3C1VA

The 1.5 a crystal structure of ca2+-bound s100a4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
93
structure length
93
Chain Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Protein S100-A4
publication title Crystal structure of the Ca(2+)-form and Ca(2+)-binding kinetics of metastasis-associated protein, S100A4
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3c1vA00
1NPQA 1FW4A 1OE9B 4ICBA 1ODBA 3VRQA 4CPVA 1KFXL 1PSBA 1EL4A 2LLUA 2LV7A 2MHHA 4I5KA 4XJKA 2KSPA 3WHTB 1CDPA 4R1EA 1NX0A 1AP4A 1K9UA 3SG6A 5AANA 4PE4A 4PALA 1OQPA 1CM1A 4I5NB 2OTGC 2K2AA 3BYAA 5BPJA 1YRUB 4OV2A 1A03A 2LMVA 4PE0A 2KYCA 4FQOA 3I5FC 1UP5A 2Q91A 1E8AA 1XFVO 3GOFA 3IQOA 3SG4A 4QJ4B 5AFPA 2EC6C 2JU0A 1MUXA 3WNXB 1OOJA 4PDZA 3TZ1A 2M1UA 3NSIA 4ORBB 1S6JA 1Q80A 1BF5A 1J1EA 1YX8A 2NXQA 2RGIA 3CR5X 1BOCA 3IQQA 2K7BA 1UWOA 2ISDA 3TDIA 4CFQA 4NQGA 1QS7A 3O4YA 3OB2B 4M2PA 1LA3A 1IGVA 1YUUA 1NUBA 3D10A 1J7QA 1J55A 3GK4X 2G2BA 4M2QA 1DF0B 2NCOA 3PALA 1BODA 1A75B 1XFUO 2JXCA 4NDBA 4TNCA 5F6TA 1XVJA 3I5HB 1XK4C 1LVCD 4FTGA 1PRWA 2NLNA 3EVUA 5CPVA 5DKNA 2PALA 3KF9A 1CMGA 2LC5A 2CT9A 2WOSA 1FI6A 2Y4QA 2BECA 3OP0A 3BUXB 1B4CA 2KI6D 1YR5A 3VRNA 1KK7Z 1LKJA 1R2UA 5DKRA 2KFFA 4GAOA 2M0RA 2LUCA 2MRDA 3NSLA 3NXAA 4N1FA 4DS7A 1FF1A 1KCYA 1F4QA 1SL8A 1WRZA 1XFYO 2COLB 2JQ6A 3TS5C 1DT7B 1KWOB 1QX7A 2PASA 1M39A 1CDNA 3M0WA 1A4PA 2JRFA 4PE7A 1KQVA 1B8RA 2L0PA 1KK8B 2SASA 1JF0A 1AVSA 1IJ5A 1WLZA 2K7OA 1PVAA 2AUCA 2I94A 5I8NA 3VRRA 4YGDB 1D1OA 2KI4B 2LMTA 4WQ2A 1ALWA 5PALA 3DVKA 1XYDA 1B8LA 1DJWA 2CXJA 2MLFC 3BUMB 1QJTA 1YVHA 5KSZA 1U5IA 4P5OE 1IJ6A 2D8NA 1BG1A 1KQMC 1FI5A 2PMYA 1LINA 2PSRA 1GGZA 1IH0A 2LP2A 4PE1A 3CWGA 1AK8A 4C0KA 2LP3A 3PLFB 5CSIA 3TDZA 1K9KA 1CDLA 1S36A 2R2IA 1QIWA 2WCBA 3SG3A 1CLLA 1QVIY 1J7PA 2F2PA 2KFHA 3LL8B 3PM8A 2EGDA 2M7LA 1WY9A 3CR4X 4U8DA 2LHLA 2JULA 1LXFC 3CS1A 4MRYA 1QLKA 4MSPA 1S5GY 1Y1AA 1RFJA 3OB1B 1SCMB 3CR2A 3DVEA 1DJXA 3EK8A 4YI9A 3WHUB 1BJFA 3C1VA 3EVVA 1XO5A 3VGOA 2GGMA 2DOQA 1BR4B 2L98A 1GGWA 1S3PA 2HPSA 3I5HC 3K21A 2CBLA 1OMRA 2JWWA 2O5GA 1K9PA 4A4CA 4YBHB 1B7TY 1K8UA 2ZKMX 1CKKA 1R6PA 2GV5A 2LCPA 5KTYA 5CSNA 3SIAA 2O60A 2ZN9A 4YI8A 3NSKA 4HRGA 4MZKA 4WQ3A 1J1DA 2MLEC 1SK6D 1B8CA 1B9AA 2KBMA 3BUNB 1KWOC 1QX5B 1JWDA 1N0YA 1EG4A 1UURA 2HF5A 2HQWA 2M49B 5AEQA 2LVJA 4ETOA 5J3XA 1J7RA 1PVBA 1QATA 1SY9A 1KQMB 3DF0B 1KK8C 1Y0VH 1OMVA 4YGBB 3FWBA 1SNLA 2K0JA 4OKHA 2BL0C 2KI4C 3AAJA 4JPZB 1V1FA 2H61C 5JOLA 4PHJA 4BY4A 5I2OA 1V1GA 1M63B 4C0JA 1BU3A 1UHNA 1C7VA 2Y1NA 1Y6WA 2WC8A 1NYAA 4ZCVA 1TRFA 1TOPA 1XA5A 1XFXO 2NCPA 3CLNA 1L7ZA 2LHIA 3AKBA 4USLA 1ZMZA 3LK1A 1XK4A 5FYXA 1XFZO 4NDCA 3AKAA 1NCZA 1H4BA 3OHMB 3ZWHA 1SBJA 3BUOB 1M31A 3D0YB 2LMUA 1LA0A 2ZN8A 1IQ3A 1SCMC 1SCVA 2NZ0A 2L4HA 3LLEA 1ZFSA 1SRAA 3BUWB 2ZFDA 2ZNEA 1SR6B 5HYDA 3VRPA 2I7AA 2M7NA 1QVIZ 4GPLB 2JNXA 4E68A 3DVMA 1S6CA 4YRUA 1S5GZ 4F0ZB 3PN7B 2F2OA 1N2DA 4A4BA 3DD4A 2BCBA 1YX7A 1K94A 1CLBA 1IG5A 2JT8A 1JC2A 4P2YB 2KAYA 2LLSA 1G33A 5G08A 1ALVA 1Y1UA 2L4IA 2JTZA 1ZOTB 3JTDB 2Y1MA 2MBXA 1B7TZ 2GGZA 1NX1A 5IBWA 2AAOA 1XFWO 2BL0B 2B1UA 2VRGA 3QRXA 3RM1A 1H8BA 3OX6A 1VRKA 3CGAA 1EXRA 1SL7A 3BOWB 1WDCB 1EG3A 4ORAB 1A2XA 3FWCA 2MAZA 3A8RA 1BLQA 1EJ3A 1YRTB 1UHHA 1K2HA 1G8IA 1HT9A 1CMFA 2E6WA 1J7OA 1MXEA 2KDHA 1OZSA 1S6IA 2LAPA 2OS8B 1RJVA 4MEWA 2L51A 1JBAA 1BT6A 1A29A 3A4UB 1TNXA 1SL9A 1FBVA 3EKHA 1JSAA 1AHRA 2E30A 4HREE 5I2LA 1IKUA 2KFGA 2HETA 4I5LB 2L2EA 3I5GB 1KFUS 4GGFC 1DF0A 3SG2A 1NCXA 2AMIA 4DIRA 4MVFA 5ER4X 1A75A 1TNQA 2K8MB 2TN4A 4GBAA 1UHIA 1AUIB 1KFXS 2KAXA 2BE6A 4ORCB 1K95A 4CLNA 1JF2A 2BKIB 3SG5A 1FPWA 4MZJA 2LE9B 4HSZA 1UHJA 1DJZA 2WORA 3H4SE 1GQMA 1TCOB 2KI6C 1DGVA 2L5XB 1IQ5A 1S26D 1NWDA 1SR6C 3O78A 1F8HA 5K89A 2M8UA 2BCAA 3JVTB 2I2RE 3CZTX 2JT3A 2K7DA 3MSEB 2ZRTA 2KBIA 3KO0A 2LLTA 3PATA 5GQQC 2FOTA 2G9BA 5CSJA 1GJYA 1SW8A 3PFVA 3PN7C 1KSOA 2BKHB 1CM4A 4JQ0D 4IL1A 2I18A 4CIDA 4L9MA 1DGUA 2M9GA 4OCIA 4GGNA 5ER5A 2KQ6A 4PHMA 5KU1A 5HKYA 1DJIA 2BCXA 3JTDC 5CSFA 3VROA 2JOJA 2H61A 3BOWA 3AAKA 2FCEA 4M2OA 1YUSA 1NIWA 3GK1A 3KHEA 1WDCC 2BBMA 5JJGA 4C0LA 3WXAA 1QV0A 3TUYB 2FCDA 4N5XA 4JWQA 2H2KA 3ZNIA 4MN0A 1RWYA 1AJ4A 1MQ1A 2KAVA 2JTTA 4AOMA 5I2QA 2Q4UA 3BXKA 3NSOA 2OS8C 5B8IB 1NX2A 5DKQA 1UUSA 5HLOA 3O2PA 3PSRA 1OZOA 3IF7A 1U5IB 1PSRA 1B47A 1ZACA 3HCMA 2QACA 4CFRA 1B1GA 2KNEA 3RLZA 3EK7A 1KSMA 1DMOA 1F71A 2WNDA 3SG7A 1BR1B 1CFDA 1SPYA 1K93D 2HQ8A 3I5GC 4GFTA 2ZNDA 1ZUZA 4DUQA 2ZRSA 4YGAA 4WRIA 4XYNA 1QXPA 2V53A 3HX4A 2K7CA 4YGEB 1HQVA 4PHNA 1CTRA 1F4OA 1SYMA 2FJUB 2LUXA 2F8PA 3I5IB 1CB1A 1YURA 2CTNA 2PRUA 1BMOA 2LANA 1WLMA 3EVRA 1YTZC 3ICBA 3TDUA 1CNPA 1C7WA 3E3RA 2F33A 3FIAA 1F54A 2MJWB 1L2OC 4OVNF 2K2FA 2WCEA 1QLSA 1CFPA 1M45A 2BE4A 1RK9A 2BBNA 1MWNA 3KPXA 1CFFA 3JVTC 1TNPA 1K90D 1X02A 1CDMA 2JC2A 2SCPA 1RECA 1N65A 1S1EA 1PULA 1YUTA 2WCFA 1NX3A 1MF8B 1K96A 1QX2A 4I5JA 1IRJA 4DRWA 1NSHA 2JZIA 2QPTA 3LCPC 3DF0A 1SMGA 1CLMA 1QTXA 1TNWA 1WRKA 3EK4A 2LVVA 1QV1A 2M1KB 4GNKB 2CNPA 2F3ZA 4MLWA 4XJKB 2KGBC 1C07A 2KHNA 1M46A 3LK0A 1W7IB 2JPTA 4GUKA 2OTGB 2Y5IA 3F45A 4BY5A 1EH2A 2LVIA 2F3YA 3I5FB 2JT0A 1TCFA 2EC6B 2A4JA 3SJSA 1OSAA 2L50A 1MHOA 1JFJA 1RTP1 3TUYC 4GGFA 5D69A 3O6BA 4AQJA 1AJ5A 2KGRA 2LVKA 4AQIA 1DVIA 1G4YR 2LNKA 1NP8A 1IWQA 1MR8A 4PHKA 1WRLA 4D1EA 1PALA 2LM5A 2PVBA 1NCYA 3D0YA 3GK2A 3FS7A 1OMDA 1QASA 2P6BB 2M29A 2M3WA 2OPOA 1KK7Y 2KQYA 4QJ3B 4YGCB 4ZCUA 1Y1XA 1L2OB 5HKWA 1PK0D 1YVLA 1SKTA 5HLVA 2EHBA 3DVJA 3EKJA 2KYFA 1JFKA 5TNCA 1F55A 4DCKA 3I5IC 5D7FA 1DJYA 1CFCA 4HRHA 1JUOA 1F70A 2MA2A 4MRXA 2K61A 1DJHA 4PCWA 4Q04A 1DTLA 1DJGA 3BQ3A 1UHKA 2JXLA 3CTNA 4NDDA 2IS9A 2M97A 4QJ5B 3KEVA 5HKZA 3TS5B 1TTXA 1W7JB 1QIVA 1MXLC 4MZLA 4OR9B 2CCMA 4N1GA 5AXIA 2JNFA 3SIBA 4UPGA 1KFUL 1RROA 2KOTA 5AERA 1TN4A 4MBEA 3OX5A 1TIZA
