A;  3I5H C;  2KBI A;  3BYA A;  1BLQ A;  3BOW A;  4MLW A;  1OOJ A;  2M29 A;  1AVS A;  1QAS A;  2IS9 A;  3SJS A;  2E30 A;  4DCK A;  2ZKM X;  2PAS A;  1B8C A;  1TOP A;  1S3P A;  3CTN A;  4MBE A;  4CLN A;  1WLZ A;  2EC6 C;  2KFH A;  2F8P A;  4MN0 A;  2JXL A;  3TUY C;  1K9P A;  1NPQ A;  1S26 D;  2KQY A;  2ZNE A;  5DKR A;  1NX3 A;  4NDB A;  1KQV A;  3HX4 A;  1SYM A;  2M8U A;  3I5I B;  2QPT A;  3I5G C;  1WY9 A;  3ICB A;  1QX5 B;  1QX7 A;  3O4Y A;  4HRH A;  3CZT X;  4ETO A;  3CS1 A;  1B4C A;  1HT9 A;  1YVL A;  4FTG A;  2AAO A;  1DJX A;  1F71 A;  4P5O E;  2JU0 A;  1D1O A;  1S6J A;  1K9U A;  3ZNI A;  2LVK A;  1JBA A;  1F70 A;  3FS7 A;  1RJV A;  1YUU A;  4OKH A;  1UHI A;  2KSP A;  2KYF A;  2WCE A;  4I5K A;  3HCM A;  4FQO A;  2CTN A;  1BOC A;  2E6W A;  3CR4 X;  1YR5 A;  1IRJ A;  2F33 A;  1XFW O;  2EHB A;  1BMO A;  1XFV O;  2PSR A;  3FIA A;  1ZUZ A;  1YUS A;  4U8D A;  1NCZ A;  4NDC A;  1DGV A;  3LL8 B;  1J7P A;  5BPJ A;  5I2Q A;  1BR1 B;  1QV0 A;  2LMT A;  1S36 A;  2K7B A;  2WND A;  1LA3 A;  1SCM B;  3H4S E;  1RRO A;  2ZRT A;  2LM5 A;  2MLF C;  2K8M B;  2LUC A;  4GFT A;  1LXF C;  1B47 A;  4MVF A;  2MJW B;  4M2P A;  4CFR A;  2RGI A;  4UPG A;  1KK7 Y;  2JOJ A;  3EVV A;  4PE1 A;  3IF7 A;  3CLN A;  3KO0 A;  5DKQ A;  3NXA A;  1NSH A;  3NSI A;  2L2E A;  1MQ1 A;  1CLM A;  4JPZ B;  1SW8 A;  1RFJ A;  2Y1N A;  3AAJ A;  2GGM A;  1X02 A;  1QAT A;  4CPV A;  3TS5 C;  3DVK A;  1DJI A;  4WQ2 A;  1SK6 D;  1SL7 A;  2EC6 B;  2Y4Q A;  3LLE A;  1JWD A;  3D10 A;  2BCA A;  2PMY A;  5HYD A;  4I5J A;  4GGF A;  1XO5 A;  3SIA A;  1S6C A;  3BUX B;  1QJT A;  1NYA A;  4BY5 A;  1N2D A;  1S5G Z;  1MR8 A;  1L7Z A;  4E68 A;  1FBV A;  2KAY A;  1KQM B;  1RK9 A;  1WLM A;  2GV5 A;  1DT7 B;  3BXK A;  3DD4 A;  1H4B A;  4OV2 A;  1Y1U A;  4A4C A;  1CFF A;  1MF8 B;  1F4Q A;  2LP3 A;  1KK7 Z;  2LC5 A;  2F3Z A;  3GK4 X;  2JPT A;  3DVJ A;  4QJ5 B;  1KFX L;  5AXI A;  5KSZ A;  1XK4 C;  1Y6W A;  1BJF A;  5TNC A;  4PHM A;  1JF0 A;  1NX1 A;  4NQG A;  4ICB A;  1EL4 A;  1FI5 A;  4PHK A;  1A03 A;  1DJY A;  3JVT B;  5HKZ A;  5DKN A;  2JTT A;  2L98 A;  3PLF B;  1QIW A;  3GOF A;  2B1U A;  2KDH A;  2KYC A;  4NDD A;  4YI8 A;  3PN7 B;  1XFY O;  1YX8 A;  2F2P A;  4ZCU A;  1CFD A;  2M1K B;  4HRE E;  1ALW A;  1MUX A; 
#chains in the Genus database with same CATH topology
