1ZOTB

Crystal structure analysis of the cyaa/c-cam with pmeapp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CyaA with C-terminal Calmodulin
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin.
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Lyase
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zotB00
2H2KA 3PSRA 4YGCB 3EK4A 2F3ZA 2F3YA 2L4HA 2LCPA 2LHLA 4OVNF 5CSIA 1JUOA 1E8AA 1SL8A 1OSAA 2MA2A 3I5HC 5J3XA 1F71A 2JOJA 4L9MA 2I18A 3HX4A 4Q04A 1ODBA 1WY9A 3MSEB 1EG3A 3VRQA 1WLZA 4YGBB 5TNCA 4YBHB 1UUSA 2KAYA 1CLBA 1K90D 4OR9B 1NX2A 2MBXA 1L2OC 1S6IA 2BE4A 3VRNA 2ZNEA 4OCIA 4PDZA 2QPTA 3EVUA 4I5KA 1MXEA 4MZKA 1KFUS 1W7IB 2LAPA 1J7OA 1PSRA 1AJ5A 1B8LA 3LLEA 2L4IA 1TN4A 2LUCA 2PALA 3NSIA 1S5GY 5D69A 1QASA 3TDZA 2CNPA 1K2HA 3TDUA 4PHKA 1IJ6A 4R1EA 2JU0A 1AVSA 4CPVA 2LC5A 1ALWA 4GPLB 1U5IB 3WNXB 1JFKA 3O6BA 1WRZA 1OZOA 5CSFA 3SG2A 1ALVA 2F2PA 3CR4X 3DVJA 2KI6C 3O4YA 1CTRA 2EHBA 1SY9A 3JTDB 4WQ3A 2JXLA 2DOQA 2L0PA 1J7QA 3NSLA 5HKWA 5HLVA 1FI5A 1SYMA 2D8NA 3EVRA 2ZN8A 4I5NB 1CFDA 3DF0B 3EK7A 4XJKB 4DS7A 4YRUA 2HQWA 1ZACA 1KK8C 1JWDA 1KFXL 3EKJA 3LCPC 1BLQA 1Y1XA 1CNPA 3LK0A 3OB2B 4MLWA 1RECA 1QTXA 1RJVA 2KBMA 3KF9A 2B1UA 3LL8B 2LM5A 1LXFC 2NCPA 4YGAA 1XFUO 2GV5A 2JT0A 1BG1A 2QACA 1QX5B 2M29A 1K94A 2KOTA 1A75B 3PALA 1K93D 3FIAA 4HRHA 2O5GA 1KK7Y 2H61A 4I5JA 4DCKA 3I5FC 3H4SE 3PATA 1DJZA 2WCFA 2WCBA 3DVKA 3BXKA 3WHTB 1KQVA 1NX1A 1KQMB 1B9AA 2I94A 2JRFA 1NWDA 3M0WA 2WOSA 1IWQA 1DMOA 1CFCA 4MSPA 2OS8B 5HKZA 1LINA 4NQGA 1OOJA 2KFFA 2LLSA 1DJXA 3AKBA 4JQ0D 3VRRA 1OE9B 2F8PA 4CLNA 4DIRA 1NPQA 1Y0VH 3ICBA 4E68A 1XK4A 2HPSA 1NCYA 2Y4QA 3CR5X 3LK1A 1CM4A 2HETA 1V1GA 1K8UA 2LHIA 2OTGC 5PALA 3OX6A 1WRLA 1YR5A 1YUUA 4DUQA 5B8IB 1KSOA 2LMUA 2ZKMX 4ETOA 4HRGA 1KWOC 1CLLA 1XFZO 1GJYA 4MZLA 4A4CA 4AQJA 1H8BA 2KSPA 1SMGA 1BJFA 1SPYA 3CWGA 1GGZA 2ZRTA 1J55A 1DF0B 2P6BB 4M2OA 4ORBB 1PRWA 4CFRA 2NCOA 3ZNIA 1Y6WA 3TUYB 1N0YA 2WC8A 3AAJA 2KGRA 1PSBA 1CLMA 1QIVA 1KFUL 3JVTC 4MEWA 4WQ2A 2M7LA 4UPGA 1KCYA 4FQOA 2H61C 1K9KA 2M1KB 2GGZA 2BL0B 4N1FA 2LANA 4ORCB 5HYDA 4M2PA 3O2PA 2LV7A 2MLFC 4MBEA 3SIAA 1AP4A 1ZFSA 3BUNB 2FJUB 4YGEB 1LA0A 1UWOA 1J1EA 2K7BA 5I2LA 2EC6B 2OPOA 3GK1A 1AJ4A 1RROA 1TIZA 2Q4UA 1CMGA 4MN0A 1K95A 3SIBA 2CT9A 1B8RA 1WLMA 3D0YB 1S6JA 2HQ8A 1XK4C 2LVKA 1K9PA 1SL7A 2KYCA 1VRKA 3A8RA 4BY4A 2HF5A 3CGAA 3CZTX 2JC2A 1TNXA 1N65A 3C1VA 1F70A 1G4YR 1DJGA 1L7ZA 2I7AA 3TZ1A 1W7JB 1SBJA 1TNQA 2MAZA 2JQ6A 1S26D 4FTGA 1F4OA 3GK4X 4PE0A 3QRXA 1UP5A 3WHUB 3BUXB 2G9BA 2KHNA 1SCMB 2M3WA 1K96A 2K8MB 1R6PA 2NLNA 3FS7A 3RM1A 2E6WA 3OB1B 1J7RA 4YI8A 2KI4B 3TS5B 1OZSA 2K0JA 3OX5A 2SCPA 3JTDC 1A4PA 1IQ5A 3VROA 3OHMB 1DVIA 1QX2A 2JXCA 1YRTB 1TTXA 2E30A 1IKUA 1M45A 1QV0A 1BR4B 1RFJA 2LMTA 1G33A 3BOWB 3RLZA 3FWBA 3EKHA 5I2QA 1NCZA 1MR8A 2JTZA 2IS9A 4QJ5B 1QLSA 1B7TZ 2L5XB 1C07A 5AANA 4MRYA 4PHMA 1C7WA 1MWNA 1CDPA 1KSMA 2I2RE 2VRGA 2LLUA 2CXJA 1IH0A 3VRPA 2MHHA 1OMVA 4PHJA 1NCXA 2ZFDA 2BCXA 3BQ3A 1IJ5A 3I5GB 1B1GA 1FF1A 2PRUA 1LVCD 3BUOB 1KQMC 1JFJA 2AAOA 3EVVA 3EK8A 3OP0A 1Q80A 5ER5A 1EH2A 1FW4A 5HLOA 3K21A 4NDBA 3SG3A 1JSAA 5KSZA 3O78A 4CFQA 4I5LB 2OS8C 5GQQC 1S3PA 1DJHA 2LVVA 1EXRA 1CDLA 1YURA 3CR2A 1IRJA 1OMRA 1YRUB 2KNEA 4JPZB 2CCMA 4PALA 2JPTA 1N2DA 1TCOB 5KU1A 3D0YA 3NXAA 1MUXA 5ER4X 2WORA 1JF0A 4DRWA 2BKHB 1UHNA 5D7FA 3SG5A 5I2OA 1LA3A 2COLB 4PCWA 1QS7A 4GGFC 2M97A 4BY5A 3SJSA 1F54A 2WCEA 2BE6A 1TNWA 2JT3A 2K7CA 1X02A 1Y1AA 4ORAB 5AERA 1M39A 1YUTA 2TN4A 1CKKA 1ZOTB 2ZRSA 3D10A 1D1OA 4ICBA 1SKTA 1GQMA 2LE9B 5CSJA 3SG6A 5HKYA 1R2UA 2KI6D 1EJ3A 1IG5A 1YVLA 2JTTA 3GOFA 1JBAA 4IL1A 5AXIA 1YUSA 4F0ZB 1J7PA 2LLTA 3TUYC 3I5IB 4HREE 5G08A 1U5IA 2KDHA 2Y5IA 4PHNA 4AOMA 1AUIB 1JC2A 3FWCA 1FI6A 4AQIA 3BUWB 1A29A 2BL0C 4D1EA 2BBNA 1SW8A 2M49B 4NDCA 5AFPA 3KO0A 2A4JA 2M7NA 2LUXA 4MZJA 2EC6C 4USLA 1DT7B 2SASA 4C0LA 4A4BA 1SRAA 1K9UA 3DF0A 4XJKA 4ZCUA 3WXAA 4C0KA 1UHHA 1YX8A 1SR6B 4GNKB 2Y1MA 1S36A 2M0RA 4JWQA 1SK6D 2GGMA 2MJWB 1F8HA 1XFXO 1PVBA 1NX0A 1G8IA 1RWYA 5DKRA 1CFPA 1CB1A 1BMOA 2K61A 1PK0D 1NYAA 2JT8A 1CM1A 1B8CA 1MQ1A 1WDCB 3DVEA 1A75A 2FOTA 2MRDA 3PN7B 1M31A 1EL4A 1F55A 1QVIZ 4P2YB 4M2QA 1SCMC 1QIWA 2BECA 1NUBA 1QXPA 4N1GA 5F6TA 1BF5A 4PE7A 1CFFA 2NXQA 2KI4C 1B7TY 1BR1B 1UURA 3TS5C 2EGDA 4QJ3B 2FCDA 1IQ3A 2LVJA 1NP8A 2KYFA 4XYNA 1YTZC 2LNKA 1BODA 1MHOA 2KFHA 1RK9A 1SNLA 3I5HB 1UHIA 5AEQA 1NSHA 2PASA 3PLFB 3VGOA 5K89A 1B47A 1DJYA 2WNDA 4ZCVA 3TDIA 1XYDA 1XO5A 4P5OE 5FYXA 1YVHA 1DJIA 2V53A 4U8DA 2BBMA 2L51A 2ZN9A 4GGFA 3DD4A 1ZUZA 1ZMZA 1QLKA 4GGNA 1L2OB 1QATA 1M63B 1JF2A 5DKNA 1B4CA 2NZ0A 1TOPA 2Y1NA 3CS1A 3E3RA 2M9GA 1DGUA 1PULA 1XFYO 3PFVA 5I8NA 2CBLA 1RTP1 1FPWA 2ISDA 1PALA 1QX7A 1HQVA 1DF0A 2M8UA 4MVFA 1MF8B 4OV2A 1SCVA 2LVIA 3I5GC 1A03A 2L50A 3SG4A 5CPVA 1M46A 1GGWA 1XFVO 2G2BA 4PE4A 3IQQA 2LMVA 2O60A 2PSRA 5JOLA 2AMIA 1QJTA 1TRFA 3DVMA 1QV1A 3IQOA 1S6CA 2BKIB 1LKJA 3A4UB 3IF7A 4OKHA 2MLEC 4TNCA 1CDMA 2KQYA 1KK8B 1MXLC 5CSNA 4MRXA 2M1UA 1DJWA 4GAOA 1S5GZ 5KTYA 2KFGA 1NX3A 2LP3A 3KPXA 1A2XA 2KQ6A 2JULA 1HT9A 2LP2A 3BUMB 1PVAA 2L2EA 3F45A 1WRKA 2K2FA 1SL9A 1IGVA 1EG4A 3KEVA 3BYAA 5IBWA 1S1EA 4GUKA 1XA5A 1XFWO 4PE1A 4YGDB 3I5IC 3I5FB 1FBVA 2FCEA 4N5XA 3ZWHA 1F4QA 3CLNA 4GFTA 2RGIA 5JJGA 1CMFA 1Y1UA 2PVBA 2KAXA 1C7VA 4HSZA 1KFXS 1BT6A 1TNPA 1QVIY 3NSOA 1CDNA 1UHKA 2JZIA 2JNXA 1TCFA 2BCAA 4CIDA 2PMYA 3AKAA 1SR6C 2K2AA 3HCMA 3NSKA 4QJ4B 3KHEA 1BU3A 2CTNA 2K7OA 2JNFA 3BOWA 2K7DA 1KK7Z 3SG7A 4C0JA 2OTGB 1J1DA 3AAKA 1BOCA 4WRIA 2AUCA 5DKQA 1YX7A 2R2IA 5BPJA 1OMDA 1WDCC 4GBAA 1KWOB 2F2OA 3CTNA 4YI9A 2KGBC 1NIWA 3PN7C 4NDDA 1OQPA 1V1FA 2F33A 1AK8A 1XVJA 1DGVA 1UHJA 2KAVA 2Q91A 2KBIA 1AHRA 1DTLA 3PM8A 2BCBA 3JVTB 2JWWA 2ZNDA 3GK2A 2L98A 1H4BA
