1ZOTB

Crystal structure analysis of the cyaa/c-cam with pmeapp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Lyase
molecule keywords CyaA with C-terminal Calmodulin
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zotB00
3ZWHA 1FBVA 1KK7Y 1N65A 1QLSA 2EC6C 3JVTB 1WRKA 4D1EA 2K61A 3K21A 1QVIZ 1LA3A 1QV0A 1PSRA 3OB1B 2K7DA 1TNWA 1K94A 2HPSA 4YGDB 1F70A 1IWQA 1WRLA 1SL7A 2DOQA 2WCEA 1XK4A 3OX6A 1CLMA 5CSJA 3CGAA 1M45A 3EKHA 1CM1A 1A75B 2OTGB 1CKKA 1F4OA 3DVJA 1OOJA 1CDLA 1ODBA 4WRIA 2WC8A 1PSBA 4Q04A 1KWOB 1OMRA 2JXLA 2PALA 3LK0A 4PHJA 2FJUB 5ER4X 2MLFC 4NQGA 2M1UA 1UHIA 1TCOB 5HKYA 1B1GA 1AJ5A 1MQ1A 2RGIA 4A4CA 1FI6A 1IQ3A 4MBEA 2AUCA 1B8RA 2I94A 2MJWB 1QX2A 1WRZA 4ICBA 1JUOA 1Y1AA 2AAOA 2P6BB 3C1VA 1WDCB 1NYAA 1N2DA 2KBMA 4ETOA 5KU1A 3LK1A 1DT7B 1SR6B 4PHNA 3VRQA 1KK8C 2CT9A 1IG5A 2WCFA 3FWBA 1W7JB 1QATA 1IKUA 1CMGA 2HQ8A 2EC6B 3JVTC 3I5GB 3VGOA 3TDZA 1KFUL 4N1FA 3IF7A 1TIZA 2ZKMX 4I5JA 1K95A 3NSOA 4DRWA 1KWOC 4CPVA 3TS5C 2LLSA 2M8UA 1QIVA 1UP5A 3AKAA 1K93D 1YRUB 2AMIA 1K9UA 2KOTA 2KHNA 1F4QA 2KI4B 1XYDA 1Y0VH 2LM5A 3DVKA 2VRGA 5TNCA 1XFUO 1XFZO 2FCEA 1XFYO 2LHIA 2NCPA 1XK4C 1X02A 4CLNA 3VRPA 3BQ3A 1A2XA 2EGDA 5HYDA 5I2OA 2MAZA 2LUCA 5AANA 2BE6A 1AVSA 2L98A 1U5IA 3JTDC 4JQ0D 2JC2A 3PM8A 5DKNA 1BODA 1OE9B 1UUSA 1RJVA 1BOCA 5HLVA 4OCIA 4OV2A 1L2OC 1UWOA 1SL8A 1OSAA 2LAPA 5DKQA 1IJ6A 1DGVA 3BXKA 1J7PA 1SR6C 3I5HB 1KSOA 1DJIA 3SIAA 1SPYA 2CTNA 1LXFC 3TUYC 3JTDB 2M7LA 1Y1XA 1YR5A 3EKJA 2JPTA 2LMTA 1AK8A 3LCPC 5FYXA 1ZMZA 1IRJA 1QV1A 4AQIA 2BECA 5KTYA 5I8NA 2R2IA 2GGZA 1SNLA 4HRGA 2F2OA 3FWCA 2JWWA 2ZNDA 4YGCB 4MLWA 1KFXS 2H2KA 1EH2A 1KCYA 1UHNA 4GGNA 3LL8B 1C7VA 2E6WA 3EVVA 2COLB 2BCXA 3PSRA 2KI4C 2L4HA 1K8UA 4ORCB 1G33A 1V1FA 3KF9A 2KDHA 2KGRA 1DTLA 2KI6D 1B7TY 1BR4B 2B1UA 2M1KB 1CFPA 1YTZC 2ZN8A 1TN4A 1D1OA 4MRYA 2Y1NA 1DJYA 1KK8B 2L51A 2OTGC 4GUKA 5AEQA 4UPGA 1JBAA 1JFJA 3D0YB 1PVAA 4L9MA 3I5GC 1SCVA 1TRFA 2F2PA 1OZSA 1KQVA 4GGFC 1FW4A 4N1GA 4YGEB 5AERA 3BUNB 2JTZA 1QASA 2PASA 2L5XB 2LNKA 4PHMA 1WLMA 1UHKA 1EL4A 5CSIA 4YI9A 1JF2A 1A4PA 2CBLA 1DJXA 2M0RA 1MUXA 3OB2B 3OHMB 1XA5A 1PVBA 2O5GA 1BF5A 3CZTX 1QLKA 4XJKA 2IS9A 1S36A 1BR1B 1EG3A 2D8NA 1QJTA 3VRRA 2KQ6A 3PLFB 1DMOA 2JOJA 1G4YR 2OS8B 4C0KA 3SG2A 4JWQA 3I5FC 1BT6A 1DVIA 5F6TA 1B47A 1G8IA 2CXJA 1TNXA 1YURA 1E8AA 4GGFA 1MF8B 4GFTA 1B8CA 4MSPA 4M2PA 2ISDA 4OR9B 1HT9A 4FTGA 3IQQA 4HSZA 5BPJA 1NUBA 3EVRA 4GPLB 4N5XA 1UHHA 4MZLA 5DKRA 1QX5B 2G9BA 2K8MB 2Y1MA 3PALA 1TTXA 1SKTA 1M31A 1BG1A 1DF0A 1DF0B 3DVEA 2JTTA 2L0PA 3KEVA 2KFFA 2CCMA 1XO5A 3I5HC 1F54A 1KFXL 1NCXA 1DJZA 2HETA 3BUXB 1KSMA 4PDZA 3PN7B 1IJ5A 1F71A 1TCFA 2KGBC 3EK8A 1MXLC 1YUUA 1RFJA 1GJYA 2MLEC 1OZOA 1SRAA 2WOSA 4ORBB 1NP8A 4YGBB 3SG7A 3GOFA 1FPWA 2GGMA 1BLQA 3TZ1A 1CDPA 3DF0A 5AXIA 1CFFA 1R6PA 5D69A 2M97A 2EHBA 3WHUB 2MRDA 2LLUA 4PE1A 3I5FB 2KQYA 1LKJA 3KO0A 1NSHA 3AAKA 2JU0A 3E3RA 1XFXO 1NX1A 1YX8A 2LVVA 1ALWA 1S6CA 1IGVA 4MZJA 4C0JA 1RECA 1DGUA 5ER5A 4YRUA 1BJFA 2LP2A 2QACA 4NDCA 4R1EA 3TDUA 4DS7A 1CDMA 3EK4A 3CR4X 2K7CA 2Q91A 3BUWB 2KFGA 4I5LB 1QIWA 2I7AA 2JNFA 2M49B 1LINA 2Y4QA 4DIRA 4MVFA 2L50A 2ZRTA 2KBIA 4AOMA 4BY5A 4M2QA 4GNKB 2MBXA 1M46A 4QJ4B 2NZ0A 1AHRA 2M7NA 2H61A 1K90D 2LHLA 2BCAA 1WDCC 3NSIA 3ZNIA 4YGAA 3SIBA 5IBWA 1MHOA 2K2FA 2KYCA 4PCWA 3WNXB 2LLTA 4XYNA 4GBAA 3AKBA 5HKZA 4I5NB 4NDBA 3A4UB 2K7BA 3EVUA 3OP0A 2PRUA 1QXPA 4A4BA 2SASA 2K0JA 4OVNF 1Y1UA 1S6JA 1ALVA 2WCBA 1J7QA 4WQ2A 1HQVA 1KK7Z 1ZFSA 1K9PA 1QVIY 4JPZB 1CFDA 2L4IA 4MRXA 4I5KA 2LVIA 3DD4A 3GK2A 3CR5X 2NXQA 1DJGA 1CB1A 2SCPA 3SG6A 4DUQA 1H8BA 1F55A 2M29A 1K96A 3LLEA 1OMDA 1SY9A 3DF0B 1JF0A 3SG4A 3M0WA 4ZCUA 2F3YA 3NSLA 1DJHA 1YRTB 2O60A 5J3XA 1JWDA 1FI5A 2I18A 3NXAA 1GGWA 2JT8A 1PK0D 1R2UA 1L7ZA 1SW8A 4FQOA 2WORA 1SK6D 3CR2A 3RM1A 4PE4A 4BY4A 1SCMB 4ZCVA 3TDIA 1PRWA 1FF1A 2Y5IA 5KSZA 1GQMA 1A75A 1U5IB 2LMUA 3DVMA 3O2PA 2M3WA 5G08A 1CMFA 1KQMC 4OKHA 1A29A 1MXEA 2H61C 2HF5A 2JT3A 1B7TZ 2KI6C 1B4CA 1LA0A 1M63B 3A8RA 1K2HA 2BBMA 3FS7A 2JZIA 4TNCA 3D10A 4MEWA 1IQ5A 1TOPA 1NX0A 2KSPA 4MN0A 1AUIB 3NSKA 3TS5B 3SG3A 2OPOA 3WXAA 3GK1A 3GK4X 3QRXA 3BUOB 1F8HA 4C0LA 5CSNA 1KQMB 1EJ3A 4P2YB 1CDNA 2PVBA 4HREE 1EXRA 1GGZA 3BOWB 1TNQA 1OMVA 2E30A 4NDDA 1SCMC 4QJ3B 4PALA 1CM4A 1CNPA 3CS1A 1J1DA 2LUXA 2LP3A 1QS7A 1RK9A 2F33A 3WHTB 1SMGA 3CTNA 1W7IB 1PALA 2NCOA 4GAOA 1S6IA 4M2OA 3PFVA 1CFCA 1IH0A 4CIDA 3KPXA 2NLNA 1DJWA 3HCMA 4E68A 1OQPA 1XFVO 2LVKA 3CLNA 1K9KA 4ORAB 2WNDA 4IL1A 3I5IB 1J7OA 2LC5A 1N0YA 1WY9A 4P5OE 1JFKA 1ZUZA 2BBNA 1V1GA 1NX3A 2LMVA 3O4YA 3O78A 1SL9A 5JOLA 3SJSA 1B9AA 3IQOA 3BUMB 4USLA 4CFRA 4XJKB 2BL0C 2BE4A 3SG5A 1C7WA 1A03A 2BCBA 2LANA 1MR8A 1S3PA 4CFQA 1RROA 1KFUS 1CLLA 1M39A 5B8IB 2JRFA 3CWGA 1PULA 1NX2A 1XVJA 2LV7A 2PMYA 4HRHA 4AQJA 2HQWA 5D7FA 2QPTA 1JC2A 3HX4A 4PHKA 5JJGA 2V53A 2I2RE 1BU3A 1S1EA 1Q80A 3PN7C 1SYMA 3D0YA 5HLOA 1AP4A 3ICBA 1J1EA 5PALA 1J55A 2KYFA 4DCKA 1BMOA 1WLZA 2ZN9A 1Y6WA 4QJ5B 3BYAA 3TUYB 1VRKA 4YI8A 5I2LA 1LVCD 1ZOTB 3EK7A 1S5GY 2JQ6A 5I2QA 1EG4A 1JSAA 2KAVA 1YX7A 2GV5A 3VROA 1RTP1 3VRNA 5K89A 2TN4A 2K7OA 3OX5A 1L2OB 2K2AA 2FOTA 2BKIB 1CTRA 2F8PA 2JXCA 1NWDA 1QX7A 1UURA 3O6BA 4PE7A 1S26D 4F0ZB 3FIAA 2FCDA 5CSFA 1NPQA 2BL0B 1NCYA 2M9GA 4YBHB 1NCZA 3MSEB 5CPVA 2G2BA 1MWNA 1YVHA 1YUSA 2BKHB 2LE9B 2JT0A 3I5IC 2KFHA 2A4JA 2LVJA 4MZKA 2JNXA 2CNPA 2PSRA 3PATA 1RWYA 2F3ZA 2ZRSA 5AFPA 4WQ3A 2L2EA 2ZNEA 1C07A 1YUTA 1XFWO 1UHJA 2OS8C 5GQQC 5HKWA 1AJ4A 2JULA 1NIWA 2KAYA 2ZFDA 3H4SE 3F45A 3RLZA 2Q4UA 4PE0A 1H4BA 1YVLA 1B8LA 2KNEA 3BOWA 1QTXA 4U8DA 1CLBA 2MA2A 1J7RA 1ZACA 1S5GZ 2LCPA 3AAJA 1SBJA 3KHEA 2KAXA 2MHHA 1TNPA