 4L9M A;  1LKJ A;  1GGZ A;  2SAS A;  1L2O C;  1OMR A;  1SL8 A;  1TNW A;  3KF9 A;  4INX A;  3DZT A;  4ORA B;  2O5G A;  5CSF A;  3SIB A;  1K2H A;  5G08 A;  3TZ1 A;  3S0G A;  3SG7 A;  1OMV A;  1U5I A;  1J55 A;  2LCP A;  1CLB A;  3OB1 B;  2LHI A;  1TN4 A;  2QEH A;  3PM8 A;  2FOT A;  3OB2 B;  3VGO A;  1XYD A;  4PCW A;  5JOL A;  4PE0 A;  1T14 A;  2KAX A;  4USL A;  1SMG A;  2LMV A;  1YRU B;  1KCY A;  3BUO B;  2M7N A;  1PRW A;  3D77 A;  1XK4 A;  3UO9 A;  1SBJ A;  2JT0 A;  3OX6 A;  3DXL A;  1DEL A;  1QWV A;  3D78 A;  3PN7 C;  1FF1 A;  3KEV A;  1B7T Z;  1AK8 A;  2ZFD A;  2JNF A;  4PHN A;  3WHU B;  2JT8 A;  2LAN A;  4MRX A;  2FJU B;  1PUL A;  1K94 A;  5D3O A;  3A8R A;  3B6X A;  5AEQ A;  1GQM A;  5HLO A;  1ODB A;  3EVU A;  1G33 A;  1IGV A;  2WCK A;  3CYZ A;  3DF0 A;  3BOW B;  3K21 A;  3SG3 A;  1XFZ O;  4N1F A;  2KGR A;  3VRQ A;  2QEB A;  3KPX A;  4YI9 A;  1K90 D;  1WRZ A;  3IVT A;  1W7J B;  5KU1 A;  2R2I A;  1J1E A;  1SCM C;  4QJ3 B;  1Q80 A;  1Z4H A;  1QVI Z;  1R6P A;  1XFU O;  1OSA A;  1QV1 A;  2AUC A;  3ZWH A;  2KHN A;  3GK1 A;  4YRU A;  1IJ5 A;  1LA0 A;  1TRF A;  1QS7 A;  3EVR A;  4OZD A;  2WC5 A;  3VRO A;  1BF5 A;  1NX2 A;  4IL1 A;  1SCV A;  1XFR A;  2BL0 C;  4MZL A;  5ER4 X;  1M63 B;  4GGF C;  3R72 A;  1PSR A;  1TNX A;  3RZS A;  2EGD A;  1ORG A;  2KI4 C;  2M49 B;  3VRN A;  4MZJ A;  1B8L A;  2ZND A;  5ER5 A;  1IH0 A;  1W7I B;  5HKW A;  3E3R A;  4YGA A;  3D75 A;  1AHR A;  3I5G B;  2BBM A;  3FE6 A;  3O4X A;  1DVI A;  1IWQ A;  1DF0 B;  1ZFS A;  1SR6 C;  1J7Q A;  2WCF A;  4YGD B;  1KK8 C;  4YBH B;  1CMG A;  3BUW B;  4PAL A;  3I5H B;  3NSK A;  4C0K A;  1WDC B;  2Q91 A;  3OHM B;  2HQW A;  3OBV A;  2I18 A;  3V2L A;  5KTY A;  5IBW A;  3CZ0 A;  1F8H A;  1PVB A;  1C3Y A;  1LIN A;  3JTD B;  3AKA A;  1OMD A;  2H61 C;  2KFF A;  2KGB C;  3RM1 A;  3CZ2 A;  1DC1 A;  1CFP A;  2LVI A;  1CM1 A;  3LK1 A;  1DGU A;  3CGA A;  3I5F C;  1BU3 A;  3S0B A;  1SL9 A;  2KI4 B;  2JNX A;  2AMI A;  1K8U A;  1VRK A;  2QAC A;  5HKY A;  1FI6 A;  1JUO A;  1DJW A;  2JZI A;  1KWO C;  1UUR A;  1E8A A;  4GUK A;  2LUX A;  1KSO A;  2M1U A;  3BFB A;  5FI6 A;  1IIO A;  2F3Y A;  5HLV A;  2NZ0 A;  1U5I B;  1YTZ C;  1F4O A;  1L2O B;  1PSB A;  1XA5 A;  4P2Y B;  1KSM A;  2MBX A;  2WOS A;  1SY9 A;  2JC2 A;  3QRX A;  5I2L A;  4AQI A;  2JQ6 A;  1YX7 A;  2LVJ A;  3D0Y A;  1SKT A;  1KK8 B;  1IKU A;  3O6B A;  4CFQ A;  1CDN A;  1NWD A;  1AJ4 A;  3DVM A;  2K2F A;  4JKT A;  3CAB A;  1REC A;  2OTG B;  3BUM B;  3DYE A;  2FCD A;  4GGN A;  1UHN A;  1S1E A;  5PAL A;  2BBN A;  1UWO A;  1YVH A;  4GPL B;  