1ZOTB

Crystal structure analysis of the cyaa/c-cam with pmeapp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords CyaA with C-terminal Calmodulin
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin.
pubmed doi rcsb
source organism Bordetella pertussis
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zotB00
4CIDA 1B8CA 4YBHB 3KO0A 1BOCA 1AJ5A 1DJWA 2LANA 5CSIA 1K90D 1DJHA 1KQVA 1LINA 3IF7A 2F33A 4XJKB 1SKTA 2LAPA 1TNXA 3DF0B 1NYAA 4PE1A 2NLNA 2WCFA 1KSOA 1OMDA 1MUXA 1K96A 1WLZA 4YGDB 2Y4QA 1HQVA 3VRPA 1S1EA 1AHRA 1XFZO 3EK8A 4L9MA 1XYDA 1SL9A 1YX8A 2P6BB 1MQ1A 1CFDA 1QJTA 2LE9B 2PASA 2GV5A 1B7TY 3AKBA 1S5GZ 1S36A 3LK0A 2GGMA 1CNPA 2LUCA 2I7AA 3GK4X 1RROA 2E6WA 1LA3A 1B7TZ 1OZSA 4AOMA 1BU3A 1BODA 1SRAA 1TIZA 3M0WA 2L4IA 1FBVA 1PSBA 2MHHA 2WORA 1WRLA 1Y1UA 2JNXA 1WDCB 5F6TA 1YRUB 3EVUA 1BJFA 3JTDB 5KTYA 2EHBA 2Q91A 1SCVA 2BCXA 3NSKA 3I5HC 1QS7A 1SMGA 1N0YA 2JPTA 1JF2A 4YGAA 3IQOA 1S6CA 3OX5A 2L98A 1NCYA 2KFGA 1BT6A 3VGOA 3BXKA 1EG3A 4N1GA 4YRUA 1KFXL 2B1UA 1Y1XA 2KNEA 1B4CA 1B47A 1IQ5A 1AK8A 2WC8A 1JBAA 4M2OA 2K7OA 1RTP1 1NPQA 2QPTA 1TN4A 1K9UA 2LVIA 1CKKA 2KYCA 1S6JA 1SCMC 4JQ0D 3KPXA 1JFKA 4I5JA 4NDBA 2JXLA 1TNQA 2ZNDA 4A4BA 2I2RE 2JU0A 3BOWB 4QJ4B 4MEWA 2K2AA 1R6PA 1UHIA 1EL4A 5ER5A 3BQ3A 3FWBA 4MLWA 2G2BA 1RJVA 2L4HA 3BUWB 1AP4A 3OP0A 2F8PA 3BUNB 3PN7B 2L51A 3EKHA 1K8UA 2LMVA 2VRGA 1X02A 2LV7A 1BG1A 2NXQA 1QLKA 1UUSA 4PCWA 1K2HA 4WQ2A 5JJGA 4MRXA 1MHOA 3TS5C 4GGFC 5JOLA 2ZRTA 1J7PA 1UHKA 2JTZA 3PM8A 4N1FA 2FCDA 4PHNA 2M8UA 1AJ4A 1DT7B 3LCPC 5AFPA 2K61A 1JFJA 1DVIA 1SNLA 2K7DA 4GFTA 4CLNA 2EC6B 1K93D 3SG4A 5HKYA 1YURA 2JNFA 3BYAA 1QTXA 4F0ZB 1KFUS 3KF9A 1W7IB 2M1KB 2K0JA 1ZMZA 3AAKA 3CS1A 5AXIA 3A8RA 1A29A 2LHLA 2KI4C 3OB1B 4BY4A 3VRRA 2KI6C 5KU1A 2LCPA 5TNCA 4FQOA 1TTXA 2Y1MA 1DGUA 3WNXB 2MJWB 1QV0A 1L2OC 1YTZC 1H8BA 1IH0A 1TOPA 1U5IB 3O2PA 1UHHA 1D1OA 1YUTA 4DS7A 1EG4A 1B9AA 2CBLA 2JT3A 1NP8A 3EVVA 3FWCA 5CPVA 3CTNA 3WHTB 1YUUA 1CLMA 2PVBA 1OMVA 1BF5A 3DVMA 3SG6A 2V53A 5I2OA 2NZ0A 1KWOC 4ETOA 2KGBC 3DVKA 1NX2A 4MRYA 1BLQA 2BKHB 3AKAA 1K94A 2JULA 2LLUA 1F54A 1DGVA 2ZN9A 1DTLA 4MZKA 2K7BA 1E8AA 5D69A 2BCAA 3KHEA 2BECA 2CNPA 1SY9A 1UHNA 1MF8B 3QRXA 1K9PA 3RLZA 3TUYC 4GGFA 2TN4A 1U5IA 3NSIA 1ZFSA 5HLOA 2OPOA 4MN0A 4USLA 1DJYA 4HRHA 1B8LA 1GQMA 2ZRSA 2M9GA 3OB2B 2CT9A 1K9KA 1YR5A 3A4UB 4MZLA 3DVEA 2BBMA 2KDHA 1N2DA 4QJ3B 4I5LB 4OCIA 1KWOB 5HKZA 1QX5B 2WOSA 1G4YR 4MSPA 1CLLA 2L2EA 1IGVA 3O4YA 4ORCB 3NXAA 1V1GA 2O5GA 1C7WA 1MWNA 2LM5A 2WCBA 2ZKMX 2OS8C 4YGBB 4NQGA 5HLVA 2EGDA 1G8IA 3TUYB 4BY5A 1L7ZA 1RK9A 1PVBA 2K7CA 2FCEA 3IQQA 1QIWA 4ZCVA 3CZTX 1LXFC 2JWWA 3OHMB 4E68A 1FPWA 2LNKA 3WHUB 1Y1AA 2KAXA 1BR4B 1SL7A 1YUSA 2F2OA 2H61A 2JTTA 3BUXB 1WRZA 1DJIA 3H4SE 2KQ6A 1J7OA 1H4BA 2OTGC 1J55A 1QATA 1F4QA 1ZACA 1FF1A 2CTNA 2R2IA 2KBIA 2M7LA 3K21A 2IS9A 4MVFA 1XO5A 1TNWA 1F4OA 3I5FC 2LMTA 3CR4X 3LLEA 1PK0D 1XFWO 2NCOA 4YGCB 3FIAA 3SG2A 1KCYA 1V1FA 3SG7A 1EH2A 4P5OE 1NWDA 2OS8B 3KEVA 2ISDA 4YGEB 2FJUB 2JXCA 4OR9B 5GQQC 1WLMA 2KYFA 2E30A 1YVHA 2M1UA 1CDNA 1CDMA 4U8DA 3I5HB 4QJ5B 2ZN8A 3GK2A 4M2PA 2MLFC 1CM4A 1LA0A 5I2LA 1M45A 1G33A 3TZ1A 1PULA 1XFVO 5G08A 4GBAA 3PLFB 1UWOA 2L0PA 1F55A 3EK7A 1W7JB 1FI6A 2BE4A 2LLSA 4UPGA 2OTGB 1PSRA 2L5XB 4PDZA 2JC2A 2KHNA 5J3XA 2F3YA 1IQ3A 3I5FB 1B1GA 1YVLA 3D0YA 4DCKA 4DRWA 4GGNA 2A4JA 1IWQA 3HCMA 2WCEA 1SL8A 2ZNEA 3DD4A 1SCMB 3MSEB 5DKQA 4XYNA 4YI8A 1QIVA 1GJYA 3CR5X 2SASA 1UURA 2BE6A 3SJSA 3EK4A 4PE7A 4ORAB 2Y1NA 5CSNA 3WXAA 2PALA 4CPVA 5DKRA 3TDUA 1XFYO 2QACA 2WNDA 2KFFA 1KFUL 3FS7A 3JVTC 2H2KA 1J1DA 1A4PA 4PHKA 2AUCA 4GNKB 3PALA 3PFVA 5IBWA 1ODBA 3CR2A 2NCPA 1C07A 5HKWA 1FW4A 1M31A 1N65A 3BUMB 1NCZA 1KQMC 3TDIA 3TS5B 1Y6WA 2LVKA 1NX3A 3SIAA 1S26D 1SK6D 1TCFA 1BMOA 2G9BA 1CMGA 1A75A 4GAOA 2KAYA 1JWDA 4OKHA 1XK4C 1QVIY 3SIBA 3OX6A 5AANA 4R1EA 4CFQA 2H61C 1VRKA 4PE0A 4D1EA 3HX4A 1OOJA 1UHJA 3E3RA 3PSRA 4I5NB 1QVIZ 1EXRA 1XVJA 5CSJA 2KI6D 1SPYA 4ORBB 1RWYA 2M3WA 4C0JA 3LL8B 3JVTB 3PATA 4GUKA 4TNCA 2KI4B 1AVSA 1SW8A 4PHMA 5HYDA 2SCPA 1YRTB 1J7QA 1KK8C 1DF0A 1L2OB 1J1EA 1Y0VH 5BPJA 1QX2A 3SG5A 1KQMB 1CTRA 4P2YB 1CFPA 1F71A 4PHJA 2LVJA 2JRFA 5K89A 2I94A 2Q4UA 2MRDA 2RGIA 4A4CA 2JT0A 2LC5A 5PALA 5CSFA 1MXLC 4Q04A 4GPLB 2MA2A 1CMFA 4IL1A 4MZJA 4NDDA 1CFFA 3RM1A 1BR1B 1ZUZA 3O78A 2D8NA 4OVNF 1EJ3A 5KSZA 2ZFDA 4N5XA 2I18A 5B8IB 2BL0C 1WDCC 2FOTA 2KFHA 1KK8B 1DJXA 3JTDC 1OSAA 2M0RA 2PMYA 1OQPA 5ER4X 1QX7A 1S5GY 2K8MB 1MR8A 3BUOB 1SYMA 1SBJA 2K2FA 1M46A 1XA5A 3EVRA 1MXEA 1DJZA 1ALWA 4MBEA 1PALA 1XK4A 3VROA 1IJ5A 3SG3A 2PRUA 1JUOA 1SR6C 1M39A 1QASA 2LP2A 4FTGA 1ALVA 1JF0A 1GGZA 1NX1A 1Q80A 2LHIA 1AUIB 1JC2A 3TDZA 1DJGA 4I5KA 1YX7A 2KOTA 1NCXA 3D0YB 2BL0B 4XJKA 2DOQA 3I5IC 2M97A 3DF0A 1A03A 2AMIA 3GOFA 3CWGA 1IKUA 1QXPA 1NUBA 4PALA 1XFUO 1TCOB 1DMOA 2JZIA 3AAJA 4JPZB 1KFXS 1LVCD 2HQ8A 2PSRA 1RFJA 1M63B 5AEQA 2MLEC 1JSAA 1A2XA 2BCBA 1FI5A 4DUQA 3PN7C 1SR6B 1OZOA 1KSMA 1IJ6A 3NSLA 3CGAA 2O60A 2BBNA 2JT8A 2JOJA 1IRJA 3I5IB 3LK1A 1CDLA 1PRWA 2EC6C 4JWQA 1J7RA 1A75B 2KAVA 4ICBA 1F70A 2HF5A 3VRQA 1QV1A 3I5GC 1NIWA 3O6BA 1GGWA 3ICBA 4AQJA 2M29A 5FYXA 1WY9A 2CCMA 1S3PA 5D7FA 2M7NA 3GK1A 2F3ZA 4C0LA 2KQYA 1CLBA 1LKJA 3CLNA 3EKJA 4NDCA 2LP3A 2HQWA 3C1VA 5AERA 1UP5A 1NX0A 1R2UA 1K95A 4YI9A 4C0KA 1DF0B 3D10A 3F45A 1CB1A 2JQ6A 1C7VA 5I2QA 4CFRA 4WQ3A 2COLB 1CDPA 3ZWHA 3NSOA 2Y5IA 2KBMA 2HPSA 1RECA 3I5GB 3BOWA 1OE9B 5DKNA 3DVJA 2LLTA 2M49B 4AQIA 2BKIB 1S6IA 2LMUA 1CFCA 2MAZA 1NSHA 2KSPA 4DIRA 1ZOTB 4HSZA 4M2QA 1F8HA 2LUXA 4ZCUA 2KGRA 1WRKA 4HREE 2GGZA 1CM1A 1KK7Y 1XFXO 2HETA 2F2PA 4PE4A 3VRNA 2MBXA 4OV2A 2LVVA 1B8RA 1PVAA 1KK7Z 2L50A 5I8NA 1HT9A 4WRIA 2CXJA 1TNPA 1QLSA 1IG5A 3ZNIA 4HRGA 1TRFA 1OMRA 2AAOA
