1ZOTB

Crystal structure analysis of the cyaa/c-cam with pmeapp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
b'TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CyaA with C-terminal Calmodulin
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Lyase
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zotB00
1DJXA 1SNLA 1TRFA 1OSAA 1KSOA 2Q4UA 2BL0B 1FBVA 1N65A 2ZKMX 1QX5B 2CT9A 3CGAA 4AOMA 1DGUA 1UHNA 2LE9B 2Y1MA 2H2KA 4FQOA 1WRZA 5HLVA 2MLEC 2MLFC 2ZN9A 3VROA 4Q04A 5I2LA 1K2HA 1XFUO 2PALA 1C07A 1EJ3A 2JWWA 1CDPA 1SL8A 1K94A 1CDLA 1SCVA 1B8RA 4YGAA 3O4YA 1GGWA 4ORBB 1NP8A 1CFPA 1K93D 1A4PA 1M46A 1WDCB 3EVUA 3FWCA 4GNKB 4D1EA 2CBLA 3CR4X 1FF1A 1TNXA 3TZ1A 1JWDA 5I8NA 1UHHA 1HQVA 1CMGA 1EXRA 1SPYA 1YRUB 2MJWB 4MZJA 2WNDA 2KI6C 1PSRA 3FWBA 4XJKB 5D69A 2KBMA 2LLTA 1PRWA 4I5LB 2LCPA 1JUOA 3KO0A 1J7OA 2KOTA 2NZ0A 1IJ6A 5I2OA 2KI6D 2LV7A 3PLFB 1H4BA 2COLB 2E30A 2I2RE 1CDNA 3EK8A 4M2PA 1DMOA 1IQ3A 2K2FA 1K90D 1NCXA 3MSEB 2JXLA 1EH2A 1F71A 3EKHA 1KWOC 3LK0A 4TNCA 2B1UA 2ISDA 1B7TZ 2WCBA 3PN7C 1GQMA 1XFYO 2K7DA 2LP3A 2PSRA 2Y5IA 1R2UA 2JTTA 3BYAA 5HKZA 5AANA 2BE4A 2E6WA 2WC8A 4C0JA 2LP2A 4PE1A 2EGDA 1KWOB 2BCBA 3RLZA 1RFJA 3PN7B 4JQ0D 2HETA 3HX4A 3SG4A 2TN4A 1ZACA 1B8CA 2KYFA 1PVBA 1QIWA 2DOQA 1IJ5A 1DTLA 1KK8C 1IWQA 2M1KB 4JPZB 1K8UA 2WCFA 1DJHA 4HRHA 2LC5A 4HSZA 1UUSA 1L2OB 1Y6WA 1NYAA 1FPWA 2WOSA 1U5IA 3RM1A 1E8AA 1CKKA 1ALVA 2M3WA 2I18A 2M97A 2JQ6A 1TOPA 3OX6A 1QIVA 1XA5A 1NX2A 1KSMA 1IRJA 1XO5A 1MUXA 1SW8A 2KYCA 1BMOA 1C7WA 2CTNA 3CS1A 3O78A 4HREE 2MHHA 1QLKA 2K7BA 1SL7A 2EHBA 2K7CA 4N1FA 3OB2B 3WHUB 5AERA 2BECA 1UHKA 3KF9A 1KFUS 2MBXA 5HLOA 3I5HB 1R6PA 1JFKA 5DKRA 2K61A 4PE0A 1MF8B 1BR4B 1XYDA 4GGNA 2L4IA 1Y1AA 1TCFA 1M63B 1NX0A 2LHIA 1S26D 4M2QA 4OV2A 1SY9A 2OPOA 4F0ZB 1SK6D 4GAOA 1QXPA 3LLEA 1LA3A 1SR6C 5JOLA 2BE6A 1IH0A 3I5GB 1QV0A 1OMDA 4I5NB 1KFUL 2BCAA 1NUBA 2K2AA 1MHOA 1J7RA 2V53A 1KFXL 2GV5A 2LMVA 2RGIA 4MBEA 2NCOA 5PALA 5B8IB 4CPVA 1SKTA 4M2OA 1KQMC 1LVCD 1SR6B 3SG5A 4ICBA 1SCMC 1UHIA 3ICBA 1MXEA 1CNPA 2H61C 2JT3A 2O5GA 1KK7Y 2Y4QA 1DJWA 1DF0B 2KI4B 3TDZA 1HT9A 1JF0A 1FI5A 4GGFA 1BJFA 1OZOA 1ODBA 2OTGC 1K95A 2L0PA 4NQGA 1SRAA 3TDUA 3VRPA 4DS7A 1AHRA 1QJTA 2KFFA 2K0JA 1RROA 3LL8B 1NX1A 3PATA 5FYXA 1BU3A 3E3RA 1TIZA 1G33A 2KQ6A 2KGRA 2OTGB 4USLA 1DF0A 1S6CA 2LMTA 2HF5A 3JVTC 3NSLA 1XFZO 5AFPA 2ZNDA 1PSBA 1PULA 1AK8A 4UPGA 1YURA 2KFGA 1J55A 1Y1XA 4ETOA 1QTXA 2JNXA 1XFWO 1PALA 2LANA 4N1GA 3PFVA 1W7JB 1TCOB 4L9MA 4BY5A 3ZWHA 1N0YA 1RJVA 2EC6C 3DF0B 4YGBB 2JRFA 3SG7A 2KBIA 1A03A 1MXLC 4GPLB 1N2DA 1K9PA 1ALWA 2LVJA 3AKAA 3VRRA 3OX5A 3DVJA 4CFQA 3VGOA 5KU1A 4MN0A 4A4BA 3O2PA 1RTP1 3DVKA 4XJKA 5ER5A 1MWNA 1XFVO 1M45A 2HQWA 2I7AA 3DF0A 4I5JA 4MVFA 5DKQA 1CB1A 4YRUA 4PDZA 2ZN8A 4MEWA 3NSIA 1CFDA 2KAYA 2SCPA 3CTNA 5G08A 3DD4A 4N5XA 1QX7A 2L51A 1WY9A 3EVVA 3AAJA 1OZSA 4PE7A 4YGCB 4YGEB 3TS5C 1X02A 1YX8A 2JNFA 4PALA 1S3PA 4YI8A 1J1EA 2PRUA 1LKJA 3KPXA 1JC2A 3VRNA 1YUSA 2KAVA 1ZFSA 1JSAA 2L5XB 4QJ3B 3PSRA 2MRDA 1B9AA 3A4UB 2ZRTA 2JC2A 2LLUA 3M0WA 3BUNB 1AVSA 2M8UA 1NIWA 2FCEA 4MSPA 4JWQA 1CDMA 2BKHB 2QPTA 1QASA 4MZKA 1RK9A 3WXAA 1BF5A 1LINA 4GFTA 1KK8B 3TUYC 1S1EA 3SIBA 2G9BA 1YX7A 1EG3A 2F2OA 1BR1B 1AJ5A 2F3YA 4AQJA 1K9UA 2R2IA 2NXQA 4OKHA 4DIRA 4IL1A 4U8DA 2L2EA 2JT0A 3HCMA 3SG2A 2BBMA 2KFHA 2WCEA 4NDDA 1QATA 2FCDA 1UWOA 3PALA 2JOJA 1S5GY 3TDIA 1J7QA 3BUOB 1QS7A 1QX2A 4C0KA 2BCXA 2Q91A 4ORAB 3WHTB 1F70A 1A75B 1OMRA 4CLNA 2AAOA 2K7OA 3BOWB 2K8MB 3IQQA 1PVAA 1CMFA 1MQ1A 4WRIA 4MZLA 3I5IC 4NDBA 3F45A 1V1GA 3H4SE 1C7VA 1S36A 1K9KA 2BBNA 3JTDC 4DCKA 1IG5A 2LAPA 2GGMA 3I5FC 1B7TY 5CSNA 1NCZA 1DT7B 2LVIA 1ZMZA 3KEVA 3SJSA 1NSHA 1Y1UA 2KQYA 4OR9B 1IGVA 5JJGA 3BOWA 5KSZA 1H8BA 3GK4X 4PHKA 1W7IB 2PASA 4ZCVA 3EK7A 1WRKA 1D1OA 4ORCB 1AJ4A 2CCMA 2KSPA 5IBWA 1G8IA 4WQ2A 3ZNIA 4R1EA 1IQ5A 1XFXO 2BKIB 2LM5A 1SYMA 1KQMB 3OB1B 2LVKA 1SCMB 1BOCA 1A29A 3BUMB 2FOTA 2JZIA 4OCIA 1B4CA 5CSFA 2HPSA 1QV1A 5GQQC 1YTZC 3QRXA 2BL0C 4PHNA 5CSJA 2L50A 1BODA 1YRTB 3PM8A 1XK4A 3SG6A 4GBAA 1YVLA 3EVRA 1B47A 2KNEA 4YBHB 2F8PA 2JTZA 5J3XA 1NPQA 2D8NA 5D7FA 1TNPA 1F8HA 5TNCA 1QVIY 1AP4A 1DVIA 2H61A 1TNWA 2I94A 2F33A 1DJIA 3CR2A 4XYNA 3D10A 1WDCC 1AUIB 3JVTB 2JPTA 5CSIA 1J1DA 2LHLA 3AAKA 1LA0A 2M29A 4PCWA 3O6BA 1F54A 2M9GA 3GOFA 1WRLA 1KQVA 1G4YR 3BXKA 4DUQA 1JF2A 1NX3A 1LXFC 3NSKA 2LVVA 5ER4X 2SASA 3AKBA 3BUXB 2EC6B 2NCPA 4BY4A 2GGZA 1IKUA 3OP0A 2IS9A 4P5OE 2AUCA 1EG4A 1RWYA 1Q80A 1CLLA 3IQOA 2HQ8A 2F2PA 3BUWB 1TN4A 1OE9B 3FS7A 5I2QA 5BPJA 1CLBA 1DJGA 2FJUB 4I5KA 3CZTX 4C0LA 1WLMA 1S5GZ 1EL4A 3OHMB 1BG1A 3CR5X 1CM4A 4YGDB 4WQ3A 5KTYA 2LUXA 2L98A 1GGZA 1K96A 1UHJA 3EKJA 1NWDA 1DJYA 4YI9A 3NSOA 4PHJA 2F3ZA 3LCPC 1S6JA 2CNPA 1CLMA 1QLSA 1YR5A 2AMIA 1B8LA 2NLNA 3CWGA 4MRXA 1UURA 3SG3A 3TS5B 1DJZA 3KHEA 1S6IA 2JT8A 3CLNA 1BT6A 2M7LA 5HKYA 4E68A 2L4HA 4PHMA 5HKWA 1PK0D 1TNQA 1A2XA 1J7PA 2LNKA 5AEQA 1U5IB 1SMGA 1OQPA 1L2OC 3A8RA 1ZUZA 4FTGA 1KCYA 1NCYA 5DKNA 2M7NA 3D0YB 1Y0VH 4HRGA 2P6BB 2G2BA 1KK7Z 2PMYA 2KAXA 3TUYB 1F4QA 1B1GA 1FW4A 4ZCUA 3WNXB 1GJYA 4MRYA 2Y1NA 5K89A 5AXIA 1L7ZA 3C1VA 1UP5A 4OVNF 2A4JA 3DVMA 1OMVA 1TTXA 3D0YA 4PE4A 4P2YB 4QJ5B 2MAZA 2KHNA 3I5HC 2KDHA 1V1FA 3GK1A 2JU0A 2M0RA 1XVJA 1CTRA 4AQIA 1CFFA 1JFJA 1OOJA 2LLSA 4A4CA 2O60A 1JBAA 1M31A 3I5IB 1QVIZ 1A75A 3IF7A 4DRWA 2M49B 2M1UA 2ZNEA 4GUKA 2OS8C 3JTDB 1KFXS 3BQ3A 3EK4A 2ZFDA 3I5FB 3I5GC 2WORA 4CFRA 3VRQA 1SBJA 1CFCA 1VRKA 3FIAA 4GGFC 2PVBA 2CXJA 4QJ4B 1FI6A 2MA2A 1BLQA 2QACA 4MLWA 2VRGA 1DGVA 2OS8B 1M39A 5HYDA 1F4OA 5CPVA 3K21A 1YUUA 2LMUA 3GK2A 2LUCA 1XK4C 3LK1A 1ZOTB 2KI4C 3SIAA 1MR8A 1F55A 3DVEA 2JXCA 3NXAA 2ZRSA 5F6TA 1CM1A 1YUTA 2KGBC 1RECA 2JULA 1WLZA 1YVHA 4CIDA 4NDCA 1SL9A