chains in the Genus database with same CATH superfamily
1TWOA 2H2KA 1W9ZA 3PSRA 4YGCB 3EK4A 2F3ZA 2F3YA 2L4HA 3BJHA 2LCPA 2LHLA 4OVNF 5CSIA 1JUOA 1E8AA 1SL8A 1OSAA 2MA2A 3I5HC 5J3XA 1F71A 2JOJA 4L9MA 3BFBA 2I18A 3HX4A 4Q04A 1OOGA 1ODBA 1WY9A 3MSEB 1EG3A 3VRQA 1WLZA 4YGBB 5TNCA 4YBHB 1UUSA 1TUJA 2KAYA 1CLBA 1K90D 4OR9B 1NX2A 3B88A 2MBXA 2YGUA 1L2OC 1S6IA 2BE4A 2QEHA 3VRNA 2ZNEA 4OCIA 3S0EA 4PDZA 2QPTA 3EVUA 4I5KA 1MXEA 4MZKA 3UNWA 1KFUS 1W7IB 2LAPA 3SS4A 1PSRA 1AJ5A 1B8LA 2WCLA 1J7OA 3LLEA 2L4IA 1TN4A 2LUCA 2PALA 2PYQA 3NSIA 1S5GY 5D69A 1QASA 3TDZA 2CNPA 1K2HA 3TDUA 4PHKA 1IJ6A 4R1EA 2JU0A 1AVSA 4CPVA 2LC5A 1ALWA 4GPLB 1U5IB 3WNXB 1JFKA 3O6BA 1WRZA 1OZOA 5CSFA 3SG2A 1ALVA 2F2PA 3CR4X 3DVJA 2KI6C 3O4YA 1CTRA 2EHBA 3UO9A 1SY9A 3JTDB 4WQ3A 4JKTA 1IIOA 2JXLA 2DOQA 2L0PA 1J7QA 3NSLA 3D74A 5D3OA 5HKWA 5HLVA 1FI5A 1SYMA 2D8NA 3EVRA 2ZN8A 4I5NB 1CFDA 3DF0B 3EK7A 4XJKB 3R72A 4DS7A 2HQWA 4YRUA 1ZACA 1KK8C 1JWDA 1KFXL 4JD9A 3EKJA 3LCPC 1BLQA 1Y1XA 3FE8A 3LK0A 3OB2B 4MLWA 1RECA 1CNPA 1QTXA 1RJVA 2KBMA 1QWVA 3KF9A 5FI2A 2B1UA 3LL8B 2FJYA 2LM5A 1LXFC 2NCPA 4YGAA 1XFUO 2GV5A 2JT0A 1BG1A 2QACA 1QX5B 3PM2A 2M29A 1K94A 2KOTA 1A75B 3PALA 3B7AA 1K93D 3FIAA 4HRHA 2O5GA 1KK7Y 2H61A 4I5JA 4DCKA 3I5FC 3H4SE 2H8VA 1DJZA 2WCFA 3PATA 2WCBA 3D77A 3DVKA 3BXKA 3WHTB 1KQVA 1NX1A 1DC1A 1KQMB 1B9AA 2I94A 2JRFA 2QEBA 3D78A 1NWDA 3M0WA 2WOSA 1IWQA 1DMOA 1CFCA 4MSPA 2OS8B 5HKZA 1LINA 4NQGA 1OOJA 2KFFA 2LLSA 1DJXA 3AKBA 4JQ0D 1DEKA 3S0DA 3VRRA 1OE9B 2F8PA 4CLNA 4DIRA 1NPQA 1Y0VH 3ICBA 4E68A 1XK4A 2HPSA 1NCYA 2Y4QA 2GTEA 3CR5X 3LK1A 1CM4A 2HETA 1V1GA 1K8UA 5DICA 2LHIA 2OTGC 5PALA 3OX6A 1WRLA 1YR5A 1YUUA 4DUQA 5B8IB 1KSOA 2LMUA 2ZKMX 4ETOA 1C3ZA 4HRGA 4OZDA 1KWOC 1CLLA 1XFZO 1GJYA 4MZLA 4A4CA 4AQJA 1H8BA 2KSPA 3Q8IA 1SMGA 1BJFA 1SPYA 3CWGA 1GGZA 2ZRTA 1J55A 1DF0B 2P6BB 4M2OA 4ORBB 1PRWA 4CFRA 2NCOA 3ZNIA 1Y6WA 3TUYB 1N0YA 2WC8A 3AAJA 2KGRA 1PSBA 1CLMA 1QIVA 1KFUL 3JVTC 4MEWA 4WQ2A 2M7LA 4UPGA 1KCYA 4FQOA 2H61C 2QEVA 1K9KA 2M1KB 4INWA 2GGZA 2BL0B 4N1FA 3D75A 2LANA 4ORCB 4FQTA 5HYDA 4M2PA 3O2PA 2LV7A 2MLFC 4MBEA 3SIAA 1AP4A 1ZFSA 3BUNB 2FJUB 4YGEB 1LA0A 1UWOA 1J1EA 2K7BA 5I2LA 2EC6B 2OPOA 3GK1A 2WCMA 1AJ4A 1RROA 1TIZA 2Q4UA 1CMGA 3L47A 1K95A 2P71A 4MN0A 3SIBA 2CT9A 1B8RA 1WLMA 3D0YB 1S6JA 2HQ8A 1XK4C 2LVKA 1K9PA 1SL7A 2KYCA 1VRKA 3A8RA 4KYNA 3NGVA 4BY4A 2HF5A 3CGAA 3B87A 3CZTX 2JC2A 1TNXA 1N65A 3C1VA 1F70A 3DY9A 1G4YR 1DJGA 1L7ZA 2I7AA 3TZ1A 1W7JB 1SBJA 1TNQA 2MAZA 2JQ6A 1S26D 4FTGA 1F4OA 3GK4X 3QMEA 3BFAA 1UP5A 3QRXA 4PE0A 3WHUB 3BUXB 2G9BA 2KHNA 1SCMB 2M3WA 1K96A 2K8MB 1R6PA 2NLNA 3FS7A 2WCJA 3RM1A 2E6WA 3OB1B 1J7RA 4YI8A 2KI4B 3TS5B 1OZSA 2K0JA 3OX5A 2SCPA 3FE6A 3JTDC 1A4PA 2ERBA 1IQ5A 3CZ1A 3VROA 3OHMB 1DVIA 3S0GA 1QX2A 2JXCA 1YRTB 1SSEB 1TTXA 2E30A 3CZ2A 1IKUA 1M45A 1QV0A 1BR4B 2L5YA 1RFJA 2LMTA 1G33A 3BOWB 3RLZA 3FWBA 3EKHA 5I2QA 1NCZA 1FF1A 1MR8A 2PQLA 2JTZA 3N7HA 2IS9A 4QJ5B 1QLSA 3DZTA 1B7TZ 2L5XB 1C07A 5AANA 4F7FA 4MRYA 4PHMA 1C7WA 1MWNA 1CDPA 1KSMA 2I2RE 2VRGA 5FI6A 1GM0A 2LLUA 2CXJA 1IH0A 3VRPA 2MHHA 3FE9A 1OMVA 4PHJA 1NCXA 2ZFDA 2BCXA 3BQ3A 1IJ5A 3I5GB 1B1GA 3D76A 2PRUA 1LVCD 3BUOB 1KQMC 1JFJA 2AAOA 3EVVA 3EK8A 3OP0A 1Q80A 5ER5A 1EH2A 1FW4A 5HLOA 3K21A 4NDBA 3SG3A 1JSAA 5KSZA 3O78A 4CFQA 4I5LB 2OS8C 5GQQC 1S3PA 1DJHA 2LVVA 1EXRA 1CDLA 1YURA 5I94A 3CR2A 1IRJA 1OMRA 1YRUB 2KNEA 4JPZB 2CCMA 4PALA 2JPTA 1N2DA 1TCOB 5KU1A 3D0YA 3NXAA 1MUXA 5EL2A 5ER4X 2WORA 1JF0A 4DRWA 2BKHB 1UHNA 5D7FA 3SG5A 5I2OA 1LA3A 2COLB 4PCWA 1QS7A 4GGFC 2M97A 4BY5A 3SJSA 1F54A 2WCEA 2BE6A 1TNWA 2JT3A 2K7CA 1X02A 1DQEA 3RZSA 1Y1AA 4ORAB 5AERA 1M39A 1YUTA 2TN4A 1CKKA 1ZOTB 5FI7A 2ZRSA 3DXLA 3D10A 3V2LA 4ICBA 1SKTA 1TUZA 1D1OA 1GQMA 2LE9B 5CSJA 3SG6A 5HKYA 1R2UA 2QDIA 3S0FA 2KI6D 1EJ3A 1IG5A 1YVLA 2JTTA 3GOFA 1JBAA 4IL1A 5AXIA 1YUSA 4F0ZB 1J7PA 2LLTA 3TUYC 3I5IB 4HREE 5G08A 1U5IA 2KDHA 2Y5IA 3OBVA 4PHNA 3B86A 4AOMA 1AUIB 1JC2A 3FWCA 1FI6A 4AQIA 3BUWB 1A29A 3R1PA 2BL0C 3S0AA 4D1EA 2BBNA 1SW8A 2M49B 4NDCA 5AFPA 3KO0A 2A4JA 2M7NA 2LUXA 4MZJA 2EC6C 4USLA 1DT7B 2SASA 4C0LA 4A4BA 1SRAA 1K9UA 3DF0A 4XJKA 4ZCUA 3WXAA 3CDNA 4C0KA 1UHHA 1YX8A 3VB1A 1SR6B 5HL1A 4GNKB 2Y1MA 1S36A 2M0RA 4JWQA 1SK6D 2GGMA 2MJWB 1F8HA 1XFXO 1Z4HA 1PVBA 1NX0A 1G8IA 1RWYA 5DKRA 1LS8A 1CFPA 1CB1A 1BMOA 3S0BA 2K61A 1PK0D 1NYAA 2JT8A 1CM1A 1B8CA 1MQ1A 1WDCB 3DVEA 1A75A 2FOTA 2MRDA 3PN7B 1OOIX 1M31A 1EL4A 1F55A 1QVIZ 4P2YB 2L2CA 4M2QA 1SCMC 1QIWA 2BECA 1NUBA 1QXPA 4N1GA 5F6TA 1BF5A 4PE7A 1CFFA 2NXQA 2KI4C 1B7TY 1BR1B 1UURA 3TS5C 1OW4A 2EGDA 3PJIA 4QJ3B 2FCDA 3K1EA 1IQ3A 2LVJA 1NP8A 2KYFA 4XYNA 1YTZC 2LNKA 1BODA 1MHOA 2KFHA 1RK9A 1SNLA 3I5HB 1UHIA 5AEQA 1NSHA 2K60A 2PASA 3PLFB 3VGOA 5K89A 1B47A 1DJYA 2WNDA 2QEOA 4ZCVA 3TDIA 1XYDA 1XO5A 3BFHA 4P5OE 5FYXA 1YVHA 1DJIA 2V53A 4U8DA 2BBMA 2L51A 2ZN9A 4GGFA 3DD4A 1ZUZA 1ZMZA 1QLKA 4GGNA 1L2OB 1QATA 3SS3A 1M63B 1JF2A 5DKNA 1B4CA 2NZ0A 1TOPA 2Y1NA 3CS1A 3E3RA 2M9GA 1DGUA 3EG5B 1PULA 1XFYO 3PFVA 5I8NA 1OOHA 1RTP1 2CBLA 2P70A 1FPWA 2ISDA 1PALA 3L4AA 1QX7A 1HQVA 1DF0A 3O4XA 2M8UA 