chains in the Genus database with same CATH superfamily
1NPQA 1FW4A 1OE9B 4ICBA 1ODBA 3R1OA 3VRQA 4CPVA 1KFXL 1PSBA 1EL4A 2LLUA 2LV7A 2MHHA 4I5KA 4XJKA 2KSPA 3WHTB 1CDPA 4R1EA 1NX0A 1AP4A 1K9UA 3SG6A 5AANA 4PE4A 4PALA 1OQPA 1CM1A 4I5NB 2OTGC 2K2AA 3BYAA 3K1EA 5BPJA 1YRUB 4OV2A 1A03A 2LMVA 4PE0A 2KYCA 4FQOA 3I5FC 1UP5A 2Q91A 1E8AA 1XFVO 3GOFA 3IQOA 3SG4A 4QJ4B 5AFPA 2EC6C 2JU0A 1MUXA 3WNXB 3B87A 1OOJA 4PDZA 3TZ1A 3RZSA 2WCLA 2M1UA 3NSIA 4ORBB 1S6JA 1Q80A 1BF5A 1J1EA 2YGUA 1YX8A 2NXQA 2RGIA 3CR5X 1BOCA 3IQQA 2K7BA 1UWOA 2ISDA 1XFRA 3TDIA 5DICA 4CFQA 4NQGA 1QS7A 3O4YA 3OB2B 4M2PA 1LA3A 1IGVA 1YUUA 1NUBA 3D10A 1J7QA 1J55A 3GK4X 2G2BA 4M2QA 1DF0B 3BFBA 2NCOA 3PALA 3IVTA 1A75B 1BODA 1XFUO 2JXCA 4NDBA 4TNCA 5F6TA 1XVJA 3I5HB 1XK4C 3FE8A 1LVCD 4FTGA 1PRWA 2NLNA 2WCKA 3EVUA 5CPVA 2L5YA 2PALA 5DKNA 3KF9A 1CMGA 1OOGA 2LC5A 2CT9A 2WOSA 1FI6A 2Y4QA 2BECA 3OP0A 3BUXB 1B4CA 2KI6D 1YR5A 3VRNA 1KK7Z 1LKJA 1R2UA 5DKRA 3VB1A 2KFFA 4GAOA 2M0RA 2WCJA 2LUCA 2MRDA 3NSLA 3NXAA 4N1FA 4DS7A 1FF1A 1KCYA 1F4QA 1SL8A 1WRZA 1XFYO 3B6XA 2COLB 2JQ6A 3TS5C 1DT7B 1KWOB 4KYNA 1QX7A 2PASA 1M39A 1CDNA 3M0WA 1A4PA 2JRFA 4PE7A 1KQVA 3CABA 1B8RA 5FI6A 2L0PA 3B86A 1KK8B 2SASA 1JF0A 5FI2A 1AVSA 1IJ5A 1WLZA 2K7OA 1PVAA 2AUCA 2I94A 5I8NA 3VRRA 4YGDB 1D1OA 2KI4B 2LMTA 4WQ2A 1ALWA 5PALA 3DVKA 1XYDA 1B8LA 1DJWA 2CXJA 2MLFC 3BUMB 3D77A 1QJTA 1YVHA 5KSZA 3L4LA 1U5IA 4P5OE 1IJ6A 2D8NA 1BG1A 1KQMC 1FI5A 2PMYA 1LINA 2PSRA 1GGZA 1IH0A 2LP2A 4PE1A 3CWGA 1AK8A 3S0EA 4C0KA 2LP3A 3PLFB 5CSIA 3TDZA 1K9KA 1CDLA 1QWVA 1S36A 2ERBA 2R2IA 1QIWA 2WCBA 2BAPA 3Q8IA 1CLLA 1QVIY 2QEHA 2F2PA 2KFHA 3LL8B 3PM8A 2EGDA 2M7LA 1J7PA 1WY9A 3CR4X 4U8DA 2LHLA 2JULA 1LXFC 2KLEA 3CS1A 4MRYA 1P28A 1QLKA 4MSPA 1S5GY 1Y1AA 1RFJA 3OB1B 1SCMB 3CR2A 3DVEA 1DJXA 3EK8A 4YI9A 3WHUB 1BJFA 3C1VA 1ORGA 3EVVA 1XO5A 3FE9A 3VGOA 2GGMA 2DOQA 1BR4B 2L98A 1GGWA 1S3PA 3CYZA 2HPSA 3I5HC 3K21A 2CBLA 1OMRA 2JWWA 2O5GA 1K9PA 4A4CA 4YBHB 1B7TY 3B88A 1K8UA 2ZKMX 3S0FA 1CKKA 1R6PA 3PJIA 1OOFA 2GV5A 2LCPA 5KTYA 5CSNA 3QMEA 4FQTA 2PQLA 2O60A 1SSEB 2ZN9A 4YI8A 3SIAA 3NSKA 3L4AA 4HRGA 4MZKA 4WQ3A 1J1DA 2MLEC 1SK6D 1B8CA 1B9AA 2KBMA 3BUNB 1KWOC 1QX5B 1JWDA 1N0YA 1EG4A 1UURA 2HF5A 2HQWA 2M49B 3UNWA 5AEQA 2LVJA 4ETOA 5J3XA 1J7RA 1PVBA 1QATA 1SY9A 1KQMB 3DF0B 1KK8C 1Y0VH 1OMVA 4YGBB 3FWBA 1SNLA 2K0JA 4OKHA 2BL0C 4IJ7A 2KI4C 3AAJA 4JPZB 1V1FA 2H61C 5JOLA 4PHJA 4BY4A 5I2OA 1V1GA 1M63B 4C0JA 3R1PA 1BU3A 1C3ZA 1UHNA 2Y1NA 1Y6WA 2WC8A 1C7VA 1NYAA 4ZCVA 2WC5A 1TRFA 1TOPA 1TWOA 1XA5A 1XFXO 2NCPA 3CLNA 3D74A 1L7ZA 2LHIA 3AKBA 3D75A 4USLA 1ZMZA 3LK1A 1XK4A 1DQEA 4PT1A 5FYXA 1XFZO 4NDCA 3AKAA 1NCZA 1H4BA 3OHMB 3ZWHA 1SBJA 3BUOB 1M31A 3D0YB 2LMUA 1LA0A 1OW4A 2ZN8A 1SCMC 1SCVA 2NZ0A 1IQ3A 2L4HA 3LLEA 1OOIX 1ZFSA 1SRAA 3BUWB 3L47A 2ZFDA 2ZNEA 1SR6B 5HYDA 3VRPA 2I7AA 2M7NA 1QVIZ 1OOHA 4GPLB 1GM0A 2JNXA 4E68A 3DVMA 4INXA 1S6CA 4YRUA 1S5GZ 2WCMA 4F0ZB 3SS3A 3PN7B 2F2OA 1N2DA 4A4BA 3DD4A 2BCBA 1YX7A 1K94A 1CLBA 1IG5A 2JT8A 1JC2A 1LS8A 4P2YB 2KAYA 2LLSA 1G33A 3SS4A 5G08A 3FE6A 1ALVA 3CZ1A 1Y1UA 2L4IA 2JTZA 1ZOTB 3JTDB 2Y1MA 2MBXA 3V2LA 1B7TZ 2GGZA 1NX1A 5IBWA 2AAOA 1XFWO 2BL0B 3CZ0A 2B1UA 2VRGA 3QRXA 3RM1A 1H8BA 3OX6A 1VRKA 3CGAA 1EXRA 1SL7A 3BOWB 1WDCB 1EG3A 4ORAB 1A2XA 3FWCA 2MAZA 3A8RA 1BLQA 1EJ3A 1YRTB 1UHHA 1K2HA 1G8IA 1HT9A 1CMFA 2E6WA 3S0AA 1J7OA 1MXEA 2KDHA 3N7HA 1OZSA 1S6IA 2LAPA 2OS8B 1RJVA 3S0GA 4MEWA 2L51A 1JBAA 1T14A 1BT6A 1A29A 4JKTA 3A4UB 1TNXA 1SL9A 1FBVA 3EKHA 1JSAA 1AHRA 2E30A 4HREE 2P70A 5I2LA 1IKUA 2KFGA 2HETA 4I5LB 2L2EA 3I5GB 1KFUS 4GGFC 1DF0A 3SG2A 1NCXA 3DY9A 2AMIA 4DIRA 4MVFA 5ER4X 1A75A 1TNQA 2K8MB 5HL1A 3BFHA 2TN4A 4GBAA 3CDNA 1UHIA 1Z2CB 1AUIB 1KFXS 2KAXA 2BE6A 4ORCB 3SS5A 1K95A 3D78A 1JF2A 4CLNA 2BKIB 3SG5A 1FPWA 4MZJA 2LE9B 4HSZA 1UHJA 1DC1A 4INWA 1DJZA 2WORA 3H4SE 1GQMA 1TCOB 2KI6C 1DGVA 2L5XB 1IQ5A 1S26D 1NWDA 1SR6C 3O78A 1F8HA 5K89A 2M8UA 2BCAA 3JVTB 2I2RE 3CZTX 2JT3A 2K7DA 3MSEB 2ZRTA 2KBIA 3KO0A 2LLTA 3O4XA 3PATA 5GQQC 2FOTA 4JD9A 2G9BA 5CSJA 1GJYA 1SW8A 3PFVA 3PN7C 1KSOA 2BKHB 2KPHA 1CM4A 4JQ0D 4IL1A 2I18A 1IIOA 1Z4HA 4L9MA 4CIDA 1DGUA 2GTEA 2M9GA 4OCIA 4GGNA 5ER5A 2PYQA 2KQ6A 4PHMA 1C3YA 5KU1A 5HKYA 3D73A 1DJIA 2BCXA 3JTDC 5CSFA 3VROA 2JOJA 2H61A 3BJHA 3BOWA 3AAKA 2FCEA 4M2OA 3NGVA 1YUSA 1NIWA 2K60A 3GK1A 3KHEA 1WDCC 2BBMA 5JJGA 3CZ2A 4C0LA 3WXAA 1QV0A 3TUYB 5I94A 2FCDA 4N5XA 4JWQA 2H2KA 3ZNIA 4MN0A 1RWYA 1AJ4A 1MQ1A 2KAVA 2JTTA 4AOMA 5I2QA 2Q4UA 3BXKA 3NSOA 2OS8C 2WCHA 5B8IB 1NX2A 3R1VA 5DKQA 1UUSA 5HLOA 1DEKA 3O2PA 2L2CA 1OZOA 1TUZA 3IF7A 1U5IB 3PSRA 1PSRA 1B47A 2QEVA 1ZACA 3HCMA 2QACA 3B7AA 3S0BA 4CFRA 1B1GA 2KNEA 3RLZA 3EK7A 1KSMA 1DMOA 2QEBA 1F71A 2WNDA 3SG7A 1BR1B 1CFDA 3S0DA 1SPYA 1K93D 2HQ8A 3I5GC 4GFTA 2ZNDA 1ZUZA 4DUQA 2ZRSA 4YGAA 4WRIA 4XYNA 1QXPA 2V53A 3HX4A 2K7CA 4YGEB 5FI7A 1HQVA 4PHNA 1CTRA 1F4OA 1SYMA 2FJUB 2LUXA 2F8PA 3I5IB 1CB1A 1YURA 2CTNA 2PRUA 1BMOA 2LANA 1WLMA 3EVRA 1YTZC 3ICBA 3TDUA 1CNPA 1C7WA 5EL2A 3E3RA 2F33A 3FIAA 1F54A 2MJWB 1L2OC 