2YGU A;  4DS7 A;  3JVT C;  3BQ3 A;  1P28 A;  2CXJ A;  1ZOT B;  2L50 A;  4BY4 A;  1UHH A;  4XJK B;  3LCP C;  1KFU S;  2G2B A;  1SSE B;  3AAK A;  1QTX A;  1GGW A;  1SPY A;  1G4Y R;  4PHJ A;  1DTL A;  2MAZ A;  3SG6 A;  4GNK B;  1CB1 A;  2K0J A;  5F6T A;  1BOD A;  2LAP A;  1XVJ A;  3WHT B;  3GK2 A;  1FW4 A;  4JD9 A;  3O78 A;  4ORB B;  4M2Q A;  1ZMZ A;  2CCM A;  3PAT A;  2K7O A;  2LV7 A;  5HL1 A;  4YGC B;  3S0E A;  1GJY A;  3PM2 A;  5K89 A;  3OP0 A;  3TDU A;  4CID A;  1CMF A;  4DUQ A;  2HF5 A;  2I7A A;  2BAP A;  1QXP A;  3EK7 A;  4XJK A;  5AAN A;  4F0Z B;  4YGB B;  3K1E A;  1MXL C;  2FCE A;  3VRP A;  3S0F A;  2ZRS A;  1CDM A;  3JTD C;  2WCJ A;  1DJG A;  4IJ7 A;  3OGN A;  2BE4 A;  1HQV A;  2M97 A;  4PE7 A;  2JTZ A;  3SG5 A;  3WXA A;  4HRG A;  2LNK A;  1B7T Y;  1OOF A;  3Q8I A;  1ZAC A;  3A4U B;  1TTX A;  4ZCV A;  3WNX B;  3NSO A;  4PE4 A;  3SS5 A;  2M7L A;  3B86 A;  2M9G A;  1AP4 A;  4PDZ A;  1PVA A;  3D0Y B;  4I5L B;  2LP2 A;  1M39 A;  4OCI A;  2WOR A;  1K93 D;  3EK4 A;  1BT6 A;  2MLE C;  1EJ3 A;  2WCM A;  3EKJ A;  4QJ4 B;  3SG2 A;  2HET A;  1KWO B;  4C0L A;  2L4I A;  1A2X A;  4GAO A;  1KFX S;  4DIR A;  1MWN A;  3RLZ A;  2KI6 C;  2DOQ A;  2H2K A;  2JXC A;  3CDN A;  1JF2 A;  5DIC A;  1B1G A;  5AFP A;  2ZN8 A;  4HSZ A;  1OQP A;  2ISD A;  2KNE A;  2BKH B;  2QEV A;  1QLK A;  3QME A;  3PFV A;  2L51 A;  2SCP A;  1R2U A;  3N7H A;  4M2O A;  5I2O A;  2K61 A;  1K9K A;  1OZO A;  2OS8 B;  1C7V A;  1EG3 A;  2WC8 A;  2M0R A;  1LVC D;  2WCH A;  1QLS A;  1NP8 A;  1N0Y A;  4XYN A;  1TNP A;  1UHJ A;  2MA2 A;  1OOH A;  2KLD A;  2JT3 A;  3AKB A;  1G8I A;  4MRY A;  1NCX A;  1DF0 A;  1CLL A;  2KQ6 A;  2MHH A;  2PQL A;  2JWW A;  2WCB A;  2CT9 A;  3M0W A;  3CR5 X;  2L2C A;  4A4B A;  2ERB A;  3NHI A;  3PSR A;  1WRL A;  3IQO A;  1K95 A;  3EG5 B;  1CNP A;  1WRK A;  2KBM A;  1J1D A;  1YRT B;  1TCF A;  5FI2 A;  3FWC A;  3NGV A;  2MRD A;  4ORC B;  4GBA A;  1C07 A;  4PT1 A;  1A75 B;  2TN4 A;  1PK0 D;  4JWQ A;  1JC2 A;  1S6I A;  2NXQ A;  2JPO A;  1Y1X A;  1CM4 A;  1RWY A;  1KQM C;  4MEW A;  2NCO A;  4DRW A;  1ALV A;  2BEC A;  2COL B;  3B87 A;  1W9Z A;  2P6B B;  1XFX O;  5B8I B;  4R1E A;  3CWG A;  1M31 A;  4C0J A;  3FWB A;  5JJG A;  1NX0 A;  5AER A;  2Y1M A;  3SS3 A;  2LE9 B;  5I94 A;  2K2A A;  2KLE A;  1K96 A;  2Q4U A;  2BKI B;  2K60 A;  3NSL A;  2CBL A;  1QIV A;  3DF0 B;  3LK0 A;  2JRF A;  1DMO A;  1A4P A;  2LMU A;  4HRE E;  2OTG C;  1TIZ A;  2BCB A;  