chains in the Genus database with same CATH superfamily
1DELA 1DJXA 1SNLA 1TRFA 1OSAA 1KSOA 2Q4UA 2BL0B 1FBVA 1N65A 2ZKMX 1QX5B 2CT9A 3CGAA 4AOMA 1DGUA 1UHNA 2LE9B 2Y1MA 2H2KA 4FQOA 1WRZA 1OOGA 5HLVA 2MLEC 2MLFC 2ZN9A 3VROA 4Q04A 3CZ1A 5I2LA 1XFUO 1K2HA 2PALA 1C07A 1EJ3A 2JWWA 1CDPA 1SL8A 1K94A 1CDLA 1SCVA 1B8RA 3IVTA 4JKTA 4YGAA 3O4YA 1GGWA 4ORBB 1NP8A 1CFPA 2KPHA 1K93D 3S0FA 1A4PA 1M46A 1WDCB 3EVUA 3FWCA 4GNKB 4D1EA 2CBLA 3CR4X 1FF1A 1TNXA 3O4XA 2QEHA 3TZ1A 1JWDA 5I8NA 1UHHA 1HQVA 1CMGA 1EXRA 1SPYA 3FE8A 1YRUB 2H8VA 3SS3A 2MJWB 4MZJA 1TUJA 2WNDA 1DC1A 2KI6C 1PSRA 3FWBA 4XJKB 5D69A 2KBMA 2LLTA 3NHIA 1PRWA 4I5LB 2LCPA 1JUOA 3KO0A 1J7OA 2KOTA 2NZ0A 1IJ6A 5I2OA 3OBVA 2KI6D 2LV7A 2QEOA 3PLFB 1H4BA 1OOIX 2COLB 2E30A 2I2RE 1CDNA 3EK8A 4M2PA 1DMOA 3D78A 1IQ3A 2K2FA 1K90D 1NCXA 3MSEB 2JXLA 1EH2A 1F71A 3EKHA 1KWOC 3LK0A 4TNCA 2B1UA 2ISDA 1B7TZ 2WCBA 3PN7C 1GQMA 1XFYO 2K7DA 2LP3A 2PSRA 2QEVA 1R2UA 2JTTA 2Y5IA 3BYAA 5HKZA 2BE4A 5AANA 2E6WA 2WC8A 4C0JA 3RZSA 2LP2A 4PE1A 2EGDA 3NHTA 1KWOB 2BCBA 3RLZA 1RFJA 5FI2A 3PN7B 4JQ0D 2HETA 3HX4A 3SG4A 2TN4A 1ZACA 1B8CA 2KYFA 1PVBA 1QIWA 2DOQA 1IJ5A 1DTLA 1KK8C 1IWQA 2M1KB 4JPZB 1K8UA 2WCFA 1DJHA 3PM2A 2LC5A 4HRHA 4HSZA 1UUSA 1L2OB 1Y6WA 3B87A 1NYAA 2FJYA 1FPWA 2WOSA 1U5IA 3CDNA 1E8AA 3RM1A 1ALVA 2M3WA 1CKKA 2I18A 2M97A 2JQ6A 1TOPA 3OX6A 1QIVA 1XA5A 3QMEA 1NX2A 1KSMA 1ORGA 2WCKA 1IRJA 1XO5A 1MUXA 1SW8A 2KYCA 1BMOA 1C7WA 2CTNA 3CS1A 3O78A 3UNWA 1TWOA 4HREE 2MHHA 1QLKA 2K7BA 1SL7A 2EHBA 2K7CA 4N1FA 3OB2B 3WHUB 5AERA 2BECA 1UHKA 3KF9A 1KFUS 2MBXA 5HLOA 3I5HB 1R6PA 1JFKA 5DKRA 2K61A 4PE0A 1MF8B 1BR4B 2WCHA 3K1EA 1XYDA 3PJIA 2L4IA 3D76A 1Y1AA 4GGNA 1TCFA 1M63B 1NX0A 2LHIA 1S26D 4M2QA 4OV2A 1SY9A 2OPOA 4F0ZB 1SK6D 4GAOA 1QXPA 2QEBA 3BFHA 3LLEA 1LA3A 1SR6C 5JOLA 2BE6A 1IH0A 3I5GB 1QV0A 1OMDA 4I5NB 1KFUL 2P71A 2BCAA 1NUBA 2K2AA 1MHOA 1J7RA 3B86A 2V53A 2KLEA 1KFXL 2GV5A 2LMVA 2RGIA 4MBEA 2NCOA 5PALA 5B8IB 4CPVA 1SKTA 4M2OA 1KQMC 1LVCD 1SR6B 3SG5A 4ICBA 1SCMC 1UHIA 3FE6A 3ICBA 1MXEA 1CNPA 2H61C 2JT3A 2O5GA 1KK7Y 2Y4QA 1DJWA 1DF0B 2KI4B 3TDZA 3DXLA 1HT9A 1JF0A 1FI5A 3L4LA 1BJFA 1OZOA 4GGFA 2PYQA 1ODBA 2OTGC 1K95A 2L0PA 4NQGA 1SRAA 3TDUA 3VRPA 4DS7A 1AHRA 1OOFA 1QJTA 2KFFA 2K0JA 1RROA 3LL8B 1NX1A 3PATA 5FYXA 1BU3A 3E3RA 1TIZA 1G33A 2KQ6A 2KGRA 3EG5B 3Q8IA 2OTGB 4USLA 1DF0A 5EL2A 1S6CA 2LMTA 2HF5A 3JVTC 3NSLA 1XFZO 5AFPA 2ZNDA 1PSBA 2QDIA 1PULA 1AK8A 4UPGA 1YURA 2KFGA 1J55A 3D75A 1Y1XA 4ETOA 1QTXA 2JNXA 1XFWO 1PALA 2LANA 4N1GA 3PFVA 1W7JB 1TCOB 4L9MA 4BY5A 3ZWHA 1N0YA 1RJVA 2EC6C 3DF0B 4YGBB 2JRFA 3SG7A 4FQTA 2KBIA 1W9ZA 1A03A 3R72A 1OOHA 3S0EA 1MXLC 1DQEA 4GPLB 2KLDA 1N2DA 1K9PA 1ALWA 2LVJA 3AKAA 3VRRA 3OX5A 3DVJA 4CFQA 3VGOA 2BAPA 4MN0A 5KU1A 4A4BA 3O2PA 1RTP1 3DVKA 4XJKA 5ER5A 1MWNA 1XFVO 1M45A 2HQWA 2I7AA 3DF0A 4I5JA 4MVFA 5DKQA 1CB1A 4OZDA 3CYZA 4YRUA 4PDZA 2ZN8A 4MEWA 3NSIA 3BFAA 1CFDA 2KAYA 2SCPA 3CTNA 5G08A 3DD4A 4N5XA 1QX7A 2L51A 1WY9A 3EVVA 3AAJA 3S0GA 1OZSA 4PE7A 4YGCB 2GTEA 4YGEB 3TS5C 1X02A 1YX8A 2JNFA 4PALA 1S3PA 4YI8A 1J1EA 2PRUA 1LKJA 3KPXA 1JC2A 3N7HA 3VRNA 1YUSA 2KAVA 1ZFSA 1JSAA 2L5XB 4QJ3B 3PSRA 2MRDA 3CABA 1B9AA 3A4UB 2ZRTA 2PQLA 1GM0A 2JC2A 2LLUA 3M0WA 3BUNB 1AVSA 3S0DA 2M8UA 1NIWA 2FCEA 2WC6A 4MSPA 4JWQA 1CDMA 2BKHB 2QPTA 1QASA 4MZKA 1RK9A 1QWVA 3WXAA 1LINA 4GFTA 1KK8B 1OW4A 1S1EA 3TUYC 1BF5A 3B6XA 3SIBA 2G9BA 3B88A 1YX7A 1EG3A 2F2OA 1BR1B 4INWA 1AJ5A 2F3YA 4AQJA 1K9UA 2L2CA 2R2IA 2NXQA 3NGVA 4OKHA 4DIRA 4IL1A 4U8DA 2L2EA 2JT0A 3HCMA 3SG2A 5HL1A 2BBMA 2KFHA 2WCEA 3R1VA 4NDDA 1QATA 1TUZA 1UWOA 2FCDA 2JOJA 2JPOA 1S5GY 3PALA 3TDIA 3BUOB 1J7QA 4F7FA 1QS7A 1QX2A 4C0KA 2BCXA 2Q91A 4ORAB 3WHTB 3D73A 1F70A 1A75B 1OMRA 4CLNA 2AAOA 2K7OA 3BOWB 5FI7A 2K8MB 3IQQA 1PVAA 1CMFA 1MQ1A 4WRIA 4MZLA 3VB1A 3I5IC 4NDBA 3F45A 1V1GA 3H4SE 1C7VA 1S36A 1K9KA 2BBNA 3JTDC 3V2LA 4DCKA 1IG5A 2LAPA 2GGMA 3I5FC 1B7TY 5CSNA 1NCZA 1DT7B 2LVIA 1ZMZA 2P70A 3KEVA 1NSHA 1Y1UA 3SJSA 2KQYA 3FE9A 4OR9B 1IGVA 5JJGA 2ERBA 3BOWA 3DYEA 5KSZA 1H8BA 3GK4X 4PHKA 1W7IB 2PASA 4ZCVA 5I94A 3EK7A 1WRKA 3S0BA 1D1OA 4ORCB 1AJ4A 2CCMA 1DEKA 2KSPA 5IBWA 1G8IA 4WQ2A 3ZNIA 4R1EA 1IQ5A 1XFXO 2BKIB 2LM5A 1SYMA 1KQMB 3OB1B 2LVKA 1SCMB 1BOCA 1A29A 3BUMB 2FOTA 2JZIA 4OCIA 1B4CA 5CSFA 2HPSA 1QV1A 5GQQC 1YTZC 3QRXA 2BL0C 4PHNA 5CSJA 2L50A 1BODA 5FI6A 1YRTB 1Z2CB 3PM8A 1XK4A 3SG6A 4GBAA 1YVLA 3EVRA 1B47A 2KNEA 4YBHB 2F8PA 2JTZA 3D74A 5J3XA 1NPQA 2D8NA 5D7FA 1TNPA 1F8HA 5TNCA 1QVIY 1AP4A 1DVIA 2H61A 1TNWA 2I94A 2F33A 1DJIA 3CR2A 4XYNA 3D10A 1WDCC 1XFRA 1AUIB 3JVTB 2JPTA 5CSIA 1J1DA 2LHLA 1C3YA 3AAKA 1LA0A 2M29A 4PCWA 3O6BA 1F54A 2M9GA 3GOFA 1WRLA 2WCMA 1KQVA 1G4YR 3BXKA 4DUQA 1JF2A 1NX3A 1LXFC 3NSKA 3SS4A 4IJ7A 2LVVA 5ER4X 2SASA 3AKBA 3BUXB 2EC6B 2NCPA 4BY4A 2GGZA 1IKUA 3L4AA 3OP0A 1LS8A 2IS9A 4P5OE 2AUCA 3CZ2A 1EG4A 1RWYA 1Q80A 1CLLA 3IQOA 2HQ8A 2F2PA 3BUWB 1T14A 1OE9B 1TN4A 3FS7A 5BPJA 5I2QA 1CLBA 1DJGA 2FJUB 4I5KA 3CZTX 4C0LA 5D3OA 1WLMA 1S5GZ 1EL4A 3OHMB 1BG1A 3CR5X 1CM4A 4YGDB 4KYNA 4WQ3A 5KTYA 2LUXA 2L98A 1GGZA 1K96A 1UHJA 3EKJA 1NWDA 1DJYA 