4OVNF 2K2FA 2WCEA 1QLSA 3UO9A 1CFPA 1M45A 2BE4A 2QDIA 1RK9A 2BBNA 1MWNA 3KPXA 4F7FA 3OBVA 3PM2A 1CFFA 3JVTC 1TNPA 1K90D 1X02A 1CDMA 2JC2A 2SCPA 1RECA 1N65A 1S1EA 1PULA 1YUTA 2WCFA 1NX3A 1MF8B 1K96A 1QX2A 4I5JA 1IRJA 4DRWA 1NSHA 2JZIA 2QPTA 3LCPC 3DF0A 2KLDA 1SMGA 1CLMA 1QTXA 1TNWA 1WRKA 2H8VA 3EK4A 2LVVA 1QV1A 2M1KB 4GNKB 2CNPA 2F3ZA 4MLWA 4XJKB 2KGBC 1C07A 2KHNA 1M46A 3LK0A 1W7IB 2JPTA 4GUKA 2OTGB 2Y5IA 3F45A 4BY5A 3DZTA 1EH2A 2LVIA 2F3YA 3I5FB 2JT0A 1TCFA 2EC6B 2A4JA 3SJSA 1OSAA 2L50A 2QEOA 1MHOA 1JFJA 1RTP1 3TUYC 4GGFA 5D69A 3O6BA 2FJYA 4AQJA 1AJ5A 2KGRA 2LVKA 4AQIA 1DVIA 1G4YR 2LNKA 1NP8A 1IWQA 1MR8A 3D76A 4PHKA 1WRLA 4D1EA 1PALA 2LM5A 2PVBA 1NCYA 3D0YA 3DYEA 3FS7A 3GK2A 1OMDA 1QASA 5D3OA 2P6BB 2M29A 2M3WA 3EG5B 2OPOA 1KK7Y 2KQYA 4QJ3B 3DXLA 4YGCB 4ZCUA 1Y1XA 4OZDA 1L2OB 5HKWA 1PK0D 1YVLA 1SKTA 5HLVA 2EHBA 3OGNA 3DVJA 3EKJA 2KYFA 1JFKA 5TNCA 1TUJA 3NHIA 4DCKA 1F55A 3I5IC 3BFAA 5D7FA 1DJYA 1CFCA 4HRHA 1JUOA 1F70A 2MA2A 4MRXA 1DELA 3NHTA 2K61A 1DJHA 2P71A 4PCWA 4Q04A 1DTLA 1DJGA 3BQ3A 1UHKA 2JXLA 3CTNA 4NDDA 2IS9A 2M97A 4QJ5B 2BNXA 3KEVA 5HKZA 3TS5B 1TTXA 1W7JB 1QIVA 3R72A 1MXLC 4MZLA 4OR9B 2CCMA 4N1GA 2WC6A 2JNFA 5AXIA 3SIBA 4UPGA 1KFUL 1RROA 2KOTA 5AERA 1TN4A 4MBEA 3SG3A 2JPOA 3OX5A 1W9ZA 1TIZA
chains in the Genus database with same CATH topology
1NPQA 1FW4A 1OE9B 4ICBA 1ODBA 3VRQA 4CPVA 1KFXL 1PSBA 1EL4A 2LLUA 2LV7A 2MHHA 4I5KA 4XJKA 2KSPA 3WHTB 1CDPA 4R1EA 1NX0A 1AP4A 1K9UA 3SG6A 5AANA 4PE4A 4PALA 1OQPA 1CM1A 4I5NB 2OTGC 2K2AA 3BYAA 5BPJA 1YRUB 4OV2A 1A03A 2LMVA 4PE0A 2KYCA 4FQOA 3I5FC 1UP5A 2Q91A 1E8AA 1XFVO 3GOFA 3IQOA 3SG4A 4QJ4B 5AFPA 2EC6C 2JU0A 1MUXA 3WNXB 1OOJA 4PDZA 3TZ1A 2M1UA 3NSIA 4ORBB 1S6JA 1Q80A 1BF5A 1J1EA 1YX8A 2NXQA 2RGIA 3CR5X 1BOCA 3IQQA 2K7BA 1UWOA 2ISDA 3TDIA 4CFQA 4NQGA 1QS7A 3O4YA 3OB2B 4M2PA 1LA3A 1IGVA 1YUUA 1NUBA 3D10A 1J7QA 1J55A 3GK4X 2G2BA 4M2QA 1DF0B 2NCOA 3PALA 1BODA 1A75B 1XFUO 2JXCA 4NDBA 4TNCA 5F6TA 1XVJA 3I5HB 1XK4C 1LVCD 4FTGA 1PRWA 2NLNA 3EVUA 5CPVA 5DKNA 2PALA 3KF9A 1CMGA 2LC5A 2CT9A 2WOSA 1FI6A 2Y4QA 2BECA 3OP0A 3BUXB 1B4CA 2KI6D 1YR5A 3VRNA 1KK7Z 1LKJA 1R2UA 5DKRA 2KFFA 4GAOA 2M0RA 2LUCA 2MRDA 3NSLA 3NXAA 4N1FA 4DS7A 1FF1A 1KCYA 1F4QA 1SL8A 1WRZA 1XFYO 2COLB 2JQ6A 3TS5C 1DT7B 1KWOB 1QX7A 2PASA 1M39A 1CDNA 3M0WA 1A4PA 2JRFA 4PE7A 1KQVA 1B8RA 2L0PA 1KK8B 2SASA 1JF0A 1AVSA 1IJ5A 1WLZA 2K7OA 1PVAA 2AUCA 2I94A 5I8NA 3VRRA 4YGDB 1D1OA 2KI4B 2LMTA 4WQ2A 1ALWA 5PALA 3DVKA 1XYDA 1B8LA 1DJWA 2CXJA 2MLFC 3BUMB 1QJTA 1YVHA 5KSZA 1U5IA 4P5OE 1IJ6A 2D8NA 1BG1A 1KQMC 1FI5A 2PMYA 1LINA 2PSRA 1GGZA 1IH0A 2LP2A 4PE1A 3CWGA 1AK8A 4C0KA 2LP3A 3PLFB 5CSIA 3TDZA 1K9KA 1CDLA 1S36A 2R2IA 1QIWA 2WCBA 3SG3A 1CLLA 1QVIY 1J7PA 2F2PA 2KFHA 3LL8B 3PM8A 2EGDA 2M7LA 1WY9A 3CR4X 4U8DA 2LHLA 2JULA 1LXFC 3CS1A 4MRYA 1QLKA 4MSPA 1S5GY 1Y1AA 1RFJA 3OB1B 1SCMB 3CR2A 3DVEA 1DJXA 3EK8A 4YI9A 3WHUB 1BJFA 3C1VA 3EVVA 1XO5A 3VGOA 2GGMA 2DOQA 1BR4B 2L98A 1GGWA 1S3PA 2HPSA 3I5HC 3K21A 2CBLA 1OMRA 2JWWA 2O5GA 1K9PA 4A4CA 4YBHB 1B7TY 1K8UA 2ZKMX 1CKKA 1R6PA 2GV5A 2LCPA 5KTYA 5CSNA 3SIAA 2O60A 2ZN9A 4YI8A 3NSKA 4HRGA 4MZKA 4WQ3A 1J1DA 2MLEC 1SK6D 1B8CA 1B9AA 2KBMA 3BUNB 1KWOC 1QX5B 1JWDA 1N0YA 1EG4A 1UURA 2HF5A 2HQWA 2M49B 5AEQA 2LVJA 4ETOA 5J3XA 1J7RA 1PVBA 1QATA 1SY9A 1KQMB 3DF0B 1KK8C 1Y0VH 1OMVA 4YGBB 3FWBA 1SNLA 2K0JA 4OKHA 2BL0C 2KI4C 3AAJA 4JPZB 1V1FA 2H61C 5JOLA 4PHJA 4BY4A 5I2OA 1V1GA 1M63B 4C0JA 1BU3A 1UHNA 1C7VA 2Y1NA 1Y6WA 2WC8A 1NYAA 4ZCVA 1TRFA 1TOPA 1XA5A 1XFXO 2NCPA 3CLNA 1L7ZA 2LHIA 3AKBA 4USLA 1ZMZA 3LK1A 1XK4A 5FYXA 1XFZO 4NDCA 3AKAA 1NCZA 1H4BA 3OHMB 3ZWHA 1SBJA 3BUOB 1M31A 3D0YB 2LMUA 1LA0A 2ZN8A 1IQ3A 1SCMC 1SCVA 2NZ0A 2L4HA 3LLEA 1ZFSA 1SRAA 3BUWB 2ZFDA 2ZNEA 1SR6B 5HYDA 3VRPA 2I7AA 2M7NA 1QVIZ 4GPLB 2JNXA 4E68A 3DVMA 1S6CA 4YRUA 1S5GZ 4F0ZB 3PN7B 2F2OA 1N2DA 4A4BA 3DD4A 2BCBA 1YX7A 1K94A 1CLBA 1IG5A 2JT8A 1JC2A 4P2YB 2KAYA 2LLSA 1G33A 5G08A 1ALVA 1Y1UA 2L4IA 2JTZA 1ZOTB 3JTDB 2Y1MA 2MBXA 1B7TZ 2GGZA 1NX1A 5IBWA 2AAOA 1XFWO 2BL0B 2B1UA 2VRGA 3QRXA 3RM1A 1H8BA 3OX6A 1VRKA 3CGAA 1EXRA 1SL7A 3BOWB 1WDCB 1EG3A 4ORAB 1A2XA 3FWCA 2MAZA 3A8RA 1BLQA 1EJ3A 1YRTB 1UHHA 1K2HA 1G8IA 1HT9A 1CMFA 2E6WA 1J7OA 1MXEA 2KDHA 1OZSA 1S6IA 2LAPA 2OS8B 1RJVA 4MEWA 2L51A 1JBAA 1BT6A 1A29A 3A4UB 1TNXA 1SL9A 1FBVA 3EKHA 1JSAA 1AHRA 2E30A 4HREE 5I2LA 1IKUA 2KFGA 2HETA 4I5LB 2L2EA 3I5GB 1KFUS 4GGFC 1DF0A 3SG2A 1NCXA 2AMIA 4DIRA 4MVFA 5ER4X 1A75A 1TNQA 2K8MB 2TN4A 4GBAA 1UHIA 1AUIB 1KFXS 2KAXA 2BE6A 4ORCB 1K95A 4CLNA 1JF2A 2BKIB 3SG5A 1FPWA 4MZJA 2LE9B 4HSZA 1UHJA 1DJZA 2WORA 3H4SE 1GQMA 1TCOB 2KI6C 1DGVA 2L5XB 1IQ5A 1S26D 1NWDA 1SR6C 3O78A 1F8HA 5K89A 2M8UA 2BCAA 3JVTB 2I2RE 3CZTX 2JT3A 2K7DA 3MSEB 2ZRTA 2KBIA 3KO0A 2LLTA 3PATA 5GQQC 2FOTA 2G9BA 5CSJA 1GJYA 1SW8A 3PFVA 3PN7C 1KSOA 2BKHB 1CM4A 4JQ0D 4IL1A 2I18A 4CIDA 4L9MA 1DGUA 2M9GA 4OCIA 4GGNA 5ER5A 2KQ6A 4PHMA 5KU1A 5HKYA 1DJIA 2BCXA 3JTDC 5CSFA 3VROA 2JOJA 2H61A 3BOWA 3AAKA 2FCEA 4M2OA 1YUSA 1NIWA 3GK1A 3KHEA 1WDCC 2BBMA 5JJGA 4C0LA 3WXAA 1QV0A 3TUYB 2FCDA 4N5XA 4JWQA 2H2KA 3ZNIA 4MN0A 1RWYA 1AJ4A 1MQ1A 2KAVA 2JTTA 4AOMA 5I2QA 2Q4UA 3BXKA 3NSOA 2OS8C 5B8IB 1NX2A 5DKQA 1UUSA 5HLOA 3O2PA 3PSRA 1OZOA 3IF7A 1U5IB 1PSRA 1B47A 1ZACA 3HCMA 2QACA 4CFRA 1B1GA 2KNEA 3RLZA 3EK7A 1KSMA 1DMOA 1F71A 2WNDA 3SG7A 1BR1B 1CFDA 1SPYA 1K93D 2HQ8A 3I5GC 4GFTA 2ZNDA 1ZUZA 4DUQA 2ZRSA 4YGAA 4WRIA 4XYNA 