4OR9 B;  1CDP A;  4JQ0 D;  1WDC C;  4N5X A;  2I2R E;  4AOM A;  2H61 A;  1EG4 A;  1A29 A;  3BUN B;  2LHL A;  2PAL A;  2PRU A;  4WRI A;  2JUL A;  2NLN A;  3BJH A;  5CSI A;  3C1V A;  5CPV A;  1RTP 1;  1A75 A;  2KFG A;  2LLU A;  1V1F A;  4TNC A;  1IQ3 A;  1M45 A;  2KPH A;  2M3W A;  1OZS A;  1DJZ A;  3EKH A;  2NCP A;  1OE9 B;  1AJ5 A;  1C7W A;  5FI7 A;  1EXR A;  3D74 A;  2D8N A;  2KI6 D;  4YGE B;  3O2P A;  1J7R A;  3FE8 A;  1H8B A;  1DJH A;  2BCX A;  2ZN9 A;  1MXE A;  1OOG A;  2BL0 B;  2LLT A;  4OVN F;  3VRR A;  1EH2 A;  2GGZ A;  5D7F A;  4AQJ A;  3I5I C;  1Y1A A;  2BE6 A;  2Y5I A;  1V1G A;  1FPW A;  2OS8 C;  3EK8 A;  2PVB A;  4MSP A;  2HPS A;  5CSN A;  1B8R A;  5J3X A;  1BG1 A;  1YUT A;  5FYX A;  1BR4 B;  1S5G Y;  1SNL A;  2VRG A;  1NCY A;  3OX5 A;  1B9A A;  2KOT A;  2HQ8 A;  3VB1 A;  1NIW A;  3R1P A;  1TUZ A;  5CSJ A;  3CR2 A;  1C3Z A;  5I8N A;  1MHO A;  2KAV A;  4D1E A;  1UUS A;  2LLS A;  3F45 A;  4INW A;  1PAL A;  3DY9 A;  2BNX A;  3DVE A;  5D69 A;  2CNP A;  4I5N B;  3UNW A;  1M46 A;  3KHE A;  2G9B A;  1NUB A;  3D76 A;  2OPO A;  1QX2 A;  1YUR A;  2QDI A;  2V53 A;  1QVI Y;  4Q04 A;  1CTR A;  1IG5 A;  2L5X B;  1SRA A;  1UHK A;  2P70 A;  1IQ5 A;  1CDL A;  2K7D A;  2LVV A;  2O60 A;  1Y0V H;  2I94 A;  3PAL A;  1TNQ A;  3TUY B;  1JFJ A;  1KFU L;  2GTE A;  1SR6 B;  3IQQ A;  1UP5 A;  4WQ3 A;  3SG4 A;  2L0P A;  1TWO A;  1F55 A;  2L4H A;  3I5F B;  1J7O A;  2F2O A;  1F54 A;  4FQT A;  4N1G A;  1IJ6 A;  2WCL A;  3R1O A;  1AUI B;  1JSA A;  2K7C A;  3L4L A;  3TDZ A;  5GQQ C;  1N65 A;  2A4J A;  3TDI A;  3MSE B;  1CKK A;  1CFC A;  4MZK A;  3TS5 B;  1TCO B;  1JFK A;  3I5H C;  1OOI X;  2KBI A;  3BFH A;  3BYA A;  3SS4 A;  1BLQ A;  3BOW A;  4MLW A;  1OOJ A;  2M29 A;  1AVS A;  1QAS A;  2IS9 A;  3SJS A;  2E30 A;  4DCK A;  2ZKM X;  2PAS A;  1B8C A;  1TOP A;  1S3P A;  1LS8 A;  3CTN A;  4MBE A;  1WLZ A;  2EC6 C;  2KFH A;  4CLN A;  2F8P A;  4MN0 A;  2JXL A;  3TUY C;  1K9P A;  1NPQ A;  1S26 D;  2KQY A;  2ZNE A;  5DKR A;  1NX3 A;  4NDB A;  1KQV A;  3HX4 A;  1SYM A;  2M8U A;  3D73 A;  3I5I B;  2QPT A;  3I5G C;  1WY9 A;  3ICB A;  1QX5 B;  1QX7 A;  3O4Y A;  4HRH A;  3CZT X;  4ETO A;  3CS1 A;  1B4C A;  1HT9 A;  1YVL A;  4FTG A;  2AAO A;  1DJX A;  1F71 A;  4P5O E;  2JU0 A;  1D1O A;  1S6J A;  1K9U A;  3ZNI A;  2LVK A;  1JBA A;  1F70 A;  3FS7 A;  1RJV A;  1YUU A;  4OKH A;  1UHI A;  2KSP A;  2KYF A;  2WCE A;  3FE9 A;  1OW4 A;  4I5K A;  3HCM A;  4FQO A;  