4YI9A 3NSOA 4PHJA 2F3ZA 3LCPC 1S6JA 4PT1A 1CLMA 1QLSA 1YR5A 2AMIA 2CNPA 1B8LA 2K60A 2NLNA 3BJHA 3CWGA 4MRXA 1UURA 5DICA 3SG3A 3TS5B 1DJZA 3KHEA 1S6IA 2JT8A 3CLNA 1BT6A 2M7LA 5HKYA 4E68A 2L4HA 4PHMA 5HKWA 1SSEB 1PK0D 1TNQA 3DZTA 3OGNA 1A2XA 3SS5A 1J7PA 2LNKA 5AEQA 1U5IB 3UO9A 1SMGA 1OQPA 1L2OC 3A8RA 1ZUZA 4FTGA 1KCYA 1NCYA 5DKNA 2M7NA 2BNXA 3B7AA 1Y0VH 2L5YA 3D0YB 2P6BB 4HRGA 2G2BA 1KK7Z 2PMYA 3CZ0A 2KAXA 3TUYB 1F4QA 1B1GA 1FW4A 2WC5A 4ZCUA 3WNXB 1GJYA 4MRYA 2Y1NA 5K89A 5AXIA 1L7ZA 3C1VA 1UP5A 4OVNF 2A4JA 3DVMA 1OMVA 1TTXA 3D0YA 4PE4A 4P2YB 1IIOA 1Z4HA 2MAZA 4QJ5B 2KHNA 3I5HC 2KDHA 1V1FA 2WCLA 3GK1A 2YGUA 2JU0A 2M0RA 1XVJA 1CTRA 4AQIA 1CFFA 1JFJA 1OOJA 2LLSA 4A4CA 2O60A 1JBAA 1M31A 3I5IB 1QVIZ 3BFBA 1A75A 3IF7A 4DRWA 2M49B 2M1UA 2ZNEA 3D77A 4GUKA 2OS8C 3JTDB 1KFXS 3BQ3A 3EK4A 4INXA 2ZFDA 3I5FB 3I5GC 2WORA 4CFRA 3L47A 3VRQA 1SBJA 1CFCA 1VRKA 3FIAA 4GGFC 2PVBA 2CXJA 4QJ4B 1FI6A 3R1PA 2MA2A 1BLQA 1P28A 2QACA 4MLWA 2VRGA 1DGVA 1C3ZA 1M39A 2OS8B 5HYDA 1F4OA 5CPVA 3K21A 1YUUA 2LMUA 2WCJA 3GK2A 2LUCA 1XK4C 3LK1A 1ZOTB 2KI4C 3SIAA 1MR8A 3DY9A 1F55A 3DVEA 4JD9A 2JXCA 3NXAA 2ZRSA 5F6TA 1CM1A 1YUTA 2KGBC 1RECA 2JULA 1WLZA 1YVHA 4CIDA 4NDCA 1SL9A 3S0AA 3R1OA
chains in the Genus database with same CATH topology
1DJXA 1SNLA 1TRFA 1OSAA 1KSOA 2Q4UA 2BL0B 1FBVA 1N65A 2ZKMX 1QX5B 2CT9A 3CGAA 4AOMA 1DGUA 1UHNA 2LE9B 2Y1MA 2H2KA 4FQOA 1WRZA 5HLVA 2MLEC 2MLFC 2ZN9A 3VROA 4Q04A 5I2LA 1K2HA 1XFUO 2PALA 1C07A 1EJ3A 2JWWA 1CDPA 1SL8A 1K94A 1CDLA 1SCVA 1B8RA 4YGAA 3O4YA 1GGWA 4ORBB 1NP8A 1CFPA 1K93D 1A4PA 1M46A 1WDCB 3EVUA 3FWCA 4GNKB 4D1EA 2CBLA 3CR4X 1FF1A 1TNXA 3TZ1A 1JWDA 5I8NA 1UHHA 1HQVA 1CMGA 1EXRA 1SPYA 1YRUB 2MJWB 4MZJA 2WNDA 2KI6C 1PSRA 3FWBA 4XJKB 5D69A 2KBMA 2LLTA 1PRWA 4I5LB 2LCPA 1JUOA 3KO0A 1J7OA 2KOTA 2NZ0A 1IJ6A 5I2OA 2KI6D 2LV7A 3PLFB 1H4BA 2COLB 2E30A 2I2RE 1CDNA 3EK8A 4M2PA 1DMOA 1IQ3A 2K2FA 1K90D 1NCXA 3MSEB 2JXLA 1EH2A 1F71A 3EKHA 1KWOC 3LK0A 4TNCA 2B1UA 2ISDA 1B7TZ 2WCBA 3PN7C 1GQMA 1XFYO 2K7DA 2LP3A 2PSRA 2Y5IA 1R2UA 2JTTA 3BYAA 5HKZA 5AANA 2BE4A 2E6WA 2WC8A 4C0JA 2LP2A 4PE1A 2EGDA 1KWOB 2BCBA 3RLZA 1RFJA 3PN7B 4JQ0D 2HETA 3HX4A 3SG4A 2TN4A 1ZACA 1B8CA 2KYFA 1PVBA 1QIWA 2DOQA 1IJ5A 1DTLA 1KK8C 1IWQA 2M1KB 4JPZB 1K8UA 2WCFA 1DJHA 4HRHA 2LC5A 4HSZA 1UUSA 1L2OB 1Y6WA 1NYAA 1FPWA 2WOSA 1U5IA 3RM1A 1E8AA 1CKKA 1ALVA 2M3WA 2I18A 2M97A 2JQ6A 1TOPA 3OX6A 1QIVA 1XA5A 1NX2A 1KSMA 1IRJA 1XO5A 1MUXA 1SW8A 2KYCA 1BMOA 1C7WA 2CTNA 3CS1A 3O78A 4HREE 2MHHA 1QLKA 2K7BA 1SL7A 2EHBA 2K7CA 4N1FA 3OB2B 3WHUB 5AERA 2BECA 1UHKA 3KF9A 1KFUS 2MBXA 5HLOA 3I5HB 1R6PA 1JFKA 5DKRA 2K61A 4PE0A 1MF8B 1BR4B 1XYDA 4GGNA 2L4IA 1Y1AA 1TCFA 1M63B 1NX0A 2LHIA 1S26D 4M2QA 4OV2A 1SY9A 2OPOA 4F0ZB 1SK6D 4GAOA 1QXPA 3LLEA 1LA3A 1SR6C 5JOLA 2BE6A 1IH0A 3I5GB 1QV0A 1OMDA 4I5NB 1KFUL 2BCAA 1NUBA 2K2AA 1MHOA 1J7RA 2V53A 1KFXL 2GV5A 2LMVA 2RGIA 4MBEA 2NCOA 5PALA 5B8IB 4CPVA 1SKTA 4M2OA 1KQMC 1LVCD 1SR6B 3SG5A 4ICBA 1SCMC 1UHIA 3ICBA 1MXEA 1CNPA 2H61C 2JT3A 2O5GA 1KK7Y 2Y4QA 1DJWA 1DF0B 2KI4B 3TDZA 1HT9A 1JF0A 1FI5A 4GGFA 1BJFA 1OZOA 1ODBA 2OTGC 1K95A 2L0PA 4NQGA 1SRAA 3TDUA 3VRPA 4DS7A 1AHRA 1QJTA 2KFFA 2K0JA 1RROA 3LL8B 1NX1A 3PATA 5FYXA 1BU3A 3E3RA 1TIZA 1G33A 2KQ6A 2KGRA 2OTGB 4USLA 1DF0A 1S6CA 2LMTA 2HF5A 3JVTC 3NSLA 1XFZO 5AFPA 2ZNDA 1PSBA 1PULA 1AK8A 4UPGA 1YURA 2KFGA 1J55A 1Y1XA 4ETOA 1QTXA 2JNXA 1XFWO 1PALA 2LANA 4N1GA 3PFVA 1W7JB 1TCOB 4L9MA 4BY5A 3ZWHA 1N0YA 1RJVA 2EC6C 3DF0B 4YGBB 2JRFA 3SG7A 2KBIA 1A03A 1MXLC 4GPLB 1N2DA 1K9PA 1ALWA 2LVJA 3AKAA 3VRRA 3OX5A 3DVJA 4CFQA 3VGOA 5KU1A 4MN0A 4A4BA 3O2PA 1RTP1 3DVKA 4XJKA 5ER5A 1MWNA 1XFVO 1M45A 2HQWA 2I7AA 3DF0A 4I5JA 4MVFA 5DKQA 1CB1A 4YRUA 4PDZA 2ZN8A 4MEWA 3NSIA 1CFDA 2KAYA 2SCPA 3CTNA 5G08A 3DD4A 4N5XA 1QX7A 2L51A 1WY9A 3EVVA 3AAJA 1OZSA 4PE7A 4YGCB 4YGEB 3TS5C 1X02A 1YX8A 2JNFA 4PALA 1S3PA 4YI8A 1J1EA 2PRUA 1LKJA 3KPXA 1JC2A 3VRNA 1YUSA 2KAVA 1ZFSA 1JSAA 2L5XB 4QJ3B 3PSRA 2MRDA 1B9AA 3A4UB 2ZRTA 2JC2A 2LLUA 3M0WA 3BUNB 1AVSA 2M8UA 1NIWA 2FCEA 4MSPA 4JWQA 1CDMA 2BKHB 2QPTA 1QASA 4MZKA 1RK9A 3WXAA 1BF5A 1LINA 4GFTA 1KK8B 3TUYC 1S1EA 3SIBA 2G9BA 1YX7A 1EG3A 2F2OA 1BR1B 1AJ5A 2F3YA 4AQJA 1K9UA 2R2IA 2NXQA 4OKHA 4DIRA 4IL1A 4U8DA 2L2EA 2JT0A 3HCMA 3SG2A 2BBMA 2KFHA 2WCEA 4NDDA 1QATA 2FCDA 1UWOA 3PALA 2JOJA 1S5GY 3TDIA 1J7QA 3BUOB 1QS7A 1QX2A 4C0KA 2BCXA 2Q91A 4ORAB 3WHTB 1F70A 1A75B 1OMRA 4CLNA 2AAOA 2K7OA 3BOWB 2K8MB 3IQQA 1PVAA 1CMFA 1MQ1A 4WRIA 4MZLA 3I5IC 4NDBA 3F45A 1V1GA 3H4SE 1C7VA 1S36A 1K9KA 2BBNA 3JTDC 4DCKA 1IG5A 2LAPA 2GGMA 3I5FC 1B7TY 5CSNA 1NCZA 1DT7B 2LVIA 1ZMZA 3KEVA 3SJSA 1NSHA 1Y1UA 2KQYA 4OR9B 1IGVA 5JJGA 3BOWA 5KSZA 1H8BA 3GK4X 4PHKA 1W7IB 2PASA 4ZCVA 3EK7A 1WRKA 1D1OA 4ORCB 1AJ4A 2CCMA 2KSPA 5IBWA 1G8IA 4WQ2A 3ZNIA 4R1EA 1IQ5A 1XFXO 2BKIB 2LM5A 1SYMA 1KQMB 3OB1B 2LVKA 1SCMB 1BOCA 1A29A 3BUMB 2FOTA 2JZIA 4OCIA 1B4CA 5CSFA 2HPSA 1QV1A 5GQQC 1YTZC 3QRXA 2BL0C 4PHNA 5CSJA 2L50A 1BODA 1YRTB 3PM8A 1XK4A 3SG6A 4GBAA 1YVLA 3EVRA 1B47A 2KNEA 4YBHB 2F8PA 2JTZA 5J3XA 1NPQA 2D8NA 5D7FA 1TNPA 1F8HA 5TNCA 1QVIY 1AP4A 1DVIA 2H61A 1TNWA 2I94A 2F33A 1DJIA 3CR2A 4XYNA 3D10A 1WDCC 1AUIB 3JVTB 2JPTA 5CSIA 1J1DA 2LHLA 3AAKA 1LA0A 2M29A 4PCWA 3O6BA 1F54A 2M9GA 3GOFA 1WRLA 1KQVA 1G4YR 3BXKA 4DUQA 1JF2A 1NX3A 1LXFC 3NSKA 2LVVA 5ER4X 2SASA 3AKBA 3BUXB 2EC6B 2NCPA 4BY4A 2GGZA 1IKUA 3OP0A 2IS9A 4P5OE 2AUCA 1EG4A 