1QXPA 2V53A 3HX4A 2K7CA 4YGEB 1HQVA 4PHNA 1CTRA 1F4OA 1SYMA 2FJUB 2LUXA 2F8PA 3I5IB 1CB1A 1YURA 2CTNA 2PRUA 1BMOA 2LANA 1WLMA 3EVRA 1YTZC 3ICBA 3TDUA 1CNPA 1C7WA 3E3RA 2F33A 3FIAA 1F54A 2MJWB 1L2OC 4OVNF 2K2FA 2WCEA 1QLSA 1CFPA 1M45A 2BE4A 1RK9A 2BBNA 1MWNA 3KPXA 1CFFA 3JVTC 1TNPA 1K90D 1X02A 1CDMA 2JC2A 2SCPA 1RECA 1N65A 1S1EA 1PULA 1YUTA 2WCFA 1NX3A 1MF8B 1K96A 1QX2A 4I5JA 1IRJA 4DRWA 1NSHA 2JZIA 2QPTA 3LCPC 3DF0A 1SMGA 1CLMA 1QTXA 1TNWA 1WRKA 3EK4A 2LVVA 1QV1A 2M1KB 4GNKB 2CNPA 2F3ZA 4MLWA 4XJKB 2KGBC 1C07A 2KHNA 1M46A 3LK0A 1W7IB 2JPTA 4GUKA 2OTGB 2Y5IA 3F45A 4BY5A 1EH2A 2LVIA 2F3YA 3I5FB 2JT0A 1TCFA 2EC6B 2A4JA 3SJSA 1OSAA 2L50A 1MHOA 1JFJA 1RTP1 3TUYC 4GGFA 5D69A 3O6BA 4AQJA 1AJ5A 2KGRA 2LVKA 4AQIA 1DVIA 1G4YR 2LNKA 1NP8A 1IWQA 1MR8A 4PHKA 1WRLA 4D1EA 1PALA 2LM5A 2PVBA 1NCYA 3D0YA 3GK2A 3FS7A 1OMDA 1QASA 2P6BB 2M29A 2M3WA 2OPOA 1KK7Y 2KQYA 4QJ3B 4YGCB 4ZCUA 1Y1XA 1L2OB 5HKWA 1PK0D 1YVLA 1SKTA 5HLVA 2EHBA 3DVJA 3EKJA 2KYFA 1JFKA 5TNCA 1F55A 4DCKA 3I5IC 5D7FA 1DJYA 1CFCA 4HRHA 1JUOA 1F70A 2MA2A 4MRXA 2K61A 1DJHA 4PCWA 4Q04A 1DTLA 1DJGA 3BQ3A 1UHKA 2JXLA 3CTNA 4NDDA 2IS9A 2M97A 4QJ5B 3KEVA 5HKZA 3TS5B 1TTXA 1W7JB 1QIVA 1MXLC 4MZLA 4OR9B 2CCMA 4N1GA 5AXIA 2JNFA 3SIBA 4UPGA 1KFUL 1RROA 2KOTA 5AERA 1TN4A 4MBEA 3OX5A 1TIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPQ A;  1FW4 A;  1OE9 B;  4ICB A;  1ODB A;  3VRQ A;  4CPV A;  1KFX L;  1PSB A;  1EL4 A;  2LLU A;  2LV7 A;  2MHH A;  4I5K A;  4XJK A;  2KSP A;  3WHT B;  1CDP A;  4R1E A;  1NX0 A;  1AP4 A;  1K9U A;  3SG6 A;  5AAN A;  4PE4 A;  4PAL A;  1OQP A;  1CM1 A;  4I5N B;  2OTG C;  2K2A A;  3BYA A;  5BPJ A;  1YRU B;  4OV2 A;  1A03 A;  2LMV A;  4PE0 A;  2KYC A;  4FQO A;  3I5F C;  1UP5 A;  2Q91 A;  1E8A A;  1XFV O;  3GOF A;  3IQO A;  3SG4 A;  4QJ4 B;  5AFP A;  2EC6 C;  2JU0 A;  1MUX A;  3WNX B;  1OOJ A;  4PDZ A;  3TZ1 A;  2M1U A;  3NSI A;  4ORB B;  1S6J A;  1Q80 A;  1BF5 A;  1J1E A;  1YX8 A;  2NXQ A;  2RGI A;  3CR5 X;  1BOC A;  3IQQ A;  2K7B A;  1UWO A;  2ISD A;  3TDI A;  4CFQ A;  4NQG A;  1QS7 A;  3O4Y A;  3OB2 B;  4M2P A;  1LA3 A;  1IGV A;  1YUU A;  1NUB A;  3D10 A;  1J7Q A;  1J55 A;  3GK4 X;  2G2B A;  4M2Q A;  1DF0 B;  2NCO A;  3PAL A;  1BOD A;  1A75 B;  1XFU O;  2JXC A;  4NDB A;  4TNC A;  5F6T A;  1XVJ A;  3I5H B;  1XK4 C;  1LVC D;  4FTG A;  1PRW A;  2NLN A;  3EVU A;  5CPV A;  5DKN A;  2PAL A;  3KF9 A;  1CMG A;  2LC5 A;  2CT9 A;  2WOS A;  1FI6 A;  2Y4Q A;  2BEC A;  3OP0 A;  3BUX B;  1B4C A;  2KI6 D;  1YR5 A;  3VRN A;  1KK7 Z;  1LKJ A;  1R2U A;  5DKR A;  2KFF A;  4GAO A;  2M0R A;  2LUC A;  2MRD A;  3NSL A;  3NXA A;  4N1F A;  4DS7 A;  1FF1 A;  1KCY A;  1F4Q A;  1SL8 A;  1WRZ A;  1XFY O;  2COL B;  2JQ6 A;  3TS5 C;  1DT7 B;  1KWO B;  1QX7 A;  2PAS A;  1M39 A;  1CDN A;  3M0W A;  1A4P A;  2JRF A;  4PE7 A;  1KQV A;  1B8R A;  2L0P A;  1KK8 B;  2SAS A;  1JF0 A;  1AVS A;  1IJ5 A;  1WLZ A;  2K7O A;  1PVA A;  2AUC A;  2I94 A;  5I8N A;  3VRR A;  4YGD B;  1D1O A;  2KI4 B;  2LMT A;  4WQ2 A;  1ALW A;  5PAL A;  3DVK A;  1XYD A;  1B8L A;  1DJW A;  2CXJ A;  2MLF C;  3BUM B;  1QJT A;  1YVH A;  5KSZ A;  1U5I A;  4P5O E;  1IJ6 A;  2D8N A;  1BG1 A;  1KQM C;  1FI5 A;  2PMY A;  1LIN A;  2PSR A;  1GGZ A;  1IH0 A;  2LP2 A;  4PE1 A;  3CWG A;  1AK8 A;  4C0K A;  2LP3 A;  3PLF B;  5CSI A;  3TDZ A;  1K9K A;  1CDL A;  1S36 A;  2R2I A;  1QIW A;  2WCB A;  3SG3 A;  1CLL A;  1QVI Y;  1J7P A;  2F2P A;  2KFH A;  3LL8 B;  3PM8 A;  2EGD A;  2M7L A;  1WY9 A;  3CR4 X;  4U8D A;  2LHL A;  2JUL A;  1LXF C;  3CS1 A;  4MRY A;  1QLK A;  4MSP A;  1S5G Y;  1Y1A A;  1RFJ A;  3OB1 B;  1SCM B;  3CR2 A;  3DVE A;  1DJX A;  3EK8 A;  4YI9 A;  3WHU B;  1BJF A;  3C1V A;  3EVV A;  1XO5 A;  3VGO A;  2GGM A;  2DOQ A;  1BR4 B;  2L98 A;  1GGW A;  1S3P A;  2HPS A;  3I5H C;  3K21 A;  2CBL A;  1OMR A;  2JWW A;  2O5G A;  1K9P A;  4A4C A;  4YBH B;  1B7T Y;  1K8U A;  2ZKM X;  1CKK A;  1R6P A;  2GV5 A;  2LCP A;  5KTY A;  5CSN A;  3SIA A;  2O60 A;  2ZN9 A;  4YI8 A;  3NSK A;  4HRG A;  4MZK A;  4WQ3 A;  1J1D A;  2MLE C;  1SK6 D;  1B8C A;  1B9A A;  2KBM A;  3BUN B;  1KWO C;  1QX5 B;  1JWD A;  1N0Y A;  1EG4 A;  1UUR A;  2HF5 A;  2HQW A;  2M49 B;  5AEQ A;  2LVJ A;  4ETO A;  5J3X A;  1J7R A;  1PVB A;  1QAT A;  1SY9 A;  1KQM B;  3DF0 B;  1KK8 C;  1Y0V H;  1OMV A;  4YGB B;  3FWB A;  1SNL A;  2K0J A;  4OKH A;  2BL0 C;  2KI4 C;  3AAJ A;  4JPZ B;  1V1F A;  2H61 C;  5JOL A;  4PHJ A;  4BY4 A;  5I2O A;  1V1G A;  1M63 B;  4C0J A;  1BU3 A;  1UHN A;  1C7V A;  2Y1N A;  1Y6W A;  2WC8 A;  1NYA A;  4ZCV A;  1TRF A;  1TOP A;  1XA5 A;  1XFX O;  2NCP A;  3CLN A;  1L7Z A;  2LHI A;  3AKB A;  4USL A;  1ZMZ A;  3LK1 A;  1XK4 A;  5FYX A;  1XFZ O;  4NDC A;  3AKA A;  1NCZ A;  1H4B A;  3OHM B;  3ZWH A;  1SBJ A;  3BUO B;  1M31 A;  3D0Y B;  2LMU A;  1LA0 A;  2ZN8 A;  1IQ3 A;  1SCM C;  1SCV A;  2NZ0 A;  2L4H A;  3LLE A;  1ZFS A;  1SRA A;  3BUW B;  2ZFD A;  2ZNE A;  1SR6 B;  5HYD A;  3VRP A;  2I7A A;  2M7N A;  1QVI Z;  4GPL B;  2JNX A;  4E68 A;  3DVM A;  1S6C A;  4YRU A;  1S5G Z;  4F0Z B;  3PN7 B;  2F2O A;  1N2D A;  4A4B A;  3DD4 A;  2BCB A;  1YX7 A;  1K94 A;  1CLB A;  1IG5 A;  2JT8 A;  1JC2 A;  4P2Y B;  2KAY A;  2LLS A;  1G33 A;  5G08 A;  1ALV A;  1Y1U A;  2L4I A;  2JTZ A;  1ZOT B;  3JTD B;  2Y1M A;  2MBX A;  1B7T Z;  2GGZ A;  1NX1 A;  5IBW A;  2AAO A;  1XFW O;  2BL0 B;  2B1U