4MVFA 1MF8B 3R1VA 1DELA 1SCVA 2LVIA 3I5GC 4OV2A 1A03A 2L50A 3SG4A 5CPVA 1M46A 2KPHA 1XFVO 1GGWA 2G2BA 4PE4A 3IQQA 2LMVA 2O60A 2PSRA 5JOLA 2AMIA 1QJTA 1TRFA 3DVMA 3R1OA 1QV1A 4PT1A 2WC6A 3IQOA 1S6CA 2BKIB 1LKJA 3A4UB 1P28A 3IF7A 2MLEC 3NHTA 4OKHA 4TNCA 1CDMA 2KQYA 1KK8B 1MXLC 5CSNA 4MRXA 4INXA 2M1UA 1DJWA 3OGNA 2BAPA 4GAOA 1S5GZ 3DYEA 5KTYA 2KFGA 1NX3A 2LP3A 3KPXA 1A2XA 2JPOA 2KQ6A 2JULA 3CZ0A 1HT9A 2LP2A 3BUMB 1PVAA 2L2EA 3F45A 1WRKA 2K2FA 1SL9A 1IGVA 1EG4A 1Z2CB 3KEVA 3BYAA 4IJ7A 5IBWA 1S1EA 1ORGA 4GUKA 1XA5A 3CABA 1XFRA 1XFWO 4PE1A 3D73A 4YGDB 3I5IC 3I5FB 1FBVA 2FCEA 4N5XA 3ZWHA 1F4QA 3CLNA 4GFTA 2RGIA 5JJGA 1OOFA 2WC5A 1CMFA 1Y1UA 2WCKA 2PVBA 2KAXA 1C7VA 4HSZA 1KFXS 1BT6A 2KLDA 1T14A 1TNPA 3L4LA 1QVIY 3NSOA 1CDNA 1UHKA 2KLEA 2JZIA 2JNXA 1TCFA 2BCAA 4CIDA 3CYZA 2PMYA 3AKAA 1SR6C 2K2AA 3IVTA 3HCMA 3NSKA 4QJ4B 3KHEA 1BU3A 2CTNA 2K7OA 2JNFA 3BOWA 2K7DA 1KK7Z 3SG7A 4C0JA 2OTGB 1J1DA 2WCHA 3AAKA 1BOCA 4WRIA 3NHIA 2AUCA 5DKQA 1YX7A 2R2IA 5BPJA 1C3YA 1OMDA 1WDCC 4GBAA 1KWOB 2F2OA 3CTNA 2BNXA 4YI9A 2KGBC 1NIWA 3PN7C 4NDDA 1OQPA 3SS5A 1V1FA 2F33A 1AK8A 1XVJA 1DGVA 1UHJA 2KAVA 2Q91A 2KBIA 1AHRA 1DTLA 3PM8A 2BCBA 3JVTB 2JWWA 2ZNDA 3B6XA 3GK2A 2L98A 1H4BA
chains in the Genus database with same CATH topology
2H2KA 3PSRA 4YGCB 3EK4A 2F3ZA 2F3YA 2L4HA 2LCPA 2LHLA 4OVNF 5CSIA 1JUOA 1E8AA 1SL8A 1OSAA 2MA2A 3I5HC 5J3XA 1F71A 2JOJA 4L9MA 2I18A 3HX4A 4Q04A 1ODBA 1WY9A 3MSEB 1EG3A 3VRQA 1WLZA 4YGBB 5TNCA 4YBHB 1UUSA 2KAYA 1CLBA 1K90D 4OR9B 1NX2A 2MBXA 1L2OC 1S6IA 2BE4A 3VRNA 2ZNEA 4OCIA 4PDZA 2QPTA 3EVUA 4I5KA 1MXEA 4MZKA 1KFUS 1W7IB 2LAPA 1J7OA 1PSRA 1AJ5A 1B8LA 3LLEA 2L4IA 1TN4A 2LUCA 2PALA 3NSIA 1S5GY 5D69A 1QASA 3TDZA 2CNPA 1K2HA 3TDUA 4PHKA 1IJ6A 4R1EA 2JU0A 1AVSA 4CPVA 2LC5A 1ALWA 4GPLB 1U5IB 3WNXB 1JFKA 3O6BA 1WRZA 1OZOA 5CSFA 3SG2A 1ALVA 2F2PA 3CR4X 3DVJA 2KI6C 3O4YA 1CTRA 2EHBA 1SY9A 3JTDB 4WQ3A 2JXLA 2DOQA 2L0PA 1J7QA 3NSLA 5HKWA 5HLVA 1FI5A 1SYMA 2D8NA 3EVRA 2ZN8A 4I5NB 1CFDA 3DF0B 3EK7A 4XJKB 4DS7A 4YRUA 2HQWA 1ZACA 1KK8C 1JWDA 1KFXL 3EKJA 3LCPC 1BLQA 1Y1XA 1CNPA 3LK0A 3OB2B 4MLWA 1RECA 1QTXA 1RJVA 2KBMA 3KF9A 2B1UA 3LL8B 2LM5A 1LXFC 2NCPA 4YGAA 1XFUO 2GV5A 2JT0A 1BG1A 2QACA 1QX5B 2M29A 1K94A 2KOTA 1A75B 3PALA 1K93D 3FIAA 4HRHA 2O5GA 1KK7Y 2H61A 4I5JA 4DCKA 3I5FC 3H4SE 3PATA 1DJZA 2WCFA 2WCBA 3DVKA 3BXKA 3WHTB 1KQVA 1NX1A 1KQMB 1B9AA 2I94A 2JRFA 1NWDA 3M0WA 2WOSA 1IWQA 1DMOA 1CFCA 4MSPA 2OS8B 5HKZA 1LINA 4NQGA 1OOJA 2KFFA 2LLSA 1DJXA 3AKBA 4JQ0D 3VRRA 1OE9B 2F8PA 4CLNA 4DIRA 1NPQA 1Y0VH 3ICBA 4E68A 1XK4A 2HPSA 1NCYA 2Y4QA 3CR5X 3LK1A 1CM4A 2HETA 1V1GA 1K8UA 2LHIA 2OTGC 5PALA 3OX6A 1WRLA 1YR5A 1YUUA 4DUQA 5B8IB 1KSOA 2LMUA 2ZKMX 4ETOA 4HRGA 1KWOC 1CLLA 1XFZO 1GJYA 4MZLA 4A4CA 4AQJA 1H8BA 2KSPA 1SMGA 1BJFA 1SPYA 3CWGA 1GGZA 2ZRTA 1J55A 1DF0B 2P6BB 4M2OA 4ORBB 1PRWA 4CFRA 2NCOA 3ZNIA 1Y6WA 3TUYB 1N0YA 2WC8A 3AAJA 2KGRA 1PSBA 1CLMA 1QIVA 1KFUL 3JVTC 4MEWA 4WQ2A 2M7LA 4UPGA 1KCYA 4FQOA 2H61C 1K9KA 2M1KB 2GGZA 2BL0B 4N1FA 2LANA 4ORCB 5HYDA 4M2PA 3O2PA 2LV7A 2MLFC 4MBEA 3SIAA 1AP4A 1ZFSA 3BUNB 2FJUB 4YGEB 1LA0A 1UWOA 1J1EA 2K7BA 5I2LA 2EC6B 2OPOA 3GK1A 1AJ4A 1RROA 1TIZA 2Q4UA 1CMGA 4MN0A 1K95A 3SIBA 2CT9A 1B8RA 1WLMA 3D0YB 1S6JA 2HQ8A 1XK4C 2LVKA 1K9PA 1SL7A 2KYCA 1VRKA 3A8RA 4BY4A 2HF5A 3CGAA 3CZTX 2JC2A 1TNXA 1N65A 3C1VA 1F70A 1G4YR 1DJGA 1L7ZA 2I7AA 3TZ1A 1W7JB 1SBJA 1TNQA 2MAZA 2JQ6A 1S26D 4FTGA 1F4OA 3GK4X 4PE0A 3QRXA 1UP5A 3WHUB 3BUXB 2G9BA 2KHNA 1SCMB 2M3WA 1K96A 2K8MB 1R6PA 2NLNA 3FS7A 3RM1A 2E6WA 3OB1B 1J7RA 4YI8A 2KI4B 3TS5B 1OZSA 2K0JA 3OX5A 2SCPA 3JTDC 1A4PA 1IQ5A 3VROA 3OHMB 1DVIA 1QX2A 2JXCA 1YRTB 1TTXA 2E30A 1IKUA 1M45A 1QV0A 1BR4B 1RFJA 2LMTA 1G33A 3BOWB 3RLZA 3FWBA 3EKHA 5I2QA 1NCZA 1MR8A 2JTZA 2IS9A 4QJ5B 1QLSA 1B7TZ 2L5XB 1C07A 5AANA 4MRYA 4PHMA 1C7WA 1MWNA 1CDPA 1KSMA 2I2RE 2VRGA 2LLUA 2CXJA 1IH0A 3VRPA 2MHHA 1OMVA 4PHJA 1NCXA 2ZFDA 2BCXA 3BQ3A 1IJ5A 3I5GB 1B1GA 1FF1A 2PRUA 1LVCD 3BUOB 1KQMC 1JFJA 2AAOA 3EVVA 3EK8A 3OP0A 1Q80A 5ER5A 1EH2A 1FW4A 5HLOA 3K21A 4NDBA 3SG3A 1JSAA 5KSZA 3O78A 4CFQA 4I5LB 2OS8C 5GQQC 1S3PA 1DJHA 2LVVA 1EXRA 1CDLA 1YURA 3CR2A 1IRJA 1OMRA 1YRUB 2KNEA 4JPZB 2CCMA 4PALA 2JPTA 1N2DA 1TCOB 5KU1A 3D0YA 3NXAA 1MUXA 5ER4X 2WORA 1JF0A 4DRWA 2BKHB 1UHNA 5D7FA 3SG5A 5I2OA 1LA3A 2COLB 4PCWA 1QS7A 4GGFC 2M97A 4BY5A 3SJSA 1F54A 2WCEA 2BE6A 1TNWA 2JT3A 2K7CA 1X02A 1Y1AA 4ORAB 5AERA 1M39A 1YUTA 2TN4A 1CKKA 1ZOTB 2ZRSA 3D10A 1D1OA 4ICBA 1SKTA 1GQMA 2LE9B 5CSJA 3SG6A 5HKYA 1R2UA 2KI6D 1EJ3A 1IG5A 1YVLA 2JTTA 3GOFA 1JBAA 4IL1A 5AXIA 1YUSA 4F0ZB 1J7PA 2LLTA 3TUYC 3I5IB 4HREE 5G08A 1U5IA 2KDHA 2Y5IA 4PHNA 4AOMA 1AUIB 1JC2A 3FWCA 1FI6A 4AQIA 3BUWB 1A29A 2BL0C 4D1EA 2BBNA 1SW8A 2M49B 4NDCA 5AFPA 3KO0A 2A4JA 2M7NA 2LUXA 4MZJA 2EC6C 4USLA 1DT7B 2SASA 4C0LA 4A4BA 1SRAA 1K9UA 3DF0A 4XJKA 4ZCUA 3WXAA 4C0KA 1UHHA 1YX8A 1SR6B 4GNKB 2Y1MA 1S36A 2M0RA 4JWQA 1SK6D 2GGMA 2MJWB 1F8HA 1XFXO 1PVBA 1NX0A 1G8IA 1RWYA 5DKRA 1CFPA 1CB1A 1BMOA 2K61A 1PK0D 1NYAA 2JT8A 1CM1A 1B8CA 1MQ1A 1WDCB 3DVEA 1A75A 2FOTA 2MRDA 3PN7B 1M31A 1EL4A 1F55A 1QVIZ 4P2YB 4M2QA 1SCMC 1QIWA 2BECA 1NUBA 1QXPA 4N1GA 5F6TA 1BF5A 4PE7A 1CFFA 2NXQA 2KI4C 1B7TY 1BR1B 1UURA 3TS5C 2EGDA 4QJ3B 2FCDA 1IQ3A 2LVJA 1NP8A 2KYFA 4XYNA 1YTZC 2LNKA 1BODA 1MHOA 2KFHA 1RK9A 1SNLA 3I5HB 1UHIA 5AEQA 1NSHA 2PASA 3PLFB 3VGOA 5K89A 1B47A 1DJYA 2WNDA 4ZCVA 3TDIA 1XYDA 1XO5A 