chains in the Genus database with same CATH superfamily
3ZWHA 1IIOA 1FBVA 3NHIA 1OOIX 1KK7Y 1N65A 1QLSA 2EC6C 3JVTB 1WRKA 3UNWA 4D1EA 2K61A 1OW4A 3K21A 1QVIZ 1LA3A 1QV0A 1PSRA 3OB1B 2K7DA 1TNWA 1K94A 2HPSA 4YGDB 1F70A 1IWQA 1WRLA 1SL7A 2DOQA 2WCEA 1XK4A 3OX6A 1CLMA 5CSJA 3CGAA 1M45A 3EKHA 1CM1A 1A75B 2OTGB 1CKKA 1F4OA 3DVJA 1OOJA 1CDLA 1ODBA 4WRIA 2WC8A 1PSBA 4JD9A 4Q04A 1KWOB 1OMRA 2JXLA 2PALA 3LK0A 4PHJA 3DY9A 2FJUB 5ER4X 4PT1A 2MLFC 4NQGA 2M1UA 1UHIA 1TCOB 5HKYA 1B1GA 1OOGA 1AJ5A 1MQ1A 2RGIA 4A4CA 1FI6A 1IQ3A 4MBEA 2AUCA 1B8RA 2I94A 2MJWB 1QX2A 1WRZA 3PJIA 4ICBA 1JUOA 1Y1AA 2AAOA 2P6BB 3C1VA 1WDCB 1NYAA 1N2DA 2KBMA 4ETOA 5KU1A 3LK1A 1DT7B 1SR6B 4PHNA 3VRQA 1KK8C 3K1EA 2CT9A 1IG5A 2WCFA 3FWBA 1W7JB 1QATA 1Z4HA 1IKUA 2HQ8A 1CMGA 1ORGA 2EC6B 3JVTC 3I5GB 3OBVA 3VGOA 3FE6A 3TDZA 1KFUL 4N1FA 3N7HA 4F7FA 3IF7A 1TIZA 2ZKMX 4I5JA 1K95A 2FJYA 3NSOA 4DRWA 1KWOC 4CPVA 3D76A 3TS5C 2LLSA 2M8UA 1QIVA 1UP5A 3AKAA 1K93D 1YRUB 2AMIA 1K9UA 2KOTA 2KHNA 3DZTA 1F4QA 2KI4B 1XYDA 1Y0VH 2LM5A 3DVKA 2VRGA 2WCLA 1XFUO 2WCHA 5TNCA 1XFZO 4IJ7A 2FCEA 1XFYO 2LHIA 2PYQA 2NCPA 3FE9A 1XK4C 1X02A 4CLNA 3VRPA 3RZSA 3BQ3A 1A2XA 2EGDA 5HYDA 5I2OA 2MAZA 2LUCA 5AANA 2BE6A 1AVSA 1DEKA 2L98A 1U5IA 3JTDC 3EG5B 4JQ0D 2JC2A 3PM8A 3B7AA 5DKNA 1BODA 1OE9B 1UUSA 1RJVA 1BOCA 5HLVA 2WCMA 4OCIA 1W9ZA 4OV2A 1L2OC 1UWOA 1SL8A 1OSAA 2LAPA 5DKQA 1IJ6A 1DGVA 3BXKA 1J7PA 1SR6C 3I5HB 1KSOA 1DJIA 3SIAA 3L4AA 1SPYA 2CTNA 1LXFC 3TUYC 3JTDB 2M7LA 3SS3A 1Y1XA 1YR5A 4INXA 3EKJA 3S0GA 2JPTA 2LMTA 1AK8A 2ERBA 3LCPC 5FYXA 1ZMZA 1IRJA 1QV1A 4AQIA 2BECA 5KTYA 5I8NA 2R2IA 2GGZA 1SNLA 3R1PA 4HRGA 2GTEA 2F2OA 2QDIA 3FWCA 2JWWA 2ZNDA 4YGCB 1TUJA 1Z2CB 2K60A 4MLWA 1KFXS 2H2KA 1EH2A 1KCYA 1UHNA 4GGNA 3LL8B 1C7VA 2E6WA 3EVVA 1XFRA 2COLB 2BCXA 3PSRA 2KI4C 2L4HA 1K8UA 4ORCB 1G33A 1V1FA 3KF9A 2KDHA 2KGRA 1DTLA 2KI6D 3CZ2A 1B7TY 1BR4B 2B1UA 2M1KB 1CFPA 1YTZC 2ZN8A 2PQLA 1TN4A 1D1OA 4MRYA 2Y1NA 1DJYA 1KK8B 2L51A 2OTGC 1DELA 4GUKA 5AEQA 3BJHA 4UPGA 1JBAA 1JFJA 3D0YB 1PVAA 4L9MA 3I5GC 1SCVA 1TRFA 4OZDA 2F2PA 1OZSA 1KQVA 4GGFC 5FI7A 1FW4A 4N1GA 4YGEB 5AERA 3BUNB 2JTZA 1QASA 2PASA 2L5XB 2LNKA 2QEHA 4PHMA 1WLMA 1UHKA 1EL4A 5CSIA 4YI9A 1JF2A 1A4PA 2CBLA 1DJXA 2M0RA 1MUXA 3OB2B 3OHMB 2L5YA 1XA5A 1PVBA 2O5GA 1BF5A 3CZTX 1QLKA 4XJKA 2IS9A 1S36A 1BR1B 1EG3A 2KPHA 2D8NA 1QJTA 3VRRA 3FE8A 2KQ6A 1T14A 3PLFB 1DMOA 2JOJA 1G4YR 3S0BA 2OS8B 4C0KA 3SG2A 4JWQA 3I5FC 1BT6A 1DVIA 2KLDA 5F6TA 1B47A 1G8IA 2CXJA 3D75A 3DXLA 1TNXA 1YURA 1E8AA 4GGFA 1MF8B 5FI6A 4GFTA 1B8CA 4MSPA 4M2PA 2ISDA 4OR9B 1HT9A 4FTGA 3IQQA 4HSZA 5BPJA 1NUBA 3EVRA 4GPLB 4N5XA 1UHHA 4MZLA 5DKRA 1QX5B 2QEBA 2G9BA 2K8MB 2Y1MA 2WCJA 1TTXA 1SKTA 3PALA 1M31A 1BG1A 1DF0A 3BFHA 1DF0B 3DVEA 2JTTA 2L0PA 3CZ0A 2KFFA 3KEVA 2CCMA 1XO5A 3I5HC 1F54A 1KFXL 1NCXA 5I94A 1DJZA 2HETA 3BUXB 1KSMA 4PDZA 2QEOA 3PN7B 1IJ5A 1F71A 1TCFA 2KGBC 3EK8A 1SSEB 1C3ZA 1MXLC 1YUUA 1RFJA 1GJYA 2MLEC 1OZOA 1SRAA 2WOSA 4ORBB 1NP8A 4YGBB 3SG7A 3GOFA 1FPWA 2GGMA 1BLQA 3TZ1A 1CDPA 3DF0A 5AXIA 1CFFA 1R6PA 5D69A 2M97A 2EHBA 2BAPA 3WHUB 2MRDA 2LLUA 4PE1A 3I5FB 2KQYA 1LKJA 3KO0A 1NSHA 3AAKA 2JU0A 3E3RA 1XFXO 3B87A 1NX1A 1YX8A 2LVVA 1ALWA 1S6CA 1IGVA 4MZJA 4C0JA 1RECA 1DGUA 3NGVA 5ER5A 4YRUA 3V2LA 1BJFA 2LP2A 2QACA 4NDCA 4R1EA 3TDUA 4DS7A 1CDMA 3EK4A 3CR4X 2K7CA 2Q91A 3BUWB 2KFGA 1P28A 4I5LB 1QIWA 2I7AA 2JNFA 2M49B 1LINA 2Y4QA 4DIRA 4MVFA 2L50A 2ZRTA 2KBIA 4AOMA 3B88A 4BY5A 4M2QA 2WCKA 4GNKB 2MBXA 1M46A 4QJ4B 2NZ0A 4JKTA 1AHRA 2M7NA 2H61A 1K90D 2LHLA 2BCAA 1WDCC 3NSIA 3O4XA 3ZNIA 4YGAA 3SIBA 5IBWA 1MHOA 2K2FA 2KYCA 4PCWA 3WNXB 2LLTA 4XYNA 3SS5A 4GBAA 3AKBA 2P71A 4I5NB 4NDBA 5HKZA 3A4UB 2K7BA 3EVUA 3OP0A 2PRUA 3D73A 1QXPA 4A4BA 2SASA 2K0JA 4OVNF 2KLEA 1Y1UA 1S6JA 1ALVA 2WCBA 1J7QA 4WQ2A 1HQVA 1KK7Z 1ZFSA 3CDNA 1K9PA 1QVIY 3D78A 4JPZB 1CFDA 2L4IA 4MRXA 3CZ1A 4I5KA 2JPOA 2LVIA 3DD4A 3GK2A 3CR5X 2NXQA 1DJGA 1CB1A 2SCPA 3SG6A 4DUQA 1H8BA 1F55A 2M29A 1K96A 3LLEA 1OMDA 1SY9A 3DF0B 1JF0A 3SG4A 3M0WA 4ZCUA 4KYNA 2F3YA 3NSLA 1DJHA 1YRTB 2O60A 5J3XA 1JWDA 1FI5A 2I18A 3NXAA 1GGWA 2JT8A 1PK0D 1R2UA 1L7ZA 1SW8A 3QMEA 4FQOA 1OOHA 2WORA 1SK6D 3CR2A 3RM1A 4PE4A 3D74A 4BY4A 1SCMB 4ZCVA 3TDIA 1PRWA 1FF1A 2Y5IA 3B6XA 5EL2A 5KSZA 1DQEA 1GQMA 1A75A 1U5IB 2LMUA 3DVMA 3O2PA 2M3WA 5G08A 1CMFA 1KQMC 3BFAA 4OKHA 3SS4A 1A29A 1MXEA 2H61C 2HF5A 2JT3A 5D3OA 1B7TZ 2KI6C 1B4CA 1LA0A 1M63B 3A8RA 1K2HA 2BBMA 3FS7A 2JZIA 4TNCA 3D10A 4MEWA 3R72A 1IQ5A 3NHTA 1DC1A 1TOPA 1NX0A 2KSPA 4MN0A 1AUIB 3NSKA 3TS5B 3SG3A 2OPOA 3WXAA 3GK1A 2WC5A 3GK4X 3QRXA 3BUOB 1F8HA 4C0LA 5CSNA 2L2CA 1KQMB 1EJ3A 1QWVA 4P2YB 1LS8A 1CDNA 2PVBA 4HREE 3VB1A 1EXRA 1GGZA 3BOWB 1TNQA 1OMVA 2E30A 4NDDA 1SCMC 4QJ3B 3BFBA 1TWOA 4PALA 1CM4A 1CNPA 3CS1A 1J1DA 2LUXA 2LP3A 1QS7A 1RK9A 2F33A 3WHTB 3OGNA 1SMGA 3CTNA 1W7IB 3IVTA 1PALA 2NCOA 4GAOA 1S6IA 4M2OA 3CYZA 3PFVA 1CFCA 1IH0A 4CIDA 3KPXA 2NLNA 1DJWA 3HCMA 4E68A 1GM0A 1OQPA 1XFVO 2LVKA 3CLNA 1K9KA 4ORAB 2WNDA 4IL1A 2WC6A 3I5IB 1J7OA 2LC5A 1N0YA 1WY9A 4P5OE 1JFKA 1ZUZA 2BBNA 1V1GA 1NX3A 1OOFA 2LMVA 2H8VA 1SL9A 3O4YA 3O78A 3SJSA 1B9AA 3IQOA 3BUMB 4USLA 4CFRA 4XJKB 3S0AA 3R1VA 2BL0C 