chains in the Genus database with same CATH superfamily
4CIDA 1B8CA 4YBHB 3KO0A 1BOCA 1AJ5A 1DJWA 4IJ7A 2LANA 5CSIA 1K90D 3SS4A 1DJHA 1KQVA 1LINA 4INWA 3IF7A 2F33A 4XJKB 1SKTA 4JKTA 2LAPA 1TNXA 5I94A 3DF0B 1NYAA 3NHTA 1P28A 2NLNA 2WCFA 4PE1A 1KSOA 1OMDA 1MUXA 1K96A 1ORGA 1WLZA 2KLEA 2PQLA 3B6XA 2Y4QA 4YGDB 1HQVA 1DEKA 3VRPA 1S1EA 1AHRA 1XFZO 3EK8A 4L9MA 1XYDA 3D75A 1SL9A 1YX8A 2FJYA 2P6BB 1MQ1A 3DYEA 2QDIA 1CFDA 1QJTA 3CZ1A 2LE9B 2PASA 2GV5A 1B7TY 3CZ2A 3AKBA 1S5GZ 3UNWA 1S36A 3LK0A 2GGMA 3R1PA 2LUCA 2I7AA 1CNPA 3GK4X 1RROA 2E6WA 1LA3A 1B7TZ 1OZSA 4AOMA 1BU3A 1BODA 1SRAA 1TIZA 3M0WA 2L4IA 1FBVA 1PSBA 2MHHA 2WORA 3SS5A 1WRLA 1Y1UA 2JNXA 1WDCB 3L47A 1YRUB 3EVUA 5F6TA 1BJFA 3JTDB 5KTYA 2EHBA 2Q91A 1SCVA 2BCXA 3NSKA 3I5HC 1QS7A 1TUZA 1IIOA 1SMGA 1N0YA 2JPTA 1JF2A 4YGAA 3IQOA 1S6CA 3OX5A 2L98A 1NCYA 2KFGA 1BT6A 3VGOA 3BXKA 1EG3A 4N1GA 4YRUA 1KFXL 2B1UA 1Y1XA 2KNEA 1W9ZA 1B4CA 1B47A 1IQ5A 1AK8A 5D3OA 2WC8A 1JBAA 4M2OA 2K7OA 1RTP1 1NPQA 2QPTA 1TN4A 1K9UA 2LVIA 1CKKA 2KYCA 1S6JA 1SCMC 4JQ0D 3KPXA 1JFKA 2KPHA 4I5JA 3BFAA 1Z2CB 4NDBA 2JXLA 1TNQA 2ZNDA 4A4BA 3N7HA 2I2RE 2JU0A 3BOWB 4QJ4B 4MEWA 2K2AA 1R6PA 1UHIA 1C3ZA 1C3YA 1EL4A 3CDNA 3BQ3A 5ER5A 3FWBA 4MLWA 3FE8A 2G2BA 1RJVA 2L4HA 3BUWB 1AP4A 3OP0A 2F8PA 3BUNB 3PN7B 2L51A 3EKHA 1K8UA 2LMVA 2VRGA 1X02A 2LV7A 1BG1A 2NXQA 1QLKA 1UUSA 4PCWA 1K2HA 4WQ2A 5JJGA 2H8VA 4MRXA 1MHOA 1TUJA 2WCMA 4GGFC 5JOLA 2GTEA 3TS5C 2ZRTA 1J7PA 1UHKA 2JTZA 3PM8A 4N1FA 2FCDA 4PHNA 2M8UA 1AJ4A 3O4XA 1DT7B 3LCPC 5AFPA 2K61A 1JFJA 1DVIA 1SNLA 2K7DA 4GFTA 4CLNA 2EC6B 1K93D 3SG4A 5HKYA 1YURA 3S0GA 2JNFA 3BYAA 1QTXA 4F0ZB 2QEOA 1KFUS 3KF9A 1W7IB 2M1KB 2K0JA 1ZMZA 3AAKA 3CS1A 5AXIA 3A8RA 2BAPA 1A29A 2LHLA 2KI4C 3OB1B 4BY4A 3VRRA 2KI6C 5KU1A 5FI6A 2LCPA 3FE6A 4FQOA 5TNCA 1TTXA 2Y1MA 1DGUA 3WNXB 2MJWB 3B87A 1QV0A 1L2OC 1YTZC 1H8BA 1OW4A 1IH0A 1TOPA 1U5IB 3O2PA 1UHHA 3S0DA 1D1OA 1YUTA 4DS7A 1EG4A 1B9AA 2CBLA 2JT3A 1NP8A 3EVVA 3FWCA 5CPVA 3CTNA 3WHTB 1YUUA 1CLMA 2PVBA 1OMVA 3OGNA 3DVMA 1BF5A 3SG6A 2V53A 5I2OA 2NZ0A 1KWOC 4ETOA 2KGBC 3DVKA 1NX2A 4MRYA 1BLQA 2BKHB 3AKAA 3OBVA 1K94A 2JULA 2LLUA 1F54A 3D78A 3FE9A 1DGVA 2ZN9A 1DTLA 4MZKA 2K7BA 1CLBA 1E8AA 3PJIA 2BCAA 3KHEA 2BECA 2CNPA 5D69A 1OOGA 1SY9A 1UHNA 1MF8B 3QRXA 1K9PA 3RLZA 3TUYC 4GGFA 2TN4A 1U5IA 3NSIA 1ZFSA 5HLOA 2OPOA 4MN0A 4USLA 2YGUA 1DJYA 4HRHA 1B8LA 1GQMA 2ZRSA 2M9GA 3OB2B 2CT9A 1K9KA 1YR5A 2WCLA 3A4UB 3DVEA 4MZLA 3VB1A 2BBMA 2KDHA 1N2DA 4QJ3B 4I5LB 4OCIA 1KWOB 5HKZA 1QX5B 2WOSA 1OOFA 1G4YR 4MSPA 3BFHA 1CLLA 2L2EA 1IGVA 3O4YA 4ORCB 3NXAA 1V1GA 2O5GA 3CYZA 1C7WA 1MWNA 2LM5A 2WCBA 2ZKMX 2OS8C 4YGBB 4NQGA 5HLVA 2EGDA 1G8IA 3TUYB 4BY5A 1L7ZA 1RK9A 1PVBA 2K7CA 2FCEA 3IQQA 2QEVA 1QIWA 4ZCVA 3CZTX 1LXFC 2JWWA 3OHMB 4E68A 1FPWA 2LNKA 3WHUB 1Y1AA 2KAXA 1BR4B 1SL7A 1YUSA 2F2OA 2H61A 2JTTA 3BUXB 1WRZA 1DJIA 3H4SE 2KQ6A 1J7OA 1H4BA 2OTGC 1J55A 1QATA 1F4QA 1ZACA 1FF1A 1OOHA 2CTNA 2R2IA 2K60A 2KBIA 2M7LA 3K21A 2IS9A 4MVFA 3L4AA 1XO5A 1TNWA 1F4OA 3I5FC 2LMTA 3CR4X 3LLEA 1PK0D 1XFWO 2NCOA 4YGCB 3FIAA 3SG2A 2WCHA 1KCYA 1V1FA 3SG7A 1EH2A 4P5OE 1NWDA 2OS8B 3KEVA 2ISDA 4YGEB 2FJUB 2JXCA 3L4LA 4OR9B 5GQQC 1WLMA 2KYFA 2E30A 3K1EA 1YVHA 2M1UA 1CDNA 1CDMA 4U8DA 3I5HB 4QJ5B 2ZN8A 3GK2A 2JPOA 4M2PA 2MLFC 1CM4A 1LA0A 5I2LA 1M45A 1G33A 3TZ1A 1PULA 1XFVO 5G08A 4GBAA 2ERBA 3PLFB 1UWOA 2L0PA 1F55A 3EK7A 1W7JB 4F7FA 1FI6A 2BE4A 2LLSA 4UPGA 2OTGB 1PSRA 2L5XB 4PDZA 2JC2A 3EG5B 3DY9A 2KHNA 5J3XA 2F3YA 1IQ3A 3I5FB 1B1GA 1YVLA 3D0YA 4DCKA 4DRWA 4GGNA 2A4JA 1IWQA 3HCMA 3S0FA 2WCEA 1SL8A 2ZNEA 3DD4A 1SCMB 3MSEB 5DKQA 4XYNA 4YI8A 1QIVA 1GJYA 3CR5X 2SASA 1UURA 4JD9A 2QEBA 2BE6A 3SJSA 3EK4A 4PE7A 4ORAB 2Y1NA 5CSNA 3WXAA 1OOIX 2PALA 4CPVA 5DKRA 3TDUA 1XFYO 2QACA 1DQEA 3D74A 2WNDA 2KFFA 1KFUL 2L5YA 3FS7A 3JVTC 2H2KA 1J1DA 1A4PA 3D73A 4PHKA 2AUCA 4GNKB 3IVTA 3PALA 5FI2A 3PFVA 5IBWA 1ODBA 3CR2A 2NCPA 3S0EA 1C07A 5HKWA 1FW4A 1M31A 1N65A 1XFRA 1NCZA 3BUMB 1KQMC 4KYNA 3TDIA 1Y6WA 2LVKA 3TS5B 1NX3A 3SIAA 1S26D 1SK6D 1TCFA 1BMOA 2G9BA 1CMGA 1A75A 4GAOA 2KAYA 1JWDA 4OKHA 1XK4C 1QVIY 3SIBA 3DZTA 3OX6A 5AANA 4R1EA 4CFQA 2H61C 1VRKA 3QMEA 4PE0A 4D1EA 3R1OA 5DICA 3HX4A 1OOJA 1UHJA 3E3RA 3PSRA 4I5NB 1QVIZ 1EXRA 1XVJA 5CSJA 2KI6D 1SPYA 4ORBB 1Z4HA 1RWYA 2M3WA 4C0JA 3LL8B 3JVTB 3PATA 4GUKA 4TNCA 2KI4B 1AVSA 1SW8A 4PHMA 5HYDA 2SCPA 1YRTB 1J7QA 1KK8C 1DF0A 1L2OB 1J1EA 1Y0VH 5BPJA 1QX2A 3SG5A 1KQMB 1CTRA 4P2YB 3S0AA 1CFPA 1F71A 4PHJA 2LVJA 2JRFA 5K89A 2I94A 2Q4UA 2MRDA 2RGIA 4A4CA 2JT0A 2LC5A 5PALA 3UO9A 5CSFA 1MXLC 4Q04A 4GPLB 2MA2A 1CMFA 4IL1A 4MZJA 4NDDA 1CFFA 3RM1A 1BR1B 1ZUZA 3O78A 2D8NA 4OVNF 1EJ3A 5KSZA 2ZFDA 1T14A 3BJHA 3S0BA 4N5XA 2I18A 5B8IB 2BL0C 1WDCC 2FOTA 2KFHA 1KK8B 1DJXA 4INXA 3JTDC 5EL2A 1OSAA 2M0RA 4OZDA 2PMYA 1OQPA 5ER4X 1QX7A 1S5GY 2K8MB 1MR8A 3BUOB 1SYMA 1SBJA 2K2FA 1M46A 1GM0A 1XA5A 3EVRA 1MXEA 1DJZA 1ALWA 4MBEA 3BFBA 1PALA 1XK4A 3VROA 1IJ5A 3SG3A 2PRUA 1JUOA 1SR6C 1M39A 1QASA 2LP2A 4FTGA 1ALVA 1JF0A 3CZ0A 1GGZA 1NX1A 1Q80A 2LHIA 1AUIB 1JC2A 3TDZA 1DJGA 4I5KA 2PYQA 1YX7A 2KOTA 1NCXA 3D0YB 2BL0B 