1RWYA 1Q80A 1CLLA 3IQOA 2HQ8A 2F2PA 3BUWB 1TN4A 1OE9B 3FS7A 5I2QA 5BPJA 1CLBA 1DJGA 2FJUB 4I5KA 3CZTX 4C0LA 1WLMA 1S5GZ 1EL4A 3OHMB 1BG1A 3CR5X 1CM4A 4YGDB 4WQ3A 5KTYA 2LUXA 2L98A 1GGZA 1K96A 1UHJA 3EKJA 1NWDA 1DJYA 4YI9A 3NSOA 4PHJA 2F3ZA 3LCPC 1S6JA 2CNPA 1CLMA 1QLSA 1YR5A 2AMIA 1B8LA 2NLNA 3CWGA 4MRXA 1UURA 3SG3A 3TS5B 1DJZA 3KHEA 1S6IA 2JT8A 3CLNA 1BT6A 2M7LA 5HKYA 4E68A 2L4HA 4PHMA 5HKWA 1PK0D 1TNQA 1A2XA 1J7PA 2LNKA 5AEQA 1U5IB 1SMGA 1OQPA 1L2OC 3A8RA 1ZUZA 4FTGA 1KCYA 1NCYA 5DKNA 2M7NA 3D0YB 1Y0VH 4HRGA 2P6BB 2G2BA 1KK7Z 2PMYA 2KAXA 3TUYB 1F4QA 1B1GA 1FW4A 4ZCUA 3WNXB 1GJYA 4MRYA 2Y1NA 5K89A 5AXIA 1L7ZA 3C1VA 1UP5A 4OVNF 2A4JA 3DVMA 1OMVA 1TTXA 3D0YA 4PE4A 4P2YB 4QJ5B 2MAZA 2KHNA 3I5HC 2KDHA 1V1FA 3GK1A 2JU0A 2M0RA 1XVJA 1CTRA 4AQIA 1CFFA 1JFJA 1OOJA 2LLSA 4A4CA 2O60A 1JBAA 1M31A 3I5IB 1QVIZ 1A75A 3IF7A 4DRWA 2M49B 2M1UA 2ZNEA 4GUKA 2OS8C 3JTDB 1KFXS 3BQ3A 3EK4A 2ZFDA 3I5FB 3I5GC 2WORA 4CFRA 3VRQA 1SBJA 1CFCA 1VRKA 3FIAA 4GGFC 2PVBA 2CXJA 4QJ4B 1FI6A 2MA2A 1BLQA 2QACA 4MLWA 2VRGA 1DGVA 2OS8B 1M39A 5HYDA 1F4OA 5CPVA 3K21A 1YUUA 2LMUA 3GK2A 2LUCA 1XK4C 3LK1A 1ZOTB 2KI4C 3SIAA 1MR8A 1F55A 3DVEA 2JXCA 3NXAA 2ZRSA 5F6TA 1CM1A 1YUTA 2KGBC 1RECA 2JULA 1WLZA 1YVHA 4CIDA 4NDCA 1SL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJX A;  1SNL A;  1TRF A;  1OSA A;  1KSO A;  2Q4U A;  2BL0 B;  1FBV A;  1N65 A;  2ZKM X;  1QX5 B;  2CT9 A;  3CGA A;  4AOM A;  1DGU A;  1UHN A;  2LE9 B;  2Y1M A;  2H2K A;  4FQO A;  1WRZ A;  5HLV A;  2MLE C;  2MLF C;  2ZN9 A;  3VRO A;  4Q04 A;  5I2L A;  1K2H A;  1XFU O;  2PAL A;  1C07 A;  1EJ3 A;  2JWW A;  1CDP A;  1SL8 A;  1K94 A;  1CDL A;  1SCV A;  1B8R A;  4YGA A;  3O4Y A;  1GGW A;  4ORB B;  1NP8 A;  1CFP A;  1K93 D;  1A4P A;  1M46 A;  1WDC B;  3EVU A;  3FWC A;  4GNK B;  4D1E A;  2CBL A;  3CR4 X;  1FF1 A;  1TNX A;  3TZ1 A;  1JWD A;  5I8N A;  1UHH A;  1HQV A;  1CMG A;  1EXR A;  1SPY A;  1YRU B;  2MJW B;  4MZJ A;  2WND A;  2KI6 C;  1PSR A;  3FWB A;  4XJK B;  5D69 A;  2KBM A;  2LLT A;  1PRW A;  4I5L B;  2LCP A;  1JUO A;  3KO0 A;  1J7O A;  2KOT A;  2NZ0 A;  1IJ6 A;  5I2O A;  2KI6 D;  2LV7 A;  3PLF B;  1H4B A;  2COL B;  2E30 A;  2I2R E;  1CDN A;  3EK8 A;  4M2P A;  1DMO A;  1IQ3 A;  2K2F A;  1K90 D;  1NCX A;  3MSE B;  2JXL A;  1EH2 A;  1F71 A;  3EKH A;  1KWO C;  3LK0 A;  4TNC A;  2B1U A;  2ISD A;  1B7T Z;  2WCB A;  3PN7 C;  1GQM A;  1XFY O;  2K7D A;  2LP3 A;  2PSR A;  2Y5I A;  1R2U A;  2JTT A;  3BYA A;  5HKZ A;  5AAN A;  2BE4 A;  2E6W A;  2WC8 A;  4C0J A;  2LP2 A;  4PE1 A;  2EGD A;  1KWO B;  2BCB A;  3RLZ A;  1RFJ A;  3PN7 B;  4JQ0 D;  2HET A;  3HX4 A;  3SG4 A;  2TN4 A;  1ZAC A;  1B8C A;  2KYF A;  1PVB A;  1QIW A;  2DOQ A;  1IJ5 A;  1DTL A;  1KK8 C;  1IWQ A;  2M1K B;  4JPZ B;  1K8U A;  2WCF A;  1DJH A;  4HRH A;  2LC5 A;  4HSZ A;  1UUS A;  1L2O B;  1Y6W A;  1NYA A;  1FPW A;  2WOS A;  1U5I A;  3RM1 A;  1E8A A;  1CKK A;  1ALV A;  2M3W A;  2I18 A;  2M97 A;  2JQ6 A;  1TOP A;  3OX6 A;  1QIV A;  1XA5 A;  1NX2 A;  1KSM A;  1IRJ A;  1XO5 A;  1MUX A;  1SW8 A;  2KYC A;  1BMO A;  1C7W A;  2CTN A;  3CS1 A;  3O78 A;  4HRE E;  2MHH A;  1QLK A;  2K7B A;  1SL7 A;  2EHB A;  2K7C A;  4N1F A;  3OB2 B;  3WHU B;  5AER A;  2BEC A;  1UHK A;  3KF9 A;  1KFU S;  2MBX A;  5HLO A;  3I5H B;  1R6P A;  1JFK A;  5DKR A;  2K61 A;  4PE0 A;  1MF8 B;  1BR4 B;  1XYD A;  4GGN A;  2L4I A;  1Y1A A;  1TCF A;  1M63 B;  1NX0 A;  2LHI A;  1S26 D;  4M2Q A;  4OV2 A;  1SY9 A;  2OPO A;  4F0Z B;  1SK6 D;  4GAO A;  1QXP A;  3LLE A;  1LA3 A;  1SR6 C;  5JOL A;  2BE6 A;  1IH0 A;  3I5G B;  1QV0 A;  1OMD A;  4I5N B;  1KFU L;  2BCA A;  1NUB A;  2K2A A;  1MHO A;  1J7R A;  2V53 A;  1KFX L;  2GV5 A;  2LMV A;  2RGI A;  4MBE A;  2NCO A;  5PAL A;  5B8I B;  4CPV A;  1SKT A;  4M2O A;  1KQM C;  1LVC D;  1SR6 B;  3SG5 A;  4ICB A;  1SCM C;  1UHI A;  3ICB A;  1MXE A;  1CNP A;  2H61 C;  2JT3 A;  2O5G A;  1KK7 Y;  2Y4Q A;  1DJW A;  1DF0 B;  2KI4 B;  3TDZ A;  1HT9 A;  1JF0 A;  1FI5 A;  4GGF A;  1BJF A;  1OZO A;  1ODB A;  2OTG C;  1K95 A;  2L0P A;  4NQG A;  1SRA A;  3TDU A;  3VRP A;  4DS7 A;  1AHR A;  1QJT A;  2KFF A;  2K0J A;  1RRO A;  3LL8 B;  1NX1 A;  3PAT A;  5FYX A;  1BU3 A;  3E3R A;  1TIZ A;  1G33 A;  2KQ6 A;  2KGR A;  2OTG B;  4USL A;  1DF0 A;  1S6C A;  2LMT A;  2HF5 A;  3JVT C;  3NSL A;  1XFZ O;  5AFP A;  2ZND A;  1PSB A;  1PUL A;  1AK8 A;  4UPG A;  1YUR A;  2KFG A;  1J55 A;  1Y1X A;  4ETO A;  1QTX A;  2JNX A;  1XFW O;  1PAL A;  2LAN A;  4N1G A;  3PFV A;  1W7J B;  1TCO B;  4L9M A;  4BY5 A;  3ZWH A;  1N0Y A;  1RJV A;  2EC6 C;  3DF0 B;  4YGB B;  2JRF A;  3SG7 A;  2KBI A;  1A03 A;  1MXL C;  4GPL B;  1N2D A;  1K9P A;  1ALW A;  2LVJ A;  3AKA A;  3VRR A;  3OX5 A;  3DVJ A;  4CFQ A;  3VGO A;  5KU1 A;  4MN0 A;  4A4B A;  3O2P A;  1RTP 1;  3DVK A;  4XJK A;  5ER5 A;  1MWN A;  1XFV O;  1M45 A;  2HQW A;  2I7A A;  3DF0 A;  4I5J A;  4MVF A;  5DKQ A;  1CB1 A;  4YRU A;  4PDZ A;  2ZN8 A;  4MEW A;  3NSI A;  1CFD A;  2KAY A;  2SCP A;  3CTN A;  5G08 A;  3DD4 A;  4N5X A;  1QX7 A;  2L51 A;  1WY9 A;  3EVV A;  3AAJ A;  1OZS A;  4PE7 A;  4YGC B;  4YGE B;  3TS5 C;  1X02 A;  1YX8 A;  2JNF A;  4PAL A;  1S3P A;  4YI8 A;  1J1E A;  2PRU A;  1LKJ A;  3KPX A;  1JC2 A;  3VRN A;  1YUS A;  2KAV A;  1ZFS A;  1JSA A;  2L5X B;  4QJ3 B;  3PSR A;  2MRD A;  1B9A A;  3A4U B;  2ZRT A;  2JC2 A;  2LLU A;  3M0W