2CTN A;  1BOC A;  2E6W A;  2FJY A;  3CR4 X;  1YR5 A;  1IRJ A;  2F33 A;  1XFW O;  2EHB A;  1BMO A;  1XFV O;  2PSR A;  3FIA A;  1ZUZ A;  1YUS A;  4U8D A;  1NCZ A;  4NDC A;  1DGV A;  3LL8 B;  1J7P A;  5BPJ A;  5I2Q A;  1BR1 B;  1QV0 A;  2LMT A;  1S36 A;  2K7B A;  2WND A;  1LA3 A;  1SCM B;  1DQE A;  1RRO A;  3H4S E;  2ZRT A;  3NHT A;  2LM5 A;  4F7F A;  2MLF C;  2K8M B;  2LUC A;  2P71 A;  4GFT A;  1LXF C;  1GM0 A;  1B47 A;  4MVF A;  3S0A A;  2MJW B;  1Z2C B;  4M2P A;  4CFR A;  2RGI A;  4UPG A;  1KK7 Y;  2JOJ A;  3EVV A;  4PE1 A;  3IF7 A;  3CLN A;  3KO0 A;  5DKQ A;  3NXA A;  1NSH A;  3NSI A;  2L2E A;  1MQ1 A;  1CLM A;  4JPZ B;  1SW8 A;  1RFJ A;  2Y1N A;  3AAJ A;  2GGM A;  1X02 A;  1QAT A;  4CPV A;  3TS5 C;  3DVK A;  1DJI A;  4WQ2 A;  1SK6 D;  1SL7 A;  2EC6 B;  2Y4Q A;  3LLE A;  1JWD A;  3D10 A;  2BCA A;  2PMY A;  5HYD A;  2H8V A;  4I5J A;  4GGF A;  1XO5 A;  3SIA A;  4KYN A;  1S6C A;  3BUX B;  1QJT A;  1NYA A;  3CZ1 A;  4BY5 A;  1N2D A;  1S5G Z;  1MR8 A;  1L7Z A;  4E68 A;  1FBV A;  2KAY A;  1KQM B;  1RK9 A;  1WLM A;  2GV5 A;  1DT7 B;  3BXK A;  3DD4 A;  1H4B A;  4OV2 A;  1Y1U A;  4A4C A;  2PYQ A;  1CFF A;  1DEK A;  1MF8 B;  1F4Q A;  2LP3 A;  1KK7 Z;  2LC5 A;  2F3Z A;  3GK4 X;  2JPT A;  3DVJ A;  5EL2 A;  4QJ5 B;  1KFX L;  5AXI A;  5KSZ A;  1XK4 C;  3PJI A;  1Y6W A;  1BJF A;  5TNC A;  4PHM A;  1JF0 A;  1NX1 A;  4NQG A;  2L5Y A;  4ICB A;  1EL4 A;  3L4A A;  4PHK A;  1FI5 A;  2QEO A;  1A03 A;  1DJY A;  3JVT B;  5HKZ A;  3B7A A;  5DKN A;  2JTT A;  3R1V A;  3S0D A;  2L98 A;  3PLF B;  3B88 A;  2WC6 A;  1QIW A;  3GOF A;  2B1U A;  2KDH A;  2KYC A;  4NDD A;  4YI8 A;  3PN7 B;  1XFY O;  3L47 A;  1TUJ A;  1YX8 A;  2F2P A;  4ZCU A;  1CFD A;  2M1K B;  3BFA A;  1ALW A;  1MUX A; 
#chains in the Genus database with same CATH homology
 4L9M A;  1LKJ A;  1GGZ A;  2SAS A;  1L2O C;  1OMR A;  1SL8 A;  1TNW A;  3KF9 A;  4ORA B;  2O5G A;  5CSF A;  3SIB A;  1K2H A;  5G08 A;  3TZ1 A;  3SG7 A;  1OMV A;  1U5I A;  1J55 A;  2LCP A;  1CLB A;  3OB1 B;  2LHI A;  1TN4 A;  3PM8 A;  2FOT A;  3OB2 B;  3VGO A;  1XYD A;  4PCW A;  5JOL A;  4PE0 A;  2KAX A;  4USL A;  1SMG A;  2LMV A;  1YRU B;  1KCY A;  3BUO B;  2M7N A;  1PRW A;  1XK4 A;  1SBJ A;  2JT0 A;  3OX6 A;  3PN7 C;  1FF1 A;  3KEV A;  1B7T Z;  1AK8 A;  2ZFD A;  2JNF A;  4PHN A;  3WHU B;  2JT8 A;  2LAN A;  4MRX A;  2FJU B;  1PUL A;  1K94 A;  3A8R A;  5AEQ A;  1GQM A;  5HLO A;  1ODB A;  3EVU A;  1G33 A;  1IGV A;  