4XJKA 3B88A 2WC5A 2DOQA 2KLDA 2M97A 3DF0A 3I5IC 1A03A 2AMIA 3GOFA 3CWGA 1IKUA 2WCKA 1QXPA 1NUBA 4PALA 1XFUO 1TCOB 1DMOA 1DC1A 2JZIA 3AAJA 4JPZB 1KFXS 1LVCD 2HQ8A 2PSRA 1RFJA 1M63B 5AEQA 3B86A 2MLEC 1JSAA 1A2XA 2L2CA 3SS3A 2BCBA 1FI5A 2QEHA 2WCJA 4DUQA 3PN7C 1SR6B 1OZOA 1KSMA 1IJ6A 2P70A 3R1VA 3NSLA 3CGAA 3B7AA 2O60A 3Q8IA 2BBNA 2JT8A 2JOJA 1IRJA 3I5IB 3LK1A 1CDLA 1PRWA 2EC6C 4JWQA 1J7RA 1A75B 1SSEB 2BNXA 2KAVA 4ICBA 1F70A 2HF5A 3VRQA 1QV1A 3I5GC 1NIWA 3O6BA 1GGWA 3ICBA 4AQJA 4PT1A 3V2LA 2M29A 5FYXA 1WY9A 3RZSA 3R72A 2CCMA 1S3PA 5D7FA 2M7NA 3D76A 2F3ZA 3GK1A 2KQYA 1LS8A 1LKJA 3CLNA 3EKJA 5FI7A 5HL1A 4NDCA 2LP3A 1QWVA 2HQWA 3C1VA 5AERA 1UP5A 1NX0A 1R2UA 1K95A 4YI9A 4C0KA 1DF0B 3D10A 3F45A 1CB1A 2JQ6A 3NGVA 5I2QA 1C7VA 4CFRA 4WQ3A 2COLB 2P71A 1CDPA 3ZWHA 3D77A 3NSOA 2Y5IA 2KBMA 2HPSA 1RECA 3I5GB 3BOWA 1OE9B 4FQTA 2WC6A 3DXLA 3DVJA 5DKNA 2LLTA 2M49B 4AQIA 1TWOA 2BKIB 1S6IA 2LMUA 1CFCA 2MAZA 1NSHA 2KSPA 4DIRA 1ZOTB 4HSZA 4C0LA 3PM2A 4M2QA 1F8HA 2LUXA 4ZCUA 2KGRA 1WRKA 4HREE 2GGZA 1CM1A 1KK7Y 1XFXO 2HETA 2F2PA 4PE4A 3VRNA 2MBXA 4OV2A 1DELA 2LVVA 1B8RA 1PVAA 1KK7Z 2L50A 5I8NA 1HT9A 4WRIA 2CXJA 1TNPA 1QLSA 1IG5A 3ZNIA 4HRGA 1TRFA 1OMRA 2AAOA 3CABA 3NHIA
chains in the Genus database with same CATH topology
4CIDA 1B8CA 4YBHB 3KO0A 1BOCA 1AJ5A 1DJWA 2LANA 5CSIA 1K90D 1DJHA 1KQVA 1LINA 3IF7A 2F33A 4XJKB 1SKTA 2LAPA 1TNXA 3DF0B 1NYAA 4PE1A 2NLNA 2WCFA 1KSOA 1OMDA 1MUXA 1K96A 1WLZA 4YGDB 2Y4QA 1HQVA 3VRPA 1S1EA 1AHRA 1XFZO 3EK8A 4L9MA 1XYDA 1SL9A 1YX8A 2P6BB 1MQ1A 1CFDA 1QJTA 2LE9B 2PASA 2GV5A 1B7TY 3AKBA 1S5GZ 1S36A 3LK0A 2GGMA 1CNPA 2LUCA 2I7AA 3GK4X 1RROA 2E6WA 1LA3A 1B7TZ 1OZSA 4AOMA 1BU3A 1BODA 1SRAA 1TIZA 3M0WA 2L4IA 1FBVA 1PSBA 2MHHA 2WORA 1WRLA 1Y1UA 2JNXA 1WDCB 5F6TA 1YRUB 3EVUA 1BJFA 3JTDB 5KTYA 2EHBA 2Q91A 1SCVA 2BCXA 3NSKA 3I5HC 1QS7A 1SMGA 1N0YA 2JPTA 1JF2A 4YGAA 3IQOA 1S6CA 3OX5A 2L98A 1NCYA 2KFGA 1BT6A 3VGOA 3BXKA 1EG3A 4N1GA 4YRUA 1KFXL 2B1UA 1Y1XA 2KNEA 1B4CA 1B47A 1IQ5A 1AK8A 2WC8A 1JBAA 4M2OA 2K7OA 1RTP1 1NPQA 2QPTA 1TN4A 1K9UA 2LVIA 1CKKA 2KYCA 1S6JA 1SCMC 4JQ0D 3KPXA 1JFKA 4I5JA 4NDBA 2JXLA 1TNQA 2ZNDA 4A4BA 2I2RE 2JU0A 3BOWB 4QJ4B 4MEWA 2K2AA 1R6PA 1UHIA 1EL4A 5ER5A 3BQ3A 3FWBA 4MLWA 2G2BA 1RJVA 2L4HA 3BUWB 1AP4A 3OP0A 2F8PA 3BUNB 3PN7B 2L51A 3EKHA 1K8UA 2LMVA 2VRGA 1X02A 2LV7A 1BG1A 2NXQA 1QLKA 1UUSA 4PCWA 1K2HA 4WQ2A 5JJGA 4MRXA 1MHOA 3TS5C 4GGFC 5JOLA 2ZRTA 1J7PA 1UHKA 2JTZA 3PM8A 4N1FA 2FCDA 4PHNA 2M8UA 1AJ4A 1DT7B 3LCPC 5AFPA 2K61A 1JFJA 1DVIA 1SNLA 2K7DA 4GFTA 4CLNA 2EC6B 1K93D 3SG4A 5HKYA 1YURA 2JNFA 3BYAA 1QTXA 4F0ZB 1KFUS 3KF9A 1W7IB 2M1KB 2K0JA 1ZMZA 3AAKA 3CS1A 5AXIA 3A8RA 1A29A 2LHLA 2KI4C 3OB1B 4BY4A 3VRRA 2KI6C 5KU1A 2LCPA 5TNCA 4FQOA 1TTXA 2Y1MA 1DGUA 3WNXB 2MJWB 1QV0A 1L2OC 1YTZC 1H8BA 1IH0A 1TOPA 1U5IB 3O2PA 1UHHA 1D1OA 1YUTA 4DS7A 1EG4A 1B9AA 2CBLA 2JT3A 1NP8A 3EVVA 3FWCA 5CPVA 3CTNA 3WHTB 1YUUA 1CLMA 2PVBA 1OMVA 1BF5A 3DVMA 3SG6A 2V53A 5I2OA 2NZ0A 1KWOC 4ETOA 2KGBC 3DVKA 1NX2A 4MRYA 1BLQA 2BKHB 3AKAA 1K94A 2JULA 2LLUA 1F54A 1DGVA 2ZN9A 1DTLA 4MZKA 2K7BA 1E8AA 5D69A 2BCAA 3KHEA 2BECA 2CNPA 1SY9A 1UHNA 1MF8B 3QRXA 1K9PA 3RLZA 3TUYC 4GGFA 2TN4A 1U5IA 3NSIA 1ZFSA 5HLOA 2OPOA 4MN0A 4USLA 1DJYA 4HRHA 1B8LA 1GQMA 2ZRSA 2M9GA 3OB2B 2CT9A 1K9KA 1YR5A 3A4UB 4MZLA 3DVEA 2BBMA 2KDHA 1N2DA 4QJ3B 4I5LB 4OCIA 1KWOB 5HKZA 1QX5B 2WOSA 1G4YR 4MSPA 1CLLA 2L2EA 1IGVA 3O4YA 4ORCB 3NXAA 1V1GA 2O5GA 1C7WA 1MWNA 2LM5A 2WCBA 2ZKMX 2OS8C 4YGBB 4NQGA 5HLVA 2EGDA 1G8IA 3TUYB 4BY5A 1L7ZA 1RK9A 1PVBA 2K7CA 2FCEA 3IQQA 1QIWA 4ZCVA 3CZTX 1LXFC 2JWWA 3OHMB 4E68A 1FPWA 2LNKA 3WHUB 1Y1AA 2KAXA 1BR4B 1SL7A 1YUSA 2F2OA 2H61A 2JTTA 3BUXB 1WRZA 1DJIA 3H4SE 2KQ6A 1J7OA 1H4BA 2OTGC 1J55A 1QATA 1F4QA 1ZACA 1FF1A 2CTNA 2R2IA 2KBIA 2M7LA 3K21A 2IS9A 4MVFA 1XO5A 1TNWA 1F4OA 3I5FC 2LMTA 3CR4X 3LLEA 1PK0D 1XFWO 2NCOA 4YGCB 3FIAA 3SG2A 1KCYA 1V1FA 3SG7A 1EH2A 4P5OE 1NWDA 2OS8B 3KEVA 2ISDA 4YGEB 2FJUB 2JXCA 4OR9B 5GQQC 1WLMA 2KYFA 2E30A 1YVHA 2M1UA 1CDNA 1CDMA 4U8DA 3I5HB 4QJ5B 2ZN8A 3GK2A 4M2PA 2MLFC 1CM4A 1LA0A 5I2LA 1M45A 1G33A 3TZ1A 1PULA 1XFVO 5G08A 4GBAA 3PLFB 1UWOA 2L0PA 1F55A 3EK7A 1W7JB 1FI6A 2BE4A 2LLSA 4UPGA 2OTGB 1PSRA 2L5XB 4PDZA 2JC2A 2KHNA 5J3XA 2F3YA 1IQ3A 3I5FB 1B1GA 1YVLA 3D0YA 4DCKA 4DRWA 4GGNA 2A4JA 1IWQA 3HCMA 2WCEA 1SL8A 2ZNEA 3DD4A 1SCMB 3MSEB 5DKQA 4XYNA 4YI8A 1QIVA 1GJYA 3CR5X 2SASA 1UURA 2BE6A 3SJSA 3EK4A 4PE7A 4ORAB 2Y1NA 5CSNA 3WXAA 2PALA 4CPVA 5DKRA 3TDUA 1XFYO 2QACA 2WNDA 2KFFA 1KFUL 3FS7A 3JVTC 2H2KA 1J1DA 1A4PA 4PHKA 2AUCA 4GNKB 3PALA 3PFVA 5IBWA 1ODBA 3CR2A 2NCPA 1C07A 5HKWA 1FW4A 1M31A 1N65A 3BUMB 1NCZA 1KQMC 3TDIA 3TS5B 1Y6WA 2LVKA 1NX3A 3SIAA 1S26D 1SK6D 1TCFA 1BMOA 2G9BA 1CMGA 1A75A 4GAOA 2KAYA 1JWDA 4OKHA 1XK4C 1QVIY 3SIBA 3OX6A 5AANA 4R1EA 4CFQA 2H61C 1VRKA 4PE0A 4D1EA 3HX4A 1OOJA 1UHJA 3E3RA 3PSRA 4I5NB 1QVIZ 1EXRA 1XVJA 5CSJA 2KI6D 1SPYA 4ORBB 1RWYA 2M3WA 4C0JA 3LL8B 3JVTB 3PATA 4GUKA 4TNCA 2KI4B 1AVSA 1SW8A 4PHMA 5HYDA 2SCPA 1YRTB 1J7QA 1KK8C 1DF0A 1L2OB 1J1EA 1Y0VH 5BPJA 1QX2A 3SG5A 1KQMB 1CTRA 4P2YB 1CFPA 1F71A 4PHJA 2LVJA 2JRFA 5K89A 2I94A 2Q4UA 2MRDA 2RGIA 4A4CA 2JT0A 2LC5A 5PALA 5CSFA 1MXLC 4Q04A 4GPLB 2MA2A 1CMFA 4IL1A 4MZJA 4NDDA 1CFFA 3RM1A 1BR1B 1ZUZA 3O78A 2D8NA 4OVNF 1EJ3A 5KSZA 2ZFDA 4N5XA 2I18A 5B8IB 2BL0C 1WDCC 2FOTA 2KFHA 1KK8B 1DJXA 3JTDC 1OSAA 2M0RA 2PMYA 1OQPA 5ER4X 1QX7A 1S5GY 