3C1VA

The 1.5 a crystal structure of ca2+-bound s100a4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
93
structure length
93
Chain Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Ca(2+)-form and Ca(2+)-binding kinetics of metastasis-associated protein, S100A4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium binding protein
molecule keywords Protein S100-A4
total genus 39
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3c1vA00
3DD4A 3O2PA 1NCYA 5JOLA 2R2IA 2SASA 2L5XB 2FCDA 1YRUB 2LE9B 4NDCA 2I7AA 1NYAA 2KGBC 3PATA 1RECA 1NCXA 4N1GA 2K8MB 1E8AA 1L7ZA 2F2OA 1S6IA 1QLSA 2LCPA 2JPTA 2K7BA 1CMFA 1LA0A 1FPWA 2ZRSA 1OE9B 2QPTA 3LK0A 4QJ4B 1JFJA 1N2DA 4XJKB 3I5HB 4XYNA 4WQ3A 2JNFA 3TDIA 1XK4C 2HF5A 4MZJA 1AJ5A 3SG4A 1W7IB 2BL0B 2K7DA 1MUXA 2WOSA 4ORAB 4M2OA 1QX5B 1A4PA 5D69A 3SIAA 2I18A 4MSPA 1MQ1A 2HPSA 3AAKA 3TS5B 4AQJA 1ZFSA 3BQ3A 2CXJA 2EGDA 3CR5X 2KSPA 1K9KA 3A8RA 3M0WA 1R6PA 1SMGA 4PE0A 1FI6A 1KK7Y 1QV0A 3BOWA 3BUWB 3I5GC 3O4YA 3WNXB 1IH0A 3FIAA 1M63B 2JNXA 1J7OA 1H8BA 2RGIA 2KNEA 4N1FA 2F2PA 2D8NA 4TNCA 4WQ2A 4JWQA 1F8HA 3VRPA 3A4UB 4YGEB 2Y1MA 2KQYA 1PRWA 2SCPA 1PULA 1CMGA 2LVJA 2FCEA 3CGAA 3ZNIA 1OSAA 3SIBA 1YUUA 1TOPA 2K7OA 1UP5A 4BY4A 1OQPA 3WXAA 1QIWA 3NSOA 1WRZA 2I94A 1CFFA 1QATA 1RWYA 1UHKA 3IF7A 4PHKA 1QV1A 5ER5A 1UURA 4A4CA 2M49B 1SCVA 4CFRA 1S5GZ 1KSOA 1S1EA 1YUTA 2M8UA 1K9UA 4M2QA 1NX2A 1NX0A 4GGFA 4PHMA 5HKYA 4DRWA 1B47A 3GOFA 1F70A 1GJYA 3PFVA 1YTZC 3GK1A 1BF5A 1SY9A 1OZSA 1PSRA 1WLMA 1J55A 1F4OA 2ISDA 1N65A 5IBWA 4ORCB 2KOTA 1YVHA 1C7VA 1XFXO 5CSIA 1OMRA 1TNXA 2PRUA 2CTNA 4GFTA 5I8NA 1BOCA 4F0ZB 1JSAA 1DF0A 2JTTA 3JTDB 4UPGA 1RTP1 2JOJA 2JULA 1EG3A 2LVVA 2WCEA 1ZOTB 1V1FA 2KI4C 2M1KB 3DVKA 2GGMA 1SKTA 1KCYA 2JT3A 2PALA 2KBMA 1UHIA 1QVIZ 1H4BA 2JXCA 2IS9A 1EXRA 2K2AA 5KTYA 1JC2A 5G08A 4YI9A 1LINA 1LXFC 1BT6A 1Y1AA 4XJKA 1SBJA 1Y0VH 4QJ3B 3OX6A 1U5IB 3DF0A 4DIRA 1FF1A 2KDHA 3KHEA 2KHNA 2Q91A 4NDBA 4MN0A 1QASA 2LLSA 4QJ5B 1QLKA 1ODBA 1QXPA 2BKHB 1MXLC 4ZCUA 2KI4B 1XFZO 3D0YB 4CLNA 1B8RA 2M7LA 5K89A 1ZMZA 1DJWA 4DCKA 1CFPA 1D1OA 2L4IA 2LVIA 2L2EA 1BU3A 1KSMA 3TUYC 1FBVA 2MLEC 3KEVA 1AVSA 1UHHA 1ZACA 3EK7A 1XVJA 1EH2A 3FS7A 1NX1A 1S36A 3EVVA 2GGZA 4ORBB 1XYDA 2KGRA 3KO0A 1WY9A 4JPZB 1QX2A 4YGBB 1HT9A 1PVBA 2H61C 2Q4UA 3CR2A 2LUCA 2M29A 1KFXL 1LA3A 1JUOA 1EJ3A 4I5LB 1TIZA 2LP2A 2ZKMX 4MRYA 1YURA 1K93D 4A4BA 1TTXA 4CFQA 1ZUZA 4JQ0D 2A4JA 2MBXA 4I5JA 2PSRA 2BECA 2KI6D 2BKIB 1JF2A 2L0PA 3IQOA 1TCOB 1NUBA 1S26D 2CNPA 4PE1A 5ER4X 1A03A 1XFUO 1CNPA 3CTNA 1CLLA 4P2YB 2F33A 1SL7A 2MA2A 1K2HA 1IJ6A 5AEQA 1TNWA 3HCMA 2JU0A 1PSBA 2ZNEA 1F54A 1B7TY 1KFUL 1NX3A 2E6WA 1UHJA 4OR9B 3RLZA 1M31A 4PHJA 5HKZA 1BMOA 4PALA 1IWQA 1CLBA 2LHIA 3TDZA 3VRRA 4I5KA 2K61A 2NZ0A 2KFGA 2L50A 4MZKA 5FYXA 1SRAA 1WDCC 5AXIA 2AMIA 4OCIA 1KQMB 2MHHA 3VGOA 4U8DA 2BL0C 2WNDA 1CFDA 2F3YA 3DVEA 3PM8A 1CM1A 2L51A 2WCFA 1AK8A 1KQMC 1OZOA 2KYFA 1U5IA 1CDLA 3DF0B 4C0JA 4ETOA 2TN4A 4GUKA 1DVIA 2JRFA 3O78A 5BPJA 3TS5C 3FWBA 3PSRA 3RM1A 4AOMA 1SL9A 3CZTX 5HLVA 3TZ1A 1B9AA 2LUXA 3FWCA 1DMOA 1KWOC 3CR4X 5KSZA 1X02A 1S6JA 3I5IB 3K21A 1KQVA 3SG5A 1QJTA 4HRGA 1ALVA 2HQWA 5B8IB 2LNKA 1MHOA 2HETA 1KWOB 3I5IC 1SR6C 1IGVA 1RROA 5AANA 1F4QA 4OVNF 4HSZA 1J7QA 2MLFC 5CPVA 3VRQA 3NSIA 2FJUB 3OP0A 1NP8A 2KFFA 4MVFA 1M45A 1RFJA 4IL1A 3BOWB 3DVJA 1KK8C 1Y1XA 4YI8A 3TDUA 1Y6WA 3MSEB 1XO5A 1J1DA 3E3RA 1JBAA 2F8PA 3I5FB 4MZLA 1MXEA 5J3XA 2MAZA 1G8IA 1TCFA 2H2KA 1KK8B 2LV7A 5I2LA 2OTGB 1BG1A 1YX8A 1CDNA 1RK9A 1B8LA 1CDPA 3SJSA 2L98A 3AKAA 4AQIA 2PMYA 4YBHB 3LLEA 3PLFB 5KU1A 1GGWA 2DOQA 2O60A 1F55A 3CWGA 4MEWA 4GBAA 2NLNA 1L2OC 4P5OE 5JJGA 4I5NB 2BCXA 1MWNA 2F3ZA 1FI5A 2Y1NA 3SG6A 1KFUS 1QVIY 1F71A 1NWDA 5GQQC 1DJXA 2COLB 1NIWA 2JT0A 2K2FA 2P6BB 1S6CA 2OS8B 1SW8A 4GNKB 1WRLA 1DJZA 1J1EA 2GV5A 2LANA 1M39A 2NCPA 4ZCVA 2O5GA 5PALA 3KF9A 1XA5A 1XFYO 4YGDB 2OS8C 4HREE 1K96A 4DUQA 2K0JA 2PVBA 1CFCA 4PDZA 1BJFA 2CBLA 3EKHA 2AUCA 5CSNA 1WLZA 1DJHA 1DGUA 1YRTB 2HQ8A 1UHNA 4OKHA 4BY5A 1IQ3A 1QX7A 1Y1UA 1JF0A 3BYAA 2EC6C 5D7FA 1IG5A 1A75B 1IRJA 3CS1A 1SR6B 4PHNA 1AJ4A 4N5XA 1SNLA 1HQVA 2WC8A 4D1EA 2EC6B 2WORA 1MF8B 5DKRA 2LC5A 2EHBA 2L4HA 3AAJA 5TNCA 5HYDA 4R1EA 2LMVA 3I5GB 3BUOB 1IQ5A 1BR4B 3JVTB 1CDMA 3O6BA 1SL8A 1R2UA 3TUYB 5AFPA 2OTGC 1NSHA 1IJ5A 3JVTC 2KI6C 1JFKA 2LLUA 3WHTB 2KFHA 2KBIA 2JXLA 1V1GA 2BE6A 3SG7A 5I2QA 1YVLA 3EVUA 4OV2A 1J7PA 3AKBA 2ZN8A 1XK4A 3D0YA 1EG4A 4FQOA 3EK8A 1DJIA 1NCZA 3QRXA 2H61A 1MR8A 2CCMA 4ICBA 2JZIA 1RJVA 4PE7A 1BLQA 1Q80A 1C07A 4MBEA 1K94A 1GGZA 1SCMC 2LP3A 1KFXS 1SK6D 1QTXA 2ZRTA 3BUMB 1B7TZ 3PALA 1OOJA 1FW4A 2M0RA 2VRGA 1OMVA 3ZWHA 1TNQA 3SG3A 2KAVA 3BUNB 2K7CA 3LL8B 2MJWB 1OMDA 4GGNA 3I5FC 2JC2A 1GQMA 3PN7C 5F6TA 1IKUA 5DKNA 3EK4A 5CSJA 1J7RA 1KK7Z 2B1UA 1TN4A 5HLOA 1QIVA 5AERA 1NPQA 1DT7B 1S5GY 3PN7B 3GK4X 1CM4A 3D10A 3OX5A 3EVRA 1CTRA 1YX7A 2BCAA 1PALA 1TNPA 1BODA 1LVCD 1DTLA 4C0LA 1QS7A 1SCMB 2Y4QA 1AP4A 1AUIB 2NCOA 1EL4A 2I2RE 1A75A 5CSFA 2ZN9A 1XFVO 4PE4A 2BCBA 1SYMA 4YGCB 1S3PA 1L2OB 3DVMA 3CLNA 4Q04A 3VRNA 1LKJA 2M3WA 1UUSA 2CT9A 4YRUA 4C0KA 3JTDC 3IQQA 1BR1B 4L9MA 3SG2A 1WDCB 3HX4A 2KAYA 2LMTA 1G33A 3LCPC 4CIDA 3NXAA 3WHUB 3NSLA 2WCBA 1K90D 3KPXA 1AHRA 2JTZA 3F45A 3BUXB 1B4CA 3OB1B 2JT8A 3I5HC 1UWOA 2NXQA 1DF0B 2M7NA 4MRXA 5HKWA 1C7WA 1DGVA 2E30A 4MLWA 4PCWA 2G9BA 3C1VA 1JWDA 3NSKA 1G4YR 4NDDA 1B8CA 2M1UA 3BXKA 4NQGA 4USLA 3H4SE 3VROA 4GAOA 2G2BA 4E68A 2M9GA 4FTGA 2M97A 2JQ6A 1M46A 2LAPA 4DS7A 4M2PA 1ALWA 1CB1A 3GK2A 1PVAA 2LHLA 4GGFC 4YGAA 4WRIA 2BBNA 4GPLB 1B1GA 2Y5IA 2AAOA 2KYCA 2JWWA 3OHMB 1A2XA 2LVKA 3ICBA 4CPVA 2LLTA 2PASA 1VRKA 1DJGA 1WRKA 2ZFDA 5I2OA 3LK1A 1YUSA 2V53A 1DJYA 2LM5A 3OB2B 1K8UA 2QACA 1CKKA 1A29A 1PK0D 1K95A 1W7JB 1XFWO 2KAXA 1CLMA 2BE4A 1N0YA 1YR5A 4HRHA 5DKQA 2FOTA 3EKJA 2BBMA 1K9PA 1TRFA 2ZNDA 2MRDA 1SPYA 2OPOA 2LMUA 2KQ6A