A;  3BUN B;  1AVS A;  2M8U A;  1NIW A;  2FCE A;  4MSP A;  4JWQ A;  1CDM A;  2BKH B;  2QPT A;  1QAS A;  4MZK A;  1RK9 A;  3WXA A;  1BF5 A;  1LIN A;  4GFT A;  1KK8 B;  3TUY C;  1S1E A;  3SIB A;  2G9B A;  1YX7 A;  1EG3 A;  2F2O A;  1BR1 B;  1AJ5 A;  2F3Y A;  4AQJ A;  1K9U A;  2R2I A;  2NXQ A;  4OKH A;  4DIR A;  4IL1 A;  4U8D A;  2L2E A;  2JT0 A;  3HCM A;  3SG2 A;  2BBM A;  2KFH A;  2WCE A;  4NDD A;  1QAT A;  2FCD A;  1UWO A;  3PAL A;  2JOJ A;  1S5G Y;  3TDI A;  1J7Q A;  3BUO B;  1QS7 A;  1QX2 A;  4C0K A;  2BCX A;  2Q91 A;  4ORA B;  3WHT B;  1F70 A;  1A75 B;  1OMR A;  4CLN A;  2AAO A;  2K7O A;  3BOW B;  2K8M B;  3IQQ A;  1PVA A;  1CMF A;  1MQ1 A;  4WRI A;  4MZL A;  3I5I C;  4NDB A;  3F45 A;  1V1G A;  3H4S E;  1C7V A;  1S36 A;  1K9K A;  2BBN A;  3JTD C;  4DCK A;  1IG5 A;  2LAP A;  2GGM A;  3I5F C;  1B7T Y;  5CSN A;  1NCZ A;  1DT7 B;  2LVI A;  1ZMZ A;  3KEV A;  3SJS A;  1NSH A;  1Y1U A;  2KQY A;  4OR9 B;  1IGV A;  5JJG A;  3BOW A;  5KSZ A;  1H8B A;  3GK4 X;  4PHK A;  1W7I B;  2PAS A;  4ZCV A;  3EK7 A;  1WRK A;  1D1O A;  4ORC B;  1AJ4 A;  2CCM A;  2KSP A;  5IBW A;  1G8I A;  4WQ2 A;  3ZNI A;  4R1E A;  1IQ5 A;  1XFX O;  2BKI B;  2LM5 A;  1SYM A;  1KQM B;  3OB1 B;  2LVK A;  1SCM B;  1BOC A;  1A29 A;  3BUM B;  2FOT A;  2JZI A;  4OCI A;  1B4C A;  5CSF A;  2HPS A;  1QV1 A;  5GQQ C;  1YTZ C;  3QRX A;  2BL0 C;  4PHN A;  5CSJ A;  2L50 A;  1BOD A;  1YRT B;  3PM8 A;  1XK4 A;  3SG6 A;  4GBA A;  1YVL A;  3EVR A;  1B47 A;  2KNE A;  4YBH B;  2F8P A;  2JTZ A;  5J3X A;  1NPQ A;  2D8N A;  5D7F A;  1TNP A;  1F8H A;  5TNC A;  1QVI Y;  1AP4 A;  1DVI A;  2H61 A;  1TNW A;  2I94 A;  2F33 A;  1DJI A;  3CR2 A;  4XYN A;  3D10 A;  1WDC C;  1AUI B;  3JVT B;  2JPT A;  5CSI A;  1J1D A;  2LHL A;  3AAK A;  1LA0 A;  2M29 A;  4PCW A;  3O6B A;  1F54 A;  2M9G A;  3GOF A;  1WRL A;  1KQV A;  1G4Y R;  3BXK A;  4DUQ A;  1JF2 A;  1NX3 A;  1LXF C;  3NSK A;  2LVV A;  5ER4 X;  2SAS A;  3AKB A;  3BUX B;  2EC6 B;  2NCP A;  4BY4 A;  2GGZ A;  1IKU A;  3OP0 A;  2IS9 A;  4P5O E;  2AUC A;  1EG4 A;  1RWY A;  1Q80 A;  1CLL A;  3IQO A;  2HQ8 A;  2F2P A;  3BUW B;  1TN4 A;  1OE9 B;  3FS7 A;  5I2Q A;  5BPJ A;  1CLB A;  1DJG A;  2FJU B;  4I5K A;  3CZT X;  4C0L A;  1WLM A;  1S5G Z;  1EL4 A;  3OHM B;  1BG1 A;  3CR5 X;  1CM4 A;  4YGD B;  4WQ3 A;  5KTY A;  2LUX A;  2L98 A;  1GGZ A;  1K96 A;  1UHJ A;  3EKJ A;  1NWD A;  1DJY A;  4YI9 A;  3NSO A;  4PHJ A;  2F3Z A;  3LCP C;  1S6J A;  2CNP A;  1CLM A;  1QLS A;  1YR5 A;  2AMI A;  1B8L A;  2NLN A;  3CWG A;  4MRX A;  1UUR A;  3SG3 A;  3TS5 B;  1DJZ A;  3KHE A;  1S6I A;  2JT8 A;  3CLN A;  1BT6 A;  2M7L A;  5HKY A;  4E68 A;  2L4H A;  4PHM A;  5HKW A;  1PK0 D;  1TNQ A;  1A2X A;  1J7P A;  2LNK A;  5AEQ A;  1U5I B;  1SMG A;  1OQP A;  1L2O C;  3A8R A;  1ZUZ A;  4FTG A;  1KCY A;  1NCY A;  5DKN A;  2M7N A;  3D0Y B;  1Y0V H;  4HRG A;  2P6B B;  2G2B A;  1KK7 Z;  2PMY A;  2KAX A;  3TUY B;  1F4Q A;  1B1G A;  1FW4 A;  4ZCU A;  3WNX B;  1GJY A;  4MRY A;  2Y1N A;  5K89 A;  5AXI A;  1L7Z A;  3C1V A;  1UP5 A;  4OVN F;  2A4J A;  3DVM A;  1OMV A;  1TTX A;  3D0Y A;  4PE4 A;  4P2Y B;  4QJ5 B;  2MAZ A;  2KHN A;  3I5H C;  2KDH A;  1V1F A;  3GK1 A;  2JU0 A;  2M0R A;  1XVJ A;  1CTR A;  4AQI A;  1CFF A;  1JFJ A;  1OOJ A;  2LLS A;  4A4C A;  2O60 A;  1JBA A;  1M31 A;  3I5I B;  1QVI Z;  1A75 A;  3IF7 A;  4DRW A;  2M49 B;  2M1U A;  2ZNE A;  4GUK A;  2OS8 C;  3JTD B;  1KFX S;  3BQ3 A;  3EK4 A;  2ZFD A;  3I5F B;  3I5G C;  2WOR A;  4CFR A;  3VRQ A;  1SBJ A;  1CFC A;  1VRK A;  3FIA A;  4GGF C;  2PVB A;  2CXJ A;  4QJ4 B;  1FI6 A;  2MA2 A;  1BLQ A;  2QAC A;  4MLW A;  2VRG A;  1DGV A;  2OS8 B;  1M39 A;  5HYD A;  1F4O A;  5CPV A;  3K21 A;  1YUU A;  2LMU A;  3GK2 A;  2LUC A;  1XK4 C;  3LK1 A;  1ZOT B;  2KI4 C;  3SIA A;  1MR8 A;  1F55 A;  3DVE A;  2JXC A;  3NXA A;  2ZRS A;  5F6T A;  1CM1 A;  1YUT A;  2KGB C;  1REC A;  2JUL A;  1WLZ A;  1YVH A;  4CID A;  4NDC A;  1SL9 A; 
#chains in the Genus database with same CATH topology
 1DEL A;  1DJX A;  1SNL A;  1TRF A;  1OSA A;  1KSO A;  2Q4U A;  2BL0 B;  1FBV A;  1N65 A;  2ZKM X;  1QX5 B;  2CT9 A;  3CGA A;  4AOM A;  1DGU A;  1UHN A;  2LE9 B;  2Y1M A;  2H2K A;  4FQO A;  1WRZ A;  1OOG A;  5HLV A;  2MLE C;  2MLF C;  2ZN9 A;  3VRO A;  4Q04 A;  3CZ1 A;  5I2L A;  1XFU O;  1K2H A;  2PAL A;  1C07 A;  1EJ3 A;  2JWW A;  1CDP A;  1SL8 A;  1K94 A;  1CDL A;  1SCV A;  1B8R A;  3IVT A;  4JKT A;  4YGA A;  3O4Y A;  1GGW A;  4ORB B;  1NP8 A;  1CFP A;  2KPH A;  1K93 D;  3S0F A;  1A4P A;  1M46 A;  1WDC B;  3EVU A;  3FWC A;  4GNK B;  4D1E A;  2CBL A;  3CR4 X;  1FF1 A;  1TNX A;  3O4X A;  2QEH A;  3TZ1 A;  1JWD A;  5I8N A;  1UHH A;  1HQV A;  1CMG A;  1EXR A;  1SPY A;  3FE8 A;  1YRU B;  2H8V A;  3SS3 A;  2MJW B;  4MZJ A;  1TUJ A;  2WND A;  1DC1 A;  2KI6 C;  1PSR A;  3FWB A;  4XJK B;  5D69 A;  2KBM A;  2LLT A;  3NHI A;  1PRW A;  4I5L B;  2LCP A;  1JUO A;  3KO0 A;  1J7O A;  2KOT A;  2NZ0 A;  1IJ6 A;  5I2O A;  3OBV A;  2KI6 D;  2LV7 A;  2QEO A;  3PLF B;  1H4B A;  1OOI X;  2COL B;  2E30 A;  2I2R E;  1CDN A;  3EK8 A;  4M2P A;  1DMO A;  3D78 A;  1IQ3 A;  2K2F A;  1K90 D;  1NCX A;  3MSE B;  2JXL A;  1EH2 A;  1F71 A;  3EKH A;  1KWO C;  3LK0 A;  4TNC A;  2B1U A;  2ISD A;  1B7T Z;  2WCB A;  3PN7 C;  1GQM A;  1XFY O;  2K7D A;  2LP3 A;  2PSR A;  2QEV A;  1R2U A;  2JTT A;  2Y5I