4P5OE 5FYXA 1YVHA 1DJIA 2V53A 4U8DA 2BBMA 2L51A 2ZN9A 4GGFA 3DD4A 1ZUZA 1ZMZA 1QLKA 4GGNA 1L2OB 1QATA 1M63B 1JF2A 5DKNA 1B4CA 2NZ0A 1TOPA 2Y1NA 3CS1A 3E3RA 2M9GA 1DGUA 1PULA 1XFYO 3PFVA 5I8NA 2CBLA 1RTP1 1FPWA 2ISDA 1PALA 1QX7A 1HQVA 1DF0A 2M8UA 4MVFA 1MF8B 4OV2A 1SCVA 2LVIA 3I5GC 1A03A 2L50A 3SG4A 5CPVA 1M46A 1GGWA 1XFVO 2G2BA 4PE4A 3IQQA 2LMVA 2O60A 2PSRA 5JOLA 2AMIA 1QJTA 1TRFA 3DVMA 1QV1A 3IQOA 1S6CA 2BKIB 1LKJA 3A4UB 3IF7A 4OKHA 2MLEC 4TNCA 1CDMA 2KQYA 1KK8B 1MXLC 5CSNA 4MRXA 2M1UA 1DJWA 4GAOA 1S5GZ 5KTYA 2KFGA 1NX3A 2LP3A 3KPXA 1A2XA 2KQ6A 2JULA 1HT9A 2LP2A 3BUMB 1PVAA 2L2EA 3F45A 1WRKA 2K2FA 1SL9A 1IGVA 1EG4A 3KEVA 3BYAA 5IBWA 1S1EA 4GUKA 1XA5A 1XFWO 4PE1A 4YGDB 3I5IC 3I5FB 1FBVA 2FCEA 4N5XA 3ZWHA 1F4QA 3CLNA 4GFTA 2RGIA 5JJGA 1CMFA 1Y1UA 2PVBA 2KAXA 1C7VA 4HSZA 1KFXS 1BT6A 1TNPA 1QVIY 3NSOA 1CDNA 1UHKA 2JZIA 2JNXA 1TCFA 2BCAA 4CIDA 2PMYA 3AKAA 1SR6C 2K2AA 3HCMA 3NSKA 4QJ4B 3KHEA 1BU3A 2CTNA 2K7OA 2JNFA 3BOWA 2K7DA 1KK7Z 3SG7A 4C0JA 2OTGB 1J1DA 3AAKA 1BOCA 4WRIA 2AUCA 5DKQA 1YX7A 2R2IA 5BPJA 1OMDA 1WDCC 4GBAA 1KWOB 2F2OA 3CTNA 4YI9A 2KGBC 1NIWA 3PN7C 4NDDA 1OQPA 1V1FA 2F33A 1AK8A 1XVJA 1DGVA 1UHJA 2KAVA 2Q91A 2KBIA 1AHRA 1DTLA 3PM8A 2BCBA 3JVTB 2JWWA 2ZNDA 3GK2A 2L98A 1H4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H2K A;  3PSR A;  4YGC B;  3EK4 A;  2F3Z A;  2F3Y A;  2L4H A;  2LCP A;  2LHL A;  4OVN F;  5CSI A;  1JUO A;  1E8A A;  1SL8 A;  1OSA A;  2MA2 A;  3I5H C;  5J3X A;  1F71 A;  2JOJ A;  4L9M A;  2I18 A;  3HX4 A;  4Q04 A;  1ODB A;  1WY9 A;  3MSE B;  1EG3 A;  3VRQ A;  1WLZ A;  4YGB B;  5TNC A;  4YBH B;  1UUS A;  2KAY A;  1CLB A;  1K90 D;  4OR9 B;  1NX2 A;  2MBX A;  1L2O C;  1S6I A;  2BE4 A;  3VRN A;  2ZNE A;  4OCI A;  4PDZ A;  2QPT A;  3EVU A;  4I5K A;  1MXE A;  4MZK A;  1KFU S;  1W7I B;  2LAP A;  1J7O A;  1PSR A;  1AJ5 A;  1B8L A;  3LLE A;  2L4I A;  1TN4 A;  2LUC A;  2PAL A;  3NSI A;  1S5G Y;  5D69 A;  1QAS A;  3TDZ A;  2CNP A;  1K2H A;  3TDU A;  4PHK A;  1IJ6 A;  4R1E A;  2JU0 A;  1AVS A;  4CPV A;  2LC5 A;  1ALW A;  4GPL B;  1U5I B;  3WNX B;  1JFK A;  3O6B A;  1WRZ A;  1OZO A;  5CSF A;  3SG2 A;  1ALV A;  2F2P A;  3CR4 X;  3DVJ A;  2KI6 C;  3O4Y A;  1CTR A;  2EHB A;  1SY9 A;  3JTD B;  4WQ3 A;  2JXL A;  2DOQ A;  2L0P A;  1J7Q A;  3NSL A;  5HKW A;  5HLV A;  1FI5 A;  1SYM A;  2D8N A;  3EVR A;  2ZN8 A;  4I5N B;  1CFD A;  3DF0 B;  3EK7 A;  4XJK B;  4DS7 A;  4YRU A;  2HQW A;  1ZAC A;  1KK8 C;  1JWD A;  1KFX L;  3EKJ A;  3LCP C;  1BLQ A;  1Y1X A;  1CNP A;  3LK0 A;  3OB2 B;  4MLW A;  1REC A;  1QTX A;  1RJV A;  2KBM A;  3KF9 A;  2B1U A;  3LL8 B;  2LM5 A;  1LXF C;  2NCP A;  4YGA A;  1XFU O;  2GV5 A;  2JT0 A;  1BG1 A;  2QAC A;  1QX5 B;  2M29 A;  1K94 A;  2KOT A;  1A75 B;  3PAL A;  1K93 D;  3FIA A;  4HRH A;  2O5G A;  1KK7 Y;  2H61 A;  4I5J A;  4DCK A;  3I5F C;  3H4S E;  3PAT A;  1DJZ A;  2WCF A;  2WCB A;  3DVK A;  3BXK A;  3WHT B;  1KQV A;  1NX1 A;  1KQM B;  1B9A A;  2I94 A;  2JRF A;  1NWD A;  3M0W A;  2WOS A;  1IWQ A;  1DMO A;  1CFC A;  4MSP A;  2OS8 B;  5HKZ A;  1LIN A;  4NQG A;  1OOJ A;  2KFF A;  2LLS A;  1DJX A;  3AKB A;  4JQ0 D;  3VRR A;  1OE9 B;  2F8P A;  4CLN A;  4DIR A;  1NPQ A;  1Y0V H;  3ICB A;  4E68 A;  1XK4 A;  2HPS A;  1NCY A;  2Y4Q A;  3CR5 X;  3LK1 A;  1CM4 A;  2HET A;  1V1G A;  1K8U A;  2LHI A;  2OTG C;  5PAL A;  3OX6 A;  1WRL A;  1YR5 A;  1YUU A;  4DUQ A;  5B8I B;  1KSO A;  2LMU A;  2ZKM X;  4ETO A;  4HRG A;  1KWO C;  1CLL A;  1XFZ O;  1GJY A;  4MZL A;  4A4C A;  4AQJ A;  1H8B A;  2KSP A;  1SMG A;  1BJF A;  1SPY A;  3CWG A;  1GGZ A;  2ZRT A;  1J55 A;  1DF0 B;  2P6B B;  4M2O A;  4ORB B;  1PRW A;  4CFR A;  2NCO A;  3ZNI A;  1Y6W A;  3TUY B;  1N0Y A;  2WC8 A;  3AAJ A;  2KGR A;  1PSB A;  1CLM A;  1QIV A;  1KFU L;  3JVT C;  4MEW A;  4WQ2 A;  2M7L A;  4UPG A;  1KCY A;  4FQO A;  2H61 C;  1K9K A;  2M1K B;  2GGZ A;  2BL0 B;  4N1F A;  2LAN A;  4ORC B;  5HYD A;  4M2P A;  3O2P A;  2LV7 A;  2MLF C;  4MBE A;  3SIA A;  1AP4 A;  1ZFS A;  3BUN B;  2FJU B;  4YGE B;  1LA0 A;  1UWO A;  1J1E A;  2K7B A;  5I2L A;  2EC6 B;  2OPO A;  3GK1 A;  1AJ4 A;  1RRO A;  1TIZ A;  2Q4U A;  1CMG A;  4MN0 A;  1K95 A;  3SIB A;  2CT9 A;  1B8R A;  1WLM A;  3D0Y B;  1S6J A;  2HQ8 A;  1XK4 C;  2LVK A;  1K9P A;  1SL7 A;  2KYC A;  1VRK A;  3A8R A;  4BY4 A;  2HF5 A;  3CGA A;  3CZT X;  2JC2 A;  1TNX A;  1N65 A;  3C1V A;  1F70 A;  1G4Y R;  1DJG A;  1L7Z A;  2I7A A;  3TZ1 A;  1W7J B;  1SBJ A;  1TNQ A;  2MAZ A;  2JQ6 A;  1S26 D;  4FTG A;  1F4O A;  3GK4 X;  4PE0 A;  3QRX A;  1UP5 A;  3WHU B;  3BUX B;  2G9B A;  2KHN A;  1SCM B;  2M3W A;  1K96 A;  2K8M B;  1R6P A;  2NLN A;  3FS7 A;  3RM1 A;  2E6W A;  3OB1 B;  1J7R A;  4YI8 A;  2KI4 B;  3TS5 B;  1OZS A;  2K0J A;  3OX5 A;  2SCP A;  3JTD C;  1A4P A;  1IQ5 A;  3VRO A;  3OHM B;  1DVI A;  1QX2 A;  2JXC A;  1YRT B;  1TTX A;  2E30 A;  1IKU A;  1M45 A;  1QV0 A;  1BR4 B;  1RFJ A;  2LMT A;  1G33 A;  3BOW B;  3RLZ A;  3FWB A;  3EKH A;  5I2Q A;  1NCZ A;  1MR8 A;  2JTZ A;  2IS9 A;  4QJ5 B;  1QLS A;  1B7T Z;  2L5X B;  1C07 A;  5AAN A;  4MRY A;  4PHM A;  1C7W A;  1MWN A;  1CDP A;  1KSM A;  2I2R E;  2VRG A;  2LLU A;  2CXJ A;  1IH0 A;  3VRP A;  2MHH A;  1OMV A;  4PHJ A;  1NCX A;  2ZFD A;  2BCX A;  3BQ3 A;  1IJ5 A;  3I5G B;  1B1G A;  1FF1 A;  2PRU A;  1LVC D;  3BUO B;  1KQM C;  1JFJ A;  2AAO A;  3EVV A;  3EK8 A;  3OP0 