chains in the Genus database with same CATH superfamily
3DD4A 3O2PA 1NCYA 5JOLA 2R2IA 2SASA 3SS5A 2L5XB 2FCDA 3D73A 1YRUB 2LE9B 3NHIA 4NDCA 2I7AA 1NYAA 2QEOA 2KGBC 2ERBA 3PATA 1RECA 1NCXA 2KPHA 4N1GA 2K8MB 2KLDA 1E8AA 1L7ZA 2F2OA 1S6IA 1QLSA 2LCPA 2JPTA 2K7BA 1CMFA 1LA0A 1TUZA 1FPWA 2ZRSA 1OE9B 2QPTA 3LK0A 4QJ4B 1JFJA 1N2DA 4XJKB 3OBVA 3I5HB 4XYNA 1C3YA 4WQ3A 2JNFA 3TDIA 1XK4C 2HF5A 4MZJA 1AJ5A 3SG4A 3K1EA 2BL0B 1T14A 1W7IB 1MUXA 2K7DA 2WOSA 4ORAB 4M2OA 1QX5B 1A4PA 5D69A 3SIAA 2I18A 4MSPA 1MQ1A 2HPSA 3AAKA 3TS5B 4AQJA 1ZFSA 3BQ3A 2CXJA 1DQEA 2EGDA 3CR5X 2KSPA 1K9KA 3A8RA 3L47A 3M0WA 1R6PA 1SMGA 2JPOA 2QEBA 4PE0A 1FI6A 1KK7Y 1QV0A 3BOWA 3BUWB 3I5GC 3O4YA 3WNXB 1IH0A 3FIAA 1M63B 1OOIX 2JNXA 3FE8A 1QWVA 2RGIA 2GTEA 2KNEA 4N1FA 1J7OA 1H8BA 2F2PA 2D8NA 4TNCA 4WQ2A 4JWQA 1F8HA 3VRPA 3A4UB 4YGEB 2Y1MA 2KQYA 1PRWA 2SCPA 1PULA 1CMGA 2LVJA 2FCEA 2K60A 2P70A 3CGAA 3ZNIA 1OSAA 3SIBA 1YUUA 1TOPA 2K7OA 1UP5A 4BY4A 1OQPA 3WXAA 1QIWA 3NSOA 1WRZA 2I94A 1CFFA 3R72A 1QATA 1RWYA 1UHKA 3IF7A 4PHKA 1QV1A 5ER5A 1UURA 4A4CA 2M49B 1SCVA 3B6XA 4CFRA 1S5GZ 1KSOA 1S1EA 1YUTA 2M8UA 1K9UA 4M2QA 3L4LA 1NX2A 1NX0A 4GGFA 4PHMA 5HKYA 4DRWA 1B47A 3BFHA 3GOFA 1F70A 3O4XA 1GJYA 2YGUA 3PFVA 1YTZC 3GK1A 1BF5A 2WCJA 1SY9A 4IJ7A 1OZSA 1PSRA 1WLMA 1J55A 1F4OA 2ISDA 1N65A 5IBWA 3BJHA 3BFAA 2KOTA 4ORCB 3S0BA 1YVHA 5I94A 3V2LA 1C7VA 1XFXO 5CSIA 1OMRA 1TNXA 2PRUA 2CTNA 4GFTA 5I8NA 1BOCA 4F0ZB 1GM0A 1JSAA 1DF0A 2JTTA 3DZTA 3JTDB 4UPGA 1RTP1 2JOJA 1SSEB 2JULA 1EG3A 2LVVA 2WCEA 1ZOTB 1V1FA 2KI4C 2M1KB 3DVKA 2GGMA 1SKTA 1KCYA 2JT3A 2PALA 2KBMA 1UHIA 1QVIZ 1H4BA 2JXCA 1Z4HA 2IS9A 1EXRA 2K2AA 1OW4A 5KTYA 1JC2A 5G08A 4YI9A 1LINA 2KLEA 1LXFC 1BT6A 1Y1AA 4XJKA 1SBJA 1Y0VH 4QJ3B 3OX6A 1U5IB 3DF0A 4DIRA 1FF1A 2KDHA 3KHEA 2KHNA 2P71A 2Q91A 4NDBA 4MN0A 3PM2A 1QASA 2LLSA 3R1PA 4QJ5B 1QLKA 1ODBA 1QXPA 2BKHB 1MXLC 4ZCUA 2KI4B 3RZSA 1XFZO 3D0YB 4CLNA 1B8RA 2M7LA 5K89A 1ZMZA 4INWA 1DJWA 4DCKA 1CFPA 1D1OA 2L4IA 2LVIA 3S0AA 2L2EA 1BU3A 1KSMA 3TUYC 1FBVA 2MLEC 3KEVA 3R1VA 1AVSA 1UHHA 1ZACA 3EK7A 1XVJA 1EH2A 3FS7A 1TUJA 1NX1A 1S36A 3EVVA 2GGZA 4ORBB 1XYDA 2KGRA 3KO0A 1WY9A 4JPZB 1QX2A 4YGBB 2FJYA 1HT9A 1PVBA 2H61C 2Q4UA 3S0EA 3CR2A 2LUCA 2M29A 1KFXL 1LA3A 1JUOA 1EJ3A 4I5LB 1TIZA 2LP2A 2ZKMX 4MRYA 1YURA 1K93D 4A4BA 1TTXA 4CFQA 1ZUZA 3CZ2A 2A4JA 4JQ0D 2MBXA 4I5JA 3DYEA 4F7FA 2PSRA 2BECA 2KI6D 2BKIB 1JF2A 2L0PA 3IQOA 1TCOB 1NUBA 1S26D 2CNPA 4PE1A 5ER4X 1A03A 1XFUO 1CNPA 3CTNA 1CLLA 4P2YB 2F33A 1SL7A 2MA2A 5HL1A 1K2HA 3CZ0A 1IJ6A 5AEQA 1TNWA 3HCMA 2JU0A 1PSBA 2ZNEA 1F54A 3UO9A 1B7TY 2L5YA 1KFUL 1NX3A 3PJIA 2E6WA 1UHJA 1W9ZA 4OR9B 3RLZA 3S0FA 1M31A 1Z2CB 3L4AA 4PHJA 5HKZA 1BMOA 4PALA 1IWQA 1CLBA 1IIOA 2LHIA 3TDZA 3VRRA 4I5KA 2K61A 2NZ0A 2KFGA 2L50A 4MZKA 5FYXA 1SRAA 1WDCC 5AXIA 2AMIA 4OCIA 1KQMB 2MHHA 3VGOA 2QEVA 3B87A 3CZ1A 4U8DA 2BL0C 2WNDA 1CFDA 2F3YA 3DVEA 3PM8A 1CM1A 2L51A 2WCFA 1AK8A 3N7HA 1KQMC 1OZOA 2KYFA 3FE9A 1U5IA 1CDLA 3DF0B 3UNWA 4C0JA 4ETOA 2TN4A 3EG5B 4GUKA 1DVIA 2JRFA 3O78A 3R1OA 3TS5C 3FWBA 2WCMA 3PSRA 3RM1A 5BPJA 4AOMA 1SL9A 3CZTX 5HLVA 3TZ1A 1B9AA 2LUXA 3FWCA 1DMOA 1KWOC 3CR4X 5KSZA 1X02A 1S6JA 3I5IB 3K21A 1KQVA 3SG5A 3NHTA 1QJTA 4HRGA 1ALVA 2HQWA 5B8IB 2LNKA 3OGNA 1MHOA 2HETA 1KWOB 3I5IC 1SR6C 1IGVA 1RROA 4JD9A 5AANA 1F4QA 2BNXA 4OVNF 4HSZA 1J7QA 2MLFC 5CPVA 3VRQA 3NSIA 2FJUB 3OP0A 1NP8A 2KFFA 4MVFA 1M45A 1RFJA 4OZDA 4IL1A 3BOWB 3SS3A 3DVJA 1KK8C 1Y1XA 4YI8A 3TDUA 1Y6WA 3MSEB 1XO5A 1J1DA 4JKTA 3E3RA 1JBAA 2F8PA 3I5FB 4MZLA 3CYZA 1MXEA 5J3XA 2MAZA 1G8IA 1TCFA 2H2KA 1KK8B 2LV7A 5I2LA 2OTGB 3S0GA 1BG1A 3D75A 1YX8A 1CDNA 1OOGA 1RK9A 1B8LA 1CDPA 3SJSA 2L98A 3AKAA 4AQIA 2PMYA 4YBHB 3LLEA 3PLFB 5KU1A 1GGWA 2DOQA 2O60A 1F55A 3CWGA 4MEWA 4GBAA 4FQTA 2NLNA 1L2OC 3D74A 4P5OE 5JJGA 4I5NB 2BCXA 1MWNA 2F3ZA 1FI5A 2Y1NA 3SG6A 2WCLA 1C3ZA 1KFUS 1QVIY 1F71A 5EL2A 3BFBA 1NWDA 5FI2A 1DJXA 5GQQC 2COLB 1NIWA 2JT0A 2K2FA 2P6BB 1S6CA 2OS8B 1SW8A 3FE6A 1WRLA 1DJZA 4GNKB 3D76A 1J1EA 2GV5A 2LANA 1M39A 2NCPA 4ZCVA 2O5GA 5PALA 3KF9A 1XA5A 1XFYO 4YGDB 2OS8C 4HREE 1K96A 4DUQA 2K0JA 2PVBA 1CFCA 4INXA 4PDZA 1BJFA 2CBLA 3EKHA 2AUCA 5CSNA 1WLZA 1DJHA 1DGUA 5FI7A 1YRTB 2HQ8A 1UHNA 4OKHA 4BY5A 1IQ3A 1QX7A 1Y1UA 1JF0A 3BYAA 2EC6C 5D7FA 1IG5A 1A75B 1IRJA 3CS1A 1SR6B 4PHNA 1AJ4A 4N5XA 1SNLA 3B88A 1HQVA 2WC8A 3VB1A 5FI6A 4D1EA 2EC6B 2WORA 1MF8B 3IVTA 5DKRA 2LC5A 2EHBA 2L4HA 3AAJA 5TNCA 5HYDA 4R1EA 2LMVA 3I5GB 3BUOB 1IQ5A 1BR4B 3JVTB 1CDMA 4KYNA 3O6BA 1XFRA 2WC6A 1SL8A 1R2UA 3DXLA 3CABA 3TUYB 5AFPA 