2BE4A 3SG5A 1C7WA 3CABA 1A03A 2BCBA 1C3YA 2LANA 1MR8A 1S3PA 4CFQA 1RROA 3S0FA 1KFUS 1CLLA 1M39A 5B8IB 5FI2A 2JRFA 3CWGA 1PULA 1NX2A 1XVJA 2LV7A 2PMYA 4HRHA 4AQJA 2HQWA 5D7FA 2QPTA 3B86A 1JC2A 3HX4A 4PHKA 3PM2A 5JJGA 2V53A 2I2RE 1BU3A 1S1EA 1Q80A 3PN7C 1SYMA 4INWA 3D0YA 5HLOA 2P70A 3ICBA 1J1EA 1AP4A 5PALA 1J55A 2KYFA 4DCKA 1BMOA 1WLZA 2ZN9A 1Y6WA 4QJ5B 3BYAA 3TUYB 3UO9A 1VRKA 4YI8A 3S0EA 5I2LA 1LVCD 1ZOTB 3EK7A 3R1OA 1S5GY 2JQ6A 2YGUA 1EG4A 5I2QA 2KAVA 1TUZA 1JSAA 1YX7A 2GV5A 3VROA 1RTP1 3VRNA 5K89A 2TN4A 2K7OA 3OX5A 1L2OB 2K2AA 3DYEA 2FOTA 2BKIB 3L4LA 3S0DA 1CTRA 2F8PA 2JXCA 1NWDA 1QX7A 1UURA 3O6BA 4PE7A 1S26D 4F0ZB 3D77A 3FIAA 2FCDA 5CSFA 1NPQA 2BL0B 1NCYA 2M9GA 4YBHB 1NCZA 3MSEB 5CPVA 2G2BA 2BNXA 1MWNA 1YVHA 1YUSA 2BKHB 2LE9B 2JT0A 3I5IC 2KFHA 2A4JA 2LVJA 4MZKA 2JNXA 2CNPA 2PSRA 3PATA 5DICA 1RWYA 2F3ZA 2ZRSA 5AFPA 4WQ3A 2L2EA 2ZNEA 1C07A 1YUTA 5JOLA 1XFWO 1UHJA 2OS8C 2QEVA 3Q8IA 5GQQC 5HKWA 1AJ4A 2JULA 1NIWA 2KAYA 2ZFDA 3H4SE 3F45A 3L47A 2Q4UA 4PE0A 3RLZA 1YVLA 1H4BA 1B8LA 5HL1A 2KNEA 3BOWA 1QTXA 4U8DA 1CLBA 4FQTA 2MA2A 1J7RA 1ZACA 1S5GZ 2LCPA 3AAJA 1SBJA 3KHEA 2KAXA 2MHHA 1TNPA
chains in the Genus database with same CATH topology
3ZWHA 1FBVA 1KK7Y 1N65A 1QLSA 2EC6C 3JVTB 1WRKA 4D1EA 2K61A 3K21A 1QVIZ 1LA3A 1QV0A 1PSRA 3OB1B 2K7DA 1TNWA 1K94A 2HPSA 4YGDB 1F70A 1IWQA 1WRLA 1SL7A 2DOQA 2WCEA 1XK4A 3OX6A 1CLMA 5CSJA 3CGAA 1M45A 3EKHA 1CM1A 1A75B 2OTGB 1CKKA 1F4OA 3DVJA 1OOJA 1CDLA 1ODBA 4WRIA 2WC8A 1PSBA 4Q04A 1KWOB 1OMRA 2JXLA 2PALA 3LK0A 4PHJA 2FJUB 5ER4X 2MLFC 4NQGA 2M1UA 1UHIA 1TCOB 5HKYA 1B1GA 1AJ5A 1MQ1A 2RGIA 4A4CA 1FI6A 1IQ3A 4MBEA 2AUCA 1B8RA 2I94A 2MJWB 1QX2A 1WRZA 4ICBA 1JUOA 1Y1AA 2AAOA 2P6BB 3C1VA 1WDCB 1NYAA 1N2DA 2KBMA 4ETOA 5KU1A 3LK1A 1DT7B 1SR6B 4PHNA 3VRQA 1KK8C 2CT9A 1IG5A 2WCFA 3FWBA 1W7JB 1QATA 1IKUA 1CMGA 2HQ8A 2EC6B 3JVTC 3I5GB 3VGOA 3TDZA 1KFUL 4N1FA 3IF7A 1TIZA 2ZKMX 4I5JA 1K95A 3NSOA 4DRWA 1KWOC 4CPVA 3TS5C 2LLSA 2M8UA 1QIVA 1UP5A 3AKAA 1K93D 1YRUB 2AMIA 1K9UA 2KOTA 2KHNA 1F4QA 2KI4B 1XYDA 1Y0VH 2LM5A 3DVKA 2VRGA 5TNCA 1XFUO 1XFZO 2FCEA 1XFYO 2LHIA 2NCPA 1XK4C 1X02A 4CLNA 3VRPA 3BQ3A 1A2XA 2EGDA 5HYDA 5I2OA 2MAZA 2LUCA 5AANA 2BE6A 1AVSA 2L98A 1U5IA 3JTDC 4JQ0D 2JC2A 3PM8A 5DKNA 1BODA 1OE9B 1UUSA 1RJVA 1BOCA 5HLVA 4OCIA 4OV2A 1L2OC 1UWOA 1SL8A 1OSAA 2LAPA 5DKQA 1IJ6A 1DGVA 3BXKA 1J7PA 1SR6C 3I5HB 1KSOA 1DJIA 3SIAA 1SPYA 2CTNA 1LXFC 3TUYC 3JTDB 2M7LA 1Y1XA 1YR5A 3EKJA 2JPTA 2LMTA 1AK8A 3LCPC 5FYXA 1ZMZA 1IRJA 1QV1A 4AQIA 2BECA 5KTYA 5I8NA 2R2IA 2GGZA 1SNLA 4HRGA 2F2OA 3FWCA 2JWWA 2ZNDA 4YGCB 4MLWA 1KFXS 2H2KA 1EH2A 1KCYA 1UHNA 4GGNA 3LL8B 1C7VA 2E6WA 3EVVA 2COLB 2BCXA 3PSRA 2KI4C 2L4HA 1K8UA 4ORCB 1G33A 1V1FA 3KF9A 2KDHA 2KGRA 1DTLA 2KI6D 1B7TY 1BR4B 2B1UA 2M1KB 1CFPA 1YTZC 2ZN8A 1TN4A 1D1OA 4MRYA 2Y1NA 1DJYA 1KK8B 2L51A 2OTGC 4GUKA 5AEQA 4UPGA 1JBAA 1JFJA 3D0YB 1PVAA 4L9MA 3I5GC 1SCVA 1TRFA 2F2PA 1OZSA 1KQVA 4GGFC 1FW4A 4N1GA 4YGEB 5AERA 3BUNB 2JTZA 1QASA 2PASA 2L5XB 2LNKA 4PHMA 1WLMA 1UHKA 1EL4A 5CSIA 4YI9A 1JF2A 1A4PA 2CBLA 1DJXA 2M0RA 1MUXA 3OB2B 3OHMB 1XA5A 1PVBA 2O5GA 1BF5A 3CZTX 1QLKA 4XJKA 2IS9A 1S36A 1BR1B 1EG3A 2D8NA 1QJTA 3VRRA 2KQ6A 3PLFB 1DMOA 2JOJA 1G4YR 2OS8B 4C0KA 3SG2A 4JWQA 3I5FC 1BT6A 1DVIA 5F6TA 1B47A 1G8IA 2CXJA 1TNXA 1YURA 1E8AA 4GGFA 1MF8B 4GFTA 1B8CA 4MSPA 4M2PA 2ISDA 4OR9B 1HT9A 4FTGA 3IQQA 4HSZA 5BPJA 1NUBA 3EVRA 4GPLB 4N5XA 1UHHA 4MZLA 5DKRA 1QX5B 2G9BA 2K8MB 2Y1MA 3PALA 1TTXA 1SKTA 1M31A 1BG1A 1DF0A 1DF0B 3DVEA 2JTTA 2L0PA 3KEVA 2KFFA 2CCMA 1XO5A 3I5HC 1F54A 1KFXL 1NCXA 1DJZA 2HETA 3BUXB 1KSMA 4PDZA 3PN7B 1IJ5A 1F71A 1TCFA 2KGBC 3EK8A 1MXLC 1YUUA 1RFJA 1GJYA 2MLEC 1OZOA 1SRAA 2WOSA 4ORBB 1NP8A 4YGBB 3SG7A 3GOFA 1FPWA 2GGMA 1BLQA 3TZ1A 1CDPA 3DF0A 5AXIA 1CFFA 1R6PA 5D69A 2M97A 2EHBA 3WHUB 2MRDA 2LLUA 4PE1A 3I5FB 2KQYA 1LKJA 3KO0A 1NSHA 3AAKA 2JU0A 3E3RA 1XFXO 1NX1A 1YX8A 2LVVA 1ALWA 1S6CA 1IGVA 4MZJA 4C0JA 1RECA 1DGUA 5ER5A 4YRUA 1BJFA 2LP2A 2QACA 4NDCA 4R1EA 3TDUA 4DS7A 1CDMA 3EK4A 3CR4X 2K7CA 2Q91A 3BUWB 2KFGA 4I5LB 1QIWA 2I7AA 2JNFA 2M49B 1LINA 2Y4QA 4DIRA 4MVFA 2L50A 2ZRTA 2KBIA 4AOMA 4BY5A 4M2QA 4GNKB 2MBXA 1M46A 4QJ4B 2NZ0A 1AHRA 2M7NA 2H61A 1K90D 2LHLA 2BCAA 1WDCC 3NSIA 3ZNIA 4YGAA 3SIBA 5IBWA 1MHOA 2K2FA 2KYCA 4PCWA 3WNXB 2LLTA 4XYNA 4GBAA 3AKBA 5HKZA 4I5NB 4NDBA 3A4UB 2K7BA 3EVUA 3OP0A 2PRUA 1QXPA 4A4BA 2SASA 2K0JA 4OVNF 1Y1UA 1S6JA 1ALVA 2WCBA 1J7QA 4WQ2A 1HQVA 1KK7Z 1ZFSA 1K9PA 1QVIY 4JPZB 1CFDA 2L4IA 4MRXA 4I5KA 2LVIA 3DD4A 3GK2A 3CR5X 2NXQA 1DJGA 1CB1A 2SCPA 3SG6A 4DUQA 1H8BA 1F55A 2M29A 1K96A 3LLEA 1OMDA 1SY9A 3DF0B 1JF0A 3SG4A 3M0WA 4ZCUA 2F3YA 3NSLA 1DJHA 1YRTB 2O60A 5J3XA 1JWDA 1FI5A 2I18A 3NXAA 1GGWA 2JT8A 1PK0D 1R2UA 1L7ZA 1SW8A 4FQOA 2WORA 1SK6D 3CR2A 3RM1A 4PE4A 4BY4A 1SCMB 4ZCVA 3TDIA 1PRWA 1FF1A 2Y5IA 5KSZA 1GQMA 1A75A 1U5IB 2LMUA 3DVMA 3O2PA 2M3WA 5G08A 1CMFA 1KQMC 4OKHA 1A29A 1MXEA 2H61C 2HF5A 2JT3A 1B7TZ 2KI6C 1B4CA 1LA0A 1M63B 3A8RA 1K2HA 2BBMA 3FS7A 2JZIA 4TNCA 3D10A 4MEWA 1IQ5A 1TOPA 1NX0A 2KSPA 4MN0A 1AUIB 3NSKA 3TS5B 3SG3A 2OPOA 3WXAA 3GK1A 3GK4X 3QRXA 3BUOB 1F8HA 4C0LA 5CSNA 1KQMB 1EJ3A 4P2YB 1CDNA 2PVBA 4HREE 1EXRA 1GGZA 3BOWB 1TNQA 1OMVA 2E30A 4NDDA 1SCMC 4QJ3B 4PALA 1CM4A 1CNPA 3CS1A 1J1DA 2LUXA 2LP3A 1QS7A 1RK9A 2F33A 3WHTB 1SMGA 3CTNA 1W7IB 1PALA 2NCOA 4GAOA 1S6IA 4M2OA 3PFVA 1CFCA 1IH0A 4CIDA 3KPXA 2NLNA 1DJWA 3HCMA 4E68A 