A;  2VRG A;  3QRX A;  3RM1 A;  1H8B A;  3OX6 A;  1VRK A;  3CGA A;  1EXR A;  1SL7 A;  3BOW B;  1WDC B;  1EG3 A;  4ORA B;  1A2X A;  3FWC A;  2MAZ A;  3A8R A;  1BLQ A;  1EJ3 A;  1YRT B;  1UHH A;  1K2H A;  1G8I A;  1HT9 A;  1CMF A;  2E6W A;  1J7O A;  1MXE A;  2KDH A;  1OZS A;  1S6I A;  2LAP A;  2OS8 B;  1RJV A;  4MEW A;  2L51 A;  1JBA A;  1BT6 A;  1A29 A;  3A4U B;  1TNX A;  1SL9 A;  1FBV A;  3EKH A;  1JSA A;  1AHR A;  2E30 A;  4HRE E;  5I2L A;  1IKU A;  2KFG A;  2HET A;  4I5L B;  2L2E A;  3I5G B;  1KFU S;  4GGF C;  1DF0 A;  3SG2 A;  1NCX A;  2AMI A;  4DIR A;  4MVF A;  5ER4 X;  1A75 A;  1TNQ A;  2K8M B;  2TN4 A;  4GBA A;  1UHI A;  1AUI B;  1KFX S;  2KAX A;  2BE6 A;  4ORC B;  1K95 A;  4CLN A;  1JF2 A;  2BKI B;  3SG5 A;  1FPW A;  4MZJ A;  2LE9 B;  4HSZ A;  1UHJ A;  1DJZ A;  2WOR A;  3H4S E;  1GQM A;  1TCO B;  2KI6 C;  1DGV A;  2L5X B;  1IQ5 A;  1S26 D;  1NWD A;  1SR6 C;  3O78 A;  1F8H A;  5K89 A;  2M8U A;  2BCA A;  3JVT B;  2I2R E;  3CZT X;  2JT3 A;  2K7D A;  3MSE B;  2ZRT A;  2KBI A;  3KO0 A;  2LLT A;  3PAT A;  5GQQ C;  2FOT A;  2G9B A;  5CSJ A;  1GJY A;  1SW8 A;  3PFV A;  3PN7 C;  1KSO A;  2BKH B;  1CM4 A;  4JQ0 D;  4IL1 A;  2I18 A;  4CID A;  4L9M A;  1DGU A;  2M9G A;  4OCI A;  4GGN A;  5ER5 A;  2KQ6 A;  4PHM A;  5KU1 A;  5HKY A;  1DJI A;  2BCX A;  3JTD C;  5CSF A;  3VRO A;  2JOJ A;  2H61 A;  3BOW A;  3AAK A;  2FCE A;  4M2O A;  1YUS A;  1NIW A;  3GK1 A;  3KHE A;  1WDC C;  2BBM A;  5JJG A;  4C0L A;  3WXA A;  1QV0 A;  3TUY B;  2FCD A;  4N5X A;  4JWQ A;  2H2K A;  3ZNI A;  4MN0 A;  1RWY A;  1AJ4 A;  1MQ1 A;  2KAV A;  2JTT A;  4AOM A;  5I2Q A;  2Q4U A;  3BXK A;  3NSO A;  2OS8 C;  5B8I B;  1NX2 A;  5DKQ A;  1UUS A;  5HLO A;  3O2P A;  3PSR A;  1OZO A;  3IF7 A;  1U5I B;  1PSR A;  1B47 A;  1ZAC A;  3HCM A;  2QAC A;  4CFR A;  1B1G A;  2KNE A;  3RLZ A;  3EK7 A;  1KSM A;  1DMO A;  1F71 A;  2WND A;  3SG7 A;  1BR1 B;  1CFD A;  1SPY A;  1K93 D;  2HQ8 A;  3I5G C;  4GFT A;  2ZND A;  1ZUZ A;  4DUQ A;  2ZRS A;  4YGA A;  4WRI A;  4XYN A;  1QXP A;  2V53 A;  3HX4 A;  2K7C A;  4YGE B;  1HQV A;  4PHN A;  1CTR A;  1F4O A;  1SYM A;  2FJU B;  2LUX A;  2F8P A;  3I5I B;  1CB1 A;  1YUR A;  2CTN A;  2PRU A;  1BMO A;  2LAN A;  1WLM A;  3EVR A;  1YTZ C;  3ICB A;  3TDU A;  1CNP A;  1C7W A;  3E3R A;  2F33 A;  3FIA A;  1F54 A;  2MJW B;  1L2O C;  4OVN F;  2K2F A;  2WCE A;  1QLS A;  1CFP A;  1M45 A;  2BE4 A;  1RK9 A;  2BBN A;  1MWN A;  3KPX A;  1CFF A;  3JVT C;  1TNP A;  1K90 D;  1X02 A;  1CDM A;  2JC2 A;  2SCP A;  1REC A;  1N65 A;  1S1E A;  1PUL A;  1YUT A;  2WCF A;  1NX3 A;  1MF8 B;  1K96 A;  1QX2 A;  4I5J A;  1IRJ A;  4DRW A;  1NSH A;  2JZI A;  2QPT A;  3LCP C;  3DF0 A;  1SMG A;  1CLM A;  1QTX A;  1TNW A;  1WRK A;  3EK4 A;  2LVV A;  1QV1 A;  2M1K B;  4GNK B;  2CNP A;  2F3Z A;  4MLW A;  4XJK B;  2KGB C;  1C07 A;  2KHN A;  1M46 A;  3LK0 A;  1W7I B;  2JPT A;  4GUK A;  2OTG B;  2Y5I A;  3F45 A;  4BY5 A;  1EH2 A;  2LVI A;  2F3Y A;  3I5F B;  2JT0 A;  1TCF A;  2EC6 B;  2A4J A;  3SJS A;  1OSA A;  2L50 A;  1MHO A;  1JFJ A;  1RTP 1;  3TUY C;  4GGF A;  5D69 A;  3O6B A;  4AQJ A;  1AJ5 A;  2KGR A;  2LVK A;  4AQI A;  1DVI A;  1G4Y R;  2LNK A;  1NP8 A;  1IWQ A;  1MR8 A;  4PHK A;  1WRL A;  4D1E A;  1PAL A;  2LM5 A;  2PVB A;  1NCY A;  3D0Y A;  3GK2 A;  3FS7 A;  1OMD A;  1QAS A;  2P6B B;  2M29 A;  2M3W A;  2OPO A;  1KK7 Y;  2KQY A;  4QJ3 B;  4YGC B;  4ZCU A;  1Y1X A;  1L2O B;  5HKW A;  1PK0 D;  1YVL A;  1SKT A;  5HLV A;  2EHB A;  3DVJ A;  3EKJ A;  2KYF A;  1JFK A;  5TNC A;  1F55 A;  4DCK A;  3I5I C;  5D7F A;  1DJY A;  1CFC A;  4HRH A;  1JUO A;  1F70 A;  2MA2 A;  4MRX A;  2K61 A;  1DJH A;  4PCW A;  4Q04 A;  1DTL A;  1DJG A;  3BQ3 A;  1UHK A;  2JXL A;  3CTN A;  4NDD A;  2IS9 A;  2M97 A;  4QJ5 B;  3KEV A;  5HKZ A;  3TS5 B;  1TTX A;  1W7J B;  1QIV A;  1MXL C;  4MZL A;  4OR9 B;  2CCM A;  4N1G A;  5AXI A;  2JNF A;  3SIB A;  4UPG A;  1KFU L;  1RRO A;  2KOT A;  5AER A;  1TN4 A;  4MBE A;  3OX5 A;  1TIZ A; 
#chains in the Genus database with same CATH topology
 1NPQ A;  1FW4 A;  1OE9 B;  4ICB A;  1ODB A;  3R1O A;  3VRQ A;  4CPV A;  1KFX L;  1PSB A;  1EL4 A;  2LLU A;  2LV7 A;  2MHH A;  4I5K A;  4XJK A;  2KSP A;  3WHT B;  1CDP A;  4R1E A;  1NX0 A;  1AP4 A;  1K9U A;  3SG6 A;  5AAN A;  4PE4 A;  4PAL A;  1OQP A;  1CM1 A;  4I5N B;  2OTG C;  2K2A A;  3BYA A;  3K1E A;  5BPJ A;  1YRU B;  4OV2 A;  1A03 A;  2LMV A;  4PE0 A;  2KYC A;  4FQO A;  3I5F C;  1UP5 A;  2Q91 A;  1E8A A;  1XFV O;  3GOF A;  3IQO A;  3SG4 A;  4QJ4 B;  5AFP A;  2EC6 C;  2JU0 A;  1MUX A;  3WNX B;  3B87 A;  1OOJ A;  4PDZ A;  3TZ1 A;  3RZS A;  2WCL A;  2M1U A;  3NSI A;  4ORB B;  1S6J A;  1Q80 A;  1BF5 A;  1J1E A;  2YGU A;  1YX8 A;  2NXQ A;  2RGI A;  3CR5 X;  1BOC A;  3IQQ A;  2K7B A;  1UWO A;  2ISD A;  1XFR A;  3TDI A;  5DIC A;  4CFQ A;  4NQG A;  1QS7 A;  3O4Y A;  3OB2 B;  4M2P A;  1LA3 A;  1IGV A;  1YUU A;  1NUB A;  3D10 A;  1J7Q A;  1J55 A;  3GK4 X;  2G2B A;  4M2Q A;  1DF0 B;  3BFB A;  2NCO A;  3PAL A;  3IVT A;  1A75 B;  1BOD A;  1XFU O;  2JXC A;  4NDB A;  4TNC A;  5F6T A;  1XVJ A;  3I5H B;  1XK4 C;  3FE8 A;  1LVC D;  4FTG A;  1PRW A;  2NLN A;  2WCK A;  3EVU A;  5CPV A;  2L5Y A;  2PAL A;  5DKN A;  3KF9 A;  1CMG A;  1OOG A;  2LC5 A;  2CT9 A;  2WOS A;  1FI6 A;  2Y4Q A;  2BEC A;  3OP0 A;  3BUX B;  1B4C A;  2KI6 D;  1YR5 A;  3VRN A;  1KK7 