2OTGC 1NSHA 1IJ5A 3JVTC 2KI6C 1JFKA 2LLUA 3WHTB 2KFHA 2KBIA 2JXLA 1V1GA 2BE6A 1DELA 3SG7A 1YVLA 3EVUA 4OV2A 5I2QA 1J7PA 3AKBA 2ZN8A 1XK4A 3D0YA 1EG4A 2QEHA 4FQOA 5DICA 3EK8A 1DJIA 1NCZA 3QRXA 2H61A 1MR8A 2CCMA 4ICBA 2JZIA 1RJVA 4PE7A 2PQLA 3D77A 1Q80A 1BLQA 1C07A 4MBEA 1K94A 1GGZA 1SCMC 2LP3A 1KFXS 1SK6D 1QTXA 2ZRTA 3BUMB 1B7TZ 3PALA 1OOJA 1FW4A 2M0RA 2VRGA 1OMVA 3ZWHA 1TNQA 3SG3A 2KAVA 3BUNB 2K7CA 3LL8B 2MJWB 1OMDA 4GGNA 2L2CA 3I5FC 1ORGA 1GQMA 2JC2A 3PN7C 5F6TA 1IKUA 5DKNA 3EK4A 5CSJA 1J7RA 1KK7Z 2BAPA 2B1UA 1TN4A 5HLOA 1QIVA 5AERA 1NPQA 1DT7B 1S5GY 3PN7B 3GK4X 1CM4A 3D10A 3OX5A 3EVRA 1CTRA 1YX7A 2BCAA 1PALA 1TNPA 1LS8A 1BODA 3DY9A 3QMEA 1LVCD 1DTLA 4C0LA 2H8VA 1QS7A 1SCMB 2Y4QA 1AP4A 4PT1A 1TWOA 1AUIB 2NCOA 1EL4A 2I2RE 1A75A 5CSFA 1OOFA 1XFVO 2ZN9A 4PE4A 2BCBA 3SS4A 1SYMA 4YGCB 1S3PA 1L2OB 3DVMA 3CLNA 4Q04A 3VRNA 1LKJA 2WCKA 2M3WA 3S0DA 1UUSA 2CT9A 4YRUA 4C0KA 3JTDC 3IQQA 1BR1B 4L9MA 1OOHA 3SG2A 1WDCB 3HX4A 2KAYA 2LMTA 2WCHA 1G33A 3LCPC 4CIDA 3NXAA 3WHUB 3NSLA 2WCBA 2WC5A 1K90D 3KPXA 1AHRA 1DC1A 2JTZA 3F45A 3BUXB 5D3OA 1B4CA 3OB1B 2JT8A 3I5HC 1UWOA 2NXQA 1DF0B 2M7NA 3Q8IA 4MRXA 1C7WA 1DGVA 2E30A 4MLWA 4PCWA 5HKWA 2G9BA 3C1VA 1JWDA 3NSKA 1G4YR 4NDDA 1B8CA 2M1UA 3BXKA 4NQGA 4USLA 3H4SE 1P28A 3VROA 2PYQA 4GAOA 2G2BA 4E68A 2M9GA 4FTGA 2M97A 2JQ6A 1M46A 2LAPA 4DS7A 2QDIA 4M2PA 1ALWA 1CB1A 3GK2A 1PVAA 2LHLA 3CDNA 4GGFC 4YGAA 4WRIA 2BBNA 4GPLB 1B1GA 2Y5IA 2AAOA 2KYCA 2JWWA 3OHMB 1A2XA 2LVKA 3ICBA 4CPVA 2LLTA 2PASA 1VRKA 1DJGA 1WRKA 2ZFDA 3NGVA 5I2OA 3LK1A 1YUSA 2V53A 3B86A 1DJYA 2LM5A 3OB2B 1K8UA 2QACA 1CKKA 1A29A 1PK0D 1K95A 1W7JB 3B7AA 1XFWO 1DEKA 2KAXA 1CLMA 2BE4A 1N0YA 1YR5A 4HRHA 3D78A 5DKQA 2FOTA 3EKJA 2BBMA 1K9PA 1TRFA 2ZNDA 2MRDA 1SPYA 2OPOA 2LMUA 2KQ6A
chains in the Genus database with same CATH topology
3DD4A 3O2PA 1NCYA 5JOLA 2R2IA 2SASA 2L5XB 2FCDA 1YRUB 2LE9B 4NDCA 2I7AA 1NYAA 2KGBC 3PATA 1RECA 1NCXA 4N1GA 2K8MB 1E8AA 1L7ZA 2F2OA 1S6IA 1QLSA 2LCPA 2JPTA 2K7BA 1CMFA 1LA0A 1FPWA 2ZRSA 1OE9B 2QPTA 3LK0A 4QJ4B 1JFJA 1N2DA 4XJKB 3I5HB 4XYNA 4WQ3A 2JNFA 3TDIA 1XK4C 2HF5A 4MZJA 1AJ5A 3SG4A 1W7IB 2BL0B 2K7DA 1MUXA 2WOSA 4ORAB 4M2OA 1QX5B 1A4PA 5D69A 3SIAA 2I18A 4MSPA 1MQ1A 2HPSA 3AAKA 3TS5B 4AQJA 1ZFSA 3BQ3A 2CXJA 2EGDA 3CR5X 2KSPA 1K9KA 3A8RA 3M0WA 1R6PA 1SMGA 4PE0A 1FI6A 1KK7Y 1QV0A 3BOWA 3BUWB 3I5GC 3O4YA 3WNXB 1IH0A 3FIAA 1M63B 2JNXA 1J7OA 1H8BA 2RGIA 2KNEA 4N1FA 2F2PA 2D8NA 4TNCA 4WQ2A 4JWQA 1F8HA 3VRPA 3A4UB 4YGEB 2Y1MA 2KQYA 1PRWA 2SCPA 1PULA 1CMGA 2LVJA 2FCEA 3CGAA 3ZNIA 1OSAA 3SIBA 1YUUA 1TOPA 2K7OA 1UP5A 4BY4A 1OQPA 3WXAA 1QIWA 3NSOA 1WRZA 2I94A 1CFFA 1QATA 1RWYA 1UHKA 3IF7A 4PHKA 1QV1A 5ER5A 1UURA 4A4CA 2M49B 1SCVA 4CFRA 1S5GZ 1KSOA 1S1EA 1YUTA 2M8UA 1K9UA 4M2QA 1NX2A 1NX0A 4GGFA 4PHMA 5HKYA 4DRWA 1B47A 3GOFA 1F70A 1GJYA 3PFVA 1YTZC 3GK1A 1BF5A 1SY9A 1OZSA 1PSRA 1WLMA 1J55A 1F4OA 2ISDA 1N65A 5IBWA 4ORCB 2KOTA 1YVHA 1C7VA 1XFXO 5CSIA 1OMRA 1TNXA 2PRUA 2CTNA 4GFTA 5I8NA 1BOCA 4F0ZB 1JSAA 1DF0A 2JTTA 3JTDB 4UPGA 1RTP1 2JOJA 2JULA 1EG3A 2LVVA 2WCEA 1ZOTB 1V1FA 2KI4C 2M1KB 3DVKA 2GGMA 1SKTA 1KCYA 2JT3A 2PALA 2KBMA 1UHIA 1QVIZ 1H4BA 2JXCA 2IS9A 1EXRA 2K2AA 5KTYA 1JC2A 5G08A 4YI9A 1LINA 1LXFC 1BT6A 1Y1AA 4XJKA 1SBJA 1Y0VH 4QJ3B 3OX6A 1U5IB 3DF0A 4DIRA 1FF1A 2KDHA 3KHEA 2KHNA 2Q91A 4NDBA 4MN0A 1QASA 2LLSA 4QJ5B 1QLKA 1ODBA 1QXPA 2BKHB 1MXLC 4ZCUA 2KI4B 1XFZO 3D0YB 4CLNA 1B8RA 2M7LA 5K89A 1ZMZA 1DJWA 4DCKA 1CFPA 1D1OA 2L4IA 2LVIA 2L2EA 1BU3A 1KSMA 3TUYC 1FBVA 2MLEC 3KEVA 1AVSA 1UHHA 1ZACA 3EK7A 1XVJA 1EH2A 3FS7A 1NX1A 1S36A 3EVVA 2GGZA 4ORBB 1XYDA 2KGRA 3KO0A 1WY9A 4JPZB 1QX2A 4YGBB 1HT9A 1PVBA 2H61C 2Q4UA 3CR2A 2LUCA 2M29A 1KFXL 1LA3A 1JUOA 1EJ3A 4I5LB 1TIZA 2LP2A 2ZKMX 4MRYA 1YURA 1K93D 4A4BA 1TTXA 4CFQA 1ZUZA 4JQ0D 2A4JA 2MBXA 4I5JA 2PSRA 2BECA 2KI6D 2BKIB 1JF2A 2L0PA 3IQOA 1TCOB 1NUBA 1S26D 2CNPA 4PE1A 5ER4X 1A03A 1XFUO 1CNPA 3CTNA 1CLLA 4P2YB 2F33A 1SL7A 2MA2A 1K2HA 1IJ6A 5AEQA 1TNWA 3HCMA 2JU0A 1PSBA 2ZNEA 1F54A 1B7TY 1KFUL 1NX3A 2E6WA 1UHJA 4OR9B 3RLZA 1M31A 4PHJA 5HKZA 1BMOA 4PALA 1IWQA 1CLBA 2LHIA 3TDZA 3VRRA 4I5KA 2K61A 2NZ0A 2KFGA 2L50A 4MZKA 5FYXA 1SRAA 1WDCC 5AXIA 2AMIA 4OCIA 1KQMB 2MHHA 3VGOA 4U8DA 2BL0C 2WNDA 1CFDA 2F3YA 3DVEA 3PM8A 1CM1A 2L51A 2WCFA 1AK8A 1KQMC 1OZOA 2KYFA 1U5IA 1CDLA 3DF0B 4C0JA 4ETOA 2TN4A 4GUKA 1DVIA 2JRFA 3O78A 5BPJA 3TS5C 3FWBA 3PSRA 3RM1A 4AOMA 1SL9A 3CZTX 5HLVA 3TZ1A 1B9AA 2LUXA 3FWCA 1DMOA 1KWOC 3CR4X 5KSZA 1X02A 1S6JA 3I5IB 3K21A 1KQVA 3SG5A 1QJTA 4HRGA 1ALVA 2HQWA 5B8IB 2LNKA 1MHOA 2HETA 1KWOB 3I5IC 1SR6C 1IGVA 1RROA 5AANA 1F4QA 4OVNF 4HSZA 1J7QA 2MLFC 5CPVA 3VRQA 3NSIA 2FJUB 3OP0A 1NP8A 2KFFA 4MVFA 1M45A 1RFJA 4IL1A 3BOWB 3DVJA 1KK8C 1Y1XA 4YI8A 3TDUA 1Y6WA 3MSEB 1XO5A 1J1DA 3E3RA 1JBAA 2F8PA 3I5FB 4MZLA 1MXEA 5J3XA 2MAZA 1G8IA 1TCFA 2H2KA 1KK8B 2LV7A 5I2LA 2OTGB 1BG1A 1YX8A 1CDNA 1RK9A 1B8LA 1CDPA 3SJSA 2L98A 3AKAA 4AQIA 2PMYA 4YBHB 3LLEA 3PLFB 5KU1A 1GGWA 2DOQA 2O60A 1F55A 3CWGA 4MEWA 4GBAA 2NLNA 1L2OC 4P5OE 5JJGA 4I5NB 2BCXA 1MWNA 2F3ZA 1FI5A 2Y1NA 3SG6A 1KFUS 1QVIY 1F71A 1NWDA 5GQQC 1DJXA 2COLB 1NIWA 2JT0A 2K2FA 2P6BB 1S6CA 2OS8B 1SW8A 4GNKB 1WRLA 1DJZA 1J1EA 2GV5A 2LANA 1M39A 