1OQPA 1XFVO 2LVKA 3CLNA 1K9KA 4ORAB 2WNDA 4IL1A 3I5IB 1J7OA 2LC5A 1N0YA 1WY9A 4P5OE 1JFKA 1ZUZA 2BBNA 1V1GA 1NX3A 2LMVA 3O4YA 3O78A 1SL9A 5JOLA 3SJSA 1B9AA 3IQOA 3BUMB 4USLA 4CFRA 4XJKB 2BL0C 2BE4A 3SG5A 1C7WA 1A03A 2BCBA 2LANA 1MR8A 1S3PA 4CFQA 1RROA 1KFUS 1CLLA 1M39A 5B8IB 2JRFA 3CWGA 1PULA 1NX2A 1XVJA 2LV7A 2PMYA 4HRHA 4AQJA 2HQWA 5D7FA 2QPTA 1JC2A 3HX4A 4PHKA 5JJGA 2V53A 2I2RE 1BU3A 1S1EA 1Q80A 3PN7C 1SYMA 3D0YA 5HLOA 1AP4A 3ICBA 1J1EA 5PALA 1J55A 2KYFA 4DCKA 1BMOA 1WLZA 2ZN9A 1Y6WA 4QJ5B 3BYAA 3TUYB 1VRKA 4YI8A 5I2LA 1LVCD 1ZOTB 3EK7A 1S5GY 2JQ6A 5I2QA 1EG4A 1JSAA 2KAVA 1YX7A 2GV5A 3VROA 1RTP1 3VRNA 5K89A 2TN4A 2K7OA 3OX5A 1L2OB 2K2AA 2FOTA 2BKIB 1CTRA 2F8PA 2JXCA 1NWDA 1QX7A 1UURA 3O6BA 4PE7A 1S26D 4F0ZB 3FIAA 2FCDA 5CSFA 1NPQA 2BL0B 1NCYA 2M9GA 4YBHB 1NCZA 3MSEB 5CPVA 2G2BA 1MWNA 1YVHA 1YUSA 2BKHB 2LE9B 2JT0A 3I5IC 2KFHA 2A4JA 2LVJA 4MZKA 2JNXA 2CNPA 2PSRA 3PATA 1RWYA 2F3ZA 2ZRSA 5AFPA 4WQ3A 2L2EA 2ZNEA 1C07A 1YUTA 1XFWO 1UHJA 2OS8C 5GQQC 5HKWA 1AJ4A 2JULA 1NIWA 2KAYA 2ZFDA 3H4SE 3F45A 3RLZA 2Q4UA 4PE0A 1H4BA 1YVLA 1B8LA 2KNEA 3BOWA 1QTXA 4U8DA 1CLBA 2MA2A 1J7RA 1ZACA 1S5GZ 2LCPA 3AAJA 1SBJA 3KHEA 2KAXA 2MHHA 1TNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWH A;  1FBV A;  1KK7 Y;  1N65 A;  1QLS A;  2EC6 C;  3JVT B;  1WRK A;  4D1E A;  2K61 A;  3K21 A;  1QVI Z;  1LA3 A;  1QV0 A;  1PSR A;  3OB1 B;  2K7D A;  1TNW A;  1K94 A;  2HPS A;  4YGD B;  1F70 A;  1IWQ A;  1WRL A;  1SL7 A;  2DOQ A;  2WCE A;  1XK4 A;  3OX6 A;  1CLM A;  5CSJ A;  3CGA A;  1M45 A;  3EKH A;  1CM1 A;  1A75 B;  2OTG B;  1CKK A;  1F4O A;  3DVJ A;  1OOJ A;  1CDL A;  1ODB A;  4WRI A;  2WC8 A;  1PSB A;  4Q04 A;  1KWO B;  1OMR A;  2JXL A;  2PAL A;  3LK0 A;  4PHJ A;  2FJU B;  5ER4 X;  2MLF C;  4NQG A;  2M1U A;  1UHI A;  1TCO B;  5HKY A;  1B1G A;  1AJ5 A;  1MQ1 A;  2RGI A;  4A4C A;  1FI6 A;  1IQ3 A;  4MBE A;  2AUC A;  1B8R A;  2I94 A;  2MJW B;  1QX2 A;  1WRZ A;  4ICB A;  1JUO A;  1Y1A A;  2AAO A;  2P6B B;  3C1V A;  1WDC B;  1NYA A;  1N2D A;  2KBM A;  4ETO A;  5KU1 A;  3LK1 A;  1DT7 B;  1SR6 B;  4PHN A;  3VRQ A;  1KK8 C;  2CT9 A;  1IG5 A;  2WCF A;  3FWB A;  1W7J B;  1QAT A;  1IKU A;  1CMG A;  2HQ8 A;  2EC6 B;  3JVT C;  3I5G B;  3VGO A;  3TDZ A;  1KFU L;  4N1F A;  3IF7 A;  1TIZ A;  2ZKM X;  4I5J A;  1K95 A;  3NSO A;  4DRW A;  1KWO C;  4CPV A;  3TS5 C;  2LLS A;  2M8U A;  1QIV A;  1UP5 A;  3AKA A;  1K93 D;  1YRU B;  2AMI A;  1K9U A;  2KOT A;  2KHN A;  1F4Q A;  2KI4 B;  1XYD A;  1Y0V H;  2LM5 A;  3DVK A;  2VRG A;  5TNC A;  1XFU O;  1XFZ O;  2FCE A;  1XFY O;  2LHI A;  2NCP A;  1XK4 C;  1X02 A;  4CLN A;  3VRP A;  3BQ3 A;  1A2X A;  2EGD A;  5HYD A;  5I2O A;  2MAZ A;  2LUC A;  5AAN A;  2BE6 A;  1AVS A;  2L98 A;  1U5I A;  3JTD C;  4JQ0 D;  2JC2 A;  3PM8 A;  5DKN A;  1BOD A;  1OE9 B;  1UUS A;  1RJV A;  1BOC A;  5HLV A;  4OCI A;  4OV2 A;  1L2O C;  1UWO A;  1SL8 A;  1OSA A;  2LAP A;  5DKQ A;  1IJ6 A;  1DGV A;  3BXK A;  1J7P A;  1SR6 C;  3I5H B;  1KSO A;  1DJI A;  3SIA A;  1SPY A;  2CTN A;  1LXF C;  3TUY C;  3JTD B;  2M7L A;  1Y1X A;  1YR5 A;  3EKJ A;  2JPT A;  2LMT A;  1AK8 A;  3LCP C;  5FYX A;  1ZMZ A;  1IRJ A;  1QV1 A;  4AQI A;  2BEC A;  5KTY A;  5I8N A;  2R2I A;  2GGZ A;  1SNL A;  4HRG A;  2F2O A;  3FWC A;  2JWW A;  2ZND A;  4YGC B;  4MLW A;  1KFX S;  2H2K A;  1EH2 A;  1KCY A;  1UHN A;  4GGN A;  3LL8 B;  1C7V A;  2E6W A;  3EVV A;  2COL B;  2BCX A;  3PSR A;  2KI4 C;  2L4H A;  1K8U A;  4ORC B;  1G33 A;  1V1F A;  3KF9 A;  2KDH A;  2KGR A;  1DTL A;  2KI6 D;  1B7T Y;  1BR4 B;  2B1U A;  2M1K B;  1CFP A;  1YTZ C;  2ZN8 A;  1TN4 A;  1D1O A;  4MRY A;  2Y1N A;  1DJY A;  1KK8 B;  2L51 A;  2OTG C;  4GUK A;  5AEQ A;  4UPG A;  1JBA A;  1JFJ A;  3D0Y B;  1PVA A;  4L9M A;  3I5G C;  1SCV A;  1TRF A;  2F2P A;  1OZS A;  1KQV A;  4GGF C;  1FW4 A;  4N1G A;  4YGE B;  5AER A;  3BUN B;  2JTZ A;  1QAS A;  2PAS A;  2L5X B;  2LNK A;  4PHM A;  1WLM A;  1UHK A;  1EL4 A;  5CSI A;  4YI9 A;  1JF2 A;  1A4P A;  2CBL A;  1DJX A;  2M0R A;  1MUX A;  3OB2 B;  3OHM B;  1XA5 A;  1PVB A;  2O5G A;  1BF5 A;  3CZT X;  1QLK A;  4XJK A;  2IS9 A;  1S36 A;  1BR1 B;  1EG3 A;  2D8N A;  1QJT A;  3VRR A;  2KQ6 A;  3PLF B;  1DMO A;  2JOJ A;  1G4Y R;  2OS8 B;  4C0K A;  3SG2 A;  4JWQ A;  3I5F C;  1BT6 A;  1DVI A;  5F6T A;  1B47 A;  1G8I A;  2CXJ A;  1TNX A;  1YUR A;  1E8A A;  4GGF A;  1MF8 B;  4GFT A;  1B8C A;  4MSP A;  4M2P A;  2ISD A;  4OR9 B;  1HT9 A;  4FTG A;  3IQQ A;  4HSZ A;  5BPJ A;  1NUB A;  3EVR A;  4GPL B;  4N5X A;  1UHH A;  4MZL A;  5DKR A;  1QX5 B;  2G9B A;  2K8M B;  2Y1M A;  3PAL A;  1TTX A;  1SKT A;  1M31 A;  1BG1 A;  1DF0 A;  1DF0 B;  3DVE A;  2JTT A;  2L0P A;  3KEV A;  2KFF A;  2CCM A;  1XO5 A;  3I5H C;  1F54 A;  1KFX L;  1NCX A;  1DJZ A;  2HET A;  3BUX B;  1KSM A;  4PDZ A;  3PN7 B;  1IJ5 A;  1F71 A;  1TCF A;  2KGB C;  3EK8 A;  1MXL C;  1YUU A;  1RFJ A;  1GJY A;  2MLE C;  1OZO A;  1SRA A;  2WOS A;  4ORB B;  1NP8 A;  4YGB B;  3SG7 A;  3GOF A;  1FPW A;  2GGM A;  1BLQ A;  3TZ1 A;  1CDP A;  3DF0 A;  5AXI A;  1CFF A;  1R6P A;  5D69 A;  2M97 A;  2EHB A;  3WHU B;  2MRD A;  2LLU A;  4PE1 A;  3I5F B;  2KQY A;  1LKJ A;  3KO0 A;  1NSH A;  3AAK A;  2JU0 A;  3E3R A;  1XFX O;  1NX1 A;  1YX8 A;  2LVV A;  1ALW A;  1S6C A;  1IGV A;  4MZJ A;  4C0J A;  1REC A;  1DGU A;  5ER5 A;  4YRU A;  1BJF A;  2LP2 A;  2QAC A;  4NDC A;  4R1E A;  3TDU A;  4DS7 A;  1CDM A;  3EK4 A;  3CR4 X;  2K7C A;  2Q91 A;  3BUW B;  2KFG A;  4I5L B;  1QIW A;  2I7A A;  2JNF A;  2M49 B;  1LIN A;  2Y4Q A;  4DIR A;  4MVF A;  2L50 A;  2ZRT A;  2KBI A;  4AOM A;  4BY5 A;  4M2Q A;  4GNK B;  2MBX A;  1M46 A;  4QJ4 B;  2NZ0 A;  1AHR A;  2M7N A;  2H61 A;  1K90 D;  2LHL A;  2BCA A;  1WDC C;  3NSI A;  3ZNI A;  4YGA A;  3SIB A;  5IBW A;  1MHO A;  2K2F A;  2KYC A;  4PCW A;  3WNX B;  2LLT A;  4XYN A;  4GBA A;  3AKB A;  5HKZ A;  4I5N B;  4NDB A;  3A4U B;  2K7B A;  3EVU A;  3OP0 A;  2PRU A;  1QXP A;  4A4B A;  2SAS A;  2K0J A;  4OVN F;  1Y1U A;  1S6J A;  1ALV A;  2WCB A;  1J7Q A;  4WQ2 A;  1HQV A;  1KK7 Z;  1ZFS A;  1K9P A;  1QVI Y;  4JPZ B;  1CFD A;  2L4I A;  4MRX A;  4I5K A;  2LVI A;  3DD4 A;  3GK2 A;  3CR5 X;  2NXQ A;  1DJG A;  1CB1 A;  2SCP A;  3SG6 A;  4DUQ A;  1H8B A;  1F55 A;  2M29 A;  1K96 A;  3LLE A;  1OMD A;  1SY9 A;  3DF0 B;  1JF0 A;  3SG4 A;  3M0W A;  4ZCU A;  2F3Y A;  3NSL A;  1DJH A;  1YRT B;  2O60 A;  5J3X A;  1JWD A;  1FI5 A;  2I18 A;  3NXA A;  1GGW A;  2JT8 A;  1PK0 D;  1R2U A;  1L7Z A;  1SW8 A;  4FQO A;  2WOR A;  1SK6 D;  3CR2 A;  3RM1 A;  4PE4 A;  4BY4 A;  1SCM B;  4ZCV A;  3TDI A;  1PRW A;  1FF1 A;  2Y5I A;  5KSZ A;  1GQM A;  1A75 A;  1U5I B;  2LMU A;  3DVM A;  3O2P A;  2M3W A;  5G08 A;  1CMF A;  1KQM C;  4OKH A;  1A29 A;  1MXE A;  2H61 C;  2HF5 A;  2JT3 A;  1B7T Z;  2KI6 C;  1B4C A;  1LA0 A;  1M63 B;  3A8R A;  1K2H A;  2BBM A;  3FS7 A;  2JZI A;  4TNC A;  3D10 A;  4MEW A;  1IQ5 A;  1TOP A;  1NX0 A;  2KSP A;  4MN0 A;  1AUI B;  3NSK A;  3TS5 B;  3SG3 A;  2OPO A;  3WXA A;  3GK1 A;  3GK4 X;  3QRX A;  3BUO B;  1F8H A;  4C0L A;  5CSN A;  1KQM B;  1EJ3 A;  4P2Y B;  1CDN A;  2PVB A;  4HRE E;  1EXR A;  1GGZ A;  3BOW B;  1TNQ A;  1OMV A;  2E30 A;  4NDD A;  1SCM C;  4QJ3 B;  4PAL A;  1CM4 A;  1CNP A;  3CS1 A;  1J1D A;  2LUX A;  2LP3 A;  1QS7 A;  1RK9 A;  2F33 A;  3WHT B;  1SMG A;  3CTN A;  1W7I B;  1PAL A;  2NCO A;  4GAO A;  1S6I A;  4M2O A;  3PFV A;  1CFC A;  1IH0 A;  4CID A;  3KPX A;  2NLN A;  1DJW A;  3HCM A;  4E68 A;  1OQP A;  1XFV O;  2LVK A;  3CLN A;  1K9K A;  4ORA B;  2WND A;  4IL1 A;  3I5I B;  1J7O A;  2LC5 A;  1N0Y A;  1WY9 A;  4P5O E;  1JFK A;  1ZUZ A;  2BBN A;  1V1G A;  1NX3 A;  2LMV A;  3O4Y A;  3O78 A;  1SL9 A;  5JOL A;  3SJS A;  1B9A A;  3IQO A;  3BUM B;  4USL A;  4CFR A;  4XJK B;  2BL0 C;  2BE4 A;  3SG5 A;  1C7W A;  1A03 A;  2BCB A;  2LAN A;  1MR8 A;  1S3P A;  4CFQ A;  1RRO A;  1KFU S;  1CLL A;  1M39 A;  5B8I B;  2JRF A;  3CWG A;  1PUL A;  1NX2 A;  1XVJ A;  2LV7 A;  2PMY A;  4HRH A;  4AQJ A;  2HQW A;  5D7F A;  2QPT A;  1JC2 A;  3HX4 A;  4PHK A;  5JJG A;  2V53 A;  2I2R E;  1BU3 A;  1S1E A;  1Q80 A;  3PN7 C;  1SYM A;  3D0Y A;  5HLO A;  1AP4 A;  3ICB A;  1J1E A;  5PAL A;  1J55 A;  2KYF A;  4DCK A;  1BMO A;  1WLZ A;  2ZN9 A;  1Y6W A;  4QJ5 B;  3BYA A;  3TUY B;  1VRK A;  4YI8 A;  5I2L A;  1LVC D;  1ZOT B;  3EK7 A;  1S5G Y;  2JQ6 A;  5I2Q A;  1EG4 A;  1JSA A;  2KAV A;  1YX7 A;  2GV5 A;  3VRO A;  1RTP 1;  3VRN A;  5K89 A;  2TN4 A;  2K7O A;  3OX5 A;  1L2O B;  2K2A A;  2FOT A;  2BKI B;  1CTR A;  2F8P A;  2JXC A;  1NWD A;  1QX7 A;  1UUR A;  3O6B A;  4PE7 A;  1S26 D;  4F0Z B;  3FIA A;  2FCD A;  5CSF A;  1NPQ A;  2BL0 B;  1NCY A;  2M9G A;  4YBH B;  1NCZ A;  3MSE B;  5CPV A;  2G2B A;  1MWN A;  1YVH A;  1YUS A;  2BKH B;  2LE9 B;  2JT0 A;  3I5I C;  2KFH A;  2A4J A;  2LVJ A;  4MZK A;  2JNX A;  2CNP A;  2PSR A;  3PAT A;  1RWY A;  2F3Z A;  2ZRS A;  5AFP A;  4WQ3 A;  2L2E A;  2ZNE A;  1C07 A;  1YUT A;  1XFW O;  1UHJ A;  2OS8 C;  5GQQ C;  5HKW A;  1AJ4 A;  2JUL A;  1NIW A;  2KAY A;  2ZFD A;  3H4S E;  3F45 A;  3RLZ A;  2Q4U A;  4PE0 A;  1H4B A;  1YVL A;  1B8L A;  2KNE A;  3BOW A;  1QTX A;  4U8D A;  1CLB A;  2MA2 A;  1J7R A;  1ZAC A;  1S5G Z;  2LCP A;  3AAJ A;  1SBJ A;  3KHE A;  2KAX A;  2MHH A;  1TNP A; 
#chains in the Genus database with same CATH topology
 3ZWH A;  1IIO A;  1FBV A;  3NHI A;  1OOI X;  1KK7 Y;  1N65 A;  1QLS A;  2EC6 C;  3JVT B;  1WRK A;  3UNW A;  4D1E A;  2K61 A;  1OW4 A;  3K21 A;  1QVI Z;  1LA3 A;  1QV0 A;  1PSR A;  3OB1 B;  2K7D A;  1TNW A;  1K94 A;  2HPS A;  4YGD B;  1F70 A;  1IWQ A;  1WRL A;  1SL7 A;  2DOQ A;  2WCE A;  1XK4 A;  3OX6 A;  1CLM A;  5CSJ A;  3CGA A;  1M45 A;  3EKH A;  1CM1 A;  1A75 B;  2OTG B;  1CKK A;  1F4O A;  3DVJ A;  1OOJ A;  1CDL A;  1ODB A;  4WRI A;  2WC8 A;  1PSB A;  4JD9 A;  4Q04 A;  1KWO B;  1OMR A;  2JXL A;  2PAL A;  3LK0 A;  4PHJ A;  3DY9 A;  2FJU B;  5ER4 X;  4PT1 A;  2MLF C;  4NQG A;  2M1U A;  1UHI A;  1TCO B;  5HKY A;  1B1G A;  1OOG A;  1AJ5 A;  1MQ1 A;  2RGI A;  4A4C A;  1FI6 A;  1IQ3 A;  4MBE A;  2AUC A;  1B8R A;  2I94 A;  2MJW B;  1QX2 A;  1WRZ A;  3PJI A;  4ICB A;  1JUO A;  1Y1A A;  2AAO A;  2P6B B;  3C1V A;  1WDC B;  1NYA A;  1N2D A;  2KBM A;  4ETO A;  5KU1 A;  3LK1 A;  1DT7 B;  1SR6 B;  4PHN A;  3VRQ A;  1KK8 C;  3K1E A;  2CT9 A;  1IG5 A;  2WCF A;  3FWB A;  1W7J B;  1QAT A;  1Z4H A;  1IKU A;  2HQ8 A;  1CMG A;  1ORG A;  2EC6 B;  3JVT C;  3I5G B;  3OBV A;  3VGO A;  3FE6 A;  3TDZ A;  1KFU L;  4N1F A;  3N7H A;  4F7F A;  3IF7 A;  1TIZ A;  2ZKM X;  4I5J A;  1K95 A;  2FJY A;  3NSO A;  4DRW A;  1KWO C;  4CPV A;  3D76 A;  3TS5 C;  2LLS A;  2M8U A;  1QIV A;  1UP5 A;  3AKA A;  1K93 D;  1YRU B;  2AMI A;  1K9U