Z;  1LKJ A;  1R2U A;  5DKR A;  3VB1 A;  2KFF A;  4GAO A;  2M0R A;  2WCJ A;  2LUC A;  2MRD A;  3NSL A;  3NXA A;  4N1F A;  4DS7 A;  1FF1 A;  1KCY A;  1F4Q A;  1SL8 A;  1WRZ A;  1XFY O;  3B6X A;  2COL B;  2JQ6 A;  3TS5 C;  1DT7 B;  1KWO B;  4KYN A;  1QX7 A;  2PAS A;  1M39 A;  1CDN A;  3M0W A;  1A4P A;  2JRF A;  4PE7 A;  1KQV A;  3CAB A;  1B8R A;  5FI6 A;  2L0P A;  3B86 A;  1KK8 B;  2SAS A;  1JF0 A;  5FI2 A;  1AVS A;  1IJ5 A;  1WLZ A;  2K7O A;  1PVA A;  2AUC A;  2I94 A;  5I8N A;  3VRR A;  4YGD B;  1D1O A;  2KI4 B;  2LMT A;  4WQ2 A;  1ALW A;  5PAL A;  3DVK A;  1XYD A;  1B8L A;  1DJW A;  2CXJ A;  2MLF C;  3BUM B;  3D77 A;  1QJT A;  1YVH A;  5KSZ A;  3L4L A;  1U5I A;  4P5O E;  1IJ6 A;  2D8N A;  1BG1 A;  1KQM C;  1FI5 A;  2PMY A;  1LIN A;  2PSR A;  1GGZ A;  1IH0 A;  2LP2 A;  4PE1 A;  3CWG A;  1AK8 A;  3S0E A;  4C0K A;  2LP3 A;  3PLF B;  5CSI A;  3TDZ A;  1K9K A;  1CDL A;  1QWV A;  1S36 A;  2ERB A;  2R2I A;  1QIW A;  2WCB A;  2BAP A;  3Q8I A;  1CLL A;  1QVI Y;  2QEH A;  2F2P A;  2KFH A;  3LL8 B;  3PM8 A;  2EGD A;  2M7L A;  1J7P A;  1WY9 A;  3CR4 X;  4U8D A;  2LHL A;  2JUL A;  1LXF C;  2KLE A;  3CS1 A;  4MRY A;  1P28 A;  1QLK A;  4MSP A;  1S5G Y;  1Y1A A;  1RFJ A;  3OB1 B;  1SCM B;  3CR2 A;  3DVE A;  1DJX A;  3EK8 A;  4YI9 A;  3WHU B;  1BJF A;  3C1V A;  1ORG A;  3EVV A;  1XO5 A;  3FE9 A;  3VGO A;  2GGM A;  2DOQ A;  1BR4 B;  2L98 A;  1GGW A;  1S3P A;  3CYZ A;  2HPS A;  3I5H C;  3K21 A;  2CBL A;  1OMR A;  2JWW A;  2O5G A;  1K9P A;  4A4C A;  4YBH B;  1B7T Y;  3B88 A;  1K8U A;  2ZKM X;  3S0F A;  1CKK A;  1R6P A;  3PJI A;  1OOF A;  2GV5 A;  2LCP A;  5KTY A;  5CSN A;  3QME A;  4FQT A;  2PQL A;  2O60 A;  1SSE B;  2ZN9 A;  4YI8 A;  3SIA A;  3NSK A;  3L4A A;  4HRG A;  4MZK A;  4WQ3 A;  1J1D A;  2MLE C;  1SK6 D;  1B8C A;  1B9A A;  2KBM A;  3BUN B;  1KWO C;  1QX5 B;  1JWD A;  1N0Y A;  1EG4 A;  1UUR A;  2HF5 A;  2HQW A;  2M49 B;  3UNW A;  5AEQ A;  2LVJ A;  4ETO A;  5J3X A;  1J7R A;  1PVB A;  1QAT A;  1SY9 A;  1KQM B;  3DF0 B;  1KK8 C;  1Y0V H;  1OMV A;  4YGB B;  3FWB A;  1SNL A;  2K0J A;  4OKH A;  2BL0 C;  4IJ7 A;  2KI4 C;  3AAJ A;  4JPZ B;  1V1F A;  2H61 C;  5JOL A;  4PHJ A;  4BY4 A;  5I2O A;  1V1G A;  1M63 B;  4C0J A;  3R1P A;  1BU3 A;  1C3Z A;  1UHN A;  2Y1N A;  1Y6W A;  2WC8 A;  1C7V A;  1NYA A;  4ZCV A;  2WC5 A;  1TRF A;  1TOP A;  1TWO A;  1XA5 A;  1XFX O;  2NCP A;  3CLN A;  3D74 A;  1L7Z A;  2LHI A;  3AKB A;  3D75 A;  4USL A;  1ZMZ A;  3LK1 A;  1XK4 A;  1DQE A;  4PT1 A;  5FYX A;  1XFZ O;  4NDC A;  3AKA A;  1NCZ A;  1H4B A;  3OHM B;  3ZWH A;  1SBJ A;  3BUO B;  1M31 A;  3D0Y B;  2LMU A;  1LA0 A;  1OW4 A;  2ZN8 A;  1SCM C;  1SCV A;  2NZ0 A;  1IQ3 A;  2L4H A;  3LLE A;  1OOI X;  1ZFS A;  1SRA A;  3BUW B;  3L47 A;  2ZFD A;  2ZNE A;  1SR6 B;  5HYD A;  3VRP A;  2I7A A;  2M7N A;  1QVI Z;  1OOH A;  4GPL B;  1GM0 A;  2JNX A;  4E68 A;  3DVM A;  4INX A;  1S6C A;  4YRU A;  1S5G Z;  2WCM A;  4F0Z B;  3SS3 A;  3PN7 B;  2F2O A;  1N2D A;  4A4B A;  3DD4 A;  2BCB A;  1YX7 A;  1K94 A;  1CLB A;  1IG5 A;  2JT8 A;  1JC2 A;  1LS8 A;  4P2Y B;  2KAY A;  2LLS A;  1G33 A;  3SS4 A;  5G08 A;  3FE6 A;  1ALV A;  3CZ1 A;  1Y1U A;  2L4I A;  2JTZ A;  1ZOT B;  3JTD B;  2Y1M A;  2MBX A;  3V2L A;  1B7T Z;  2GGZ A;  1NX1 A;  5IBW A;  2AAO A;  1XFW O;  2BL0 B;  3CZ0 A;  2B1U A;  2VRG A;  3QRX A;  3RM1 A;  1H8B A;  3OX6 A;  1VRK A;  3CGA A;  1EXR A;  1SL7 A;  3BOW B;  1WDC B;  1EG3 A;  4ORA B;  1A2X A;  3FWC A;  2MAZ A;  3A8R A;  1BLQ A;  1EJ3 A;  1YRT B;  1UHH A;  1K2H A;  1G8I A;  1HT9 A;  1CMF A;  2E6W A;  3S0A A;  1J7O A;  1MXE A;  2KDH A;  3N7H A;  1OZS A;  1S6I A;  2LAP A;  2OS8 B;  1RJV A;  3S0G A;  4MEW A;  2L51 A;  1JBA A;  1T14 A;  1BT6 A;  1A29 A;  4JKT A;  3A4U B;  1TNX A;  1SL9 A;  1FBV A;  3EKH A;  1JSA A;  1AHR A;  2E30 A;  4HRE E;  2P70 A;  5I2L A;  1IKU A;  2KFG A;  2HET A;  4I5L B;  2L2E A;  3I5G B;  1KFU S;  4GGF C;  1DF0 A;  3SG2 A;  1NCX A;  3DY9 A;  2AMI A;  4DIR A;  4MVF A;  5ER4 X;  1A75 A;  1TNQ A;  2K8M B;  5HL1 A;  3BFH A;  2TN4 A;  4GBA A;  3CDN A;  1UHI A;  1Z2C B;  1AUI B;  1KFX S;  2KAX A;  2BE6 A;  4ORC B;  3SS5 A;  1K95 A;  3D78 A;  1JF2 A;  4CLN A;  2BKI B;  3SG5 A;  1FPW A;  4MZJ A;  2LE9 B;  4HSZ A;  1UHJ A;  1DC1 A;  4INW A;  1DJZ A;  2WOR A;  3H4S E;  1GQM A;  1TCO B;  2KI6 C;  1DGV A;  2L5X B;  1IQ5 A;  1S26 D;  1NWD A;  1SR6 C;  3O78 A;  1F8H A;  5K89 A;  2M8U A;  2BCA A;  3JVT B;  2I2R E;  3CZT X;  2JT3 A;  2K7D A;  3MSE B;  2ZRT A;  2KBI A;  3KO0 A;  2LLT A;  3O4X A;  3PAT A;  5GQQ C;  2FOT A;  4JD9 A;  2G9B A;  5CSJ A;  1GJY A;  1SW8 A;  3PFV A;  3PN7 C;  1KSO A;  2BKH B;  2KPH A;  1CM4 A;  4JQ0 D;  4IL1 A;  2I18 A;  1IIO A;  1Z4H A;  4L9M A;  4CID A;  1DGU A;  2GTE A;  2M9G A;  4OCI A;  4GGN A;  5ER5 A;  2PYQ A;  2KQ6 A;  4PHM A;  1C3Y A;  5KU1 A;  5HKY A;  3D73 A;  1DJI A;  2BCX A;  3JTD C;  5CSF A;  3VRO A;  2JOJ A;  2H61 A;  3BJH A;  3BOW A;  3AAK A;  2FCE A;  4M2O A;  3NGV A;  1YUS A;  1NIW A;  2K60 A;  3GK1 A;  3KHE A;  1WDC C;  2BBM A;  5JJG A;  3CZ2 A;  4C0L A;  3WXA A;  1QV0 A;  3TUY B;  5I94 A;  2FCD A;  4N5X A;  4JWQ A;  2H2K A;  3ZNI A;  4MN0 A;  1RWY A;  1AJ4 A;  1MQ1 A;  2KAV A;  2JTT A;  4AOM A;  5I2Q A;  2Q4U A;  3BXK A;  3NSO A;  2OS8 C;  2WCH A;  5B8I B;  1NX2 A;  3R1V A;  5DKQ A;  1UUS A;  5HLO A;  1DEK A;  3O2P A;  2L2C