2NCPA 4ZCVA 2O5GA 5PALA 3KF9A 1XA5A 1XFYO 4YGDB 2OS8C 4HREE 1K96A 4DUQA 2K0JA 2PVBA 1CFCA 4PDZA 1BJFA 2CBLA 3EKHA 2AUCA 5CSNA 1WLZA 1DJHA 1DGUA 1YRTB 2HQ8A 1UHNA 4OKHA 4BY5A 1IQ3A 1QX7A 1Y1UA 1JF0A 3BYAA 2EC6C 5D7FA 1IG5A 1A75B 1IRJA 3CS1A 1SR6B 4PHNA 1AJ4A 4N5XA 1SNLA 1HQVA 2WC8A 4D1EA 2EC6B 2WORA 1MF8B 5DKRA 2LC5A 2EHBA 2L4HA 3AAJA 5TNCA 5HYDA 4R1EA 2LMVA 3I5GB 3BUOB 1IQ5A 1BR4B 3JVTB 1CDMA 3O6BA 1SL8A 1R2UA 3TUYB 5AFPA 2OTGC 1NSHA 1IJ5A 3JVTC 2KI6C 1JFKA 2LLUA 3WHTB 2KFHA 2KBIA 2JXLA 1V1GA 2BE6A 3SG7A 5I2QA 1YVLA 3EVUA 4OV2A 1J7PA 3AKBA 2ZN8A 1XK4A 3D0YA 1EG4A 4FQOA 3EK8A 1DJIA 1NCZA 3QRXA 2H61A 1MR8A 2CCMA 4ICBA 2JZIA 1RJVA 4PE7A 1BLQA 1Q80A 1C07A 4MBEA 1K94A 1GGZA 1SCMC 2LP3A 1KFXS 1SK6D 1QTXA 2ZRTA 3BUMB 1B7TZ 3PALA 1OOJA 1FW4A 2M0RA 2VRGA 1OMVA 3ZWHA 1TNQA 3SG3A 2KAVA 3BUNB 2K7CA 3LL8B 2MJWB 1OMDA 4GGNA 3I5FC 2JC2A 1GQMA 3PN7C 5F6TA 1IKUA 5DKNA 3EK4A 5CSJA 1J7RA 1KK7Z 2B1UA 1TN4A 5HLOA 1QIVA 5AERA 1NPQA 1DT7B 1S5GY 3PN7B 3GK4X 1CM4A 3D10A 3OX5A 3EVRA 1CTRA 1YX7A 2BCAA 1PALA 1TNPA 1BODA 1LVCD 1DTLA 4C0LA 1QS7A 1SCMB 2Y4QA 1AP4A 1AUIB 2NCOA 1EL4A 2I2RE 1A75A 5CSFA 2ZN9A 1XFVO 4PE4A 2BCBA 1SYMA 4YGCB 1S3PA 1L2OB 3DVMA 3CLNA 4Q04A 3VRNA 1LKJA 2M3WA 1UUSA 2CT9A 4YRUA 4C0KA 3JTDC 3IQQA 1BR1B 4L9MA 3SG2A 1WDCB 3HX4A 2KAYA 2LMTA 1G33A 3LCPC 4CIDA 3NXAA 3WHUB 3NSLA 2WCBA 1K90D 3KPXA 1AHRA 2JTZA 3F45A 3BUXB 1B4CA 3OB1B 2JT8A 3I5HC 1UWOA 2NXQA 1DF0B 2M7NA 4MRXA 5HKWA 1C7WA 1DGVA 2E30A 4MLWA 4PCWA 2G9BA 3C1VA 1JWDA 3NSKA 1G4YR 4NDDA 1B8CA 2M1UA 3BXKA 4NQGA 4USLA 3H4SE 3VROA 4GAOA 2G2BA 4E68A 2M9GA 4FTGA 2M97A 2JQ6A 1M46A 2LAPA 4DS7A 4M2PA 1ALWA 1CB1A 3GK2A 1PVAA 2LHLA 4GGFC 4YGAA 4WRIA 2BBNA 4GPLB 1B1GA 2Y5IA 2AAOA 2KYCA 2JWWA 3OHMB 1A2XA 2LVKA 3ICBA 4CPVA 2LLTA 2PASA 1VRKA 1DJGA 1WRKA 2ZFDA 5I2OA 3LK1A 1YUSA 2V53A 1DJYA 2LM5A 3OB2B 1K8UA 2QACA 1CKKA 1A29A 1PK0D 1K95A 1W7JB 1XFWO 2KAXA 1CLMA 2BE4A 1N0YA 1YR5A 4HRHA 5DKQA 2FOTA 3EKJA 2BBMA 1K9PA 1TRFA 2ZNDA 2MRDA 1SPYA 2OPOA 2LMUA 2KQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD4 A;  3O2P A;  1NCY A;  5JOL A;  2R2I A;  2SAS A;  2L5X B;  2FCD A;  1YRU B;  2LE9 B;  4NDC A;  2I7A A;  1NYA A;  2KGB C;  3PAT A;  1REC A;  1NCX A;  4N1G A;  2K8M B;  1E8A A;  1L7Z A;  2F2O A;  1S6I A;  1QLS A;  2LCP A;  2JPT A;  2K7B A;  1CMF A;  1LA0 A;  1FPW A;  2ZRS A;  1OE9 B;  2QPT A;  3LK0 A;  4QJ4 B;  1JFJ A;  1N2D A;  4XJK B;  3I5H B;  4XYN A;  4WQ3 A;  2JNF A;  3TDI A;  1XK4 C;  2HF5 A;  4MZJ A;  1AJ5 A;  3SG4 A;  1W7I B;  2BL0 B;  2K7D A;  1MUX A;  2WOS A;  4ORA B;  4M2O A;  1QX5 B;  1A4P A;  5D69 A;  3SIA A;  2I18 A;  4MSP A;  1MQ1 A;  2HPS A;  3AAK A;  3TS5 B;  4AQJ A;  1ZFS A;  3BQ3 A;  2CXJ A;  2EGD A;  3CR5 X;  2KSP A;  1K9K A;  3A8R A;  3M0W A;  1R6P A;  1SMG A;  4PE0 A;  1FI6 A;  1KK7 Y;  1QV0 A;  3BOW A;  3BUW B;  3I5G C;  3O4Y A;  3WNX B;  1IH0 A;  3FIA A;  1M63 B;  2JNX A;  1J7O A;  1H8B A;  2RGI A;  2KNE A;  4N1F A;  2F2P A;  2D8N A;  4TNC A;  4WQ2 A;  4JWQ A;  1F8H A;  3VRP A;  3A4U B;  4YGE B;  2Y1M A;  2KQY A;  1PRW A;  2SCP A;  1PUL A;  1CMG A;  2LVJ A;  2FCE A;  3CGA A;  3ZNI A;  1OSA A;  3SIB A;  1YUU A;  1TOP A;  2K7O A;  1UP5 A;  4BY4 A;  1OQP A;  3WXA A;  1QIW A;  3NSO A;  1WRZ A;  2I94 A;  1CFF A;  1QAT A;  1RWY A;  1UHK A;  3IF7 A;  4PHK A;  1QV1 A;  5ER5 A;  1UUR A;  4A4C A;  2M49 B;  1SCV A;  4CFR A;  1S5G Z;  1KSO A;  1S1E A;  1YUT A;  2M8U A;  1K9U A;  4M2Q A;  1NX2 A;  1NX0 A;  4GGF A;  4PHM A;  5HKY A;  4DRW A;  1B47 A;  3GOF A;  1F70 A;  1GJY A;  3PFV A;  1YTZ C;  3GK1 A;  1BF5 A;  1SY9 A;  1OZS A;  1PSR A;  1WLM A;  1J55 A;  1F4O A;  2ISD A;  1N65 A;  5IBW A;  4ORC B;  2KOT A;  1YVH A;  1C7V A;  1XFX O;  5CSI A;  1OMR A;  1TNX A;  2PRU A;  2CTN A;  4GFT A;  5I8N A;  1BOC A;  4F0Z B;  1JSA A;  1DF0 A;  2JTT A;  3JTD B;  4UPG A;  1RTP 1;  2JOJ A;  2JUL A;  1EG3 A;  2LVV A;  2WCE A;  1ZOT B;  1V1F A;  2KI4 C;  2M1K B;  3DVK A;  2GGM A;  1SKT A;  1KCY A;  2JT3 A;  2PAL A;  2KBM A;  1UHI A;  1QVI Z;  1H4B A;  2JXC A;  2IS9 A;  1EXR A;  2K2A A;  5KTY A;  1JC2 A;  5G08 A;  4YI9 A;  1LIN A;  1LXF C;  1BT6 A;  1Y1A A;  4XJK A;  1SBJ A;  1Y0V H;  4QJ3 B;  3OX6 A;  1U5I B;  3DF0 A;  4DIR A;  1FF1 A;  2KDH A;  3KHE A;  2KHN A;  2Q91 A;  4NDB A;  4MN0 A;  1QAS A;  2LLS A;  4QJ5 B;  1QLK A;  1ODB A;  1QXP A;  2BKH B;  1MXL C;  4ZCU A;  2KI4 B;  1XFZ O;  3D0Y B;  4CLN A;  1B8R A;  2M7L A;  5K89 A;  1ZMZ A;  1DJW A;  4DCK A;  1CFP A;  1D1O A;  2L4I A;  2LVI A;  2L2E A;  1BU3 A;  1KSM A;  3TUY C;  1FBV A;  2MLE C;  3KEV A;  1AVS A;  1UHH A;  1ZAC A;  3EK7 A;  1XVJ A;  1EH2 A;  3FS7 A;  1NX1 A;  1S36 A;  3EVV A;  2GGZ A;  4ORB B;  1XYD A;  2KGR A;  3KO0 A;  1WY9 A;  4JPZ B;  1QX2 A;  4YGB B;  1HT9 A;  1PVB A;  2H61 C;  2Q4U A;  3CR2 A;  2LUC A;  2M29 A;  1KFX L;  1LA3 A;  1JUO A;  1EJ3 A;  4I5L B;  1TIZ A;  2LP2 A;  2ZKM X;  4MRY A;  1YUR A;  1K93 D;  4A4B A;  1TTX A;  4CFQ A;  1ZUZ A;  4JQ0 D;  2A4J A;  2MBX A;  4I5J A;  2PSR A;  2BEC A;  2KI6 D;  2BKI B;  1JF2 A;  2L0P A;  3IQO A;  1TCO B;  1NUB A;  1S26 D;  2CNP A;  4PE1 A;  5ER4 X;  1A03 A;  1XFU O;  1CNP A;  3CTN A;  