3DF0 A;  3BOW B;  3K21 A;  3SG3 A;  1XFZ O;  4N1F A;  2KGR A;  3VRQ A;  3KPX A;  4YI9 A;  1K90 D;  1WRZ A;  1W7J B;  5KU1 A;  2R2I A;  1J1E A;  1SCM C;  4QJ3 B;  1Q80 A;  1QVI Z;  1R6P A;  1XFU O;  1OSA A;  1QV1 A;  2AUC A;  3ZWH A;  2KHN A;  3GK1 A;  4YRU A;  1IJ5 A;  1LA0 A;  1TRF A;  1QS7 A;  3EVR A;  3VRO A;  1BF5 A;  1NX2 A;  4IL1 A;  1SCV A;  2BL0 C;  4MZL A;  5ER4 X;  1M63 B;  4GGF C;  1PSR A;  1TNX A;  2EGD A;  2KI4 C;  2M49 B;  3VRN A;  4MZJ A;  1B8L A;  2ZND A;  5ER5 A;  1IH0 A;  1W7I B;  5HKW A;  3E3R A;  4YGA A;  1AHR A;  3I5G B;  2BBM A;  1DVI A;  1IWQ A;  1DF0 B;  1ZFS A;  1SR6 C;  1J7Q A;  2WCF A;  4YGD B;  1KK8 C;  4YBH B;  1CMG A;  3BUW B;  4PAL A;  3I5H B;  3NSK A;  4C0K A;  1WDC B;  2Q91 A;  3OHM B;  2HQW A;  5KTY A;  2I18 A;  5IBW A;  1F8H A;  1PVB A;  1LIN A;  3JTD B;  3AKA A;  1OMD A;  2H61 C;  2KFF A;  2KGB C;  3RM1 A;  1CFP A;  2LVI A;  1CM1 A;  3LK1 A;  1DGU A;  3CGA A;  3I5F C;  1BU3 A;  1SL9 A;  2KI4 B;  2JNX A;  2AMI A;  1K8U A;  1VRK A;  2QAC A;  5HKY A;  1FI6 A;  1JUO A;  1DJW A;  2JZI A;  1KWO C;  1UUR A;  1E8A A;  4GUK A;  2LUX A;  1KSO A;  2M1U A;  2F3Y A;  5HLV A;  2NZ0 A;  1U5I B;  1YTZ C;  1F4O A;  1L2O B;  1PSB A;  1XA5 A;  4P2Y B;  1KSM A;  2MBX A;  2WOS A;  1SY9 A;  2JC2 A;  3QRX A;  5I2L A;  4AQI A;  2JQ6 A;  1YX7 A;  2LVJ A;  3D0Y A;  1SKT A;  1KK8 B;  1IKU A;  3O6B A;  4CFQ A;  1CDN A;  1NWD A;  1AJ4 A;  3DVM A;  2K2F A;  1REC A;  2OTG B;  3BUM B;  2FCD A;  4GGN A;  1UHN A;  1S1E A;  5PAL A;  2BBN A;  1UWO A;  1YVH A;  4GPL B;  4DS7 A;  3JVT C;  3BQ3 A;  2CXJ A;  1ZOT B;  2L50 A;  4BY4 A;  1UHH A;  4XJK B;  3LCP C;  1KFU S;  2G2B A;  3AAK A;  1QTX A;  1GGW A;  1SPY A;  1G4Y R;  4PHJ A;  1DTL A;  2MAZ A;  3SG6 A;  4GNK B;  1CB1 A;  2K0J A;  5F6T A;  1BOD A;  2LAP A;  1XVJ A;  3WHT B;  3GK2 A;  1FW4 A;  3O78 A;  4ORB B;  4M2Q A;  1ZMZ A;  2CCM A;  3PAT A;  2K7O A;  2LV7 A;  4YGC B;  1GJY A;  5K89 A;  3OP0 A;  3TDU A;  4CID A;  1CMF A;  4DUQ A;  2HF5 A;  2I7A A;  1QXP A;  3EK7 A;  4XJK A;  5AAN A;  4F0Z B;  4YGB B;  3VRP A;  1MXL C;  2FCE A;  2ZRS A;  1CDM A;  3JTD C;  1DJG A;  2BE4 A;  1HQV A;  2M97 A;  4PE7 A;  2JTZ A;  3SG5 A;  3WXA A;  4HRG A;  2LNK A;  1B7T Y;  1ZAC A;  3A4U B;  1TTX A;  4ZCV A;  3WNX B;  3NSO A;  4PE4 A;  2M7L A;  2M9G A;  1AP4 A;  4PDZ A;  1PVA A;  3D0Y B;  4I5L B;  2LP2 A;  1M39 A;  4OCI A;  2WOR A;  1K93 D;  3EK4 A;  1BT6 A;  2MLE C;  1EJ3 A;  3EKJ A;  4QJ4 B;  3SG2 A;  2HET A;  1KWO B;  4C0L A;  2L4I A;  1A2X A;  4GAO A;  1KFX S;  4DIR A;  1MWN A;  3RLZ A;  2KI6 C;  2DOQ A;  2H2K A;  2JXC A;  1JF2 A;  1B1G A;  5AFP A;  2ZN8 A;  4HSZ A;  1OQP A;  2ISD A;  2KNE A;  2BKH B;  1QLK A;  3PFV A;  2L51 A;  2SCP A;  1R2U A;  4M2O A;  5I2O A;  2K61 A;  1K9K A;  1OZO A;  2OS8 B;  1C7V A;  1EG3 A;  2WC8 A;  2M0R A;  1LVC D;  1QLS A;  1NP8 A;  1N0Y A;  4XYN A;  1TNP A;  1UHJ A;  2MA2 A;  2JT3 A;  3AKB A;  1G8I A;  4MRY A;  1NCX A;  1DF0 A;  1CLL A;  2KQ6 A;  2MHH A;  2JWW A;  2WCB A;  2CT9 A;  3M0W A;  3CR5 X;  4A4B A;  3PSR A;  1WRL A;  3IQO A;  1K95 A;  1CNP A;  1WRK A;  2KBM A;  1J1D A;  1YRT B;  1TCF A;  3FWC A;  2MRD A;  4ORC B;  4GBA A;  1C07 A;  1A75 B;  2TN4 A;  1PK0 D;  4JWQ A;  1JC2 A;  1S6I A;  2NXQ A;  1Y1X A;  1CM4 A;  1RWY A;  1KQM C;  4MEW A;  2NCO A;  4DRW A;  1ALV A;  2BEC A;  2COL B;  2P6B B;  1XFX O;  5B8I B;  4R1E A;  3CWG A;  1M31 A;  4C0J A;  3FWB A;  5JJG A;  1NX0 A;  5AER A;  2Y1M A;  2LE9 B;  2K2A A;  1K96 A;  2Q4U A;  2BKI B;  3NSL A;  2CBL A;  1QIV A;  3DF0 B;  3LK0 A;  2JRF A;  1DMO A;  1A4P A;  2LMU A;  2OTG C;  1TIZ A;  2BCB A;  4OR9 B;  1CDP A;  4JQ0 D;  1WDC C;  4N5X A;  2I2R E;  4AOM A;  2H61 A;  1EG4 A;  1A29 A;  3BUN B;  2LHL A;  2PAL A;  2PRU A;  4WRI A;  2JUL A;  2NLN A;  5CSI A;  3C1V A;  5CPV A;  1RTP 1;  1A75 A;  2KFG A;  2LLU A;  1V1F A;  4TNC A;  1IQ3 A;  1M45 A;  2M3W A;  1OZS A;  1DJZ A;  3EKH A;  2NCP A;  1OE9 B;  1AJ5 A;  1C7W A;  1EXR A;  4YGE B;  2D8N A;  2KI6 D;  3O2P A;  1J7R A;  1H8B A;  1DJH A;  2BCX A;  2ZN9 A;  1MXE A;  2BL0 B;  2LLT A;  4OVN F;  3VRR A;  1EH2 A;  2GGZ A;  5D7F A;  4AQJ A;  3I5I C;  1Y1A A;  2BE6 A;  2Y5I A;  1V1G A;  1FPW A;  2OS8 C;  3EK8 A;  2PVB A;  4MSP A;  2HPS A;  5CSN A;  1B8R A;  5J3X A;  1BG1 A;  1YUT A;  5FYX A;  1BR4 B;  1S5G Y;  1SNL A;  2VRG A;  1NCY A;  3OX5 A;  1B9A A;  2KOT A;  2HQ8 A;  1NIW A;  5CSJ A;  3CR2 A;  5I8N A;  1MHO A;  2KAV A;  4D1E A;  1UUS A;  2LLS A;  3F45 A;  1PAL A;  3DVE A;  5D69 A;  2CNP A;  4I5N B;  1M46 A;  3KHE A;  2G9B A;  1NUB A;  2OPO A;  1QX2 A;  1YUR A;  2V53 A;  1QVI Y;  4Q04 A;  1CTR A;  1IG5 A;  2L5X B;  1SRA A;  1UHK A;  1IQ5 A;  1CDL A;  2K7D A;  2LVV A;  2O60 A;  1Y0V H;  2I94 A;  3PAL A;  1TNQ A;  3TUY B;  1JFJ A;  1KFU L;  1SR6 B;  3IQQ A;  1UP5 A;  4WQ3 A;  3SG4 A;  2L0P A;  1F55 A;  2L4H A;  3I5F B;  1J7O A;  2F2O A;  1F54 A;  4N1G A;  1IJ6 A;  1JSA