A;  1Q80 A;  5ER5 A;  1EH2 A;  1FW4 A;  5HLO A;  3K21 A;  4NDB A;  3SG3 A;  1JSA A;  5KSZ A;  3O78 A;  4CFQ A;  4I5L B;  2OS8 C;  5GQQ C;  1S3P A;  1DJH A;  2LVV A;  1EXR A;  1CDL A;  1YUR A;  3CR2 A;  1IRJ A;  1OMR A;  1YRU B;  2KNE A;  4JPZ B;  2CCM A;  4PAL A;  2JPT A;  1N2D A;  1TCO B;  5KU1 A;  3D0Y A;  3NXA A;  1MUX A;  5ER4 X;  2WOR A;  1JF0 A;  4DRW A;  2BKH B;  1UHN A;  5D7F A;  3SG5 A;  5I2O A;  1LA3 A;  2COL B;  4PCW A;  1QS7 A;  4GGF C;  2M97 A;  4BY5 A;  3SJS A;  1F54 A;  2WCE A;  2BE6 A;  1TNW A;  2JT3 A;  2K7C A;  1X02 A;  1Y1A A;  4ORA B;  5AER A;  1M39 A;  1YUT A;  2TN4 A;  1CKK A;  1ZOT B;  2ZRS A;  3D10 A;  1D1O A;  4ICB A;  1SKT A;  1GQM A;  2LE9 B;  5CSJ A;  3SG6 A;  5HKY A;  1R2U A;  2KI6 D;  1EJ3 A;  1IG5 A;  1YVL A;  2JTT A;  3GOF A;  1JBA A;  4IL1 A;  5AXI A;  1YUS A;  4F0Z B;  1J7P A;  2LLT A;  3TUY C;  3I5I B;  4HRE E;  5G08 A;  1U5I A;  2KDH A;  2Y5I A;  4PHN A;  4AOM A;  1AUI B;  1JC2 A;  3FWC A;  1FI6 A;  4AQI A;  3BUW B;  1A29 A;  2BL0 C;  4D1E A;  2BBN A;  1SW8 A;  2M49 B;  4NDC A;  5AFP A;  3KO0 A;  2A4J A;  2M7N A;  2LUX A;  4MZJ A;  2EC6 C;  4USL A;  1DT7 B;  2SAS A;  4C0L A;  4A4B A;  1SRA A;  1K9U A;  3DF0 A;  4XJK A;  4ZCU A;  3WXA A;  4C0K A;  1UHH A;  1YX8 A;  1SR6 B;  4GNK B;  2Y1M A;  1S36 A;  2M0R A;  4JWQ A;  1SK6 D;  2GGM A;  2MJW B;  1F8H A;  1XFX O;  1PVB A;  1NX0 A;  1G8I A;  1RWY A;  5DKR A;  1CFP A;  1CB1 A;  1BMO A;  2K61 A;  1PK0 D;  1NYA A;  2JT8 A;  1CM1 A;  1B8C A;  1MQ1 A;  1WDC B;  3DVE A;  1A75 A;  2FOT A;  2MRD A;  3PN7 B;  1M31 A;  1EL4 A;  1F55 A;  1QVI Z;  4P2Y B;  4M2Q A;  1SCM C;  1QIW A;  2BEC A;  1NUB A;  1QXP A;  4N1G A;  5F6T A;  1BF5 A;  4PE7 A;  1CFF A;  2NXQ A;  2KI4 C;  1B7T Y;  1BR1 B;  1UUR A;  3TS5 C;  2EGD A;  4QJ3 B;  2FCD A;  1IQ3 A;  2LVJ A;  1NP8 A;  2KYF A;  4XYN A;  1YTZ C;  2LNK A;  1BOD A;  1MHO A;  2KFH A;  1RK9 A;  1SNL A;  3I5H B;  1UHI A;  5AEQ A;  1NSH A;  2PAS A;  3PLF B;  3VGO A;  5K89 A;  1B47 A;  1DJY A;  2WND A;  4ZCV A;  3TDI A;  1XYD A;  1XO5 A;  4P5O E;  5FYX A;  1YVH A;  1DJI A;  2V53 A;  4U8D A;  2BBM A;  2L51 A;  2ZN9 A;  4GGF A;  3DD4 A;  1ZUZ A;  1ZMZ A;  1QLK A;  4GGN A;  1L2O B;  1QAT A;  1M63 B;  1JF2 A;  5DKN A;  1B4C A;  2NZ0 A;  1TOP A;  2Y1N A;  3CS1 A;  3E3R A;  2M9G A;  1DGU A;  1PUL A;  1XFY O;  3PFV A;  5I8N A;  2CBL A;  1RTP 1;  1FPW A;  2ISD A;  1PAL A;  1QX7 A;  1HQV A;  1DF0 A;  2M8U A;  4MVF A;  1MF8 B;  4OV2 A;  1SCV A;  2LVI A;  3I5G C;  1A03 A;  2L50 A;  3SG4 A;  5CPV A;  1M46 A;  1GGW A;  1XFV O;  2G2B A;  4PE4 A;  3IQQ A;  2LMV A;  2O60 A;  2PSR A;  5JOL A;  2AMI A;  1QJT A;  1TRF A;  3DVM A;  1QV1 A;  3IQO A;  1S6C A;  2BKI B;  1LKJ A;  3A4U B;  3IF7 A;  4OKH A;  2MLE C;  4TNC A;  1CDM A;  2KQY A;  1KK8 B;  1MXL C;  5CSN A;  4MRX A;  2M1U A;  1DJW A;  4GAO A;  1S5G Z;  5KTY A;  2KFG A;  1NX3 A;  2LP3 A;  3KPX A;  1A2X A;  2KQ6 A;  2JUL A;  1HT9 A;  2LP2 A;  3BUM B;  1PVA A;  2L2E A;  3F45 A;  1WRK A;  2K2F A;  1SL9 A;  1IGV A;  1EG4 A;  3KEV A;  3BYA A;  5IBW A;  1S1E A;  4GUK A;  1XA5 A;  1XFW O;  4PE1 A;  4YGD B;  3I5I C;  3I5F B;  1FBV A;  2FCE A;  4N5X A;  3ZWH A;  1F4Q A;  3CLN A;  4GFT A;  2RGI A;  5JJG A;  1CMF A;  1Y1U A;  2PVB A;  2KAX A;  1C7V A;  4HSZ A;  1KFX S;  1BT6 A;  1TNP A;  1QVI Y;  3NSO A;  1CDN A;  1UHK A;  2JZI A;  2JNX A;  1TCF A;  2BCA A;  4CID A;  2PMY A;  3AKA A;  1SR6 C;  2K2A A;  3HCM A;  3NSK A;  4QJ4 B;  3KHE A;  1BU3 A;  2CTN A;  2K7O A;  2JNF A;  3BOW A;  2K7D A;  1KK7 Z;  3SG7 A;  4C0J A;  2OTG B;  1J1D A;  3AAK A;  1BOC A;  4WRI A;  2AUC A;  5DKQ A;  1YX7 A;  2R2I A;  5BPJ A;  1OMD A;  1WDC C;  4GBA A;  1KWO B;  2F2O A;  3CTN A;  4YI9 A;  2KGB C;  1NIW A;  3PN7 C;  4NDD A;  1OQP A;  1V1F A;  2F33 A;  1AK8 A;  1XVJ A;  1DGV A;  1UHJ A;  2KAV A;  2Q91 A;  2KBI A;  1AHR A;  1DTL A;  3PM8 A;  2BCB A;  3JVT B;  2JWW A;  2ZND A;  3GK2 A;  2L98 A;  1H4B A; 
#chains in the Genus database with same CATH topology
 1TWO A;  2H2K A;  1W9Z A;  3PSR A;  4YGC B;  3EK4 A;  2F3Z A;  2F3Y A;  2L4H A;  3BJH A;  2LCP A;  2LHL A;  4OVN F;  5CSI A;  1JUO A;  1E8A A;  1SL8 A;  1OSA A;  2MA2 A;  3I5H C;  5J3X A;  1F71 A;  2JOJ A;  4L9M A;  3BFB A;  2I18 A;  3HX4 A;  4Q04 A;  1OOG A;  1ODB A;  1WY9 A;  3MSE B;  1EG3 A;  3VRQ A;  1WLZ A;  4YGB B;  5TNC A;  4YBH B;  1UUS A;  1TUJ A;  2KAY A;  1CLB A;  1K90 D;  4OR9 B;  1NX2 A;  3B88 A;  2MBX A;  2YGU A;  1L2O C;  1S6I A;  2BE4 A;  2QEH A;  3VRN A;  2ZNE A;  4OCI A;  3S0E A;  4PDZ A;  2QPT A;  3EVU A;  4I5K A;  1MXE A;  4MZK A;  3UNW A;  1KFU S;  1W7I B;  2LAP A;  3SS4 A;  1PSR A;  1AJ5 A;  1B8L A;  2WCL A;  1J7O A;  3LLE A;  2L4I A;  1TN4 A;  2LUC A;  2PAL A;  2PYQ A;  3NSI A;  1S5G Y;  5D69 A;  1QAS A;  3TDZ A;  2CNP A;  1K2H A;  3TDU A;  4PHK A;  1IJ6 A;  4R1E A;  2JU0 A;  1AVS A;  4CPV A;  2LC5 A;  1ALW A;  4GPL B;  1U5I B;  3WNX B;  1JFK A;  3O6B A;  1WRZ A;  1OZO A;  5CSF A;  3SG2 A;  1ALV A;  2F2P A;  3CR4 X;  3DVJ A;  2KI6 C;  3O4Y A;  1CTR A;  2EHB A;  3UO9 A;  1SY9 A;  3JTD B;  4WQ3 A;  4JKT A;  1IIO A;  2JXL A;  2DOQ A;  2L0P A;  1J7Q A;  3NSL A;  3D74 A;  5D3O A;  5HKW A;  5HLV A;  1FI5 A;  1SYM A;  2D8N A;  3EVR A;  2ZN8 A;  4I5N B;  1CFD A;  3DF0 B;  3EK7 A;  4XJK B;  3R72 A;  4DS7 A;  2HQW A;  4YRU A;  1ZAC A;  1KK8 C;  1JWD