1CLL A;  4P2Y B;  2F33 A;  1SL7 A;  2MA2 A;  1K2H A;  1IJ6 A;  5AEQ A;  1TNW A;  3HCM A;  2JU0 A;  1PSB A;  2ZNE A;  1F54 A;  1B7T Y;  1KFU L;  1NX3 A;  2E6W A;  1UHJ A;  4OR9 B;  3RLZ A;  1M31 A;  4PHJ A;  5HKZ A;  1BMO A;  4PAL A;  1IWQ A;  1CLB A;  2LHI A;  3TDZ A;  3VRR A;  4I5K A;  2K61 A;  2NZ0 A;  2KFG A;  2L50 A;  4MZK A;  5FYX A;  1SRA A;  1WDC C;  5AXI A;  2AMI A;  4OCI A;  1KQM B;  2MHH A;  3VGO A;  4U8D A;  2BL0 C;  2WND A;  1CFD A;  2F3Y A;  3DVE A;  3PM8 A;  1CM1 A;  2L51 A;  2WCF A;  1AK8 A;  1KQM C;  1OZO A;  2KYF A;  1U5I A;  1CDL A;  3DF0 B;  4C0J A;  4ETO A;  2TN4 A;  4GUK A;  1DVI A;  2JRF A;  3O78 A;  5BPJ A;  3TS5 C;  3FWB A;  3PSR A;  3RM1 A;  4AOM A;  1SL9 A;  3CZT X;  5HLV A;  3TZ1 A;  1B9A A;  2LUX A;  3FWC A;  1DMO A;  1KWO C;  3CR4 X;  5KSZ A;  1X02 A;  1S6J A;  3I5I B;  3K21 A;  1KQV A;  3SG5 A;  1QJT A;  4HRG A;  1ALV A;  2HQW A;  5B8I B;  2LNK A;  1MHO A;  2HET A;  1KWO B;  3I5I C;  1SR6 C;  1IGV A;  1RRO A;  5AAN A;  1F4Q A;  4OVN F;  4HSZ A;  1J7Q A;  2MLF C;  5CPV A;  3VRQ A;  3NSI A;  2FJU B;  3OP0 A;  1NP8 A;  2KFF A;  4MVF A;  1M45 A;  1RFJ A;  4IL1 A;  3BOW B;  3DVJ A;  1KK8 C;  1Y1X A;  4YI8 A;  3TDU A;  1Y6W A;  3MSE B;  1XO5 A;  1J1D A;  3E3R A;  1JBA A;  2F8P A;  3I5F B;  4MZL A;  1MXE A;  5J3X A;  2MAZ A;  1G8I A;  1TCF A;  2H2K A;  1KK8 B;  2LV7 A;  5I2L A;  2OTG B;  1BG1 A;  1YX8 A;  1CDN A;  1RK9 A;  1B8L A;  1CDP A;  3SJS A;  2L98 A;  3AKA A;  4AQI A;  2PMY A;  4YBH B;  3LLE A;  3PLF B;  5KU1 A;  1GGW A;  2DOQ A;  2O60 A;  1F55 A;  3CWG A;  4MEW A;  4GBA A;  2NLN A;  1L2O C;  4P5O E;  5JJG A;  4I5N B;  2BCX A;  1MWN A;  2F3Z A;  1FI5 A;  2Y1N A;  3SG6 A;  1KFU S;  1QVI Y;  1F71 A;  1NWD A;  5GQQ C;  1DJX A;  2COL B;  1NIW A;  2JT0 A;  2K2F A;  2P6B B;  1S6C A;  2OS8 B;  1SW8 A;  4GNK B;  1WRL A;  1DJZ A;  1J1E A;  2GV5 A;  2LAN A;  1M39 A;  2NCP A;  4ZCV A;  2O5G A;  5PAL A;  3KF9 A;  1XA5 A;  1XFY O;  4YGD B;  2OS8 C;  4HRE E;  1K96 A;  4DUQ A;  2K0J A;  2PVB A;  1CFC A;  4PDZ A;  1BJF A;  2CBL A;  3EKH A;  2AUC A;  5CSN A;  1WLZ A;  1DJH A;  1DGU A;  1YRT B;  2HQ8 A;  1UHN A;  4OKH A;  4BY5 A;  1IQ3 A;  1QX7 A;  1Y1U A;  1JF0 A;  3BYA A;  2EC6 C;  5D7F A;  1IG5 A;  1A75 B;  1IRJ A;  3CS1 A;  1SR6 B;  4PHN A;  1AJ4 A;  4N5X A;  1SNL A;  1HQV A;  2WC8 A;  4D1E A;  2EC6 B;  2WOR A;  1MF8 B;  5DKR A;  2LC5 A;  2EHB A;  2L4H A;  3AAJ A;  5TNC A;  5HYD A;  4R1E A;  2LMV A;  3I5G B;  3BUO B;  1IQ5 A;  1BR4 B;  3JVT B;  1CDM A;  3O6B A;  1SL8 A;  1R2U A;  3TUY B;  5AFP A;  2OTG C;  1NSH A;  1IJ5 A;  3JVT C;  2KI6 C;  1JFK A;  2LLU A;  3WHT B;  2KFH A;  2KBI A;  2JXL A;  1V1G A;  2BE6 A;  3SG7 A;  5I2Q A;  1YVL A;  3EVU A;  4OV2 A;  1J7P A;  3AKB A;  2ZN8 A;  1XK4 A;  3D0Y A;  1EG4 A;  4FQO A;  3EK8 A;  1DJI A;  1NCZ A;  3QRX A;  2H61 A;  1MR8 A;  2CCM A;  4ICB A;  2JZI A;  1RJV A;  4PE7 A;  1BLQ A;  1Q80 A;  1C07 A;  4MBE A;  1K94 A;  1GGZ A;  1SCM C;  2LP3 A;  1KFX S;  1SK6 D;  1QTX A;  2ZRT A;  3BUM B;  1B7T Z;  3PAL A;  1OOJ A;  1FW4 A;  2M0R A;  2VRG A;  1OMV A;  3ZWH A;  1TNQ A;  3SG3 A;  2KAV A;  3BUN B;  2K7C A;  3LL8 B;  2MJW B;  1OMD A;  4GGN A;  3I5F C;  2JC2 A;  1GQM A;  3PN7 C;  5F6T A;  1IKU A;  5DKN A;  3EK4 A;  5CSJ A;  1J7R A;  1KK7 Z;  2B1U A;  1TN4 A;  5HLO A;  1QIV A;  5AER A;  1NPQ A;  1DT7 B;  1S5G Y;  3PN7 B;  3GK4 X;  1CM4 A;  3D10 A;  3OX5 A;  3EVR A;  1CTR A;  1YX7 A;  2BCA A;  1PAL A;  1TNP A;  1BOD A;  1LVC D;  1DTL A;  4C0L A;  1QS7 A;  1SCM B;  2Y4Q A;  1AP4 A;  1AUI B;  2NCO A;  1EL4 A;  2I2R E;  1A75 A;  5CSF A;  2ZN9 A;  1XFV O;  4PE4 A;  2BCB A;  1SYM A;  4YGC B;  1S3P A;  1L2O B;  3DVM A;  3CLN A;  4Q04 A;  3VRN A;  1LKJ A;  2M3W A;  1UUS A;  2CT9 A;  4YRU A;  4C0K A;  3JTD C;  3IQQ A;  1BR1 B;  4L9M A;  3SG2 A;  1WDC B;  3HX4 A;  2KAY A;  2LMT A;  1G33 A;  3LCP C;  4CID A;  3NXA A;  3WHU B;  3NSL A;  2WCB A;  1K90 D;  3KPX A;  1AHR A;  2JTZ A;  3F45 A;  3BUX B;  1B4C A;  3OB1 B;  2JT8 A;  3I5H C;  1UWO A;  2NXQ A;  1DF0 B;  2M7N A;  4MRX A;  5HKW A;  1C7W A;  1DGV A;  2E30 A;  4MLW A;  4PCW A;  2G9B A;  3C1V A;  1JWD A;  3NSK A;  1G4Y R;  4NDD A;  1B8C A;  2M1U A;  3BXK A;  4NQG A;  4USL A;  3H4S E;  3VRO A;  4GAO A;  2G2B A;  4E68 A;  2M9G A;  4FTG A;  2M97 A;  2JQ6 A;  1M46 A;  2LAP A;  4DS7 A;  4M2P A;  1ALW A;  1CB1 A;  3GK2 A;  1PVA A;  2LHL A;  4GGF C;  4YGA A;  4WRI A;  2BBN A;  4GPL B;  1B1G A;  2Y5I A;  2AAO A;  2KYC A;  2JWW A;  3OHM B;  1A2X A;  2LVK A;  3ICB A;  4CPV A;  2LLT A;  2PAS A;  1VRK A;  1DJG A;  1WRK A;  2ZFD A;  5I2O A;  3LK1 A;  1YUS A;  2V53 A;  1DJY A;  2LM5 A;  3OB2 B;  1K8U A;  2QAC A;  1CKK A;  1A29 A;  1PK0 D;  1K95 A;  1W7J B;  1XFW O;  2KAX A;  1CLM A;  2BE4 A;  1N0Y A;  1YR5 A;  4HRH A;  5DKQ A;  2FOT A;  3EKJ A;  2BBM A;  1K9P A;  1TRF A;  2ZND A;  2MRD A;  1SPY A;  2OPO A;  2LMU A;  2KQ6 A; 
#chains in the Genus database with same CATH topology