A;  3BYA A;  5HKZ A;  2BE4 A;  5AAN A;  2E6W A;  2WC8 A;  4C0J A;  3RZS A;  2LP2 A;  4PE1 A;  2EGD A;  3NHT A;  1KWO B;  2BCB A;  3RLZ A;  1RFJ A;  5FI2 A;  3PN7 B;  4JQ0 D;  2HET A;  3HX4 A;  3SG4 A;  2TN4 A;  1ZAC A;  1B8C A;  2KYF A;  1PVB A;  1QIW A;  2DOQ A;  1IJ5 A;  1DTL A;  1KK8 C;  1IWQ A;  2M1K B;  4JPZ B;  1K8U A;  2WCF A;  1DJH A;  3PM2 A;  2LC5 A;  4HRH A;  4HSZ A;  1UUS A;  1L2O B;  1Y6W A;  3B87 A;  1NYA A;  2FJY A;  1FPW A;  2WOS A;  1U5I A;  3CDN A;  1E8A A;  3RM1 A;  1ALV A;  2M3W A;  1CKK A;  2I18 A;  2M97 A;  2JQ6 A;  1TOP A;  3OX6 A;  1QIV A;  1XA5 A;  3QME A;  1NX2 A;  1KSM A;  1ORG A;  2WCK A;  1IRJ A;  1XO5 A;  1MUX A;  1SW8 A;  2KYC A;  1BMO A;  1C7W A;  2CTN A;  3CS1 A;  3O78 A;  3UNW A;  1TWO A;  4HRE E;  2MHH A;  1QLK A;  2K7B A;  1SL7 A;  2EHB A;  2K7C A;  4N1F A;  3OB2 B;  3WHU B;  5AER A;  2BEC A;  1UHK A;  3KF9 A;  1KFU S;  2MBX A;  5HLO A;  3I5H B;  1R6P A;  1JFK A;  5DKR A;  2K61 A;  4PE0 A;  1MF8 B;  1BR4 B;  2WCH A;  3K1E A;  1XYD A;  3PJI A;  2L4I A;  3D76 A;  1Y1A A;  4GGN A;  1TCF A;  1M63 B;  1NX0 A;  2LHI A;  1S26 D;  4M2Q A;  4OV2 A;  1SY9 A;  2OPO A;  4F0Z B;  1SK6 D;  4GAO A;  1QXP A;  2QEB A;  3BFH A;  3LLE A;  1LA3 A;  1SR6 C;  5JOL A;  2BE6 A;  1IH0 A;  3I5G B;  1QV0 A;  1OMD A;  4I5N B;  1KFU L;  2P71 A;  2BCA A;  1NUB A;  2K2A A;  1MHO A;  1J7R A;  3B86 A;  2V53 A;  2KLE A;  1KFX L;  2GV5 A;  2LMV A;  2RGI A;  4MBE A;  2NCO A;  5PAL A;  5B8I B;  4CPV A;  1SKT A;  4M2O A;  1KQM C;  1LVC D;  1SR6 B;  3SG5 A;  4ICB A;  1SCM C;  1UHI A;  3FE6 A;  3ICB A;  1MXE A;  1CNP A;  2H61 C;  2JT3 A;  2O5G A;  1KK7 Y;  2Y4Q A;  1DJW A;  1DF0 B;  2KI4 B;  3TDZ A;  3DXL A;  1HT9 A;  1JF0 A;  1FI5 A;  3L4L A;  1BJF A;  1OZO A;  4GGF A;  2PYQ A;  1ODB A;  2OTG C;  1K95 A;  2L0P A;  4NQG A;  1SRA A;  3TDU A;  3VRP A;  4DS7 A;  1AHR A;  1OOF A;  1QJT A;  2KFF A;  2K0J A;  1RRO A;  3LL8 B;  1NX1 A;  3PAT A;  5FYX A;  1BU3 A;  3E3R A;  1TIZ A;  1G33 A;  2KQ6 A;  2KGR A;  3EG5 B;  3Q8I A;  2OTG B;  4USL A;  1DF0 A;  5EL2 A;  1S6C A;  2LMT A;  2HF5 A;  3JVT C;  3NSL A;  1XFZ O;  5AFP A;  2ZND A;  1PSB A;  2QDI A;  1PUL A;  1AK8 A;  4UPG A;  1YUR A;  2KFG A;  1J55 A;  3D75 A;  1Y1X A;  4ETO A;  1QTX A;  2JNX A;  1XFW O;  1PAL A;  2LAN A;  4N1G A;  3PFV A;  1W7J B;  1TCO B;  4L9M A;  4BY5 A;  3ZWH A;  1N0Y A;  1RJV A;  2EC6 C;  3DF0 B;  4YGB B;  2JRF A;  3SG7 A;  4FQT A;  2KBI A;  1W9Z A;  1A03 A;  3R72 A;  1OOH A;  3S0E A;  1MXL C;  1DQE A;  4GPL B;  2KLD A;  1N2D A;  1K9P A;  1ALW A;  2LVJ A;  3AKA A;  3VRR A;  3OX5 A;  3DVJ A;  4CFQ A;  3VGO A;  2BAP A;  4MN0 A;  5KU1 A;  4A4B A;  3O2P A;  1RTP 1;  3DVK A;  4XJK A;  5ER5 A;  1MWN A;  1XFV O;  1M45 A;  2HQW A;  2I7A A;  3DF0 A;  4I5J A;  4MVF A;  5DKQ A;  1CB1 A;  4OZD A;  3CYZ A;  4YRU A;  4PDZ A;  2ZN8 A;  4MEW A;  3NSI A;  3BFA A;  1CFD A;  2KAY A;  2SCP A;  3CTN A;  5G08 A;  3DD4 A;  4N5X A;  1QX7 A;  2L51 A;  1WY9 A;  3EVV A;  3AAJ A;  3S0G A;  1OZS A;  4PE7 A;  4YGC B;  2GTE A;  4YGE B;  3TS5 C;  1X02 A;  1YX8 A;  2JNF A;  4PAL A;  1S3P A;  4YI8 A;  1J1E A;  2PRU A;  1LKJ A;  3KPX A;  1JC2 A;  3N7H A;  3VRN A;  1YUS A;  2KAV A;  1ZFS A;  1JSA A;  2L5X B;  4QJ3 B;  3PSR A;  2MRD A;  3CAB A;  1B9A A;  3A4U B;  2ZRT A;  2PQL A;  1GM0 A;  2JC2 A;  2LLU A;  3M0W A;  3BUN B;  1AVS A;  3S0D A;  2M8U A;  1NIW A;  2FCE A;  2WC6 A;  4MSP A;  4JWQ A;  1CDM A;  2BKH B;  2QPT A;  1QAS A;  4MZK A;  1RK9 A;  1QWV A;  3WXA A;  1LIN A;  4GFT A;  1KK8 B;  1OW4 A;  1S1E A;  3TUY C;  1BF5 A;  3B6X A;  3SIB A;  2G9B A;  3B88 A;  1YX7 A;  1EG3 A;  2F2O A;  1BR1 B;  4INW A;  1AJ5 A;  2F3Y A;  4AQJ A;  1K9U A;  2L2C A;  2R2I A;  2NXQ A;  3NGV A;  4OKH A;  4DIR A;  4IL1 A;  4U8D A;  2L2E A;  2JT0 A;  3HCM A;  3SG2 A;  5HL1 A;  2BBM A;  2KFH A;  2WCE A;  3R1V A;  4NDD A;  1QAT A;  1TUZ A;  1UWO A;  2FCD A;  2JOJ A;  2JPO A;  1S5G Y;  3PAL A;  3TDI A;  3BUO B;  1J7Q A;  4F7F A;  1QS7 A;  1QX2 A;  4C0K A;  2BCX A;  2Q91 A;  4ORA B;  3WHT B;  3D73 A;  1F70 A;  1A75 B;  1OMR A;  4CLN A;  2AAO A;  2K7O A;  3BOW B;  5FI7 A;  2K8M B;  3IQQ A;  1PVA A;  1CMF A;  1MQ1 A;  4WRI A;  4MZL A;  3VB1 A;  3I5I C;  4NDB A;  3F45 A;  1V1G A;  3H4S E;  1C7V A;  1S36 A;  1K9K A;  2BBN A;  3JTD C;  3V2L A;  4DCK A;  1IG5 A;  2LAP A;  2GGM A;  3I5F C;  1B7T Y;  5CSN A;  1NCZ A;  1DT7 B;  2LVI A;  1ZMZ A;  2P70 A;  3KEV A;  1NSH A;  1Y1U A;  3SJS A;  2KQY A;  3FE9 A;  4OR9 B;  1IGV A;  5JJG A;  2ERB A;  3BOW A;  3DYE A;  5KSZ A;  1H8B A;  3GK4 X;  4PHK A;  1W7I B;  2PAS A;  4ZCV A;  5I94 A;  3EK7 A;  1WRK A;  3S0B A;  1D1O A;  4ORC B;  1AJ4 A;  2CCM A;  1DEK A;  2KSP A;  5IBW A;  1G8I A;  4WQ2 A;  3ZNI A;  4R1E A;  1IQ5 A;  1XFX O;  2BKI B;  2LM5 A;  1SYM A;  1KQM B;  3OB1 B;  2LVK A;  1SCM B;  1BOC A;  1A29 A;  3BUM B;  2FOT A;  2JZI A;  4OCI A;  1B4C A;  5CSF A;  2HPS A;  1QV1 A;  5GQQ C;  1YTZ C;  3QRX A;  2BL0 C;  4PHN A;  5CSJ A;  2L50 A;  1BOD A;  5FI6 A;  1YRT B;  1Z2C B;  3PM8 A;  1XK4 A;  3SG6 A;  4GBA A;  1YVL A;  3EVR A;  1B47 A;  2KNE A;  4YBH B;  2F8P A;  2JTZ A;  3D74 A;  5J3X A;  1NPQ A;  2D8N A;  5D7F A;  1TNP A;  1F8H A;  5TNC A;  1QVI Y;  1AP4 A;  1DVI A;  2H61 A;  1TNW A;  2I94 A;  2F33 A;  1DJI A;  3CR2 A;  4XYN A;  3D10 A;  1WDC C;  1XFR A;  1AUI B;  3JVT B;  2JPT