A;  2KOT A;  2KHN A;  3DZT A;  1F4Q A;  2KI4 B;  1XYD A;  1Y0V H;  2LM5 A;  3DVK A;  2VRG A;  2WCL A;  1XFU O;  2WCH A;  5TNC A;  1XFZ O;  4IJ7 A;  2FCE A;  1XFY O;  2LHI A;  2PYQ A;  2NCP A;  3FE9 A;  1XK4 C;  1X02 A;  4CLN A;  3VRP A;  3RZS A;  3BQ3 A;  1A2X A;  2EGD A;  5HYD A;  5I2O A;  2MAZ A;  2LUC A;  5AAN A;  2BE6 A;  1AVS A;  1DEK A;  2L98 A;  1U5I A;  3JTD C;  3EG5 B;  4JQ0 D;  2JC2 A;  3PM8 A;  3B7A A;  5DKN A;  1BOD A;  1OE9 B;  1UUS A;  1RJV A;  1BOC A;  5HLV A;  2WCM A;  4OCI A;  1W9Z A;  4OV2 A;  1L2O C;  1UWO A;  1SL8 A;  1OSA A;  2LAP A;  5DKQ A;  1IJ6 A;  1DGV A;  3BXK A;  1J7P A;  1SR6 C;  3I5H B;  1KSO A;  1DJI A;  3SIA A;  3L4A A;  1SPY A;  2CTN A;  1LXF C;  3TUY C;  3JTD B;  2M7L A;  3SS3 A;  1Y1X A;  1YR5 A;  4INX A;  3EKJ A;  3S0G A;  2JPT A;  2LMT A;  1AK8 A;  2ERB A;  3LCP C;  5FYX A;  1ZMZ A;  1IRJ A;  1QV1 A;  4AQI A;  2BEC A;  5KTY A;  5I8N A;  2R2I A;  2GGZ A;  1SNL A;  3R1P A;  4HRG A;  2GTE A;  2F2O A;  2QDI A;  3FWC A;  2JWW A;  2ZND A;  4YGC B;  1TUJ A;  1Z2C B;  2K60 A;  4MLW A;  1KFX S;  2H2K A;  1EH2 A;  1KCY A;  1UHN A;  4GGN A;  3LL8 B;  1C7V A;  2E6W A;  3EVV A;  1XFR A;  2COL B;  2BCX A;  3PSR A;  2KI4 C;  2L4H A;  1K8U A;  4ORC B;  1G33 A;  1V1F A;  3KF9 A;  2KDH A;  2KGR A;  1DTL A;  2KI6 D;  3CZ2 A;  1B7T Y;  1BR4 B;  2B1U A;  2M1K B;  1CFP A;  1YTZ C;  2ZN8 A;  2PQL A;  1TN4 A;  1D1O A;  4MRY A;  2Y1N A;  1DJY A;  1KK8 B;  2L51 A;  2OTG C;  1DEL A;  4GUK A;  5AEQ A;  3BJH A;  4UPG A;  1JBA A;  1JFJ A;  3D0Y B;  1PVA A;  4L9M A;  3I5G C;  1SCV A;  1TRF A;  4OZD A;  2F2P A;  1OZS A;  1KQV A;  4GGF C;  5FI7 A;  1FW4 A;  4N1G A;  4YGE B;  5AER A;  3BUN B;  2JTZ A;  1QAS A;  2PAS A;  2L5X B;  2LNK A;  2QEH A;  4PHM A;  1WLM A;  1UHK A;  1EL4 A;  5CSI A;  4YI9 A;  1JF2 A;  1A4P A;  2CBL A;  1DJX A;  2M0R A;  1MUX A;  3OB2 B;  3OHM B;  2L5Y A;  1XA5 A;  1PVB A;  2O5G A;  1BF5 A;  3CZT X;  1QLK A;  4XJK A;  2IS9 A;  1S36 A;  1BR1 B;  1EG3 A;  2KPH A;  2D8N A;  1QJT A;  3VRR A;  3FE8 A;  2KQ6 A;  1T14 A;  3PLF B;  1DMO A;  2JOJ A;  1G4Y R;  3S0B A;  2OS8 B;  4C0K A;  3SG2 A;  4JWQ A;  3I5F C;  1BT6 A;  1DVI A;  2KLD A;  5F6T A;  1B47 A;  1G8I A;  2CXJ A;  3D75 A;  3DXL A;  1TNX A;  1YUR A;  1E8A A;  4GGF A;  1MF8 B;  5FI6 A;  4GFT A;  1B8C A;  4MSP A;  4M2P A;  2ISD A;  4OR9 B;  1HT9 A;  4FTG A;  3IQQ A;  4HSZ A;  5BPJ A;  1NUB A;  3EVR A;  4GPL B;  4N5X A;  1UHH A;  4MZL A;  5DKR A;  1QX5 B;  2QEB A;  2G9B A;  2K8M B;  2Y1M A;  2WCJ A;  1TTX A;  1SKT A;  3PAL A;  1M31 A;  1BG1 A;  1DF0 A;  3BFH A;  1DF0 B;  3DVE A;  2JTT A;  2L0P A;  3CZ0 A;  2KFF A;  3KEV A;  2CCM A;  1XO5 A;  3I5H C;  1F54 A;  1KFX L;  1NCX A;  5I94 A;  1DJZ A;  2HET A;  3BUX B;  1KSM A;  4PDZ A;  2QEO A;  3PN7 B;  1IJ5 A;  1F71 A;  1TCF A;  2KGB C;  3EK8 A;  1SSE B;  1C3Z A;  1MXL C;  1YUU A;  1RFJ A;  1GJY A;  2MLE C;  1OZO A;  1SRA A;  2WOS A;  4ORB B;  1NP8 A;  4YGB B;  3SG7 A;  3GOF A;  1FPW A;  2GGM A;  1BLQ A;  3TZ1 A;  1CDP A;  3DF0 A;  5AXI A;  1CFF A;  1R6P A;  5D69 A;  2M97 A;  2EHB A;  2BAP A;  3WHU B;  2MRD A;  2LLU A;  4PE1 A;  3I5F B;  2KQY A;  1LKJ A;  3KO0 A;  1NSH A;  3AAK A;  2JU0 A;  3E3R A;  1XFX O;  3B87 A;  1NX1 A;  1YX8 A;  2LVV A;  1ALW A;  1S6C A;  1IGV A;  4MZJ A;  4C0J A;  1REC A;  1DGU A;  3NGV A;  5ER5 A;  4YRU A;  3V2L A;  1BJF A;  2LP2 A;  2QAC A;  4NDC A;  4R1E A;  3TDU A;  4DS7 A;  1CDM A;  3EK4 A;  3CR4 X;  2K7C A;  2Q91 A;  3BUW B;  2KFG A;  1P28 A;  4I5L B;  1QIW A;  2I7A A;  2JNF A;  2M49 B;  1LIN A;  2Y4Q A;  4DIR A;  4MVF A;  2L50 A;  2ZRT A;  2KBI A;  4AOM A;  3B88 A;  4BY5 A;  4M2Q A;  2WCK A;  4GNK B;  2MBX A;  1M46 A;  4QJ4 B;  2NZ0 A;  4JKT A;  1AHR A;  2M7N A;  2H61 A;  1K90 D;  2LHL A;  2BCA A;  1WDC C;  3NSI A;  3O4X A;  3ZNI A;  4YGA A;  3SIB A;  5IBW A;  1MHO A;  2K2F A;  2KYC A;  4PCW A;  3WNX B;  2LLT A;  4XYN A;  3SS5 A;  4GBA A;  3AKB A;  2P71 A;  4I5N B;  4NDB A;  5HKZ A;  3A4U B;  2K7B A;  3EVU A;  3OP0 A;  2PRU A;  3D73 A;  1QXP A;  4A4B A;  2SAS A;  2K0J A;  4OVN F;  2KLE A;  1Y1U A;  1S6J A;  1ALV A;  2WCB A;  1J7Q A;  4WQ2 A;  1HQV A;  1KK7 Z;  1ZFS A;  3CDN A;  1K9P A;  1QVI Y;  3D78 A;  4JPZ B;  1CFD A;  2L4I A;  4MRX A;  3CZ1 A;  4I5K A;  2JPO A;  2LVI A;  3DD4 A;  3GK2 A;  3CR5 X;  2NXQ A;  1DJG A;  1CB1 A;  2SCP A;  3SG6 A;  4DUQ A;  1H8B A;  1F55 A;  2M29 A;  1K96 A;  3LLE A;  1OMD A;  1SY9 A;  3DF0 B;  1JF0 A;  3SG4 A;  3M0W A;  4ZCU A;  4KYN A;  2F3Y A;  3NSL A;  1DJH A;  1YRT B;  2O60 A;  5J3X A;  1JWD A;  1FI5 A;  2I18 A;  3NXA A;  1GGW A;  2JT8 A;  1PK0 D;  1R2U A;  1L7Z A;  1SW8 A;  3QME A;  4FQO A;  1OOH A;  2WOR A;  1SK6 D;  3CR2 A;  3RM1 A;  4PE4 A;  3D74 A;  4BY4 A;  1SCM B;  4ZCV A;  3TDI A;  1PRW A;  1FF1 A;  2Y5I A;  3B6X A;  5EL2 A;  5KSZ A;  1DQE A;  1GQM A;  1A75 A;  1U5I B;  2LMU A;  3DVM A;  3O2P A;  2M3W A;  5G08 A;  1CMF A;  1KQM C;  3BFA A;  4OKH A;  3SS4 A;  1A29 A;  1MXE A;  2H61 C;  2HF5 A;  2JT3 A;  5D3O A;  1B7T Z;  2KI6 C;  1B4C A;  1LA0 A;  1M63 B;  3A8R A;  1K2H A;  2BBM A;  3FS7 A;  2JZI A;  4TNC A;  3D10 A;  4MEW A;  3R72 A;  1IQ5 A;  3NHT A;  1DC1 A;  1TOP A;  1NX0 A;  2KSP A;  4MN0 A;  1AUI B;  3NSK A;  3TS5 B;  3SG3 A;  2OPO A;  3WXA A;  3GK1 A;  2WC5 A;  3GK4 X;  3QRX A;  3BUO B;  1F8H A;  4C0L A;  