2K8MB 1MR8A 3BUOB 1SYMA 1SBJA 2K2FA 1M46A 1XA5A 3EVRA 1MXEA 1DJZA 1ALWA 4MBEA 1PALA 1XK4A 3VROA 1IJ5A 3SG3A 2PRUA 1JUOA 1SR6C 1M39A 1QASA 2LP2A 4FTGA 1ALVA 1JF0A 1GGZA 1NX1A 1Q80A 2LHIA 1AUIB 1JC2A 3TDZA 1DJGA 4I5KA 1YX7A 2KOTA 1NCXA 3D0YB 2BL0B 4XJKA 2DOQA 3I5IC 2M97A 3DF0A 1A03A 2AMIA 3GOFA 3CWGA 1IKUA 1QXPA 1NUBA 4PALA 1XFUO 1TCOB 1DMOA 2JZIA 3AAJA 4JPZB 1KFXS 1LVCD 2HQ8A 2PSRA 1RFJA 1M63B 5AEQA 2MLEC 1JSAA 1A2XA 2BCBA 1FI5A 4DUQA 3PN7C 1SR6B 1OZOA 1KSMA 1IJ6A 3NSLA 3CGAA 2O60A 2BBNA 2JT8A 2JOJA 1IRJA 3I5IB 3LK1A 1CDLA 1PRWA 2EC6C 4JWQA 1J7RA 1A75B 2KAVA 4ICBA 1F70A 2HF5A 3VRQA 1QV1A 3I5GC 1NIWA 3O6BA 1GGWA 3ICBA 4AQJA 2M29A 5FYXA 1WY9A 2CCMA 1S3PA 5D7FA 2M7NA 3GK1A 2F3ZA 4C0LA 2KQYA 1CLBA 1LKJA 3CLNA 3EKJA 4NDCA 2LP3A 2HQWA 3C1VA 5AERA 1UP5A 1NX0A 1R2UA 1K95A 4YI9A 4C0KA 1DF0B 3D10A 3F45A 1CB1A 2JQ6A 1C7VA 5I2QA 4CFRA 4WQ3A 2COLB 1CDPA 3ZWHA 3NSOA 2Y5IA 2KBMA 2HPSA 1RECA 3I5GB 3BOWA 1OE9B 5DKNA 3DVJA 2LLTA 2M49B 4AQIA 2BKIB 1S6IA 2LMUA 1CFCA 2MAZA 1NSHA 2KSPA 4DIRA 1ZOTB 4HSZA 4M2QA 1F8HA 2LUXA 4ZCUA 2KGRA 1WRKA 4HREE 2GGZA 1CM1A 1KK7Y 1XFXO 2HETA 2F2PA 4PE4A 3VRNA 2MBXA 4OV2A 2LVVA 1B8RA 1PVAA 1KK7Z 2L50A 5I8NA 1HT9A 4WRIA 2CXJA 1TNPA 1QLSA 1IG5A 3ZNIA 4HRGA 1TRFA 1OMRA 2AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CID A;  1B8C A;  4YBH B;  3KO0 A;  1BOC A;  1AJ5 A;  1DJW A;  2LAN A;  5CSI A;  1K90 D;  1DJH A;  1KQV A;  1LIN A;  3IF7 A;  2F33 A;  4XJK B;  1SKT A;  2LAP A;  1TNX A;  3DF0 B;  1NYA A;  4PE1 A;  2NLN A;  2WCF A;  1KSO A;  1OMD A;  1MUX A;  1K96 A;  1WLZ A;  4YGD B;  2Y4Q A;  1HQV A;  3VRP A;  1S1E A;  1AHR A;  1XFZ O;  3EK8 A;  4L9M A;  1XYD A;  1SL9 A;  1YX8 A;  2P6B B;  1MQ1 A;  1CFD A;  1QJT A;  2LE9 B;  2PAS A;  2GV5 A;  1B7T Y;  3AKB A;  1S5G Z;  1S36 A;  3LK0 A;  2GGM A;  1CNP A;  2LUC A;  2I7A A;  3GK4 X;  1RRO A;  2E6W A;  1LA3 A;  1B7T Z;  1OZS A;  4AOM A;  1BU3 A;  1BOD A;  1SRA A;  1TIZ A;  3M0W A;  2L4I A;  1FBV A;  1PSB A;  2MHH A;  2WOR A;  1WRL A;  1Y1U A;  2JNX A;  1WDC B;  5F6T A;  1YRU B;  3EVU A;  1BJF A;  3JTD B;  5KTY A;  2EHB A;  2Q91 A;  1SCV A;  2BCX A;  3NSK A;  3I5H C;  1QS7 A;  1SMG A;  1N0Y A;  2JPT A;  1JF2 A;  4YGA A;  3IQO A;  1S6C A;  3OX5 A;  2L98 A;  1NCY A;  2KFG A;  1BT6 A;  3VGO A;  3BXK A;  1EG3 A;  4N1G A;  4YRU A;  1KFX L;  2B1U A;  1Y1X A;  2KNE A;  1B4C A;  1B47 A;  1IQ5 A;  1AK8 A;  2WC8 A;  1JBA A;  4M2O A;  2K7O A;  1RTP 1;  1NPQ A;  2QPT A;  1TN4 A;  1K9U A;  2LVI A;  1CKK A;  2KYC A;  1S6J A;  1SCM C;  4JQ0 D;  3KPX A;  1JFK A;  4I5J A;  4NDB A;  2JXL A;  1TNQ A;  2ZND A;  4A4B A;  2I2R E;  2JU0 A;  3BOW B;  4QJ4 B;  4MEW A;  2K2A A;  1R6P A;  1UHI A;  1EL4 A;  5ER5 A;  3BQ3 A;  3FWB A;  4MLW A;  2G2B A;  1RJV A;  2L4H A;  3BUW B;  1AP4 A;  3OP0 A;  2F8P A;  3BUN B;  3PN7 B;  2L51 A;  3EKH A;  1K8U A;  2LMV A;  2VRG A;  1X02 A;  2LV7 A;  1BG1 A;  2NXQ A;  1QLK A;  1UUS A;  4PCW A;  1K2H A;  4WQ2 A;  5JJG A;  4MRX A;  1MHO A;  3TS5 C;  4GGF C;  5JOL A;  2ZRT A;  1J7P A;  1UHK A;  2JTZ A;  3PM8 A;  4N1F A;  2FCD A;  4PHN A;  2M8U A;  1AJ4 A;  1DT7 B;  3LCP C;  5AFP A;  2K61 A;  1JFJ A;  1DVI A;  1SNL A;  2K7D A;  4GFT A;  4CLN A;  2EC6 B;  1K93 D;  3SG4 A;  5HKY A;  1YUR A;  2JNF A;  3BYA A;  1QTX A;  4F0Z B;  1KFU S;  3KF9 A;  1W7I B;  2M1K B;  2K0J A;  1ZMZ A;  3AAK A;  3CS1 A;  5AXI A;  3A8R A;  1A29 A;  2LHL A;  2KI4 C;  3OB1 B;  4BY4 A;  3VRR A;  2KI6 C;  5KU1 A;  2LCP A;  5TNC A;  4FQO A;  1TTX A;  2Y1M A;  1DGU A;  3WNX B;  2MJW B;  1QV0 A;  1L2O C;  1YTZ C;  1H8B A;  1IH0 A;  1TOP A;  1U5I B;  3O2P A;  1UHH A;  1D1O A;  1YUT A;  4DS7 A;  1EG4 A;  1B9A A;  2CBL A;  2JT3 A;  1NP8 A;  3EVV A;  3FWC A;  5CPV A;  3CTN A;  3WHT B;  1YUU A;  1CLM A;  2PVB A;  1OMV A;  1BF5 A;  3DVM A;  3SG6 A;  2V53 A;  5I2O A;  2NZ0 A;  1KWO C;  4ETO A;  2KGB C;  3DVK A;  1NX2 A;  4MRY A;  1BLQ A;  2BKH B;  3AKA A;  1K94 A;  2JUL A;  2LLU A;  1F54 A;  1DGV A;  2ZN9 A;  1DTL A;  4MZK A;  2K7B A;  1E8A A;  5D69 A;  2BCA A;  3KHE A;  2BEC A;  2CNP A;  1SY9 A;  1UHN A;  1MF8 B;  3QRX A;  1K9P A;  3RLZ A;  3TUY C;  4GGF A;  2TN4 A;  1U5I A;  3NSI A;  1ZFS A;  5HLO A;  2OPO A;  4MN0 A;  4USL A;  1DJY A;  4HRH A;  1B8L A;  1GQM A;  2ZRS A;  2M9G A;  3OB2 B;  2CT9 A;  1K9K A;  1YR5 A;  3A4U B;  4MZL A;  3DVE A;  2BBM A;  2KDH A;  1N2D A;  4QJ3 B;  4I5L B;  4OCI A;  1KWO B;  5HKZ A;  1QX5 B;  2WOS A;  1G4Y R;  4MSP A;  1CLL A;  2L2E A;  1IGV A;  3O4Y A;  4ORC B;  3NXA A;  1V1G A;  2O5G A;  1C7W A;  1MWN A;  2LM5 A;  2WCB A;  2ZKM X;  2OS8 C;  4YGB B;  4NQG A;  5HLV A;  2EGD A;  1G8I A;  3TUY B;  4BY5 A;  1L7Z A;  1RK9 A;  1PVB A;  2K7C A;  2FCE A;  3IQQ A;  1QIW A;  4ZCV A;  3CZT X;  1LXF C;  2JWW A;  3OHM B;  4E68 A;  1FPW A;  2LNK A;  3WHU B;  1Y1A A;  2KAX A;  1BR4 B;  1SL7 A;  1YUS A;  2F2O A;  2H61 A;  2JTT A;  3BUX B;  1WRZ A;  1DJI A;  3H4S E;  2KQ6 A;  1J7O A;  1H4B A;  2OTG C;  1J55 A;  1QAT A;  1F4Q A;  1ZAC A;  1FF1 A;  2CTN A;  2R2I A;  2KBI A;  2M7L A;  3K21 A;  2IS9 A;  4MVF A;  1XO5 A;  1TNW A;  1F4O A;  3I5F C;  2LMT A;  3CR4 X;  3LLE A;  1PK0 D;  1XFW O;  2NCO A;  4YGC B;  3FIA A;  3SG2 A;  1KCY A;  1V1F A;  3SG7 A;  1EH2 A;  4P5O E;  1NWD A;  2OS8 B;  3KEV A;  2ISD A;  4YGE B;  2FJU B;  2JXC A;  4OR9 B;  5GQQ C;  1WLM A;  2KYF A;  2E30 A;  1YVH A;  2M1U