 3DD4 A;  3O2P A;  1NCY A;  5JOL A;  2R2I A;  2SAS A;  3SS5 A;  2L5X B;  2FCD A;  3D73 A;  1YRU B;  2LE9 B;  3NHI A;  4NDC A;  2I7A A;  1NYA A;  2QEO A;  2KGB C;  2ERB A;  3PAT A;  1REC A;  1NCX A;  2KPH A;  4N1G A;  2K8M B;  2KLD A;  1E8A A;  1L7Z A;  2F2O A;  1S6I A;  1QLS A;  2LCP A;  2JPT A;  2K7B A;  1CMF A;  1LA0 A;  1TUZ A;  1FPW A;  2ZRS A;  1OE9 B;  2QPT A;  3LK0 A;  4QJ4 B;  1JFJ A;  1N2D A;  4XJK B;  3OBV A;  3I5H B;  4XYN A;  1C3Y A;  4WQ3 A;  2JNF A;  3TDI A;  1XK4 C;  2HF5 A;  4MZJ A;  1AJ5 A;  3SG4 A;  3K1E A;  2BL0 B;  1T14 A;  1W7I B;  1MUX A;  2K7D A;  2WOS A;  4ORA B;  4M2O A;  1QX5 B;  1A4P A;  5D69 A;  3SIA A;  2I18 A;  4MSP A;  1MQ1 A;  2HPS A;  3AAK A;  3TS5 B;  4AQJ A;  1ZFS A;  3BQ3 A;  2CXJ A;  1DQE A;  2EGD A;  3CR5 X;  2KSP A;  1K9K A;  3A8R A;  3L47 A;  3M0W A;  1R6P A;  1SMG A;  2JPO A;  2QEB A;  4PE0 A;  1FI6 A;  1KK7 Y;  1QV0 A;  3BOW A;  3BUW B;  3I5G C;  3O4Y A;  3WNX B;  1IH0 A;  3FIA A;  1M63 B;  1OOI X;  2JNX A;  3FE8 A;  1QWV A;  2RGI A;  2GTE A;  2KNE A;  4N1F A;  1J7O A;  1H8B A;  2F2P A;  2D8N A;  4TNC A;  4WQ2 A;  4JWQ A;  1F8H A;  3VRP A;  3A4U B;  4YGE B;  2Y1M A;  2KQY A;  1PRW A;  2SCP A;  1PUL A;  1CMG A;  2LVJ A;  2FCE A;  2K60 A;  2P70 A;  3CGA A;  3ZNI A;  1OSA A;  3SIB A;  1YUU A;  1TOP A;  2K7O A;  1UP5 A;  4BY4 A;  1OQP A;  3WXA A;  1QIW A;  3NSO A;  1WRZ A;  2I94 A;  1CFF A;  3R72 A;  1QAT A;  1RWY A;  1UHK A;  3IF7 A;  4PHK A;  1QV1 A;  5ER5 A;  1UUR A;  4A4C A;  2M49 B;  1SCV A;  3B6X A;  4CFR A;  1S5G Z;  1KSO A;  1S1E A;  1YUT A;  2M8U A;  1K9U A;  4M2Q A;  3L4L A;  1NX2 A;  1NX0 A;  4GGF A;  4PHM A;  5HKY A;  4DRW A;  1B47 A;  3BFH A;  3GOF A;  1F70 A;  3O4X A;  1GJY A;  2YGU A;  3PFV A;  1YTZ C;  3GK1 A;  1BF5 A;  2WCJ A;  1SY9 A;  4IJ7 A;  1OZS A;  1PSR A;  1WLM A;  1J55 A;  1F4O A;  2ISD A;  1N65 A;  5IBW A;  3BJH A;  3BFA A;  2KOT A;  4ORC B;  3S0B A;  1YVH A;  5I94 A;  3V2L A;  1C7V A;  1XFX O;  5CSI A;  1OMR A;  1TNX A;  2PRU A;  2CTN A;  4GFT A;  5I8N A;  1BOC A;  4F0Z B;  1GM0 A;  1JSA A;  1DF0 A;  2JTT A;  3DZT A;  3JTD B;  4UPG A;  1RTP 1;  2JOJ A;  1SSE B;  2JUL A;  1EG3 A;  2LVV A;  2WCE A;  1ZOT B;  1V1F A;  2KI4 C;  2M1K B;  3DVK A;  2GGM A;  1SKT A;  1KCY A;  2JT3 A;  2PAL A;  2KBM A;  1UHI A;  1QVI Z;  1H4B A;  2JXC A;  1Z4H A;  2IS9 A;  1EXR A;  2K2A A;  1OW4 A;  5KTY A;  1JC2 A;  5G08 A;  4YI9 A;  1LIN A;  2KLE A;  1LXF C;  1BT6 A;  1Y1A A;  4XJK A;  1SBJ A;  1Y0V H;  4QJ3 B;  3OX6 A;  1U5I B;  3DF0 A;  4DIR A;  1FF1 A;  2KDH A;  3KHE A;  2KHN A;  2P71 A;  2Q91 A;  4NDB A;  4MN0 A;  3PM2 A;  1QAS A;  2LLS A;  3R1P A;  4QJ5 B;  1QLK A;  1ODB A;  1QXP A;  2BKH B;  1MXL C;  4ZCU A;  2KI4 B;  3RZS A;  1XFZ O;  3D0Y B;  4CLN A;  1B8R A;  2M7L A;  5K89 A;  1ZMZ A;  4INW A;  1DJW A;  4DCK A;  1CFP A;  1D1O A;  2L4I A;  2LVI A;  3S0A A;  2L2E A;  1BU3 A;  1KSM A;  3TUY C;  1FBV A;  2MLE C;  3KEV A;  3R1V A;  1AVS A;  1UHH A;  1ZAC A;  3EK7 A;  1XVJ A;  1EH2 A;  3FS7 A;  1TUJ A;  1NX1 A;  1S36 A;  3EVV A;  2GGZ A;  4ORB B;  1XYD A;  2KGR A;  3KO0 A;  1WY9 A;  4JPZ B;  1QX2 A;  4YGB B;  2FJY A;  1HT9 A;  1PVB A;  2H61 C;  2Q4U A;  3S0E A;  3CR2 A;  2LUC A;  2M29 A;  1KFX L;  1LA3 A;  1JUO A;  1EJ3 A;  4I5L B;  1TIZ A;  2LP2 A;  2ZKM X;  4MRY A;  1YUR A;  1K93 D;  4A4B A;  1TTX A;  4CFQ A;  1ZUZ A;  3CZ2 A;  2A4J A;  4JQ0 D;  2MBX A;  4I5J A;  3DYE A;  4F7F A;  2PSR A;  2BEC A;  2KI6 D;  2BKI B;  1JF2 A;  2L0P A;  3IQO A;  1TCO B;  1NUB A;  1S26 D;  2CNP A;  4PE1 A;  5ER4 X;  1A03 A;  1XFU O;  1CNP A;  3CTN A;  1CLL A;  4P2Y B;  2F33 A;  1SL7 A;  2MA2 A;  5HL1 A;  1K2H A;  3CZ0 A;  1IJ6 A;  5AEQ A;  1TNW A;  3HCM A;  2JU0 A;  1PSB A;  2ZNE A;  1F54 A;  3UO9 A;  1B7T Y;  2L5Y A;  1KFU L;  1NX3 A;  3PJI A;  2E6W A;  1UHJ A;  1W9Z A;  4OR9 B;  3RLZ A;  3S0F A;  1M31 A;  1Z2C B;  3L4A A;  4PHJ A;  5HKZ A;  1BMO A;  4PAL A;  1IWQ A;  1CLB A;  1IIO A;  2LHI A;  3TDZ A;  3VRR A;  4I5K A;  2K61 A;  2NZ0 A;  2KFG A;  2L50 A;  4MZK A;  5FYX A;  1SRA A;  1WDC C;  5AXI A;  2AMI A;  4OCI A;  1KQM B;  2MHH A;  3VGO A;  2QEV A;  3B87 A;  3CZ1 A;  4U8D A;  2BL0 C;  2WND A;  1CFD A;  2F3Y A;  3DVE A;  3PM8 A;  1CM1 A;  2L51 A;  2WCF A;  1AK8 A;  3N7H A;  1KQM C;  1OZO A;  2KYF A;  3FE9 A;  1U5I A;  1CDL A;  3DF0 B;  3UNW A;  4C0J A;  4ETO A;  2TN4 A;  3EG5 B;  4GUK A;  1DVI A;  2JRF A;  3O78 A;  3R1O A;  3TS5 C;  3FWB A;  2WCM A;  3PSR A;  3RM1 A;  5BPJ A;  4AOM A;  1SL9 A;  3CZT X;  5HLV A;  3TZ1 A;  1B9A A;  2LUX A;  3FWC A;  1DMO A;  1KWO C;  3CR4 X;  5KSZ A;  1X02 A;  1S6J A;  3I5I B;  3K21 A;  1KQV A;  3SG5 A;  3NHT A;  1QJT A;  4HRG A;  1ALV A;  2HQW A;  5B8I B;  2LNK A;  3OGN A;  1MHO A;  2HET A;  1KWO B;  3I5I C;  1SR6 C;  1IGV A;  1RRO A;  4JD9 A;  5AAN A;  1F4Q A;  2BNX A;  4OVN F;  4HSZ A;  1J7Q A;  2MLF C;  5CPV A;  3VRQ A;  3NSI A;  2FJU B;  3OP0 A;  1NP8 A;  2KFF A;  4MVF A;  1M45 A;  1RFJ A;  4OZD A;  4IL1 A;  3BOW B;  3SS3 A;  3DVJ A;  1KK8 C;  1Y1X A;  4YI8 A;  3TDU A;  1Y6W A;  3MSE B;  1XO5 A;  1J1D A;  4JKT A;  3E3R A;  1JBA A;  2F8P A;  3I5F B;  4MZL A;  3CYZ A;  1MXE A;  5J3X A;  2MAZ A;  1G8I A;  1TCF A;  2H2K A;  1KK8 B;  2LV7 A;  5I2L A;  2OTG B;  3S0G A;  1BG1 A;  3D75 A;  1YX8 A;  1CDN A;  1OOG A;  1RK9 A;  1B8L A;  1CDP