A;  1KFX L;  4JD9 A;  3EKJ A;  3LCP C;  1BLQ A;  1Y1X A;  3FE8 A;  3LK0 A;  3OB2 B;  4MLW A;  1REC A;  1CNP A;  1QTX A;  1RJV A;  2KBM A;  1QWV A;  3KF9 A;  5FI2 A;  2B1U A;  3LL8 B;  2FJY A;  2LM5 A;  1LXF C;  2NCP A;  4YGA A;  1XFU O;  2GV5 A;  2JT0 A;  1BG1 A;  2QAC A;  1QX5 B;  3PM2 A;  2M29 A;  1K94 A;  2KOT A;  1A75 B;  3PAL A;  3B7A A;  1K93 D;  3FIA A;  4HRH A;  2O5G A;  1KK7 Y;  2H61 A;  4I5J A;  4DCK A;  3I5F C;  3H4S E;  2H8V A;  1DJZ A;  2WCF A;  3PAT A;  2WCB A;  3D77 A;  3DVK A;  3BXK A;  3WHT B;  1KQV A;  1NX1 A;  1DC1 A;  1KQM B;  1B9A A;  2I94 A;  2JRF A;  2QEB A;  3D78 A;  1NWD A;  3M0W A;  2WOS A;  1IWQ A;  1DMO A;  1CFC A;  4MSP A;  2OS8 B;  5HKZ A;  1LIN A;  4NQG A;  1OOJ A;  2KFF A;  2LLS A;  1DJX A;  3AKB A;  4JQ0 D;  1DEK A;  3S0D A;  3VRR A;  1OE9 B;  2F8P A;  4CLN A;  4DIR A;  1NPQ A;  1Y0V H;  3ICB A;  4E68 A;  1XK4 A;  2HPS A;  1NCY A;  2Y4Q A;  2GTE A;  3CR5 X;  3LK1 A;  1CM4 A;  2HET A;  1V1G A;  1K8U A;  5DIC A;  2LHI A;  2OTG C;  5PAL A;  3OX6 A;  1WRL A;  1YR5 A;  1YUU A;  4DUQ A;  5B8I B;  1KSO A;  2LMU A;  2ZKM X;  4ETO A;  1C3Z A;  4HRG A;  4OZD A;  1KWO C;  1CLL A;  1XFZ O;  1GJY A;  4MZL A;  4A4C A;  4AQJ A;  1H8B A;  2KSP A;  3Q8I A;  1SMG A;  1BJF A;  1SPY A;  3CWG A;  1GGZ A;  2ZRT A;  1J55 A;  1DF0 B;  2P6B B;  4M2O A;  4ORB B;  1PRW A;  4CFR A;  2NCO A;  3ZNI A;  1Y6W A;  3TUY B;  1N0Y A;  2WC8 A;  3AAJ A;  2KGR A;  1PSB A;  1CLM A;  1QIV A;  1KFU L;  3JVT C;  4MEW A;  4WQ2 A;  2M7L A;  4UPG A;  1KCY A;  4FQO A;  2H61 C;  2QEV A;  1K9K A;  2M1K B;  4INW A;  2GGZ A;  2BL0 B;  4N1F A;  3D75 A;  2LAN A;  4ORC B;  4FQT A;  5HYD A;  4M2P A;  3O2P A;  2LV7 A;  2MLF C;  4MBE A;  3SIA A;  1AP4 A;  1ZFS A;  3BUN B;  2FJU B;  4YGE B;  1LA0 A;  1UWO A;  1J1E A;  2K7B A;  5I2L A;  2EC6 B;  2OPO A;  3GK1 A;  2WCM A;  1AJ4 A;  1RRO A;  1TIZ A;  2Q4U A;  1CMG A;  3L47 A;  1K95 A;  2P71 A;  4MN0 A;  3SIB A;  2CT9 A;  1B8R A;  1WLM A;  3D0Y B;  1S6J A;  2HQ8 A;  1XK4 C;  2LVK A;  1K9P A;  1SL7 A;  2KYC A;  1VRK A;  3A8R A;  4KYN A;  3NGV A;  4BY4 A;  2HF5 A;  3CGA A;  3B87 A;  3CZT X;  2JC2 A;  1TNX A;  1N65 A;  3C1V A;  1F70 A;  3DY9 A;  1G4Y R;  1DJG A;  1L7Z A;  2I7A A;  3TZ1 A;  1W7J B;  1SBJ A;  1TNQ A;  2MAZ A;  2JQ6 A;  1S26 D;  4FTG A;  1F4O A;  3GK4 X;  3QME A;  3BFA A;  1UP5 A;  3QRX A;  4PE0 A;  3WHU B;  3BUX B;  2G9B A;  2KHN A;  1SCM B;  2M3W A;  1K96 A;  2K8M B;  1R6P A;  2NLN A;  3FS7 A;  2WCJ A;  3RM1 A;  2E6W A;  3OB1 B;  1J7R A;  4YI8 A;  2KI4 B;  3TS5 B;  1OZS A;  2K0J A;  3OX5 A;  2SCP A;  3FE6 A;  3JTD C;  1A4P A;  2ERB A;  1IQ5 A;  3CZ1 A;  3VRO A;  3OHM B;  1DVI A;  3S0G A;  1QX2 A;  2JXC A;  1YRT B;  1SSE B;  1TTX A;  2E30 A;  3CZ2 A;  1IKU A;  1M45 A;  1QV0 A;  1BR4 B;  2L5Y A;  1RFJ A;  2LMT A;  1G33 A;  3BOW B;  3RLZ A;  3FWB A;  3EKH A;  5I2Q A;  1NCZ A;  1FF1 A;  1MR8 A;  2PQL A;  2JTZ A;  3N7H A;  2IS9 A;  4QJ5 B;  1QLS A;  3DZT A;  1B7T Z;  2L5X B;  1C07 A;  5AAN A;  4F7F A;  4MRY A;  4PHM A;  1C7W A;  1MWN A;  1CDP A;  1KSM A;  2I2R E;  2VRG A;  5FI6 A;  1GM0 A;  2LLU A;  2CXJ A;  1IH0 A;  3VRP A;  2MHH A;  3FE9 A;  1OMV A;  4PHJ A;  1NCX A;  2ZFD A;  2BCX A;  3BQ3 A;  1IJ5 A;  3I5G B;  1B1G A;  3D76 A;  2PRU A;  1LVC D;  3BUO B;  1KQM C;  1JFJ A;  2AAO A;  3EVV A;  3EK8 A;  3OP0 A;  1Q80 A;  5ER5 A;  1EH2 A;  1FW4 A;  5HLO A;  3K21 A;  4NDB A;  3SG3 A;  1JSA A;  5KSZ A;  3O78 A;  4CFQ A;  4I5L B;  2OS8 C;  5GQQ C;  1S3P A;  1DJH A;  2LVV A;  1EXR A;  1CDL A;  1YUR A;  5I94 A;  3CR2 A;  1IRJ A;  1OMR A;  1YRU B;  2KNE A;  4JPZ B;  2CCM A;  4PAL A;  2JPT A;  1N2D A;  1TCO B;  5KU1 A;  3D0Y A;  3NXA A;  1MUX A;  5EL2 A;  5ER4 X;  2WOR A;  1JF0 A;  4DRW A;  2BKH B;  1UHN A;  5D7F A;  3SG5 A;  5I2O A;  1LA3 A;  2COL B;  4PCW A;  1QS7 A;  4GGF C;  2M97 A;  4BY5 A;  3SJS A;  1F54 A;  2WCE A;  2BE6 A;  1TNW A;  2JT3 A;  2K7C A;  1X02 A;  1DQE A;  3RZS A;  1Y1A A;  4ORA B;  5AER A;  1M39 A;  1YUT A;  2TN4 A;  1CKK A;  1ZOT B;  5FI7 A;  2ZRS A;  3DXL A;  3D10 A;  3V2L A;  4ICB A;  1SKT A;  1TUZ A;  1D1O A;  1GQM A;  2LE9 B;  5CSJ A;  3SG6 A;  5HKY A;  1R2U A;  2QDI A;  3S0F A;  2KI6 D;  1EJ3 A;  1IG5 A;  1YVL A;  2JTT A;  3GOF A;  1JBA A;  4IL1 A;  5AXI A;  1YUS A;  4F0Z B;  1J7P A;  2LLT A;  3TUY C;  3I5I B;  4HRE E;  5G08 A;  1U5I A;  2KDH A;  2Y5I A;  3OBV A;  4PHN A;  3B86 A;  4AOM A;  1AUI B;  1JC2 A;  3FWC A;  1FI6 A;  4AQI A;  3BUW B;  1A29 A;  3R1P A;  2BL0 C;  3S0A A;  4D1E A;  2BBN A;  1SW8 A;  2M49 B;  4NDC A;  5AFP A;  3KO0 A;  2A4J A;  2M7N A;  2LUX A;  4MZJ A;  2EC6 C;  4USL A;  1DT7 B;  2SAS A;  4C0L A;  4A4B A;  1SRA A;  1K9U A;  3DF0 A;  4XJK A;  4ZCU A;  3WXA A;  3CDN A;  4C0K A;  1UHH A;  1YX8 A;  3VB1 A;  1SR6 B;  5HL1 A;  4GNK B;  2Y1M A;  1S36 A;  2M0R A;  4JWQ A;  1SK6 D;  2GGM A;  2MJW B;  1F8H A;  1XFX O;  1Z4H A;  1PVB A;  1NX0 A;  1G8I A;  1RWY A;  5DKR A;  1LS8 A;  1CFP A;  1CB1 A;  1BMO A;  3S0B A;  2K61 A;  1PK0 D;  1NYA A;  2JT8 A;  1CM1 A;  1B8C A;  1MQ1 A;  1WDC B;  3DVE A;  1A75 A;  2FOT A;  2MRD A;  3PN7 B;  1OOI X;  1M31 A;  1EL4 A;  1F55 A;  1QVI Z;  4P2Y B;  2L2C A;  4M2Q A;  1SCM C;  1QIW A;  2BEC A;  1NUB A;  1QXP A;  4N1G A;  5F6T A;  1BF5 A;  4PE7 A;  1CFF A;  2NXQ A;  2KI4 C;  1B7T Y;  1BR1 B;  1UUR A;  3TS5 C;  1OW4 A;  2EGD