A;  1OZO A;  1TUZ A;  3IF7 A;  1U5I B;  3PSR A;  1PSR A;  1B47 A;  2QEV A;  1ZAC A;  3HCM A;  2QAC A;  3B7A A;  3S0B A;  4CFR A;  1B1G A;  2KNE A;  3RLZ A;  3EK7 A;  1KSM A;  1DMO A;  2QEB A;  1F71 A;  2WND A;  3SG7 A;  1BR1 B;  1CFD A;  3S0D A;  1SPY A;  1K93 D;  2HQ8 A;  3I5G C;  4GFT A;  2ZND A;  1ZUZ A;  4DUQ A;  2ZRS A;  4YGA A;  4WRI A;  4XYN A;  1QXP A;  2V53 A;  3HX4 A;  2K7C A;  4YGE B;  5FI7 A;  1HQV A;  4PHN A;  1CTR A;  1F4O A;  1SYM A;  2FJU B;  2LUX A;  2F8P A;  3I5I B;  1CB1 A;  1YUR A;  2CTN A;  2PRU A;  1BMO A;  2LAN A;  1WLM A;  3EVR A;  1YTZ C;  3ICB A;  3TDU A;  1CNP A;  1C7W A;  5EL2 A;  3E3R A;  2F33 A;  3FIA A;  1F54 A;  2MJW B;  1L2O C;  4OVN F;  2K2F A;  2WCE A;  1QLS A;  3UO9 A;  1CFP A;  1M45 A;  2BE4 A;  2QDI A;  1RK9 A;  2BBN A;  1MWN A;  3KPX A;  4F7F A;  3OBV A;  3PM2 A;  1CFF A;  3JVT C;  1TNP A;  1K90 D;  1X02 A;  1CDM A;  2JC2 A;  2SCP A;  1REC A;  1N65 A;  1S1E A;  1PUL A;  1YUT A;  2WCF A;  1NX3 A;  1MF8 B;  1K96 A;  1QX2 A;  4I5J A;  1IRJ A;  4DRW A;  1NSH A;  2JZI A;  2QPT A;  3LCP C;  3DF0 A;  2KLD A;  1SMG A;  1CLM A;  1QTX A;  1TNW A;  1WRK A;  2H8V A;  3EK4 A;  2LVV A;  1QV1 A;  2M1K B;  4GNK B;  2CNP A;  2F3Z A;  4MLW A;  4XJK B;  2KGB C;  1C07 A;  2KHN A;  1M46 A;  3LK0 A;  1W7I B;  2JPT A;  4GUK A;  2OTG B;  2Y5I A;  3F45 A;  4BY5 A;  3DZT A;  1EH2 A;  2LVI A;  2F3Y A;  3I5F B;  2JT0 A;  1TCF A;  2EC6 B;  2A4J A;  3SJS A;  1OSA A;  2L50 A;  2QEO A;  1MHO A;  1JFJ A;  1RTP 1;  3TUY C;  4GGF A;  5D69 A;  3O6B A;  2FJY A;  4AQJ A;  1AJ5 A;  2KGR A;  2LVK A;  4AQI A;  1DVI A;  1G4Y R;  2LNK A;  1NP8 A;  1IWQ A;  1MR8 A;  3D76 A;  4PHK A;  1WRL A;  4D1E A;  1PAL A;  2LM5 A;  2PVB A;  1NCY A;  3D0Y A;  3DYE A;  3FS7 A;  3GK2 A;  1OMD A;  1QAS A;  5D3O A;  2P6B B;  2M29 A;  2M3W A;  3EG5 B;  2OPO A;  1KK7 Y;  2KQY A;  4QJ3 B;  3DXL A;  4YGC B;  4ZCU A;  1Y1X A;  4OZD A;  1L2O B;  5HKW A;  1PK0 D;  1YVL A;  1SKT A;  5HLV A;  2EHB A;  3OGN A;  3DVJ A;  3EKJ A;  2KYF A;  1JFK A;  5TNC A;  1TUJ A;  3NHI A;  4DCK A;  1F55 A;  3I5I C;  3BFA A;  5D7F A;  1DJY A;  1CFC A;  4HRH A;  1JUO A;  1F70 A;  2MA2 A;  4MRX A;  1DEL A;  3NHT A;  2K61 A;  1DJH A;  2P71 A;  4PCW A;  4Q04 A;  1DTL A;  1DJG A;  3BQ3 A;  1UHK A;  2JXL A;  3CTN A;  4NDD A;  2IS9 A;  2M97 A;  4QJ5 B;  2BNX A;  3KEV A;  5HKZ A;  3TS5 B;  1TTX A;  1W7J B;  1QIV A;  3R72 A;  1MXL C;  4MZL A;  4OR9 B;  2CCM A;  4N1G A;  2WC6 A;  2JNF A;  5AXI A;  3SIB A;  4UPG A;  1KFU L;  1RRO A;  2KOT A;  5AER A;  1TN4 A;  4MBE A;  3SG3 A;  2JPO A;  3OX5 A;  1W9Z A;  1TIZ A; 
#chains in the Genus database with same CATH homology
 1NPQ A;  1FW4 A;  1OE9 B;  4ICB A;  1ODB A;  3VRQ A;  4CPV A;  1KFX L;  1PSB A;  1EL4 A;  2LLU A;  2LV7 A;  2MHH A;  4I5K A;  4XJK A;  2KSP A;  3WHT B;  1CDP A;  4R1E A;  1NX0 A;  1AP4 A;  1K9U A;  3SG6 A;  5AAN A;  4PE4 A;  4PAL A;  1OQP A;  1CM1 A;  4I5N B;  2OTG C;  2K2A A;  3BYA A;  5BPJ A;  1YRU B;  4OV2 A;  1A03 A;  2LMV A;  4PE0 A;  2KYC A;  4FQO A;  3I5F C;  1UP5 A;  2Q91 A;  1E8A A;  1XFV O;  3GOF A;  3IQO A;  3SG4 A;  4QJ4 B;  5AFP A;  2EC6 C;  2JU0 A;  1MUX A;  3WNX B;  1OOJ A;  4PDZ A;  3TZ1 A;  2M1U A;  3NSI A;  4ORB B;  1S6J A;  1Q80 A;  1BF5 A;  1J1E A;  1YX8 A;  2NXQ A;  2RGI A;  3CR5 X;  1BOC A;  3IQQ A;  2K7B A;  1UWO A;  2ISD A;  3TDI A;  4CFQ A;  4NQG A;  1QS7 A;  3O4Y A;  3OB2 B;  4M2P A;  1LA3 A;  1IGV A;  1YUU A;  1NUB A;  3D10 A;  1J7Q A;  1J55 A;  3GK4 X;  2G2B A;  4M2Q A;  1DF0 B;  2NCO A;  3PAL A;  1BOD A;  1A75 B;  1XFU O;  2JXC A;  4NDB A;  4TNC A;  5F6T A;  1XVJ A;  3I5H B;  1XK4 C;  1LVC D;  4FTG A;  1PRW A;  2NLN A;  3EVU A;  5CPV A;  5DKN A;  2PAL A;  3KF9 A;  1CMG A;  2LC5 A;  2CT9 A;  2WOS A;  1FI6 A;  2Y4Q A;  2BEC A;  3OP0 A;  3BUX B;  1B4C A;  2KI6 D;  1YR5 A;  3VRN A;  1KK7 Z;  1LKJ A;  1R2U A;  5DKR A;  2KFF A;  4GAO A;  2M0R A;  2LUC A;  2MRD A;  3NSL A;  3NXA A;  4N1F A;  4DS7 A;  1FF1 A;  1KCY A;  1F4Q A;  1SL8 A;  1WRZ A;  1XFY O;  2COL B;  2JQ6 A;  3TS5 C;  1DT7 B;  1KWO B;  1QX7 A;  2PAS A;  1M39 A;  1CDN A;  3M0W A;  1A4P A;  2JRF A;  4PE7 A;  1KQV A;  1B8R A;  2L0P A;  1KK8 B;  2SAS A;  1JF0 A;  1AVS A;  1IJ5 A;  1WLZ A;  2K7O A;  1PVA A;  2AUC A;  2I94 A;  5I8N A;  3VRR A;  4YGD B;  1D1O A;  2KI4 B;  2LMT A;  4WQ2 A;  1ALW A;  5PAL A;  3DVK A;  1XYD A;  1B8L A;  1DJW A;  2CXJ A;  2MLF C;  3BUM B;  1QJT A;  1YVH A;  5KSZ A;  1U5I A;  4P5O E;  1IJ6 A;  2D8N A;  1BG1 A;  1KQM C;  1FI5 A;  2PMY A;  1LIN A;  2PSR A;  1GGZ A;  1IH0 A;  2LP2 A;  4PE1 A;  3CWG A;  1AK8 A;  4C0K A;  2LP3 A;  3PLF B;  5CSI A;  3TDZ A;  1K9K A;  1CDL A;  1S36 A;  2R2I A;  1QIW A;  2WCB A;  3SG3 A;  1CLL A;  1QVI Y;  1J7P A;  2F2P A;  2KFH A;  3LL8 B;  3PM8 A;  2EGD A;  2M7L A;  1WY9 A;  3CR4 X;  4U8D A;  2LHL A;  2JUL A;  1LXF C;  3CS1 A;  4MRY A;  1QLK A;  4MSP A;  1S5G Y;  1Y1A A;  1RFJ A;  3OB1 B;  1SCM B;  3CR2 A;  3DVE A;  1DJX A;  3EK8 A;  4YI9 A;  3WHU B;  1BJF A;  3C1V A;  3EVV A;  1XO5 A;  3VGO A;  2GGM A;  2DOQ A;  1BR4 B;  2L98 A;  1GGW A;  1S3P A;  2HPS A;  3I5H C;  3K21 A;  2CBL A;  1OMR A;  2JWW A;  2O5G A;  1K9P A;  4A4C A;  4YBH B;  1B7T Y;  1K8U A;  2ZKM X;  1CKK A;  1R6P A;  2GV5 A;  2LCP A;  5KTY A;  5CSN A;  3SIA A;  2O60 A;  2ZN9 A;  4YI8 A;  3NSK A;  4HRG A;  4MZK A;  4WQ3 A;  1J1D