A;  3SJS A;  2L98 A;  3AKA A;  4AQI A;  2PMY A;  4YBH B;  3LLE A;  3PLF B;  5KU1 A;  1GGW A;  2DOQ A;  2O60 A;  1F55 A;  3CWG A;  4MEW A;  4GBA A;  4FQT A;  2NLN A;  1L2O C;  3D74 A;  4P5O E;  5JJG A;  4I5N B;  2BCX A;  1MWN A;  2F3Z A;  1FI5 A;  2Y1N A;  3SG6 A;  2WCL A;  1C3Z A;  1KFU S;  1QVI Y;  1F71 A;  5EL2 A;  3BFB A;  1NWD A;  5FI2 A;  1DJX A;  5GQQ C;  2COL B;  1NIW A;  2JT0 A;  2K2F A;  2P6B B;  1S6C A;  2OS8 B;  1SW8 A;  3FE6 A;  1WRL A;  1DJZ A;  4GNK B;  3D76 A;  1J1E A;  2GV5 A;  2LAN A;  1M39 A;  2NCP A;  4ZCV A;  2O5G A;  5PAL A;  3KF9 A;  1XA5 A;  1XFY O;  4YGD B;  2OS8 C;  4HRE E;  1K96 A;  4DUQ A;  2K0J A;  2PVB A;  1CFC A;  4INX A;  4PDZ A;  1BJF A;  2CBL A;  3EKH A;  2AUC A;  5CSN A;  1WLZ A;  1DJH A;  1DGU A;  5FI7 A;  1YRT B;  2HQ8 A;  1UHN A;  4OKH A;  4BY5 A;  1IQ3 A;  1QX7 A;  1Y1U A;  1JF0 A;  3BYA A;  2EC6 C;  5D7F A;  1IG5 A;  1A75 B;  1IRJ A;  3CS1 A;  1SR6 B;  4PHN A;  1AJ4 A;  4N5X A;  1SNL A;  3B88 A;  1HQV A;  2WC8 A;  3VB1 A;  5FI6 A;  4D1E A;  2EC6 B;  2WOR A;  1MF8 B;  3IVT A;  5DKR A;  2LC5 A;  2EHB A;  2L4H A;  3AAJ A;  5TNC A;  5HYD A;  4R1E A;  2LMV A;  3I5G B;  3BUO B;  1IQ5 A;  1BR4 B;  3JVT B;  1CDM A;  4KYN A;  3O6B A;  1XFR A;  2WC6 A;  1SL8 A;  1R2U A;  3DXL A;  3CAB A;  3TUY B;  5AFP A;  2OTG C;  1NSH A;  1IJ5 A;  3JVT C;  2KI6 C;  1JFK A;  2LLU A;  3WHT B;  2KFH A;  2KBI A;  2JXL A;  1V1G A;  2BE6 A;  1DEL A;  3SG7 A;  1YVL A;  3EVU A;  4OV2 A;  5I2Q A;  1J7P A;  3AKB A;  2ZN8 A;  1XK4 A;  3D0Y A;  1EG4 A;  2QEH A;  4FQO A;  5DIC A;  3EK8 A;  1DJI A;  1NCZ A;  3QRX A;  2H61 A;  1MR8 A;  2CCM A;  4ICB A;  2JZI A;  1RJV A;  4PE7 A;  2PQL A;  3D77 A;  1Q80 A;  1BLQ A;  1C07 A;  4MBE A;  1K94 A;  1GGZ A;  1SCM C;  2LP3 A;  1KFX S;  1SK6 D;  1QTX A;  2ZRT A;  3BUM B;  1B7T Z;  3PAL A;  1OOJ A;  1FW4 A;  2M0R A;  2VRG A;  1OMV A;  3ZWH A;  1TNQ A;  3SG3 A;  2KAV A;  3BUN B;  2K7C A;  3LL8 B;  2MJW B;  1OMD A;  4GGN A;  2L2C A;  3I5F C;  1ORG A;  1GQM A;  2JC2 A;  3PN7 C;  5F6T A;  1IKU A;  5DKN A;  3EK4 A;  5CSJ A;  1J7R A;  1KK7 Z;  2BAP A;  2B1U A;  1TN4 A;  5HLO A;  1QIV A;  5AER A;  1NPQ A;  1DT7 B;  1S5G Y;  3PN7 B;  3GK4 X;  1CM4 A;  3D10 A;  3OX5 A;  3EVR A;  1CTR A;  1YX7 A;  2BCA A;  1PAL A;  1TNP A;  1LS8 A;  1BOD A;  3DY9 A;  3QME A;  1LVC D;  1DTL A;  4C0L A;  2H8V A;  1QS7 A;  1SCM B;  2Y4Q A;  1AP4 A;  4PT1 A;  1TWO A;  1AUI B;  2NCO A;  1EL4 A;  2I2R E;  1A75 A;  5CSF A;  1OOF A;  1XFV O;  2ZN9 A;  4PE4 A;  2BCB A;  3SS4 A;  1SYM A;  4YGC B;  1S3P A;  1L2O B;  3DVM A;  3CLN A;  4Q04 A;  3VRN A;  1LKJ A;  2WCK A;  2M3W A;  3S0D A;  1UUS A;  2CT9 A;  4YRU A;  4C0K A;  3JTD C;  3IQQ A;  1BR1 B;  4L9M A;  1OOH A;  3SG2 A;  1WDC B;  3HX4 A;  2KAY A;  2LMT A;  2WCH A;  1G33 A;  3LCP C;  4CID A;  3NXA A;  3WHU B;  3NSL A;  2WCB A;  2WC5 A;  1K90 D;  3KPX A;  1AHR A;  1DC1 A;  2JTZ A;  3F45 A;  3BUX B;  5D3O A;  1B4C A;  3OB1 B;  2JT8 A;  3I5H C;  1UWO A;  2NXQ A;  1DF0 B;  2M7N A;  3Q8I A;  4MRX A;  1C7W A;  1DGV A;  2E30 A;  4MLW A;  4PCW A;  5HKW A;  2G9B A;  3C1V A;  1JWD A;  3NSK A;  1G4Y R;  4NDD A;  1B8C A;  2M1U A;  3BXK A;  4NQG A;  4USL A;  3H4S E;  1P28 A;  3VRO A;  2PYQ A;  4GAO A;  2G2B A;  4E68 A;  2M9G A;  4FTG A;  2M97 A;  2JQ6 A;  1M46 A;  2LAP A;  4DS7 A;  2QDI A;  4M2P A;  1ALW A;  1CB1 A;  3GK2 A;  1PVA A;  2LHL A;  3CDN A;  4GGF C;  4YGA A;  4WRI A;  2BBN A;  4GPL B;  1B1G A;  2Y5I A;  2AAO A;  2KYC A;  2JWW A;  3OHM B;  1A2X A;  2LVK A;  3ICB A;  4CPV A;  2LLT A;  2PAS A;  1VRK A;  1DJG A;  1WRK A;  2ZFD A;  3NGV A;  5I2O A;  3LK1 A;  1YUS A;  2V53 A;  3B86 A;  1DJY A;  2LM5 A;  3OB2 B;  1K8U A;  2QAC A;  1CKK A;  1A29 A;  1PK0 D;  1K95 A;  1W7J B;  3B7A A;  1XFW O;  1DEK A;  2KAX A;  1CLM A;  2BE4 A;  1N0Y A;  1YR5 A;  4HRH A;  3D78 A;  5DKQ A;  2FOT A;  3EKJ A;  2BBM A;  1K9P A;  1TRF A;  2ZND A;  2MRD A;  1SPY A;  2OPO A;  2LMU A;  2KQ6 A; 
#chains in the Genus database with same CATH homology
 3DD4 A;  3O2P A;  1NCY A;  5JOL A;  2R2I A;  2SAS A;  2L5X B;  2FCD A;  1YRU B;  2LE9 B;  4NDC A;  2I7A A;  1NYA A;  2KGB C;  3PAT A;  1REC A;  1NCX A;  4N1G A;  2K8M B;  1E8A A;  1L7Z A;  2F2O A;  1S6I A;  1QLS A;  2LCP A;  2JPT A;  2K7B A;  1CMF A;  1LA0 A;  1FPW A;  2ZRS A;  1OE9 B;  2QPT A;  3LK0 A;  4QJ4 B;  1JFJ A;  1N2D A;  4XJK B;  3I5H B;  4XYN A;  4WQ3 A;  2JNF A;  3TDI A;  1XK4 C;  2HF5 A;  4MZJ A;  1AJ5 A;  3SG4 A;  1W7I B;  2BL0 B;  2K7D A;  1MUX A;  2WOS A;  4ORA B;  4M2O A;  1QX5 B;  1A4P A;  5D69 A;  3SIA A;  2I18 A;  4MSP A;  1MQ1 A;  2HPS A;  3AAK A;  3TS5 B;  4AQJ A;  1ZFS A;  3BQ3 A;  2CXJ A;  2EGD A;  3CR5 X;  2KSP A;  1K9K A;  3A8R A;  3M0W A;  1R6P A;  1SMG A;  4PE0 A;  1FI6 A;  1KK7 Y;  1QV0 A;  3BOW A;  3BUW B;  3I5G C;  3O4Y A;  3WNX B;  1IH0 A;  3FIA A;  1M63 B;  2JNX A;  1J7O A;  1H8B A;  2RGI A;  2KNE A;  4N1F A;  2F2P A;  2D8N A;  4TNC A;  4WQ2 A;  4JWQ A;  1F8H A;  3VRP A;  3A4U B;  4YGE B;  2Y1M A;  2KQY A;  1PRW A;  2SCP A;  1PUL A;  1CMG A;  2LVJ A;  2FCE A;  3CGA A;  3ZNI A;  1OSA A;  3SIB A;  1YUU A;  1TOP A;  2K7O A;  1UP5 