A;  3PJI A;  4QJ3 B;  2FCD A;  3K1E A;  1IQ3 A;  2LVJ A;  1NP8 A;  2KYF A;  4XYN A;  1YTZ C;  2LNK A;  1BOD A;  1MHO A;  2KFH A;  1RK9 A;  1SNL A;  3I5H B;  1UHI A;  5AEQ A;  1NSH A;  2K60 A;  2PAS A;  3PLF B;  3VGO A;  5K89 A;  1B47 A;  1DJY A;  2WND A;  2QEO A;  4ZCV A;  3TDI A;  1XYD A;  1XO5 A;  3BFH A;  4P5O E;  5FYX A;  1YVH A;  1DJI A;  2V53 A;  4U8D A;  2BBM A;  2L51 A;  2ZN9 A;  4GGF A;  3DD4 A;  1ZUZ A;  1ZMZ A;  1QLK A;  4GGN A;  1L2O B;  1QAT A;  3SS3 A;  1M63 B;  1JF2 A;  5DKN A;  1B4C A;  2NZ0 A;  1TOP A;  2Y1N A;  3CS1 A;  3E3R A;  2M9G A;  1DGU A;  3EG5 B;  1PUL A;  1XFY O;  3PFV A;  5I8N A;  1OOH A;  1RTP 1;  2CBL A;  2P70 A;  1FPW A;  2ISD A;  1PAL A;  3L4A A;  1QX7 A;  1HQV A;  1DF0 A;  3O4X A;  2M8U A;  4MVF A;  1MF8 B;  3R1V A;  1DEL A;  1SCV A;  2LVI A;  3I5G C;  4OV2 A;  1A03 A;  2L50 A;  3SG4 A;  5CPV A;  1M46 A;  2KPH A;  1XFV O;  1GGW A;  2G2B A;  4PE4 A;  3IQQ A;  2LMV A;  2O60 A;  2PSR A;  5JOL A;  2AMI A;  1QJT A;  1TRF A;  3DVM A;  3R1O A;  1QV1 A;  4PT1 A;  2WC6 A;  3IQO A;  1S6C A;  2BKI B;  1LKJ A;  3A4U B;  1P28 A;  3IF7 A;  2MLE C;  3NHT A;  4OKH A;  4TNC A;  1CDM A;  2KQY A;  1KK8 B;  1MXL C;  5CSN A;  4MRX A;  4INX A;  2M1U A;  1DJW A;  3OGN A;  2BAP A;  4GAO A;  1S5G Z;  3DYE A;  5KTY A;  2KFG A;  1NX3 A;  2LP3 A;  3KPX A;  1A2X A;  2JPO A;  2KQ6 A;  2JUL A;  3CZ0 A;  1HT9 A;  2LP2 A;  3BUM B;  1PVA A;  2L2E A;  3F45 A;  1WRK A;  2K2F A;  1SL9 A;  1IGV A;  1EG4 A;  1Z2C B;  3KEV A;  3BYA A;  4IJ7 A;  5IBW A;  1S1E A;  1ORG A;  4GUK A;  1XA5 A;  3CAB A;  1XFR A;  1XFW O;  4PE1 A;  3D73 A;  4YGD B;  3I5I C;  3I5F B;  1FBV A;  2FCE A;  4N5X A;  3ZWH A;  1F4Q A;  3CLN A;  4GFT A;  2RGI A;  5JJG A;  1OOF A;  2WC5 A;  1CMF A;  1Y1U A;  2WCK A;  2PVB A;  2KAX A;  1C7V A;  4HSZ A;  1KFX S;  1BT6 A;  2KLD A;  1T14 A;  1TNP A;  3L4L A;  1QVI Y;  3NSO A;  1CDN A;  1UHK A;  2KLE A;  2JZI A;  2JNX A;  1TCF A;  2BCA A;  4CID A;  3CYZ A;  2PMY A;  3AKA A;  1SR6 C;  2K2A A;  3IVT A;  3HCM A;  3NSK A;  4QJ4 B;  3KHE A;  1BU3 A;  2CTN A;  2K7O A;  2JNF A;  3BOW A;  2K7D A;  1KK7 Z;  3SG7 A;  4C0J A;  2OTG B;  1J1D A;  2WCH A;  3AAK A;  1BOC A;  4WRI A;  3NHI A;  2AUC A;  5DKQ A;  1YX7 A;  2R2I A;  5BPJ A;  1C3Y A;  1OMD A;  1WDC C;  4GBA A;  1KWO B;  2F2O A;  3CTN A;  2BNX A;  4YI9 A;  2KGB C;  1NIW A;  3PN7 C;  4NDD A;  1OQP A;  3SS5 A;  1V1F A;  2F33 A;  1AK8 A;  1XVJ A;  1DGV A;  1UHJ A;  2KAV A;  2Q91 A;  2KBI A;  1AHR A;  1DTL A;  3PM8 A;  2BCB A;  3JVT B;  2JWW A;  2ZND A;  3B6X A;  3GK2 A;  2L98 A;  1H4B A; 
#chains in the Genus database with same CATH homology
 2H2K A;  3PSR A;  4YGC B;  3EK4 A;  2F3Z A;  2F3Y A;  2L4H A;  2LCP A;  2LHL A;  4OVN F;  5CSI A;  1JUO A;  1E8A A;  1SL8 A;  1OSA A;  2MA2 A;  3I5H C;  5J3X A;  1F71 A;  2JOJ A;  4L9M A;  2I18 A;  3HX4 A;  4Q04 A;  1ODB A;  1WY9 A;  3MSE B;  1EG3 A;  3VRQ A;  1WLZ A;  4YGB B;  5TNC A;  4YBH B;  1UUS A;  2KAY A;  1CLB A;  1K90 D;  4OR9 B;  1NX2 A;  2MBX A;  1L2O C;  1S6I A;  2BE4 A;  3VRN A;  2ZNE A;  4OCI A;  4PDZ A;  2QPT A;  3EVU A;  4I5K A;  1MXE A;  4MZK A;  1KFU S;  1W7I B;  2LAP A;  1J7O A;  1PSR A;  1AJ5 A;  1B8L A;  3LLE A;  2L4I A;  1TN4 A;  2LUC A;  2PAL A;  3NSI A;  1S5G Y;  5D69 A;  1QAS A;  3TDZ A;  2CNP A;  1K2H A;  3TDU A;  4PHK A;  1IJ6 A;  4R1E A;  2JU0 A;  1AVS A;  4CPV A;  2LC5 A;  1ALW A;  4GPL B;  1U5I B;  3WNX B;  1JFK A;  3O6B A;  1WRZ A;  1OZO A;  5CSF A;  3SG2 A;  1ALV A;  2F2P A;  3CR4 X;  3DVJ A;  2KI6 C;  3O4Y A;  1CTR A;  2EHB A;  1SY9 A;  3JTD B;  4WQ3 A;  2JXL A;  2DOQ A;  2L0P A;  1J7Q A;  3NSL A;  5HKW A;  5HLV A;  1FI5 A;  1SYM A;  2D8N A;  3EVR A;  2ZN8 A;  4I5N B;  1CFD A;  3DF0 B;  3EK7 A;  4XJK B;  4DS7 A;  4YRU A;  2HQW A;  1ZAC A;  1KK8 C;  1JWD A;  1KFX L;  3EKJ A;  3LCP C;  1BLQ A;  1Y1X A;  1CNP A;  3LK0 A;  3OB2 B;  4MLW A;  1REC A;  1QTX A;  1RJV A;  2KBM A;  3KF9 A;  2B1U A;  3LL8 B;  2LM5 A;  1LXF C;  2NCP A;  4YGA A;  1XFU O;  2GV5 A;  2JT0 A;  1BG1 A;  2QAC A;  1QX5 B;  2M29 A;  1K94 A;  2KOT A;  1A75 B;  3PAL A;  1K93 D;  3FIA A;  4HRH A;  2O5G A;  1KK7 Y;  2H61 A;  4I5J A;  4DCK A;  3I5F C;  3H4S E;  3PAT A;  1DJZ A;  2WCF A;  2WCB A;  3DVK A;  3BXK A;  3WHT B;  1KQV A;  1NX1 A;  1KQM B;  1B9A A;  2I94 A;  2JRF A;  1NWD A;  3M0W A;  2WOS A;  1IWQ A;  1DMO A;  1CFC A;  4MSP A;  2OS8 B;  5HKZ A;  1LIN A;  4NQG A;  1OOJ A;  2KFF A;  2LLS A;  1DJX A;  3AKB A;  4JQ0 D;  3VRR A;  1OE9 B;  2F8P A;  4CLN A;  4DIR A;  1NPQ A;  1Y0V H;  3ICB A;  4E68 A;  1XK4 A;  2HPS A;  1NCY A;  2Y4Q A;  3CR5 X;  3LK1 A;  1CM4 A;  2HET A;  1V1G A;  1K8U A;  2LHI A;  2OTG C;  5PAL A;  3OX6 A;  1WRL A;  1YR5 A;  1YUU A;  4DUQ A;  5B8I B;  1KSO A;  2LMU A;  2ZKM X;  4ETO A;  4HRG A;  1KWO C;  1CLL A;  1XFZ O;  1GJY A;  4MZL A;  4A4C A;  4AQJ A;  1H8B A;  2KSP A;  1SMG A;  1BJF A;  1SPY A;  3CWG A;  1GGZ A;  2ZRT A;  1J55 A;  1DF0 B;  2P6B B;  4M2O A;  4ORB B;  1PRW A;  4CFR A;  2NCO A;  3ZNI A;  1Y6W A;  3TUY B;  1N0Y A;  2WC8 A;  3AAJ A;  2KGR A;  1PSB A;  1CLM A;  1QIV A;  1KFU L;  3JVT C;  4MEW A;  4WQ2 A;  2M7L A;  4UPG A;  1KCY A;  4FQO A;  2H61 C;  1K9K A;  2M1K B;  2GGZ A;  2BL0 B;  4N1F A;  2LAN A;  4ORC B;  5HYD A;  4M2P A;  3O2P A;  2LV7 A;  2MLF C;  4MBE A;  3SIA A;  1AP4 A;  1ZFS A;  3BUN B;  2FJU