5CSN A;  2L2C A;  1KQM B;  1EJ3 A;  1QWV A;  4P2Y B;  1LS8 A;  1CDN A;  2PVB A;  4HRE E;  3VB1 A;  1EXR A;  1GGZ A;  3BOW B;  1TNQ A;  1OMV A;  2E30 A;  4NDD A;  1SCM C;  4QJ3 B;  3BFB A;  1TWO A;  4PAL A;  1CM4 A;  1CNP A;  3CS1 A;  1J1D A;  2LUX A;  2LP3 A;  1QS7 A;  1RK9 A;  2F33 A;  3WHT B;  3OGN A;  1SMG A;  3CTN A;  1W7I B;  3IVT A;  1PAL A;  2NCO A;  4GAO A;  1S6I A;  4M2O A;  3CYZ A;  3PFV A;  1CFC A;  1IH0 A;  4CID A;  3KPX A;  2NLN A;  1DJW A;  3HCM A;  4E68 A;  1GM0 A;  1OQP A;  1XFV O;  2LVK A;  3CLN A;  1K9K A;  4ORA B;  2WND A;  4IL1 A;  2WC6 A;  3I5I B;  1J7O A;  2LC5 A;  1N0Y A;  1WY9 A;  4P5O E;  1JFK A;  1ZUZ A;  2BBN A;  1V1G A;  1NX3 A;  1OOF A;  2LMV A;  2H8V A;  1SL9 A;  3O4Y A;  3O78 A;  3SJS A;  1B9A A;  3IQO A;  3BUM B;  4USL A;  4CFR A;  4XJK B;  3S0A A;  3R1V A;  2BL0 C;  2BE4 A;  3SG5 A;  1C7W A;  3CAB A;  1A03 A;  2BCB A;  1C3Y A;  2LAN A;  1MR8 A;  1S3P A;  4CFQ A;  1RRO A;  3S0F A;  1KFU S;  1CLL A;  1M39 A;  5B8I B;  5FI2 A;  2JRF A;  3CWG A;  1PUL A;  1NX2 A;  1XVJ A;  2LV7 A;  2PMY A;  4HRH A;  4AQJ A;  2HQW A;  5D7F A;  2QPT A;  3B86 A;  1JC2 A;  3HX4 A;  4PHK A;  3PM2 A;  5JJG A;  2V53 A;  2I2R E;  1BU3 A;  1S1E A;  1Q80 A;  3PN7 C;  1SYM A;  4INW A;  3D0Y A;  5HLO A;  2P70 A;  3ICB A;  1J1E A;  1AP4 A;  5PAL A;  1J55 A;  2KYF A;  4DCK A;  1BMO A;  1WLZ A;  2ZN9 A;  1Y6W A;  4QJ5 B;  3BYA A;  3TUY B;  3UO9 A;  1VRK A;  4YI8 A;  3S0E A;  5I2L A;  1LVC D;  1ZOT B;  3EK7 A;  3R1O A;  1S5G Y;  2JQ6 A;  2YGU A;  1EG4 A;  5I2Q A;  2KAV A;  1TUZ A;  1JSA A;  1YX7 A;  2GV5 A;  3VRO A;  1RTP 1;  3VRN A;  5K89 A;  2TN4 A;  2K7O A;  3OX5 A;  1L2O B;  2K2A A;  3DYE A;  2FOT A;  2BKI B;  3L4L A;  3S0D A;  1CTR A;  2F8P A;  2JXC A;  1NWD A;  1QX7 A;  1UUR A;  3O6B A;  4PE7 A;  1S26 D;  4F0Z B;  3D77 A;  3FIA A;  2FCD A;  5CSF A;  1NPQ A;  2BL0 B;  1NCY A;  2M9G A;  4YBH B;  1NCZ A;  3MSE B;  5CPV A;  2G2B A;  2BNX A;  1MWN A;  1YVH A;  1YUS A;  2BKH B;  2LE9 B;  2JT0 A;  3I5I C;  2KFH A;  2A4J A;  2LVJ A;  4MZK A;  2JNX A;  2CNP A;  2PSR A;  3PAT A;  5DIC A;  1RWY A;  2F3Z A;  2ZRS A;  5AFP A;  4WQ3 A;  2L2E A;  2ZNE A;  1C07 A;  1YUT A;  5JOL A;  1XFW O;  1UHJ A;  2OS8 C;  2QEV A;  3Q8I A;  5GQQ C;  5HKW A;  1AJ4 A;  2JUL A;  1NIW A;  2KAY A;  2ZFD A;  3H4S E;  3F45 A;  3L47 A;  2Q4U A;  4PE0 A;  3RLZ A;  1YVL A;  1H4B A;  1B8L A;  5HL1 A;  2KNE A;  3BOW A;  1QTX A;  4U8D A;  1CLB A;  4FQT A;  2MA2 A;  1J7R A;  1ZAC A;  1S5G Z;  2LCP A;  3AAJ A;  1SBJ A;  3KHE A;  2KAX A;  2MHH A;  1TNP A; 
#chains in the Genus database with same CATH homology
 3ZWH A;  1FBV A;  1KK7 Y;  1N65 A;  1QLS A;  2EC6 C;  3JVT B;  1WRK A;  4D1E A;  2K61 A;  3K21 A;  1QVI Z;  1LA3 A;  1QV0 A;  1PSR A;  3OB1 B;  2K7D A;  1TNW A;  1K94 A;  2HPS A;  4YGD B;  1F70 A;  1IWQ A;  1WRL A;  1SL7 A;  2DOQ A;  2WCE A;  1XK4 A;  3OX6 A;  1CLM A;  5CSJ A;  3CGA A;  1M45 A;  3EKH A;  1CM1 A;  1A75 B;  2OTG B;  1CKK A;  1F4O A;  3DVJ A;  1OOJ A;  1CDL A;  1ODB A;  4WRI A;  2WC8 A;  1PSB A;  4Q04 A;  1KWO B;  1OMR A;  2JXL A;  2PAL A;  3LK0 A;  4PHJ A;  2FJU B;  5ER4 X;  2MLF C;  4NQG A;  2M1U A;  1UHI A;  1TCO B;  5HKY A;  1B1G A;  1AJ5 A;  1MQ1 A;  2RGI A;  4A4C A;  1FI6 A;  1IQ3 A;  4MBE A;  2AUC A;  1B8R A;  2I94 A;  2MJW B;  1QX2 A;  1WRZ A;  4ICB A;  1JUO A;  1Y1A A;  2AAO A;  2P6B B;  3C1V A;  1WDC B;  1NYA A;  1N2D A;  2KBM A;  4ETO A;  5KU1 A;  3LK1 A;  1DT7 B;  1SR6 B;  4PHN A;  3VRQ A;  1KK8 C;  2CT9 A;  1IG5 A;  2WCF A;  3FWB A;  1W7J B;  1QAT A;  1IKU A;  1CMG A;  2HQ8 A;  2EC6 B;  3JVT C;  3I5G B;  3VGO A;  3TDZ A;  1KFU L;  4N1F A;  3IF7 A;  1TIZ A;  2ZKM X;  4I5J A;  1K95 A;  3NSO A;  4DRW A;  1KWO C;  4CPV A;  3TS5 C;  2LLS A;  2M8U A;  1QIV A;  1UP5 A;  3AKA A;  1K93 D;  1YRU B;  2AMI A;  1K9U A;  2KOT A;  2KHN A;  1F4Q A;  2KI4 B;  1XYD A;  1Y0V H;  2LM5 A;  3DVK A;  2VRG A;  5TNC A;  1XFU O;  1XFZ O;  2FCE A;  1XFY O;  2LHI A;  2NCP A;  1XK4 C;  1X02 A;  4CLN A;  3VRP A;  3BQ3 A;  1A2X A;  2EGD A;  5HYD A;  5I2O A;  2MAZ A;  2LUC A;  5AAN A;  2BE6 A;  1AVS A;  2L98 A;  1U5I A;  3JTD C;  4JQ0 D;  2JC2 A;  3PM8 A;  5DKN A;  1BOD A;  1OE9 B;  1UUS A;  1RJV A;  1BOC A;  5HLV A;  4OCI A;  4OV2 A;  1L2O C;  1UWO A;  1SL8 A;  1OSA A;  2LAP A;  5DKQ A;  1IJ6 A;  1DGV A;  3BXK A;  1J7P A;  1SR6 C;  3I5H B;  1KSO A;  1DJI A;  3SIA A;  1SPY A;  2CTN A;  1LXF C;  3TUY C;  3JTD B;  2M7L A;  1Y1X A;  1YR5 A;  3EKJ A;  2JPT A;  2LMT A;  1AK8 A;  3LCP C;  5FYX A;  1ZMZ A;  1IRJ A;  1QV1 A;  4AQI A;  2BEC A;  5KTY A;  5I8N A;  2R2I A;  2GGZ A;  1SNL A;  4HRG A;  2F2O A;  3FWC A;  2JWW A;  2ZND A;  4YGC B;  4MLW A;  1KFX S;  2H2K A;  1EH2 A;  1KCY A;  1UHN A;  4GGN A;  3LL8 B;  1C7V A;  2E6W A;  3EVV A;  2COL B;  2BCX A;  3PSR A;  2KI4 C;  2L4H A;  1K8U A;  4ORC B;  1G33 A;  1V1F A;  3KF9 A;  2KDH A;  2KGR A;  1DTL A;  2KI6 D;  1B7T Y;  1BR4 B;  2B1U A;  2M1K B;  1CFP A;  1YTZ C;  2ZN8 A;  1TN4 A;  1D1O A;  4MRY A;  2Y1N A;  1DJY A;  1KK8 B;  2L51 A;  2OTG C;  4GUK A;  5AEQ A;  4UPG A;  1JBA A;  1JFJ A;  3D0Y B;  1PVA A;  4L9M A;  3I5G C;  1SCV A;  1TRF A;  2F2P A;  1OZS A;  1KQV A;  4GGF C;  1FW4 A;  4N1G A;  4YGE B;  5AER A;  3BUN B;  2JTZ A;  1QAS A;  2PAS A;  2L5X B;  2LNK A;  4PHM A;  1WLM A;  1UHK A;  1EL4 A;  5CSI