A;  5CSI A;  1J1D A;  2LHL A;  1C3Y A;  3AAK A;  1LA0 A;  2M29 A;  4PCW A;  3O6B A;  1F54 A;  2M9G A;  3GOF A;  1WRL A;  2WCM A;  1KQV A;  1G4Y R;  3BXK A;  4DUQ A;  1JF2 A;  1NX3 A;  1LXF C;  3NSK A;  3SS4 A;  4IJ7 A;  2LVV A;  5ER4 X;  2SAS A;  3AKB A;  3BUX B;  2EC6 B;  2NCP A;  4BY4 A;  2GGZ A;  1IKU A;  3L4A A;  3OP0 A;  1LS8 A;  2IS9 A;  4P5O E;  2AUC A;  3CZ2 A;  1EG4 A;  1RWY A;  1Q80 A;  1CLL A;  3IQO A;  2HQ8 A;  2F2P A;  3BUW B;  1T14 A;  1OE9 B;  1TN4 A;  3FS7 A;  5BPJ A;  5I2Q A;  1CLB A;  1DJG A;  2FJU B;  4I5K A;  3CZT X;  4C0L A;  5D3O A;  1WLM A;  1S5G Z;  1EL4 A;  3OHM B;  1BG1 A;  3CR5 X;  1CM4 A;  4YGD B;  4KYN A;  4WQ3 A;  5KTY A;  2LUX A;  2L98 A;  1GGZ A;  1K96 A;  1UHJ A;  3EKJ A;  1NWD A;  1DJY A;  4YI9 A;  3NSO A;  4PHJ A;  2F3Z A;  3LCP C;  1S6J A;  4PT1 A;  1CLM A;  1QLS A;  1YR5 A;  2AMI A;  2CNP A;  1B8L A;  2K60 A;  2NLN A;  3BJH A;  3CWG A;  4MRX A;  1UUR A;  5DIC A;  3SG3 A;  3TS5 B;  1DJZ A;  3KHE A;  1S6I A;  2JT8 A;  3CLN A;  1BT6 A;  2M7L A;  5HKY A;  4E68 A;  2L4H A;  4PHM A;  5HKW A;  1SSE B;  1PK0 D;  1TNQ A;  3DZT A;  3OGN A;  1A2X A;  3SS5 A;  1J7P A;  2LNK A;  5AEQ A;  1U5I B;  3UO9 A;  1SMG A;  1OQP A;  1L2O C;  3A8R A;  1ZUZ A;  4FTG A;  1KCY A;  1NCY A;  5DKN A;  2M7N A;  2BNX A;  3B7A A;  1Y0V H;  2L5Y A;  3D0Y B;  2P6B B;  4HRG A;  2G2B A;  1KK7 Z;  2PMY A;  3CZ0 A;  2KAX A;  3TUY B;  1F4Q A;  1B1G A;  1FW4 A;  2WC5 A;  4ZCU A;  3WNX B;  1GJY A;  4MRY A;  2Y1N A;  5K89 A;  5AXI A;  1L7Z A;  3C1V A;  1UP5 A;  4OVN F;  2A4J A;  3DVM A;  1OMV A;  1TTX A;  3D0Y A;  4PE4 A;  4P2Y B;  1IIO A;  1Z4H A;  2MAZ A;  4QJ5 B;  2KHN A;  3I5H C;  2KDH A;  1V1F A;  2WCL A;  3GK1 A;  2YGU A;  2JU0 A;  2M0R A;  1XVJ A;  1CTR A;  4AQI A;  1CFF A;  1JFJ A;  1OOJ A;  2LLS A;  4A4C A;  2O60 A;  1JBA A;  1M31 A;  3I5I B;  1QVI Z;  3BFB A;  1A75 A;  3IF7 A;  4DRW A;  2M49 B;  2M1U A;  2ZNE A;  3D77 A;  4GUK A;  2OS8 C;  3JTD B;  1KFX S;  3BQ3 A;  3EK4 A;  4INX A;  2ZFD A;  3I5F B;  3I5G C;  2WOR A;  4CFR A;  3L47 A;  3VRQ A;  1SBJ A;  1CFC A;  1VRK A;  3FIA A;  4GGF C;  2PVB A;  2CXJ A;  4QJ4 B;  1FI6 A;  3R1P A;  2MA2 A;  1BLQ A;  1P28 A;  2QAC A;  4MLW A;  2VRG A;  1DGV A;  1C3Z A;  1M39 A;  2OS8 B;  5HYD A;  1F4O A;  5CPV A;  3K21 A;  1YUU A;  2LMU A;  2WCJ A;  3GK2 A;  2LUC A;  1XK4 C;  3LK1 A;  1ZOT B;  2KI4 C;  3SIA A;  1MR8 A;  3DY9 A;  1F55 A;  3DVE A;  4JD9 A;  2JXC A;  3NXA A;  2ZRS A;  5F6T A;  1CM1 A;  1YUT A;  2KGB C;  1REC A;  2JUL A;  1WLZ A;  1YVH A;  4CID A;  4NDC A;  1SL9 A;  3S0A A;  3R1O A; 
#chains in the Genus database with same CATH homology
 1DJX A;  1SNL A;  1TRF A;  1OSA A;  1KSO A;  2Q4U A;  2BL0 B;  1FBV A;  1N65 A;  2ZKM X;  1QX5 B;  2CT9 A;  3CGA A;  4AOM A;  1DGU A;  1UHN A;  2LE9 B;  2Y1M A;  2H2K A;  4FQO A;  1WRZ A;  5HLV A;  2MLE C;  2MLF C;  2ZN9 A;  3VRO A;  4Q04 A;  5I2L A;  1K2H A;  1XFU O;  2PAL A;  1C07 A;  1EJ3 A;  2JWW A;  1CDP A;  1SL8 A;  1K94 A;  1CDL A;  1SCV A;  1B8R A;  4YGA A;  3O4Y A;  1GGW A;  4ORB B;  1NP8 A;  1CFP A;  1K93 D;  1A4P A;  1M46 A;  1WDC B;  3EVU A;  3FWC A;  4GNK B;  4D1E A;  2CBL A;  3CR4 X;  1FF1 A;  1TNX A;  3TZ1 A;  1JWD A;  5I8N A;  1UHH A;  1HQV A;  1CMG A;  1EXR A;  1SPY A;  1YRU B;  2MJW B;  4MZJ A;  2WND A;  2KI6 C;  1PSR A;  3FWB A;  4XJK B;  5D69 A;  2KBM A;  2LLT A;  1PRW A;  4I5L B;  2LCP A;  1JUO A;  3KO0 A;  1J7O A;  2KOT A;  2NZ0 A;  1IJ6 A;  5I2O A;  2KI6 D;  2LV7 A;  3PLF B;  1H4B A;  2COL B;  2E30 A;  2I2R E;  1CDN A;  3EK8 A;  4M2P A;  1DMO A;  1IQ3 A;  2K2F A;  1K90 D;  1NCX A;  3MSE B;  2JXL A;  1EH2 A;  1F71 A;  3EKH A;  1KWO C;  3LK0 A;  4TNC A;  2B1U A;  2ISD A;  1B7T Z;  2WCB A;  3PN7 C;  1GQM A;  1XFY O;  2K7D A;  2LP3 A;  2PSR A;  2Y5I A;  1R2U A;  2JTT A;  3BYA A;  5HKZ A;  5AAN A;  2BE4 A;  2E6W A;  2WC8 A;  4C0J A;  2LP2 A;  4PE1 A;  2EGD A;  1KWO B;  2BCB A;  3RLZ A;  1RFJ A;  3PN7 B;  4JQ0 D;  2HET A;  3HX4 A;  3SG4 A;  2TN4 A;  1ZAC A;  1B8C A;  2KYF A;  1PVB A;  1QIW A;  2DOQ A;  1IJ5 A;  1DTL A;  1KK8 C;  1IWQ A;  2M1K B;  4JPZ B;  1K8U A;  2WCF A;  1DJH A;  4HRH A;  2LC5 A;  4HSZ A;  1UUS A;  1L2O B;  1Y6W A;  1NYA A;  1FPW A;  2WOS A;  1U5I A;  3RM1 A;  1E8A A;  1CKK A;  1ALV A;  2M3W A;  2I18 A;  2M97 A;  2JQ6 A;  1TOP A;  3OX6 A;  1QIV A;  1XA5 A;  1NX2 A;  1KSM A;  1IRJ A;  1XO5 A;  1MUX A;  1SW8 A;  2KYC A;  1BMO A;  1C7W A;  2CTN A;  3CS1 A;  3O78 A;  4HRE E;  2MHH A;  1QLK A;  2K7B A;  1SL7 A;  2EHB A;  2K7C A;  4N1F A;  3OB2 B;  3WHU B;  5AER A;  2BEC A;  1UHK A;  3KF9 A;  1KFU S;  2MBX A;  5HLO A;  3I5H B;  1R6P A;  1JFK A;  5DKR A;  2K61 A;  4PE0 A;  1MF8 B;  1BR4 B;  1XYD A;  4GGN A;  2L4I A;  1Y1A A;  1TCF A;  1M63 B;  1NX0 A;  2LHI A;  1S26 D;  4M2Q A;  4OV2 A;  1SY9 A;  2OPO A;  4F0Z B;  1SK6 D;  4GAO A;  1QXP A;  3LLE A;  1LA3 A;  1SR6 C;  5JOL A;  2BE6 A;  1IH0 A;  3I5G B;  1QV0 A;  1OMD A;  4I5N B;  1KFU L;  2BCA A;  1NUB A;  2K2A A;  1MHO A;  1J7R A;  2V53 A;  1KFX L;  2GV5 A;  2LMV A;  2RGI A;  4MBE A;  2NCO A;  5PAL A;  5B8I B;  4CPV A;  1SKT A;  4M2O A;  1KQM C;  1LVC D;  1SR6 B;  3SG5 A;  4ICB A;  1SCM C;  1UHI A;  3ICB A;  1MXE A;  1CNP A;  2H61 C;  2JT3 A;  2O5G A;  1KK7 Y;  2Y4Q A;  1DJW A;  1DF0 B;  2KI4 B;  3TDZ A;  1HT9 A;  1JF0 A;  1FI5 A;  4GGF A;  1BJF A;  1OZO