B;  4YGE B;  1LA0 A;  1UWO A;  1J1E A;  2K7B A;  5I2L A;  2EC6 B;  2OPO A;  3GK1 A;  1AJ4 A;  1RRO A;  1TIZ A;  2Q4U A;  1CMG A;  4MN0 A;  1K95 A;  3SIB A;  2CT9 A;  1B8R A;  1WLM A;  3D0Y B;  1S6J A;  2HQ8 A;  1XK4 C;  2LVK A;  1K9P A;  1SL7 A;  2KYC A;  1VRK A;  3A8R A;  4BY4 A;  2HF5 A;  3CGA A;  3CZT X;  2JC2 A;  1TNX A;  1N65 A;  3C1V A;  1F70 A;  1G4Y R;  1DJG A;  1L7Z A;  2I7A A;  3TZ1 A;  1W7J B;  1SBJ A;  1TNQ A;  2MAZ A;  2JQ6 A;  1S26 D;  4FTG A;  1F4O A;  3GK4 X;  4PE0 A;  3QRX A;  1UP5 A;  3WHU B;  3BUX B;  2G9B A;  2KHN A;  1SCM B;  2M3W A;  1K96 A;  2K8M B;  1R6P A;  2NLN A;  3FS7 A;  3RM1 A;  2E6W A;  3OB1 B;  1J7R A;  4YI8 A;  2KI4 B;  3TS5 B;  1OZS A;  2K0J A;  3OX5 A;  2SCP A;  3JTD C;  1A4P A;  1IQ5 A;  3VRO A;  3OHM B;  1DVI A;  1QX2 A;  2JXC A;  1YRT B;  1TTX A;  2E30 A;  1IKU A;  1M45 A;  1QV0 A;  1BR4 B;  1RFJ A;  2LMT A;  1G33 A;  3BOW B;  3RLZ A;  3FWB A;  3EKH A;  5I2Q A;  1NCZ A;  1MR8 A;  2JTZ A;  2IS9 A;  4QJ5 B;  1QLS A;  1B7T Z;  2L5X B;  1C07 A;  5AAN A;  4MRY A;  4PHM A;  1C7W A;  1MWN A;  1CDP A;  1KSM A;  2I2R E;  2VRG A;  2LLU A;  2CXJ A;  1IH0 A;  3VRP A;  2MHH A;  1OMV A;  4PHJ A;  1NCX A;  2ZFD A;  2BCX A;  3BQ3 A;  1IJ5 A;  3I5G B;  1B1G A;  1FF1 A;  2PRU A;  1LVC D;  3BUO B;  1KQM C;  1JFJ A;  2AAO A;  3EVV A;  3EK8 A;  3OP0 A;  1Q80 A;  5ER5 A;  1EH2 A;  1FW4 A;  5HLO A;  3K21 A;  4NDB A;  3SG3 A;  1JSA A;  5KSZ A;  3O78 A;  4CFQ A;  4I5L B;  2OS8 C;  5GQQ C;  1S3P A;  1DJH A;  2LVV A;  1EXR A;  1CDL A;  1YUR A;  3CR2 A;  1IRJ A;  1OMR A;  1YRU B;  2KNE A;  4JPZ B;  2CCM A;  4PAL A;  2JPT A;  1N2D A;  1TCO B;  5KU1 A;  3D0Y A;  3NXA A;  1MUX A;  5ER4 X;  2WOR A;  1JF0 A;  4DRW A;  2BKH B;  1UHN A;  5D7F A;  3SG5 A;  5I2O A;  1LA3 A;  2COL B;  4PCW A;  1QS7 A;  4GGF C;  2M97 A;  4BY5 A;  3SJS A;  1F54 A;  2WCE A;  2BE6 A;  1TNW A;  2JT3 A;  2K7C A;  1X02 A;  1Y1A A;  4ORA B;  5AER A;  1M39 A;  1YUT A;  2TN4 A;  1CKK A;  1ZOT B;  2ZRS A;  3D10 A;  1D1O A;  4ICB A;  1SKT A;  1GQM A;  2LE9 B;  5CSJ A;  3SG6 A;  5HKY A;  1R2U A;  2KI6 D;  1EJ3 A;  1IG5 A;  1YVL A;  2JTT A;  3GOF A;  1JBA A;  4IL1 A;  5AXI A;  1YUS A;  4F0Z B;  1J7P A;  2LLT A;  3TUY C;  3I5I B;  4HRE E;  5G08 A;  1U5I A;  2KDH A;  2Y5I A;  4PHN A;  4AOM A;  1AUI B;  1JC2 A;  3FWC A;  1FI6 A;  4AQI A;  3BUW B;  1A29 A;  2BL0 C;  4D1E A;  2BBN A;  1SW8 A;  2M49 B;  4NDC A;  5AFP A;  3KO0 A;  2A4J A;  2M7N A;  2LUX A;  4MZJ A;  2EC6 C;  4USL A;  1DT7 B;  2SAS A;  4C0L A;  4A4B A;  1SRA A;  1K9U A;  3DF0 A;  4XJK A;  4ZCU A;  3WXA A;  4C0K A;  1UHH A;  1YX8 A;  1SR6 B;  4GNK B;  2Y1M A;  1S36 A;  2M0R A;  4JWQ A;  1SK6 D;  2GGM A;  2MJW B;  1F8H A;  1XFX O;  1PVB A;  1NX0 A;  1G8I A;  1RWY A;  5DKR A;  1CFP A;  1CB1 A;  1BMO A;  2K61 A;  1PK0 D;  1NYA A;  2JT8 A;  1CM1 A;  1B8C A;  1MQ1 A;  1WDC B;  3DVE A;  1A75 A;  2FOT A;  2MRD A;  3PN7 B;  1M31 A;  1EL4 A;  1F55 A;  1QVI Z;  4P2Y B;  4M2Q A;  1SCM C;  1QIW A;  2BEC A;  1NUB A;  1QXP A;  4N1G A;  5F6T A;  1BF5 A;  4PE7 A;  1CFF A;  2NXQ A;  2KI4 C;  1B7T Y;  1BR1 B;  1UUR A;  3TS5 C;  2EGD A;  4QJ3 B;  2FCD A;  1IQ3 A;  2LVJ A;  1NP8 A;  2KYF A;  4XYN A;  1YTZ C;  2LNK A;  1BOD A;  1MHO A;  2KFH A;  1RK9 A;  1SNL A;  3I5H B;  1UHI A;  5AEQ A;  1NSH A;  2PAS A;  3PLF B;  3VGO A;  5K89 A;  1B47 A;  1DJY A;  2WND A;  4ZCV A;  3TDI A;  1XYD A;  1XO5 A;  4P5O E;  5FYX A;  1YVH A;  1DJI A;  2V53 A;  4U8D A;  2BBM A;  2L51 A;  2ZN9 A;  4GGF A;  3DD4 A;  1ZUZ A;  1ZMZ A;  1QLK A;  4GGN A;  1L2O B;  1QAT A;  1M63 B;  1JF2 A;  5DKN A;  1B4C A;  2NZ0 A;  1TOP A;  2Y1N A;  3CS1 A;  3E3R A;  2M9G A;  1DGU A;  1PUL A;  1XFY O;  3PFV A;  5I8N A;  2CBL A;  1RTP 1;  1FPW A;  2ISD A;  1PAL A;  1QX7 A;  1HQV A;  1DF0 A;  2M8U A;  4MVF A;  1MF8 B;  4OV2 A;  1SCV A;  2LVI A;  3I5G C;  1A03 A;  2L50 A;  3SG4 A;  5CPV A;  1M46 A;  1GGW A;  1XFV O;  2G2B A;  4PE4 A;  3IQQ A;  2LMV A;  2O60 A;  2PSR A;  5JOL A;  2AMI A;  1QJT A;  1TRF A;  3DVM A;  1QV1 A;  3IQO A;  1S6C A;  2BKI B;  1LKJ A;  3A4U B;  3IF7 A;  4OKH A;  2MLE C;  4TNC A;  1CDM A;  2KQY A;  1KK8 B;  1MXL C;  5CSN A;  4MRX A;  2M1U A;  1DJW A;  4GAO A;  1S5G Z;  5KTY A;  2KFG A;  1NX3 A;  2LP3 A;  3KPX A;  1A2X A;  2KQ6 A;  2JUL A;  1HT9 A;  2LP2 A;  3BUM B;  1PVA A;  2L2E A;  3F45 A;  1WRK A;  2K2F A;  1SL9 A;  1IGV A;  1EG4 A;  3KEV A;  3BYA A;  5IBW A;  1S1E A;  4GUK A;  1XA5 A;  1XFW O;  4PE1 A;  4YGD B;  3I5I C;  3I5F B;  1FBV A;  2FCE A;  4N5X A;  3ZWH A;  1F4Q A;  3CLN A;  4GFT A;  2RGI A;  5JJG A;  1CMF A;  1Y1U A;  2PVB A;  2KAX A;  1C7V A;  4HSZ A;  1KFX S;  1BT6 A;  1TNP A;  1QVI Y;  3NSO A;  1CDN A;  1UHK A;  2JZI A;  2JNX A;  1TCF A;  2BCA A;  4CID A;  2PMY A;  3AKA A;  1SR6 C;  2K2A A;  3HCM A;  3NSK A;  4QJ4 B;  3KHE A;  1BU3 A;  2CTN A;  2K7O A;  2JNF A;  3BOW A;  2K7D A;  1KK7 Z;  3SG7 A;  4C0J A;  2OTG B;  1J1D A;  3AAK A;  1BOC A;  4WRI A;  2AUC A;  5DKQ A;  1YX7 A;  2R2I A;  5BPJ A;  1OMD A;  1WDC C;  4GBA A;  1KWO B;  2F2O A;  3CTN A;  4YI9 A;  2KGB C;  1NIW A;  3PN7 C;  4NDD A;  1OQP A;  1V1F A;  2F33 A;  1AK8 A;  1XVJ A;  1DGV A;  1UHJ A;  2KAV A;  2Q91 A;  2KBI A;  1AHR A;  1DTL A;  3PM8 A;  2BCB A;  3JVT B;  2JWW A;  2ZND A;  3GK2 A;  2L98 A;  1H4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...