A;  1CDN A;  1CDM A;  4U8D A;  3I5H B;  4QJ5 B;  2ZN8 A;  3GK2 A;  4M2P A;  2MLF C;  1CM4 A;  1LA0 A;  5I2L A;  1M45 A;  1G33 A;  3TZ1 A;  1PUL A;  1XFV O;  5G08 A;  4GBA A;  3PLF B;  1UWO A;  2L0P A;  1F55 A;  3EK7 A;  1W7J B;  1FI6 A;  2BE4 A;  2LLS A;  4UPG A;  2OTG B;  1PSR A;  2L5X B;  4PDZ A;  2JC2 A;  2KHN A;  5J3X A;  2F3Y A;  1IQ3 A;  3I5F B;  1B1G A;  1YVL A;  3D0Y A;  4DCK A;  4DRW A;  4GGN A;  2A4J A;  1IWQ A;  3HCM A;  2WCE A;  1SL8 A;  2ZNE A;  3DD4 A;  1SCM B;  3MSE B;  5DKQ A;  4XYN A;  4YI8 A;  1QIV A;  1GJY A;  3CR5 X;  2SAS A;  1UUR A;  2BE6 A;  3SJS A;  3EK4 A;  4PE7 A;  4ORA B;  2Y1N A;  5CSN A;  3WXA A;  2PAL A;  4CPV A;  5DKR A;  3TDU A;  1XFY O;  2QAC A;  2WND A;  2KFF A;  1KFU L;  3FS7 A;  3JVT C;  2H2K A;  1J1D A;  1A4P A;  4PHK A;  2AUC A;  4GNK B;  3PAL A;  3PFV A;  5IBW A;  1ODB A;  3CR2 A;  2NCP A;  1C07 A;  5HKW A;  1FW4 A;  1M31 A;  1N65 A;  3BUM B;  1NCZ A;  1KQM C;  3TDI A;  3TS5 B;  1Y6W A;  2LVK A;  1NX3 A;  3SIA A;  1S26 D;  1SK6 D;  1TCF A;  1BMO A;  2G9B A;  1CMG A;  1A75 A;  4GAO A;  2KAY A;  1JWD A;  4OKH A;  1XK4 C;  1QVI Y;  3SIB A;  3OX6 A;  5AAN A;  4R1E A;  4CFQ A;  2H61 C;  1VRK A;  4PE0 A;  4D1E A;  3HX4 A;  1OOJ A;  1UHJ A;  3E3R A;  3PSR A;  4I5N B;  1QVI Z;  1EXR A;  1XVJ A;  5CSJ A;  2KI6 D;  1SPY A;  4ORB B;  1RWY A;  2M3W A;  4C0J A;  3LL8 B;  3JVT B;  3PAT A;  4GUK A;  4TNC A;  2KI4 B;  1AVS A;  1SW8 A;  4PHM A;  5HYD A;  2SCP A;  1YRT B;  1J7Q A;  1KK8 C;  1DF0 A;  1L2O B;  1J1E A;  1Y0V H;  5BPJ A;  1QX2 A;  3SG5 A;  1KQM B;  1CTR A;  4P2Y B;  1CFP A;  1F71 A;  4PHJ A;  2LVJ A;  2JRF A;  5K89 A;  2I94 A;  2Q4U A;  2MRD A;  2RGI A;  4A4C A;  2JT0 A;  2LC5 A;  5PAL A;  5CSF A;  1MXL C;  4Q04 A;  4GPL B;  2MA2 A;  1CMF A;  4IL1 A;  4MZJ A;  4NDD A;  1CFF A;  3RM1 A;  1BR1 B;  1ZUZ A;  3O78 A;  2D8N A;  4OVN F;  1EJ3 A;  5KSZ A;  2ZFD A;  4N5X A;  2I18 A;  5B8I B;  2BL0 C;  1WDC C;  2FOT A;  2KFH A;  1KK8 B;  1DJX A;  3JTD C;  1OSA A;  2M0R A;  2PMY A;  1OQP A;  5ER4 X;  1QX7 A;  1S5G Y;  2K8M B;  1MR8 A;  3BUO B;  1SYM A;  1SBJ A;  2K2F A;  1M46 A;  1XA5 A;  3EVR A;  1MXE A;  1DJZ A;  1ALW A;  4MBE A;  1PAL A;  1XK4 A;  3VRO A;  1IJ5 A;  3SG3 A;  2PRU A;  1JUO A;  1SR6 C;  1M39 A;  1QAS A;  2LP2 A;  4FTG A;  1ALV A;  1JF0 A;  1GGZ A;  1NX1 A;  1Q80 A;  2LHI A;  1AUI B;  1JC2 A;  3TDZ A;  1DJG A;  4I5K A;  1YX7 A;  2KOT A;  1NCX A;  3D0Y B;  2BL0 B;  4XJK A;  2DOQ A;  3I5I C;  2M97 A;  3DF0 A;  1A03 A;  2AMI A;  3GOF A;  3CWG A;  1IKU A;  1QXP A;  1NUB A;  4PAL A;  1XFU O;  1TCO B;  1DMO A;  2JZI A;  3AAJ A;  4JPZ B;  1KFX S;  1LVC D;  2HQ8 A;  2PSR A;  1RFJ A;  1M63 B;  5AEQ A;  2MLE C;  1JSA A;  1A2X A;  2BCB A;  1FI5 A;  4DUQ A;  3PN7 C;  1SR6 B;  1OZO A;  1KSM A;  1IJ6 A;  3NSL A;  3CGA A;  2O60 A;  2BBN A;  2JT8 A;  2JOJ A;  1IRJ A;  3I5I B;  3LK1 A;  1CDL A;  1PRW A;  2EC6 C;  4JWQ A;  1J7R A;  1A75 B;  2KAV A;  4ICB A;  1F70 A;  2HF5 A;  3VRQ A;  1QV1 A;  3I5G C;  1NIW A;  3O6B A;  1GGW A;  3ICB A;  4AQJ A;  2M29 A;  5FYX A;  1WY9 A;  2CCM A;  1S3P A;  5D7F A;  2M7N A;  3GK1 A;  2F3Z A;  4C0L A;  2KQY A;  1CLB A;  1LKJ A;  3CLN A;  3EKJ A;  4NDC A;  2LP3 A;  2HQW A;  3C1V A;  5AER A;  1UP5 A;  1NX0 A;  1R2U A;  1K95 A;  4YI9 A;  4C0K A;  1DF0 B;  3D10 A;  3F45 A;  1CB1 A;  2JQ6 A;  1C7V A;  5I2Q A;  4CFR A;  4WQ3 A;  2COL B;  1CDP A;  3ZWH A;  3NSO A;  2Y5I A;  2KBM A;  2HPS A;  1REC A;  3I5G B;  3BOW A;  1OE9 B;  5DKN A;  3DVJ A;  2LLT A;  2M49 B;  4AQI A;  2BKI B;  1S6I A;  2LMU A;  1CFC A;  2MAZ A;  1NSH A;  2KSP A;  4DIR A;  1ZOT B;  4HSZ A;  4M2Q A;  1F8H A;  2LUX A;  4ZCU A;  2KGR A;  1WRK A;  4HRE E;  2GGZ A;  1CM1 A;  1KK7 Y;  1XFX O;  2HET A;  2F2P A;  4PE4 A;  3VRN A;  2MBX A;  4OV2 A;  2LVV A;  1B8R A;  1PVA A;  1KK7 Z;  2L50 A;  5I8N A;  1HT9 A;  4WRI A;  2CXJ A;  1TNP A;  1QLS A;  1IG5 A;  3ZNI A;  4HRG A;  1TRF A;  1OMR A;  2AAO A; 
#chains in the Genus database with same CATH topology
 4CID A;  1B8C A;  4YBH B;  3KO0 A;  1BOC A;  1AJ5 A;  1DJW A;  4IJ7 A;  2LAN A;  5CSI A;  1K90 D;  3SS4 A;  1DJH A;  1KQV A;  1LIN A;  4INW A;  3IF7 A;  2F33 A;  4XJK B;  1SKT A;  4JKT A;  2LAP A;  1TNX A;  5I94 A;  3DF0 B;  1NYA A;  3NHT A;  1P28 A;  2NLN A;  2WCF A;  4PE1 A;  1KSO A;  1OMD A;  1MUX A;  1K96 A;  1ORG A;  1WLZ A;  2KLE A;  2PQL A;  3B6X A;  2Y4Q A;  4YGD B;  1HQV A;  1DEK A;  3VRP A;  1S1E A;  1AHR A;  1XFZ O;  3EK8 A;  4L9M A;  1XYD A;  3D75 A;  1SL9 A;  1YX8 A;  2FJY A;  2P6B B;  1MQ1 A;  3DYE A;  2QDI A;  1CFD A;  1QJT A;  3CZ1 A;  2LE9 B;  2PAS A;  2GV5 A;  1B7T Y;  3CZ2 A;  3AKB A;  1S5G Z;  3UNW A;  1S36 A;  3LK0 A;  2GGM A;  3R1P A;  2LUC A;  2I7A A;  1CNP A;  3GK4 X;  1RRO A;  2E6W A;  1LA3 A;  1B7T Z;  1OZS A;  4AOM A;  1BU3 A;  1BOD A;  1SRA A;  1TIZ A;  3M0W A;  2L4I A;  1FBV A;  1PSB A;  2MHH A;  2WOR A;  3SS5 A;  1WRL A;  1Y1U A;  2JNX A;  1WDC B;  3L47 A;  1YRU B;  3EVU A;  5F6T A;  1BJF A;  3JTD B;  5KTY A;  2EHB A;  2Q91 A;  1SCV A;  2BCX A;  3NSK A;  3I5H C;  1QS7 A;  1TUZ A;  1IIO A;  1SMG A;  1N0Y A;  2JPT A;  1JF2 A;  4YGA A;  3IQO A;  1S6C A;  3OX5 A;  2L98 A;  1NCY A;  2KFG A;  1BT6 A;  3VGO A;  3BXK A;  1EG3 A;  4N1G A;  4YRU A;  1KFX L;  2B1U A;  1Y1X A;  2KNE A;  1W9Z A;  1B4C A;  1B47 A;  1IQ5 A;  1AK8 A;  5D3O A;  2WC8 