A;  4YI9 A;  1JF2 A;  1A4P A;  2CBL A;  1DJX A;  2M0R A;  1MUX A;  3OB2 B;  3OHM B;  1XA5 A;  1PVB A;  2O5G A;  1BF5 A;  3CZT X;  1QLK A;  4XJK A;  2IS9 A;  1S36 A;  1BR1 B;  1EG3 A;  2D8N A;  1QJT A;  3VRR A;  2KQ6 A;  3PLF B;  1DMO A;  2JOJ A;  1G4Y R;  2OS8 B;  4C0K A;  3SG2 A;  4JWQ A;  3I5F C;  1BT6 A;  1DVI A;  5F6T A;  1B47 A;  1G8I A;  2CXJ A;  1TNX A;  1YUR A;  1E8A A;  4GGF A;  1MF8 B;  4GFT A;  1B8C A;  4MSP A;  4M2P A;  2ISD A;  4OR9 B;  1HT9 A;  4FTG A;  3IQQ A;  4HSZ A;  5BPJ A;  1NUB A;  3EVR A;  4GPL B;  4N5X A;  1UHH A;  4MZL A;  5DKR A;  1QX5 B;  2G9B A;  2K8M B;  2Y1M A;  3PAL A;  1TTX A;  1SKT A;  1M31 A;  1BG1 A;  1DF0 A;  1DF0 B;  3DVE A;  2JTT A;  2L0P A;  3KEV A;  2KFF A;  2CCM A;  1XO5 A;  3I5H C;  1F54 A;  1KFX L;  1NCX A;  1DJZ A;  2HET A;  3BUX B;  1KSM A;  4PDZ A;  3PN7 B;  1IJ5 A;  1F71 A;  1TCF A;  2KGB C;  3EK8 A;  1MXL C;  1YUU A;  1RFJ A;  1GJY A;  2MLE C;  1OZO A;  1SRA A;  2WOS A;  4ORB B;  1NP8 A;  4YGB B;  3SG7 A;  3GOF A;  1FPW A;  2GGM A;  1BLQ A;  3TZ1 A;  1CDP A;  3DF0 A;  5AXI A;  1CFF A;  1R6P A;  5D69 A;  2M97 A;  2EHB A;  3WHU B;  2MRD A;  2LLU A;  4PE1 A;  3I5F B;  2KQY A;  1LKJ A;  3KO0 A;  1NSH A;  3AAK A;  2JU0 A;  3E3R A;  1XFX O;  1NX1 A;  1YX8 A;  2LVV A;  1ALW A;  1S6C A;  1IGV A;  4MZJ A;  4C0J A;  1REC A;  1DGU A;  5ER5 A;  4YRU A;  1BJF A;  2LP2 A;  2QAC A;  4NDC A;  4R1E A;  3TDU A;  4DS7 A;  1CDM A;  3EK4 A;  3CR4 X;  2K7C A;  2Q91 A;  3BUW B;  2KFG A;  4I5L B;  1QIW A;  2I7A A;  2JNF A;  2M49 B;  1LIN A;  2Y4Q A;  4DIR A;  4MVF A;  2L50 A;  2ZRT A;  2KBI A;  4AOM A;  4BY5 A;  4M2Q A;  4GNK B;  2MBX A;  1M46 A;  4QJ4 B;  2NZ0 A;  1AHR A;  2M7N A;  2H61 A;  1K90 D;  2LHL A;  2BCA A;  1WDC C;  3NSI A;  3ZNI A;  4YGA A;  3SIB A;  5IBW A;  1MHO A;  2K2F A;  2KYC A;  4PCW A;  3WNX B;  2LLT A;  4XYN A;  4GBA A;  3AKB A;  5HKZ A;  4I5N B;  4NDB A;  3A4U B;  2K7B A;  3EVU A;  3OP0 A;  2PRU A;  1QXP A;  4A4B A;  2SAS A;  2K0J A;  4OVN F;  1Y1U A;  1S6J A;  1ALV A;  2WCB A;  1J7Q A;  4WQ2 A;  1HQV A;  1KK7 Z;  1ZFS A;  1K9P A;  1QVI Y;  4JPZ B;  1CFD A;  2L4I A;  4MRX A;  4I5K A;  2LVI A;  3DD4 A;  3GK2 A;  3CR5 X;  2NXQ A;  1DJG A;  1CB1 A;  2SCP A;  3SG6 A;  4DUQ A;  1H8B A;  1F55 A;  2M29 A;  1K96 A;  3LLE A;  1OMD A;  1SY9 A;  3DF0 B;  1JF0 A;  3SG4 A;  3M0W A;  4ZCU A;  2F3Y A;  3NSL A;  1DJH A;  1YRT B;  2O60 A;  5J3X A;  1JWD A;  1FI5 A;  2I18 A;  3NXA A;  1GGW A;  2JT8 A;  1PK0 D;  1R2U A;  1L7Z A;  1SW8 A;  4FQO A;  2WOR A;  1SK6 D;  3CR2 A;  3RM1 A;  4PE4 A;  4BY4 A;  1SCM B;  4ZCV A;  3TDI A;  1PRW A;  1FF1 A;  2Y5I A;  5KSZ A;  1GQM A;  1A75 A;  1U5I B;  2LMU A;  3DVM A;  3O2P A;  2M3W A;  5G08 A;  1CMF A;  1KQM C;  4OKH A;  1A29 A;  1MXE A;  2H61 C;  2HF5 A;  2JT3 A;  1B7T Z;  2KI6 C;  1B4C A;  1LA0 A;  1M63 B;  3A8R A;  1K2H A;  2BBM A;  3FS7 A;  2JZI A;  4TNC A;  3D10 A;  4MEW A;  1IQ5 A;  1TOP A;  1NX0 A;  2KSP A;  4MN0 A;  1AUI B;  3NSK A;  3TS5 B;  3SG3 A;  2OPO A;  3WXA A;  3GK1 A;  3GK4 X;  3QRX A;  3BUO B;  1F8H A;  4C0L A;  5CSN A;  1KQM B;  1EJ3 A;  4P2Y B;  1CDN A;  2PVB A;  4HRE E;  1EXR A;  1GGZ A;  3BOW B;  1TNQ A;  1OMV A;  2E30 A;  4NDD A;  1SCM C;  4QJ3 B;  4PAL A;  1CM4 A;  1CNP A;  3CS1 A;  1J1D A;  2LUX A;  2LP3 A;  1QS7 A;  1RK9 A;  2F33 A;  3WHT B;  1SMG A;  3CTN A;  1W7I B;  1PAL A;  2NCO A;  4GAO A;  1S6I A;  4M2O A;  3PFV A;  1CFC A;  1IH0 A;  4CID A;  3KPX A;  2NLN A;  1DJW A;  3HCM A;  4E68 A;  1OQP A;  1XFV O;  2LVK A;  3CLN A;  1K9K A;  4ORA B;  2WND A;  4IL1 A;  3I5I B;  1J7O A;  2LC5 A;  1N0Y A;  1WY9 A;  4P5O E;  1JFK A;  1ZUZ A;  2BBN A;  1V1G A;  1NX3 A;  2LMV A;  3O4Y A;  3O78 A;  1SL9 A;  5JOL A;  3SJS A;  1B9A A;  3IQO A;  3BUM B;  4USL A;  4CFR A;  4XJK B;  2BL0 C;  2BE4 A;  3SG5 A;  1C7W A;  1A03 A;  2BCB A;  2LAN A;  1MR8 A;  1S3P A;  4CFQ A;  1RRO A;  1KFU S;  1CLL A;  1M39 A;  5B8I B;  2JRF A;  3CWG A;  1PUL A;  1NX2 A;  1XVJ A;  2LV7 A;  2PMY A;  4HRH A;  4AQJ A;  2HQW A;  5D7F A;  2QPT A;  1JC2 A;  3HX4 A;  4PHK A;  5JJG A;  2V53 A;  2I2R E;  1BU3 A;  1S1E A;  1Q80 A;  3PN7 C;  1SYM A;  3D0Y A;  5HLO A;  1AP4 A;  3ICB A;  1J1E A;  5PAL A;  1J55 A;  2KYF A;  4DCK A;  1BMO A;  1WLZ A;  2ZN9 A;  1Y6W A;  4QJ5 B;  3BYA A;  3TUY B;  1VRK A;  4YI8 A;  5I2L A;  1LVC D;  1ZOT B;  3EK7 A;  1S5G Y;  2JQ6 A;  5I2Q A;  1EG4 A;  1JSA A;  2KAV A;  1YX7 A;  2GV5 A;  3VRO A;  1RTP 1;  3VRN A;  5K89 A;  2TN4 A;  2K7O A;  3OX5 A;  1L2O B;  2K2A A;  2FOT A;  2BKI B;  1CTR A;  2F8P A;  2JXC A;  1NWD A;  1QX7 A;  1UUR A;  3O6B A;  4PE7 A;  1S26 D;  4F0Z B;  3FIA A;  2FCD A;  5CSF A;  1NPQ A;  2BL0 B;  1NCY A;  2M9G A;  4YBH B;  1NCZ A;  3MSE B;  5CPV A;  2G2B A;  1MWN A;  1YVH A;  1YUS A;  2BKH B;  2LE9 B;  2JT0 A;  3I5I C;  2KFH A;  2A4J A;  2LVJ A;  4MZK A;  2JNX A;  2CNP A;  2PSR A;  3PAT A;  1RWY A;  2F3Z A;  2ZRS A;  5AFP A;  4WQ3 A;  2L2E A;  2ZNE A;  1C07 A;  1YUT A;  1XFW O;  1UHJ A;  2OS8 C;  5GQQ C;  5HKW A;  1AJ4 A;  2JUL A;  1NIW A;  2KAY A;  2ZFD A;  3H4S E;  3F45 A;  3RLZ A;  2Q4U A;  4PE0 A;  1H4B A;  1YVL A;  1B8L A;  2KNE A;  3BOW A;  1QTX A;  4U8D A;  1CLB A;  2MA2 A;  1J7R A;  1ZAC A;  1S5G Z;  2LCP A;  3AAJ A;  1SBJ A;  3KHE A;  2KAX A;  2MHH A;  1TNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...