A;  2MLE C;  1SK6 D;  1B8C A;  1B9A A;  2KBM A;  3BUN B;  1KWO C;  1QX5 B;  1JWD A;  1N0Y A;  1EG4 A;  1UUR A;  2HF5 A;  2HQW A;  2M49 B;  5AEQ A;  2LVJ A;  4ETO A;  5J3X A;  1J7R A;  1PVB A;  1QAT A;  1SY9 A;  1KQM B;  3DF0 B;  1KK8 C;  1Y0V H;  1OMV A;  4YGB B;  3FWB A;  1SNL A;  2K0J A;  4OKH A;  2BL0 C;  2KI4 C;  3AAJ A;  4JPZ B;  1V1F A;  2H61 C;  5JOL A;  4PHJ A;  4BY4 A;  5I2O A;  1V1G A;  1M63 B;  4C0J A;  1BU3 A;  1UHN A;  1C7V A;  2Y1N A;  1Y6W A;  2WC8 A;  1NYA A;  4ZCV A;  1TRF A;  1TOP A;  1XA5 A;  1XFX O;  2NCP A;  3CLN A;  1L7Z A;  2LHI A;  3AKB A;  4USL A;  1ZMZ A;  3LK1 A;  1XK4 A;  5FYX A;  1XFZ O;  4NDC A;  3AKA A;  1NCZ A;  1H4B A;  3OHM B;  3ZWH A;  1SBJ A;  3BUO B;  1M31 A;  3D0Y B;  2LMU A;  1LA0 A;  2ZN8 A;  1IQ3 A;  1SCM C;  1SCV A;  2NZ0 A;  2L4H A;  3LLE A;  1ZFS A;  1SRA A;  3BUW B;  2ZFD A;  2ZNE A;  1SR6 B;  5HYD A;  3VRP A;  2I7A A;  2M7N A;  1QVI Z;  4GPL B;  2JNX A;  4E68 A;  3DVM A;  1S6C A;  4YRU A;  1S5G Z;  4F0Z B;  3PN7 B;  2F2O A;  1N2D A;  4A4B A;  3DD4 A;  2BCB A;  1YX7 A;  1K94 A;  1CLB A;  1IG5 A;  2JT8 A;  1JC2 A;  4P2Y B;  2KAY A;  2LLS A;  1G33 A;  5G08 A;  1ALV A;  1Y1U A;  2L4I A;  2JTZ A;  1ZOT B;  3JTD B;  2Y1M A;  2MBX A;  1B7T Z;  2GGZ A;  1NX1 A;  5IBW A;  2AAO A;  1XFW O;  2BL0 B;  2B1U A;  2VRG A;  3QRX A;  3RM1 A;  1H8B A;  3OX6 A;  1VRK A;  3CGA A;  1EXR A;  1SL7 A;  3BOW B;  1WDC B;  1EG3 A;  4ORA B;  1A2X A;  3FWC A;  2MAZ A;  3A8R A;  1BLQ A;  1EJ3 A;  1YRT B;  1UHH A;  1K2H A;  1G8I A;  1HT9 A;  1CMF A;  2E6W A;  1J7O A;  1MXE A;  2KDH A;  1OZS A;  1S6I A;  2LAP A;  2OS8 B;  1RJV A;  4MEW A;  2L51 A;  1JBA A;  1BT6 A;  1A29 A;  3A4U B;  1TNX A;  1SL9 A;  1FBV A;  3EKH A;  1JSA A;  1AHR A;  2E30 A;  4HRE E;  5I2L A;  1IKU A;  2KFG A;  2HET A;  4I5L B;  2L2E A;  3I5G B;  1KFU S;  4GGF C;  1DF0 A;  3SG2 A;  1NCX A;  2AMI A;  4DIR A;  4MVF A;  5ER4 X;  1A75 A;  1TNQ A;  2K8M B;  2TN4 A;  4GBA A;  1UHI A;  1AUI B;  1KFX S;  2KAX A;  2BE6 A;  4ORC B;  1K95 A;  4CLN A;  1JF2 A;  2BKI B;  3SG5 A;  1FPW A;  4MZJ A;  2LE9 B;  4HSZ A;  1UHJ A;  1DJZ A;  2WOR A;  3H4S E;  1GQM A;  1TCO B;  2KI6 C;  1DGV A;  2L5X B;  1IQ5 A;  1S26 D;  1NWD A;  1SR6 C;  3O78 A;  1F8H A;  5K89 A;  2M8U A;  2BCA A;  3JVT B;  2I2R E;  3CZT X;  2JT3 A;  2K7D A;  3MSE B;  2ZRT A;  2KBI A;  3KO0 A;  2LLT A;  3PAT A;  5GQQ C;  2FOT A;  2G9B A;  5CSJ A;  1GJY A;  1SW8 A;  3PFV A;  3PN7 C;  1KSO A;  2BKH B;  1CM4 A;  4JQ0 D;  4IL1 A;  2I18 A;  4CID A;  4L9M A;  1DGU A;  2M9G A;  4OCI A;  4GGN A;  5ER5 A;  2KQ6 A;  4PHM A;  5KU1 A;  5HKY A;  1DJI A;  2BCX A;  3JTD C;  5CSF A;  3VRO A;  2JOJ A;  2H61 A;  3BOW A;  3AAK A;  2FCE A;  4M2O A;  1YUS A;  1NIW A;  3GK1 A;  3KHE A;  1WDC C;  2BBM A;  5JJG A;  4C0L A;  3WXA A;  1QV0 A;  3TUY B;  2FCD A;  4N5X A;  4JWQ A;  2H2K A;  3ZNI A;  4MN0 A;  1RWY A;  1AJ4 A;  1MQ1 A;  2KAV A;  2JTT A;  4AOM A;  5I2Q A;  2Q4U A;  3BXK A;  3NSO A;  2OS8 C;  5B8I B;  1NX2 A;  5DKQ A;  1UUS A;  5HLO A;  3O2P A;  3PSR A;  1OZO A;  3IF7 A;  1U5I B;  1PSR A;  1B47 A;  1ZAC A;  3HCM A;  2QAC A;  4CFR A;  1B1G A;  2KNE A;  3RLZ A;  3EK7 A;  1KSM A;  1DMO A;  1F71 A;  2WND A;  3SG7 A;  1BR1 B;  1CFD A;  1SPY A;  1K93 D;  2HQ8 A;  3I5G C;  4GFT A;  2ZND A;  1ZUZ A;  4DUQ A;  2ZRS A;  4YGA A;  4WRI A;  4XYN A;  1QXP A;  2V53 A;  3HX4 A;  2K7C A;  4YGE B;  1HQV A;  4PHN A;  1CTR A;  1F4O A;  1SYM A;  2FJU B;  2LUX A;  2F8P A;  3I5I B;  1CB1 A;  1YUR A;  2CTN A;  2PRU A;  1BMO A;  2LAN A;  1WLM A;  3EVR A;  1YTZ C;  3ICB A;  3TDU A;  1CNP A;  1C7W A;  3E3R A;  2F33 A;  3FIA A;  1F54 A;  2MJW B;  1L2O C;  4OVN F;  2K2F A;  2WCE A;  1QLS A;  1CFP A;  1M45 A;  2BE4 A;  1RK9 A;  2BBN A;  1MWN A;  3KPX A;  1CFF A;  3JVT C;  1TNP A;  1K90 D;  1X02 A;  1CDM A;  2JC2 A;  2SCP A;  1REC A;  1N65 A;  1S1E A;  1PUL A;  1YUT A;  2WCF A;  1NX3 A;  1MF8 B;  1K96 A;  1QX2 A;  4I5J A;  1IRJ A;  4DRW A;  1NSH A;  2JZI A;  2QPT A;  3LCP C;  3DF0 A;  1SMG A;  1CLM A;  1QTX A;  1TNW A;  1WRK A;  3EK4 A;  2LVV A;  1QV1 A;  2M1K B;  4GNK B;  2CNP A;  2F3Z A;  4MLW A;  4XJK B;  2KGB C;  1C07 A;  2KHN A;  1M46 A;  3LK0 A;  1W7I B;  2JPT A;  4GUK A;  2OTG B;  2Y5I A;  3F45 A;  4BY5 A;  1EH2 A;  2LVI A;  2F3Y A;  3I5F B;  2JT0 A;  1TCF A;  2EC6 B;  2A4J A;  3SJS A;  1OSA A;  2L50 A;  1MHO A;  1JFJ A;  1RTP 1;  3TUY C;  4GGF A;  5D69 A;  3O6B A;  4AQJ A;  1AJ5 A;  2KGR A;  2LVK A;  4AQI A;  1DVI A;  1G4Y R;  2LNK A;  1NP8 A;  1IWQ A;  1MR8 A;  4PHK A;  1WRL A;  4D1E A;  1PAL A;  2LM5 A;  2PVB A;  1NCY A;  3D0Y A;  3GK2 A;  3FS7 A;  1OMD A;  1QAS A;  2P6B B;  2M29 A;  2M3W A;  2OPO A;  1KK7 Y;  2KQY A;  4QJ3 B;  4YGC B;  4ZCU A;  1Y1X A;  1L2O B;  5HKW A;  1PK0 D;  1YVL A;  1SKT A;  5HLV A;  2EHB A;  3DVJ A;  3EKJ A;  2KYF A;  1JFK A;  5TNC A;  1F55 A;  4DCK A;  3I5I C;  5D7F A;  1DJY A;  1CFC A;  4HRH A;  1JUO A;  1F70 A;  2MA2 A;  4MRX A;  2K61 A;  1DJH A;  4PCW A;  4Q04 A;  1DTL A;  1DJG A;  3BQ3 A;  1UHK A;  2JXL A;  3CTN A;  4NDD A;  2IS9 A;  2M97 A;  4QJ5 B;  3KEV A;  5HKZ A;  3TS5 B;  1TTX A;  1W7J B;  1QIV A;  1MXL C;  4MZL A;  4OR9 B;  2CCM A;  4N1G A;  5AXI A;  2JNF A;  3SIB A;  4UPG A;  1KFU L;  1RRO A;  2KOT A;  5AER A;  1TN4 A;  4MBE A;  3OX5 A;  1TIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...