A;  1JBA A;  4M2O A;  2K7O A;  1RTP 1;  1NPQ A;  2QPT A;  1TN4 A;  1K9U A;  2LVI A;  1CKK A;  2KYC A;  1S6J A;  1SCM C;  4JQ0 D;  3KPX A;  1JFK A;  2KPH A;  4I5J A;  3BFA A;  1Z2C B;  4NDB A;  2JXL A;  1TNQ A;  2ZND A;  4A4B A;  3N7H A;  2I2R E;  2JU0 A;  3BOW B;  4QJ4 B;  4MEW A;  2K2A A;  1R6P A;  1UHI A;  1C3Z A;  1C3Y A;  1EL4 A;  3CDN A;  3BQ3 A;  5ER5 A;  3FWB A;  4MLW A;  3FE8 A;  2G2B A;  1RJV A;  2L4H A;  3BUW B;  1AP4 A;  3OP0 A;  2F8P A;  3BUN B;  3PN7 B;  2L51 A;  3EKH A;  1K8U A;  2LMV A;  2VRG A;  1X02 A;  2LV7 A;  1BG1 A;  2NXQ A;  1QLK A;  1UUS A;  4PCW A;  1K2H A;  4WQ2 A;  5JJG A;  2H8V A;  4MRX A;  1MHO A;  1TUJ A;  2WCM A;  4GGF C;  5JOL A;  2GTE A;  3TS5 C;  2ZRT A;  1J7P A;  1UHK A;  2JTZ A;  3PM8 A;  4N1F A;  2FCD A;  4PHN A;  2M8U A;  1AJ4 A;  3O4X A;  1DT7 B;  3LCP C;  5AFP A;  2K61 A;  1JFJ A;  1DVI A;  1SNL A;  2K7D A;  4GFT A;  4CLN A;  2EC6 B;  1K93 D;  3SG4 A;  5HKY A;  1YUR A;  3S0G A;  2JNF A;  3BYA A;  1QTX A;  4F0Z B;  2QEO A;  1KFU S;  3KF9 A;  1W7I B;  2M1K B;  2K0J A;  1ZMZ A;  3AAK A;  3CS1 A;  5AXI A;  3A8R A;  2BAP A;  1A29 A;  2LHL A;  2KI4 C;  3OB1 B;  4BY4 A;  3VRR A;  2KI6 C;  5KU1 A;  5FI6 A;  2LCP A;  3FE6 A;  4FQO A;  5TNC A;  1TTX A;  2Y1M A;  1DGU A;  3WNX B;  2MJW B;  3B87 A;  1QV0 A;  1L2O C;  1YTZ C;  1H8B A;  1OW4 A;  1IH0 A;  1TOP A;  1U5I B;  3O2P A;  1UHH A;  3S0D A;  1D1O A;  1YUT A;  4DS7 A;  1EG4 A;  1B9A A;  2CBL A;  2JT3 A;  1NP8 A;  3EVV A;  3FWC A;  5CPV A;  3CTN A;  3WHT B;  1YUU A;  1CLM A;  2PVB A;  1OMV A;  3OGN A;  3DVM A;  1BF5 A;  3SG6 A;  2V53 A;  5I2O A;  2NZ0 A;  1KWO C;  4ETO A;  2KGB C;  3DVK A;  1NX2 A;  4MRY A;  1BLQ A;  2BKH B;  3AKA A;  3OBV A;  1K94 A;  2JUL A;  2LLU A;  1F54 A;  3D78 A;  3FE9 A;  1DGV A;  2ZN9 A;  1DTL A;  4MZK A;  2K7B A;  1CLB A;  1E8A A;  3PJI A;  2BCA A;  3KHE A;  2BEC A;  2CNP A;  5D69 A;  1OOG A;  1SY9 A;  1UHN A;  1MF8 B;  3QRX A;  1K9P A;  3RLZ A;  3TUY C;  4GGF A;  2TN4 A;  1U5I A;  3NSI A;  1ZFS A;  5HLO A;  2OPO A;  4MN0 A;  4USL A;  2YGU A;  1DJY A;  4HRH A;  1B8L A;  1GQM A;  2ZRS A;  2M9G A;  3OB2 B;  2CT9 A;  1K9K A;  1YR5 A;  2WCL A;  3A4U B;  3DVE A;  4MZL A;  3VB1 A;  2BBM A;  2KDH A;  1N2D A;  4QJ3 B;  4I5L B;  4OCI A;  1KWO B;  5HKZ A;  1QX5 B;  2WOS A;  1OOF A;  1G4Y R;  4MSP A;  3BFH A;  1CLL A;  2L2E A;  1IGV A;  3O4Y A;  4ORC B;  3NXA A;  1V1G A;  2O5G A;  3CYZ A;  1C7W A;  1MWN A;  2LM5 A;  2WCB A;  2ZKM X;  2OS8 C;  4YGB B;  4NQG A;  5HLV A;  2EGD A;  1G8I A;  3TUY B;  4BY5 A;  1L7Z A;  1RK9 A;  1PVB A;  2K7C A;  2FCE A;  3IQQ A;  2QEV A;  1QIW A;  4ZCV A;  3CZT X;  1LXF C;  2JWW A;  3OHM B;  4E68 A;  1FPW A;  2LNK A;  3WHU B;  1Y1A A;  2KAX A;  1BR4 B;  1SL7 A;  1YUS A;  2F2O A;  2H61 A;  2JTT A;  3BUX B;  1WRZ A;  1DJI A;  3H4S E;  2KQ6 A;  1J7O A;  1H4B A;  2OTG C;  1J55 A;  1QAT A;  1F4Q A;  1ZAC A;  1FF1 A;  1OOH A;  2CTN A;  2R2I A;  2K60 A;  2KBI A;  2M7L A;  3K21 A;  2IS9 A;  4MVF A;  3L4A A;  1XO5 A;  1TNW A;  1F4O A;  3I5F C;  2LMT A;  3CR4 X;  3LLE A;  1PK0 D;  1XFW O;  2NCO A;  4YGC B;  3FIA A;  3SG2 A;  2WCH A;  1KCY A;  1V1F A;  3SG7 A;  1EH2 A;  4P5O E;  1NWD A;  2OS8 B;  3KEV A;  2ISD A;  4YGE B;  2FJU B;  2JXC A;  3L4L A;  4OR9 B;  5GQQ C;  1WLM A;  2KYF A;  2E30 A;  3K1E A;  1YVH A;  2M1U A;  1CDN A;  1CDM A;  4U8D A;  3I5H B;  4QJ5 B;  2ZN8 A;  3GK2 A;  2JPO A;  4M2P A;  2MLF C;  1CM4 A;  1LA0 A;  5I2L A;  1M45 A;  1G33 A;  3TZ1 A;  1PUL A;  1XFV O;  5G08 A;  4GBA A;  2ERB A;  3PLF B;  1UWO A;  2L0P A;  1F55 A;  3EK7 A;  1W7J B;  4F7F A;  1FI6 A;  2BE4 A;  2LLS A;  4UPG A;  2OTG B;  1PSR A;  2L5X B;  4PDZ A;  2JC2 A;  3EG5 B;  3DY9 A;  2KHN A;  5J3X A;  2F3Y A;  1IQ3 A;  3I5F B;  1B1G A;  1YVL A;  3D0Y A;  4DCK A;  4DRW A;  4GGN A;  2A4J A;  1IWQ A;  3HCM A;  3S0F A;  2WCE A;  1SL8 A;  2ZNE A;  3DD4 A;  1SCM B;  3MSE B;  5DKQ A;  4XYN A;  4YI8 A;  1QIV A;  1GJY A;  3CR5 X;  2SAS A;  1UUR A;  4JD9 A;  2QEB A;  2BE6 A;  3SJS A;  3EK4 A;  4PE7 A;  4ORA B;  2Y1N A;  5CSN A;  3WXA A;  1OOI X;  2PAL A;  4CPV A;  5DKR A;  3TDU A;  1XFY O;  2QAC A;  1DQE A;  3D74 A;  2WND A;  2KFF A;  1KFU L;  2L5Y A;  3FS7 A;  3JVT C;  2H2K A;  1J1D A;  1A4P A;  3D73 A;  4PHK A;  2AUC A;  4GNK B;  3IVT A;  3PAL A;  5FI2 A;  3PFV A;  5IBW A;  1ODB A;  3CR2 A;  2NCP A;  3S0E A;  1C07 A;  5HKW A;  1FW4 A;  1M31 A;  1N65 A;  1XFR A;  1NCZ A;  3BUM B;  1KQM C;  4KYN A;  3TDI A;  1Y6W A;  2LVK A;  3TS5 B;  1NX3 A;  3SIA A;  1S26 D;  1SK6 D;  1TCF A;  1BMO A;  2G9B A;  1CMG A;  1A75 A;  4GAO A;  2KAY A;  1JWD A;  4OKH A;  1XK4 C;  1QVI Y;  3SIB A;  3DZT A;  3OX6 A;  5AAN A;  4R1E A;  4CFQ A;  2H61 C;  1VRK A;  3QME A;  4PE0 A;  4D1E A;  3R1O A;  5DIC A;  3HX4 A;  1OOJ A;  1UHJ A;  3E3R A;  3PSR A;  4I5N B;  1QVI Z;  1EXR A;  1XVJ A;  5CSJ A;  2KI6 D;  1SPY A;  4ORB B;  1Z4H A;  1RWY A;  2M3W A;  4C0J A;  3LL8 B;  3JVT B;  3PAT A;  4GUK A;  4TNC A;  2KI4 B;  1AVS A;  1SW8 A;  4PHM A;  5HYD A;  2SCP A;  1YRT B;  1J7Q A;  1KK8 C;  1DF0 A;  1L2O B;  1J1E A;  1Y0V H;  5BPJ A;  1QX2 A;  3SG5 A;  1KQM B;  1CTR A;  4P2Y B;  3S0A A;  1CFP A;  1F71 A;  4PHJ A;  2LVJ A;  2JRF A;  5K89 A;  2I94 A;  2Q4U A;  2MRD A;  2RGI A;  4A4C A;  2JT0 A;  2LC5 A;  5PAL A;  3UO9 A;  5CSF A;  1MXL C;  4Q04 A;  4GPL B;  2MA2 A;  1CMF