A;  1ODB A;  2OTG C;  1K95 A;  2L0P A;  4NQG A;  1SRA A;  3TDU A;  3VRP A;  4DS7 A;  1AHR A;  1QJT A;  2KFF A;  2K0J A;  1RRO A;  3LL8 B;  1NX1 A;  3PAT A;  5FYX A;  1BU3 A;  3E3R A;  1TIZ A;  1G33 A;  2KQ6 A;  2KGR A;  2OTG B;  4USL A;  1DF0 A;  1S6C A;  2LMT A;  2HF5 A;  3JVT C;  3NSL A;  1XFZ O;  5AFP A;  2ZND A;  1PSB A;  1PUL A;  1AK8 A;  4UPG A;  1YUR A;  2KFG A;  1J55 A;  1Y1X A;  4ETO A;  1QTX A;  2JNX A;  1XFW O;  1PAL A;  2LAN A;  4N1G A;  3PFV A;  1W7J B;  1TCO B;  4L9M A;  4BY5 A;  3ZWH A;  1N0Y A;  1RJV A;  2EC6 C;  3DF0 B;  4YGB B;  2JRF A;  3SG7 A;  2KBI A;  1A03 A;  1MXL C;  4GPL B;  1N2D A;  1K9P A;  1ALW A;  2LVJ A;  3AKA A;  3VRR A;  3OX5 A;  3DVJ A;  4CFQ A;  3VGO A;  5KU1 A;  4MN0 A;  4A4B A;  3O2P A;  1RTP 1;  3DVK A;  4XJK A;  5ER5 A;  1MWN A;  1XFV O;  1M45 A;  2HQW A;  2I7A A;  3DF0 A;  4I5J A;  4MVF A;  5DKQ A;  1CB1 A;  4YRU A;  4PDZ A;  2ZN8 A;  4MEW A;  3NSI A;  1CFD A;  2KAY A;  2SCP A;  3CTN A;  5G08 A;  3DD4 A;  4N5X A;  1QX7 A;  2L51 A;  1WY9 A;  3EVV A;  3AAJ A;  1OZS A;  4PE7 A;  4YGC B;  4YGE B;  3TS5 C;  1X02 A;  1YX8 A;  2JNF A;  4PAL A;  1S3P A;  4YI8 A;  1J1E A;  2PRU A;  1LKJ A;  3KPX A;  1JC2 A;  3VRN A;  1YUS A;  2KAV A;  1ZFS A;  1JSA A;  2L5X B;  4QJ3 B;  3PSR A;  2MRD A;  1B9A A;  3A4U B;  2ZRT A;  2JC2 A;  2LLU A;  3M0W A;  3BUN B;  1AVS A;  2M8U A;  1NIW A;  2FCE A;  4MSP A;  4JWQ A;  1CDM A;  2BKH B;  2QPT A;  1QAS A;  4MZK A;  1RK9 A;  3WXA A;  1BF5 A;  1LIN A;  4GFT A;  1KK8 B;  3TUY C;  1S1E A;  3SIB A;  2G9B A;  1YX7 A;  1EG3 A;  2F2O A;  1BR1 B;  1AJ5 A;  2F3Y A;  4AQJ A;  1K9U A;  2R2I A;  2NXQ A;  4OKH A;  4DIR A;  4IL1 A;  4U8D A;  2L2E A;  2JT0 A;  3HCM A;  3SG2 A;  2BBM A;  2KFH A;  2WCE A;  4NDD A;  1QAT A;  2FCD A;  1UWO A;  3PAL A;  2JOJ A;  1S5G Y;  3TDI A;  1J7Q A;  3BUO B;  1QS7 A;  1QX2 A;  4C0K A;  2BCX A;  2Q91 A;  4ORA B;  3WHT B;  1F70 A;  1A75 B;  1OMR A;  4CLN A;  2AAO A;  2K7O A;  3BOW B;  2K8M B;  3IQQ A;  1PVA A;  1CMF A;  1MQ1 A;  4WRI A;  4MZL A;  3I5I C;  4NDB A;  3F45 A;  1V1G A;  3H4S E;  1C7V A;  1S36 A;  1K9K A;  2BBN A;  3JTD C;  4DCK A;  1IG5 A;  2LAP A;  2GGM A;  3I5F C;  1B7T Y;  5CSN A;  1NCZ A;  1DT7 B;  2LVI A;  1ZMZ A;  3KEV A;  3SJS A;  1NSH A;  1Y1U A;  2KQY A;  4OR9 B;  1IGV A;  5JJG A;  3BOW A;  5KSZ A;  1H8B A;  3GK4 X;  4PHK A;  1W7I B;  2PAS A;  4ZCV A;  3EK7 A;  1WRK A;  1D1O A;  4ORC B;  1AJ4 A;  2CCM A;  2KSP A;  5IBW A;  1G8I A;  4WQ2 A;  3ZNI A;  4R1E A;  1IQ5 A;  1XFX O;  2BKI B;  2LM5 A;  1SYM A;  1KQM B;  3OB1 B;  2LVK A;  1SCM B;  1BOC A;  1A29 A;  3BUM B;  2FOT A;  2JZI A;  4OCI A;  1B4C A;  5CSF A;  2HPS A;  1QV1 A;  5GQQ C;  1YTZ C;  3QRX A;  2BL0 C;  4PHN A;  5CSJ A;  2L50 A;  1BOD A;  1YRT B;  3PM8 A;  1XK4 A;  3SG6 A;  4GBA A;  1YVL A;  3EVR A;  1B47 A;  2KNE A;  4YBH B;  2F8P A;  2JTZ A;  5J3X A;  1NPQ A;  2D8N A;  5D7F A;  1TNP A;  1F8H A;  5TNC A;  1QVI Y;  1AP4 A;  1DVI A;  2H61 A;  1TNW A;  2I94 A;  2F33 A;  1DJI A;  3CR2 A;  4XYN A;  3D10 A;  1WDC C;  1AUI B;  3JVT B;  2JPT A;  5CSI A;  1J1D A;  2LHL A;  3AAK A;  1LA0 A;  2M29 A;  4PCW A;  3O6B A;  1F54 A;  2M9G A;  3GOF A;  1WRL A;  1KQV A;  1G4Y R;  3BXK A;  4DUQ A;  1JF2 A;  1NX3 A;  1LXF C;  3NSK A;  2LVV A;  5ER4 X;  2SAS A;  3AKB A;  3BUX B;  2EC6 B;  2NCP A;  4BY4 A;  2GGZ A;  1IKU A;  3OP0 A;  2IS9 A;  4P5O E;  2AUC A;  1EG4 A;  1RWY A;  1Q80 A;  1CLL A;  3IQO A;  2HQ8 A;  2F2P A;  3BUW B;  1TN4 A;  1OE9 B;  3FS7 A;  5I2Q A;  5BPJ A;  1CLB A;  1DJG A;  2FJU B;  4I5K A;  3CZT X;  4C0L A;  1WLM A;  1S5G Z;  1EL4 A;  3OHM B;  1BG1 A;  3CR5 X;  1CM4 A;  4YGD B;  4WQ3 A;  5KTY A;  2LUX A;  2L98 A;  1GGZ A;  1K96 A;  1UHJ A;  3EKJ A;  1NWD A;  1DJY A;  4YI9 A;  3NSO A;  4PHJ A;  2F3Z A;  3LCP C;  1S6J A;  2CNP A;  1CLM A;  1QLS A;  1YR5 A;  2AMI A;  1B8L A;  2NLN A;  3CWG A;  4MRX A;  1UUR A;  3SG3 A;  3TS5 B;  1DJZ A;  3KHE A;  1S6I A;  2JT8 A;  3CLN A;  1BT6 A;  2M7L A;  5HKY A;  4E68 A;  2L4H A;  4PHM A;  5HKW A;  1PK0 D;  1TNQ A;  1A2X A;  1J7P A;  2LNK A;  5AEQ A;  1U5I B;  1SMG A;  1OQP A;  1L2O C;  3A8R A;  1ZUZ A;  4FTG A;  1KCY A;  1NCY A;  5DKN A;  2M7N A;  3D0Y B;  1Y0V H;  4HRG A;  2P6B B;  2G2B A;  1KK7 Z;  2PMY A;  2KAX A;  3TUY B;  1F4Q A;  1B1G A;  1FW4 A;  4ZCU A;  3WNX B;  1GJY A;  4MRY A;  2Y1N A;  5K89 A;  5AXI A;  1L7Z A;  3C1V A;  1UP5 A;  4OVN F;  2A4J A;  3DVM A;  1OMV A;  1TTX A;  3D0Y A;  4PE4 A;  4P2Y B;  4QJ5 B;  2MAZ A;  2KHN A;  3I5H C;  2KDH A;  1V1F A;  3GK1 A;  2JU0 A;  2M0R A;  1XVJ A;  1CTR A;  4AQI A;  1CFF A;  1JFJ A;  1OOJ A;  2LLS A;  4A4C A;  2O60 A;  1JBA A;  1M31 A;  3I5I B;  1QVI Z;  1A75 A;  3IF7 A;  4DRW A;  2M49 B;  2M1U A;  2ZNE A;  4GUK A;  2OS8 C;  3JTD B;  1KFX S;  3BQ3 A;  3EK4 A;  2ZFD A;  3I5F B;  3I5G C;  2WOR A;  4CFR A;  3VRQ A;  1SBJ A;  1CFC A;  1VRK A;  3FIA A;  4GGF C;  2PVB A;  2CXJ A;  4QJ4 B;  1FI6 A;  2MA2 A;  1BLQ A;  2QAC A;  4MLW A;  2VRG A;  1DGV A;  2OS8 B;  1M39 A;  5HYD A;  1F4O A;  5CPV A;  3K21 A;  1YUU A;  2LMU A;  3GK2 A;  2LUC A;  1XK4 C;  3LK1 A;  1ZOT B;  2KI4 C;  3SIA A;  1MR8 A;  1F55 A;  3DVE A;  2JXC A;  3NXA A;  2ZRS A;  5F6T A;  1CM1 A;  1YUT A;  2KGB C;  1REC A;  2JUL A;  1WLZ A;  1YVH A;  4CID A;  4NDC A;  1SL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...