A;  1AUI B;  2K7C A;  3TDZ A;  5GQQ C;  1N65 A;  2A4J A;  3TDI A;  3MSE B;  1CKK A;  1CFC A;  4MZK A;  3TS5 B;  1TCO B;  1JFK A;  3I5H C;  2KBI A;  3BYA A;  1BLQ A;  3BOW A;  4MLW A;  1OOJ A;  2M29 A;  1AVS A;  1QAS A;  2IS9 A;  3SJS A;  2E30 A;  4DCK A;  2ZKM X;  2PAS A;  1B8C A;  1TOP A;  1S3P A;  3CTN A;  4MBE A;  4CLN A;  1WLZ A;  2EC6 C;  2KFH A;  2F8P A;  4MN0 A;  2JXL A;  3TUY C;  1K9P A;  1NPQ A;  1S26 D;  2KQY A;  2ZNE A;  5DKR A;  1NX3 A;  4NDB A;  1KQV A;  3HX4 A;  1SYM A;  2M8U A;  3I5I B;  2QPT A;  3I5G C;  1WY9 A;  3ICB A;  1QX5 B;  1QX7 A;  3O4Y A;  4HRH A;  3CZT X;  4ETO A;  3CS1 A;  1B4C A;  1HT9 A;  1YVL A;  4FTG A;  2AAO A;  1DJX A;  1F71 A;  4P5O E;  2JU0 A;  1D1O A;  1S6J A;  1K9U A;  3ZNI A;  2LVK A;  1JBA A;  1F70 A;  3FS7 A;  1RJV A;  1YUU A;  4OKH A;  1UHI A;  2KSP A;  2KYF A;  2WCE A;  4I5K A;  3HCM A;  4FQO A;  2CTN A;  1BOC A;  2E6W A;  3CR4 X;  1YR5 A;  1IRJ A;  2F33 A;  1XFW O;  2EHB A;  1BMO A;  1XFV O;  2PSR A;  3FIA A;  1ZUZ A;  1YUS A;  4U8D A;  1NCZ A;  4NDC A;  1DGV A;  3LL8 B;  1J7P A;  5BPJ A;  5I2Q A;  1BR1 B;  1QV0 A;  2LMT A;  1S36 A;  2K7B A;  2WND A;  1LA3 A;  1SCM B;  3H4S E;  1RRO A;  2ZRT A;  2LM5 A;  2MLF C;  2K8M B;  2LUC A;  4GFT A;  1LXF C;  1B47 A;  4MVF A;  2MJW B;  4M2P A;  4CFR A;  2RGI A;  4UPG A;  1KK7 Y;  2JOJ A;  3EVV A;  4PE1 A;  3IF7 A;  3CLN A;  3KO0 A;  5DKQ A;  3NXA A;  1NSH A;  3NSI A;  2L2E A;  1MQ1 A;  1CLM A;  4JPZ B;  1SW8 A;  1RFJ A;  2Y1N A;  3AAJ A;  2GGM A;  1X02 A;  1QAT A;  4CPV A;  3TS5 C;  3DVK A;  1DJI A;  4WQ2 A;  1SK6 D;  1SL7 A;  2EC6 B;  2Y4Q A;  3LLE A;  1JWD A;  3D10 A;  2BCA A;  2PMY A;  5HYD A;  4I5J A;  4GGF A;  1XO5 A;  3SIA A;  1S6C A;  3BUX B;  1QJT A;  1NYA A;  4BY5 A;  1N2D A;  1S5G Z;  1MR8 A;  1L7Z A;  4E68 A;  1FBV A;  2KAY A;  1KQM B;  1RK9 A;  1WLM A;  2GV5 A;  1DT7 B;  3BXK A;  3DD4 A;  1H4B A;  4OV2 A;  1Y1U A;  4A4C A;  1CFF A;  1MF8 B;  1F4Q A;  2LP3 A;  1KK7 Z;  2LC5 A;  2F3Z A;  3GK4 X;  2JPT A;  3DVJ A;  4QJ5 B;  1KFX L;  5AXI A;  5KSZ A;  1XK4 C;  1Y6W A;  1BJF A;  5TNC A;  4PHM A;  1JF0 A;  1NX1 A;  4NQG A;  4ICB A;  1EL4 A;  1FI5 A;  4PHK A;  1A03 A;  1DJY A;  3JVT B;  5HKZ A;  5DKN A;  2JTT A;  2L98 A;  3PLF B;  1QIW A;  3GOF A;  2B1U A;  2KDH A;  2KYC A;  4NDD A;  4YI8 A;  3PN7 B;  1XFY O;  1YX8 A;  2F2P A;  4ZCU A;  1CFD A;  2M1K B;  4HRE E;  1ALW A;  1MUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...