A;  4IL1 A;  4MZJ A;  4NDD A;  1CFF A;  3RM1 A;  1BR1 B;  1ZUZ A;  3O78 A;  2D8N A;  4OVN F;  1EJ3 A;  5KSZ A;  2ZFD A;  1T14 A;  3BJH A;  3S0B A;  4N5X A;  2I18 A;  5B8I B;  2BL0 C;  1WDC C;  2FOT A;  2KFH A;  1KK8 B;  1DJX A;  4INX A;  3JTD C;  5EL2 A;  1OSA A;  2M0R A;  4OZD A;  2PMY A;  1OQP A;  5ER4 X;  1QX7 A;  1S5G Y;  2K8M B;  1MR8 A;  3BUO B;  1SYM A;  1SBJ A;  2K2F A;  1M46 A;  1GM0 A;  1XA5 A;  3EVR A;  1MXE A;  1DJZ A;  1ALW A;  4MBE A;  3BFB A;  1PAL A;  1XK4 A;  3VRO A;  1IJ5 A;  3SG3 A;  2PRU A;  1JUO A;  1SR6 C;  1M39 A;  1QAS A;  2LP2 A;  4FTG A;  1ALV A;  1JF0 A;  3CZ0 A;  1GGZ A;  1NX1 A;  1Q80 A;  2LHI A;  1AUI B;  1JC2 A;  3TDZ A;  1DJG A;  4I5K A;  2PYQ A;  1YX7 A;  2KOT A;  1NCX A;  3D0Y B;  2BL0 B;  4XJK A;  3B88 A;  2WC5 A;  2DOQ A;  2KLD A;  2M97 A;  3DF0 A;  3I5I C;  1A03 A;  2AMI A;  3GOF A;  3CWG A;  1IKU A;  2WCK A;  1QXP A;  1NUB A;  4PAL A;  1XFU O;  1TCO B;  1DMO A;  1DC1 A;  2JZI A;  3AAJ A;  4JPZ B;  1KFX S;  1LVC D;  2HQ8 A;  2PSR A;  1RFJ A;  1M63 B;  5AEQ A;  3B86 A;  2MLE C;  1JSA A;  1A2X A;  2L2C A;  3SS3 A;  2BCB A;  1FI5 A;  2QEH A;  2WCJ A;  4DUQ A;  3PN7 C;  1SR6 B;  1OZO A;  1KSM A;  1IJ6 A;  2P70 A;  3R1V A;  3NSL A;  3CGA A;  3B7A A;  2O60 A;  3Q8I A;  2BBN A;  2JT8 A;  2JOJ A;  1IRJ A;  3I5I B;  3LK1 A;  1CDL A;  1PRW A;  2EC6 C;  4JWQ A;  1J7R A;  1A75 B;  1SSE B;  2BNX A;  2KAV A;  4ICB A;  1F70 A;  2HF5 A;  3VRQ A;  1QV1 A;  3I5G C;  1NIW A;  3O6B A;  1GGW A;  3ICB A;  4AQJ A;  4PT1 A;  3V2L A;  2M29 A;  5FYX A;  1WY9 A;  3RZS A;  3R72 A;  2CCM A;  1S3P A;  5D7F A;  2M7N A;  3D76 A;  2F3Z A;  3GK1 A;  2KQY A;  1LS8 A;  1LKJ A;  3CLN A;  3EKJ A;  5FI7 A;  5HL1 A;  4NDC A;  2LP3 A;  1QWV A;  2HQW A;  3C1V A;  5AER A;  1UP5 A;  1NX0 A;  1R2U A;  1K95 A;  4YI9 A;  4C0K A;  1DF0 B;  3D10 A;  3F45 A;  1CB1 A;  2JQ6 A;  3NGV A;  5I2Q A;  1C7V A;  4CFR A;  4WQ3 A;  2COL B;  2P71 A;  1CDP A;  3ZWH A;  3D77 A;  3NSO A;  2Y5I A;  2KBM A;  2HPS A;  1REC A;  3I5G B;  3BOW A;  1OE9 B;  4FQT A;  2WC6 A;  3DXL A;  3DVJ A;  5DKN A;  2LLT A;  2M49 B;  4AQI A;  1TWO A;  2BKI B;  1S6I A;  2LMU A;  1CFC A;  2MAZ A;  1NSH A;  2KSP A;  4DIR A;  1ZOT B;  4HSZ A;  4C0L A;  3PM2 A;  4M2Q A;  1F8H A;  2LUX A;  4ZCU A;  2KGR A;  1WRK A;  4HRE E;  2GGZ A;  1CM1 A;  1KK7 Y;  1XFX O;  2HET A;  2F2P A;  4PE4 A;  3VRN A;  2MBX A;  4OV2 A;  1DEL A;  2LVV A;  1B8R A;  1PVA A;  1KK7 Z;  2L50 A;  5I8N A;  1HT9 A;  4WRI A;  2CXJ A;  1TNP A;  1QLS A;  1IG5 A;  3ZNI A;  4HRG A;  1TRF A;  1OMR A;  2AAO A;  3CAB A;  3NHI A; 
#chains in the Genus database with same CATH homology
 4CID A;  1B8C A;  4YBH B;  3KO0 A;  1BOC A;  1AJ5 A;  1DJW A;  2LAN A;  5CSI A;  1K90 D;  1DJH A;  1KQV A;  1LIN A;  3IF7 A;  2F33 A;  4XJK B;  1SKT A;  2LAP A;  1TNX A;  3DF0 B;  1NYA A;  4PE1 A;  2NLN A;  2WCF A;  1KSO A;  1OMD A;  1MUX A;  1K96 A;  1WLZ A;  4YGD B;  2Y4Q A;  1HQV A;  3VRP A;  1S1E A;  1AHR A;  1XFZ O;  3EK8 A;  4L9M A;  1XYD A;  1SL9 A;  1YX8 A;  2P6B B;  1MQ1 A;  1CFD A;  1QJT A;  2LE9 B;  2PAS A;  2GV5 A;  1B7T Y;  3AKB A;  1S5G Z;  1S36 A;  3LK0 A;  2GGM A;  1CNP A;  2LUC A;  2I7A A;  3GK4 X;  1RRO A;  2E6W A;  1LA3 A;  1B7T Z;  1OZS A;  4AOM A;  1BU3 A;  1BOD A;  1SRA A;  1TIZ A;  3M0W A;  2L4I A;  1FBV A;  1PSB A;  2MHH A;  2WOR A;  1WRL A;  1Y1U A;  2JNX A;  1WDC B;  5F6T A;  1YRU B;  3EVU A;  1BJF A;  3JTD B;  5KTY A;  2EHB A;  2Q91 A;  1SCV A;  2BCX A;  3NSK A;  3I5H C;  1QS7 A;  1SMG A;  1N0Y A;  2JPT A;  1JF2 A;  4YGA A;  3IQO A;  1S6C A;  3OX5 A;  2L98 A;  1NCY A;  2KFG A;  1BT6 A;  3VGO A;  3BXK A;  1EG3 A;  4N1G A;  4YRU A;  1KFX L;  2B1U A;  1Y1X A;  2KNE A;  1B4C A;  1B47 A;  1IQ5 A;  1AK8 A;  2WC8 A;  1JBA A;  4M2O A;  2K7O A;  1RTP 1;  1NPQ A;  2QPT A;  1TN4 A;  1K9U A;  2LVI A;  1CKK A;  2KYC A;  1S6J A;  1SCM C;  4JQ0 D;  3KPX A;  1JFK A;  4I5J A;  4NDB A;  2JXL A;  1TNQ A;  2ZND A;  4A4B A;  2I2R E;  2JU0 A;  3BOW B;  4QJ4 B;  4MEW A;  2K2A A;  1R6P A;  1UHI A;  1EL4 A;  5ER5 A;  3BQ3 A;  3FWB A;  4MLW A;  2G2B A;  1RJV A;  2L4H A;  3BUW B;  1AP4 A;  3OP0 A;  2F8P A;  3BUN B;  3PN7 B;  2L51 A;  3EKH A;  1K8U A;  2LMV A;  2VRG A;  1X02 A;  2LV7 A;  1BG1 A;  2NXQ A;  1QLK A;  1UUS A;  4PCW A;  1K2H A;  4WQ2 A;  5JJG A;  4MRX A;  1MHO A;  3TS5 C;  4GGF C;  5JOL A;  2ZRT A;  1J7P A;  1UHK A;  2JTZ A;  3PM8 A;  4N1F A;  2FCD A;  4PHN A;  2M8U A;  1AJ4 A;  1DT7 B;  3LCP C;  5AFP A;  2K61 A;  1JFJ A;  1DVI A;  1SNL A;  2K7D A;  4GFT A;  4CLN A;  2EC6 B;  1K93 D;  3SG4 A;  5HKY A;  1YUR A;  2JNF A;  3BYA A;  1QTX A;  4F0Z B;  1KFU S;  3KF9 A;  1W7I B;  2M1K B;  2K0J A;  1ZMZ A;  3AAK A;  3CS1 A;  5AXI A;  3A8R A;  1A29 A;  2LHL A;  2KI4 C;  3OB1 B;  4BY4 A;  3VRR A;  2KI6 C;  5KU1 A;  2LCP A;  5TNC A;  4FQO A;  1TTX A;  2Y1M A;  1DGU A;  3WNX B;  2MJW B;  1QV0 A;  1L2O C;  1YTZ C;  1H8B A;  1IH0 A;  1TOP A;  1U5I B;  3O2P A;  1UHH A;  1D1O A;  1YUT A;  4DS7 A;  1EG4 A;  1B9A A;  2CBL A;  2JT3 A;  1NP8 A;  3EVV A;  3FWC A;  5CPV A;  3CTN A;  3WHT B;  1YUU A;  1CLM A;  2PVB A;  1OMV A;  1BF5 A;  3DVM A;  3SG6 A;  2V53 A;  5I2O A;  2NZ0 A;  1KWO C;  4ETO A;  2KGB C;  3DVK A;  1NX2 A;  4MRY A;  1BLQ A;  2BKH B;  3AKA A;  1K94 A;  2JUL A;  2LLU A;  1F54 A;  1DGV A;  2ZN9 A;  1DTL A;  4MZK A;  2K7B A;  1E8A A;  5D69 A;  2BCA A;  3KHE A;  2BEC A;  2CNP A;  1SY9 A;  1UHN A;  1MF8 B;  3QRX A;  1K9P A;  3RLZ A;  3TUY C;  4GGF A;  2TN4 A;  1U5I A;  3NSI A;  1ZFS A;  5HLO A;  2OPO A;  4MN0 A;  4USL A;  1DJY A;  4HRH A;  1B8L A;  1GQM A;  2ZRS A;  2M9G A;  3OB2 B;  2CT9 A;  1K9K A;  1YR5 A;  3A4U B;  4MZL A;  3DVE A;  2BBM A;  2KDH A;  1N2D A;  4QJ3 B;  4I5L B;  4OCI A;  1KWO B;  5HKZ A;  1QX5 B;  2WOS A;  1G4Y R;  4MSP A;  1CLL A;  2L2E A;  1IGV A;  3O4Y A;  4ORC B;  3NXA A;  1V1G A;  2O5G A;  1C7W A;  1MWN A;  2LM5 A;  2WCB A;  2ZKM X;  2OS8 C;  4YGB B;  4NQG A;  5HLV A;  2EGD A;  1G8I A;  3TUY B;  4BY5 A;  1L7Z A;  1RK9 A;  1PVB A;  2K7C A;  2FCE A;  3IQQ A;  1QIW A;  4ZCV A;  3CZT X;  1LXF C;  2JWW A;  3OHM B;  4E68 A;  1FPW A;  2LNK A;  3WHU B;  1Y1A A;  2KAX A;  1BR4 B;  1SL7 A;  1YUS A;  2F2O A;  2H61 A;  2JTT A;  3BUX B;  1WRZ A;  1DJI A;  3H4S E;  2KQ6 A;  1J7O A;  1H4B A;  2OTG C;  1J55 A;  1QAT A;  1F4Q A;  1ZAC A;  1FF1 A;  2CTN A;  2R2I A;  2KBI A;  2M7L A;  3K21 A;  2IS9 A;  4MVF A;  1XO5 A;  1TNW A;  1F4O A;  3I5F C;  2LMT A;  3CR4 X;  3LLE A;  1PK0 D;  1XFW O;  2NCO A;  4YGC B;  3FIA A;  3SG2 A;  1KCY A;  1V1F A;  3SG7 A;  1EH2 A;  4P5O E;  1NWD A;  2OS8 B;  3KEV A;  2ISD A;  4YGE B;  2FJU B;  2JXC A;  4OR9 B;  5GQQ C;  1WLM A;  2KYF A;  2E30 A;  1YVH A;  2M1U A;  1CDN A;  1CDM A;  4U8D A;  3I5H B;  4QJ5 B;  2ZN8 A;  3GK2 A;  4M2P A;  2MLF C;  1CM4 A;  1LA0 A;  5I2L A;  1M45 A;  1G33 A;  3TZ1 A;  1PUL A;  1XFV O;  5G08 A;  4GBA A;  3PLF B;  1UWO A;  2L0P A;  1F55 A;  3EK7 A;  1W7J B;  1FI6 A;  2BE4 A;  2LLS A;  4UPG A;  2OTG B;  1PSR A;  2L5X B;  4PDZ A;  2JC2 A;  2KHN A;  5J3X A;  2F3Y A;  1IQ3 A;  3I5F B;  1B1G A;  1YVL A;  3D0Y A;  4DCK A;  4DRW A;  4GGN A;  2A4J A;  1IWQ A;  3HCM A;  2WCE A;  1SL8 A;  2ZNE A;  3DD4 A;  1SCM B;  3MSE B;  5DKQ A;  4XYN A;  4YI8 A;  1QIV A;  1GJY A;  3CR5 X;  2SAS A;  1UUR A;  2BE6 A;  3SJS A;  3EK4 A;  4PE7 A;  4ORA B;  2Y1N A;  5CSN A;  3WXA A;  2PAL A;  4CPV A;  5DKR A;  3TDU A;  1XFY O;  2QAC A;  2WND A;  2KFF A;  1KFU L;  3FS7 A;  3JVT C;  2H2K A;  1J1D A;  1A4P A;  4PHK A;  2AUC A;  4GNK B;  3PAL A;  3PFV A;  5IBW A;  1ODB A;  3CR2 A;  2NCP A;  1C07 A;  5HKW A;  1FW4 A;  1M31 A;  1N65 A;  3BUM B;  1NCZ A;  1KQM C;  3TDI A;  3TS5 B;  1Y6W A;  2LVK A;  1NX3 A;  3SIA A;  1S26 D;  1SK6 D;  1TCF A;  1BMO A;  2G9B A;  1CMG A;  1A75 A;  4GAO A;  2KAY A;  1JWD A;  4OKH A;  1XK4 C;  1QVI Y;  3SIB A;  3OX6 A;  5AAN A;  4R1E A;  4CFQ A;  2H61 C;  1VRK A;  4PE0 A;  4D1E A;  3HX4 A;  1OOJ A;  1UHJ A;  3E3R A;  3PSR A;  4I5N B;  1QVI Z;  1EXR A;  1XVJ A;  5CSJ A;  2KI6 D;  1SPY A;  4ORB B;  1RWY A;  2M3W A;  4C0J A;  3LL8 B;  3JVT B;  3PAT A;  4GUK A;  4TNC A;  2KI4 B;  1AVS A;  1SW8 A;  4PHM A;  5HYD A;  2SCP A;  1YRT B;  1J7Q A;  1KK8 C;  1DF0 A;  1L2O B;  1J1E A;  1Y0V H;  5BPJ A;  1QX2 A;  3SG5 A;  1KQM B;  1CTR A;  4P2Y B;  1CFP A;  1F71 A;  4PHJ A;  2LVJ A;  2JRF A;  5K89 A;  2I94 A;  2Q4U A;  2MRD A;  2RGI A;  4A4C A;  2JT0 A;  2LC5 A;  5PAL A;  5CSF A;  1MXL C;  4Q04 A;  4GPL B;  2MA2 A;  1CMF A;  4IL1 A;  4MZJ A;  4NDD A;  1CFF A;  3RM1 A;  1BR1 B;  1ZUZ A;  3O78 A;  2D8N A;  4OVN F;  1EJ3 A;  5KSZ A;  2ZFD A;  4N5X A;  2I18 A;  5B8I B;  2BL0 C;  1WDC C;  2FOT A;  2KFH A;  1KK8 B;  1DJX A;  3JTD C;  1OSA A;  2M0R A;  2PMY A;  1OQP A;  5ER4 X;  1QX7 A;  1S5G Y;  2K8M B;  1MR8 A;  3BUO B;  1SYM A;  1SBJ A;  2K2F A;  1M46 A;  1XA5 A;  3EVR A;  1MXE A;  1DJZ A;  1ALW A;  4MBE A;  1PAL A;  1XK4 A;  3VRO A;  1IJ5 A;  3SG3 A;  2PRU A;  1JUO A;  1SR6 C;  1M39 A;  1QAS A;  2LP2 A;  4FTG A;  1ALV A;  1JF0 A;  1GGZ A;  1NX1 A;  1Q80 A;  2LHI A;  1AUI B;  1JC2 A;  3TDZ A;  1DJG A;  4I5K A;  1YX7 A;  2KOT A;  1NCX A;  3D0Y B;  2BL0 B;  4XJK A;  2DOQ A;  3I5I C;  2M97 A;  3DF0 A;  1A03 A;  2AMI A;  3GOF A;  3CWG A;  1IKU A;  1QXP A;  1NUB A;  4PAL A;  1XFU O;  1TCO B;  1DMO A;  2JZI A;  3AAJ A;  4JPZ B;  1KFX S;  1LVC D;  2HQ8 A;  2PSR A;  1RFJ A;  1M63 B;  5AEQ A;  2MLE C;  1JSA A;  1A2X A;  2BCB A;  1FI5 A;  4DUQ A;  3PN7 C;  1SR6 B;  1OZO A;  1KSM A;  1IJ6 A;  3NSL A;  3CGA A;  2O60 A;  2BBN A;  2JT8 A;  2JOJ A;  1IRJ A;  3I5I B;  3LK1 A;  1CDL A;  1PRW A;  2EC6 C;  4JWQ A;  1J7R A;  1A75 B;  2KAV A;  4ICB A;  1F70 A;  2HF5 A;  3VRQ A;  1QV1 A;  3I5G C;  1NIW A;  3O6B A;  1GGW A;  3ICB A;  4AQJ A;  2M29 A;  5FYX A;  1WY9 A;  2CCM A;  1S3P A;  5D7F A;  2M7N A;  3GK1 A;  2F3Z A;  4C0L A;  2KQY A;  1CLB A;  1LKJ A;  3CLN A;  3EKJ A;  4NDC A;  2LP3 A;  2HQW A;  3C1V A;  5AER A;  1UP5 A;  1NX0 A;  1R2U A;  1K95 A;  4YI9 A;  4C0K A;  1DF0 B;  3D10 A;  3F45 A;  1CB1 A;  2JQ6 A;  1C7V A;  5I2Q A;  4CFR A;  4WQ3 A;  2COL B;  1CDP A;  3ZWH A;  3NSO A;  2Y5I A;  2KBM A;  2HPS A;  1REC A;  3I5G B;  3BOW A;  1OE9 B;  5DKN A;  3DVJ A;  2LLT A;  2M49 B;  4AQI A;  2BKI B;  1S6I A;  2LMU A;  1CFC A;  2MAZ A;  1NSH A;  2KSP A;  4DIR A;  1ZOT B;  4HSZ A;  4M2Q A;  1F8H A;  2LUX A;  4ZCU A;  2KGR A;  1WRK A;  4HRE E;  2GGZ A;  1CM1 A;  1KK7 Y;  1XFX O;  2HET A;  2F2P A;  4PE4 A;  3VRN A;  2MBX A;  4OV2 A;  2LVV A;  1B8R A;  1PVA A;  1KK7 Z;  2L50 A;  5I8N A;  1HT9 A;  4WRI A;  2CXJ A;  1TNP A;  1QLS A;  1IG5 A;  3ZNI A;  4HRG A;  1TRF A;  1OMR A;  2AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...