A;  4BY4 A;  1OQP A;  3WXA A;  1QIW A;  3NSO A;  1WRZ A;  2I94 A;  1CFF A;  1QAT A;  1RWY A;  1UHK A;  3IF7 A;  4PHK A;  1QV1 A;  5ER5 A;  1UUR A;  4A4C A;  2M49 B;  1SCV A;  4CFR A;  1S5G Z;  1KSO A;  1S1E A;  1YUT A;  2M8U A;  1K9U A;  4M2Q A;  1NX2 A;  1NX0 A;  4GGF A;  4PHM A;  5HKY A;  4DRW A;  1B47 A;  3GOF A;  1F70 A;  1GJY A;  3PFV A;  1YTZ C;  3GK1 A;  1BF5 A;  1SY9 A;  1OZS A;  1PSR A;  1WLM A;  1J55 A;  1F4O A;  2ISD A;  1N65 A;  5IBW A;  4ORC B;  2KOT A;  1YVH A;  1C7V A;  1XFX O;  5CSI A;  1OMR A;  1TNX A;  2PRU A;  2CTN A;  4GFT A;  5I8N A;  1BOC A;  4F0Z B;  1JSA A;  1DF0 A;  2JTT A;  3JTD B;  4UPG A;  1RTP 1;  2JOJ A;  2JUL A;  1EG3 A;  2LVV A;  2WCE A;  1ZOT B;  1V1F A;  2KI4 C;  2M1K B;  3DVK A;  2GGM A;  1SKT A;  1KCY A;  2JT3 A;  2PAL A;  2KBM A;  1UHI A;  1QVI Z;  1H4B A;  2JXC A;  2IS9 A;  1EXR A;  2K2A A;  5KTY A;  1JC2 A;  5G08 A;  4YI9 A;  1LIN A;  1LXF C;  1BT6 A;  1Y1A A;  4XJK A;  1SBJ A;  1Y0V H;  4QJ3 B;  3OX6 A;  1U5I B;  3DF0 A;  4DIR A;  1FF1 A;  2KDH A;  3KHE A;  2KHN A;  2Q91 A;  4NDB A;  4MN0 A;  1QAS A;  2LLS A;  4QJ5 B;  1QLK A;  1ODB A;  1QXP A;  2BKH B;  1MXL C;  4ZCU A;  2KI4 B;  1XFZ O;  3D0Y B;  4CLN A;  1B8R A;  2M7L A;  5K89 A;  1ZMZ A;  1DJW A;  4DCK A;  1CFP A;  1D1O A;  2L4I A;  2LVI A;  2L2E A;  1BU3 A;  1KSM A;  3TUY C;  1FBV A;  2MLE C;  3KEV A;  1AVS A;  1UHH A;  1ZAC A;  3EK7 A;  1XVJ A;  1EH2 A;  3FS7 A;  1NX1 A;  1S36 A;  3EVV A;  2GGZ A;  4ORB B;  1XYD A;  2KGR A;  3KO0 A;  1WY9 A;  4JPZ B;  1QX2 A;  4YGB B;  1HT9 A;  1PVB A;  2H61 C;  2Q4U A;  3CR2 A;  2LUC A;  2M29 A;  1KFX L;  1LA3 A;  1JUO A;  1EJ3 A;  4I5L B;  1TIZ A;  2LP2 A;  2ZKM X;  4MRY A;  1YUR A;  1K93 D;  4A4B A;  1TTX A;  4CFQ A;  1ZUZ A;  4JQ0 D;  2A4J A;  2MBX A;  4I5J A;  2PSR A;  2BEC A;  2KI6 D;  2BKI B;  1JF2 A;  2L0P A;  3IQO A;  1TCO B;  1NUB A;  1S26 D;  2CNP A;  4PE1 A;  5ER4 X;  1A03 A;  1XFU O;  1CNP A;  3CTN A;  1CLL A;  4P2Y B;  2F33 A;  1SL7 A;  2MA2 A;  1K2H A;  1IJ6 A;  5AEQ A;  1TNW A;  3HCM A;  2JU0 A;  1PSB A;  2ZNE A;  1F54 A;  1B7T Y;  1KFU L;  1NX3 A;  2E6W A;  1UHJ A;  4OR9 B;  3RLZ A;  1M31 A;  4PHJ A;  5HKZ A;  1BMO A;  4PAL A;  1IWQ A;  1CLB A;  2LHI A;  3TDZ A;  3VRR A;  4I5K A;  2K61 A;  2NZ0 A;  2KFG A;  2L50 A;  4MZK A;  5FYX A;  1SRA A;  1WDC C;  5AXI A;  2AMI A;  4OCI A;  1KQM B;  2MHH A;  3VGO A;  4U8D A;  2BL0 C;  2WND A;  1CFD A;  2F3Y A;  3DVE A;  3PM8 A;  1CM1 A;  2L51 A;  2WCF A;  1AK8 A;  1KQM C;  1OZO A;  2KYF A;  1U5I A;  1CDL A;  3DF0 B;  4C0J A;  4ETO A;  2TN4 A;  4GUK A;  1DVI A;  2JRF A;  3O78 A;  5BPJ A;  3TS5 C;  3FWB A;  3PSR A;  3RM1 A;  4AOM A;  1SL9 A;  3CZT X;  5HLV A;  3TZ1 A;  1B9A A;  2LUX A;  3FWC A;  1DMO A;  1KWO C;  3CR4 X;  5KSZ A;  1X02 A;  1S6J A;  3I5I B;  3K21 A;  1KQV A;  3SG5 A;  1QJT A;  4HRG A;  1ALV A;  2HQW A;  5B8I B;  2LNK A;  1MHO A;  2HET A;  1KWO B;  3I5I C;  1SR6 C;  1IGV A;  1RRO A;  5AAN A;  1F4Q A;  4OVN F;  4HSZ A;  1J7Q A;  2MLF C;  5CPV A;  3VRQ A;  3NSI A;  2FJU B;  3OP0 A;  1NP8 A;  2KFF A;  4MVF A;  1M45 A;  1RFJ A;  4IL1 A;  3BOW B;  3DVJ A;  1KK8 C;  1Y1X A;  4YI8 A;  3TDU A;  1Y6W A;  3MSE B;  1XO5 A;  1J1D A;  3E3R A;  1JBA A;  2F8P A;  3I5F B;  4MZL A;  1MXE A;  5J3X A;  2MAZ A;  1G8I A;  1TCF A;  2H2K A;  1KK8 B;  2LV7 A;  5I2L A;  2OTG B;  1BG1 A;  1YX8 A;  1CDN A;  1RK9 A;  1B8L A;  1CDP A;  3SJS A;  2L98 A;  3AKA A;  4AQI A;  2PMY A;  4YBH B;  3LLE A;  3PLF B;  5KU1 A;  1GGW A;  2DOQ A;  2O60 A;  1F55 A;  3CWG A;  4MEW A;  4GBA A;  2NLN A;  1L2O C;  4P5O E;  5JJG A;  4I5N B;  2BCX A;  1MWN A;  2F3Z A;  1FI5 A;  2Y1N A;  3SG6 A;  1KFU S;  1QVI Y;  1F71 A;  1NWD A;  5GQQ C;  1DJX A;  2COL B;  1NIW A;  2JT0 A;  2K2F A;  2P6B B;  1S6C A;  2OS8 B;  1SW8 A;  4GNK B;  1WRL A;  1DJZ A;  1J1E A;  2GV5 A;  2LAN A;  1M39 A;  2NCP A;  4ZCV A;  2O5G A;  5PAL A;  3KF9 A;  1XA5 A;  1XFY O;  4YGD B;  2OS8 C;  4HRE E;  1K96 A;  4DUQ A;  2K0J A;  2PVB A;  1CFC A;  4PDZ A;  1BJF A;  2CBL A;  3EKH A;  2AUC A;  5CSN A;  1WLZ A;  1DJH A;  1DGU A;  1YRT B;  2HQ8 A;  1UHN A;  4OKH A;  4BY5 A;  1IQ3 A;  1QX7 A;  1Y1U A;  1JF0 A;  3BYA A;  2EC6 C;  5D7F A;  1IG5 A;  1A75 B;  1IRJ A;  3CS1 A;  1SR6 B;  4PHN A;  1AJ4 A;  4N5X A;  1SNL A;  1HQV A;  2WC8 A;  4D1E A;  2EC6 B;  2WOR A;  1MF8 B;  5DKR A;  2LC5 A;  2EHB A;  2L4H A;  3AAJ A;  5TNC A;  5HYD A;  4R1E A;  2LMV A;  3I5G B;  3BUO B;  1IQ5 A;  1BR4 B;  3JVT B;  1CDM A;  3O6B A;  1SL8 A;  1R2U A;  3TUY B;  5AFP A;  2OTG C;  1NSH A;  1IJ5 A;  3JVT C;  2KI6 C;  1JFK A;  2LLU A;  3WHT B;  2KFH A;  2KBI A;  2JXL A;  1V1G A;  2BE6 A;  3SG7 A;  5I2Q A;  1YVL A;  3EVU A;  4OV2 A;  1J7P A;  3AKB A;  2ZN8 A;  1XK4 A;  3D0Y A;  1EG4 A;  4FQO A;  3EK8 A;  1DJI A;  1NCZ A;  3QRX A;  2H61 A;  1MR8 A;  2CCM A;  4ICB A;  2JZI A;  1RJV A;  4PE7 A;  1BLQ A;  1Q80 A;  1C07 A;  4MBE A;  1K94 A;  1GGZ A;  1SCM C;  2LP3 A;  1KFX S;  1SK6 D;  1QTX A;  2ZRT A;  3BUM B;  1B7T Z;  3PAL A;  1OOJ A;  1FW4 A;  2M0R A;  2VRG A;  1OMV A;  3ZWH A;  1TNQ A;  3SG3 A;  2KAV A;  3BUN B;  2K7C A;  3LL8 B;  2MJW B;  1OMD A;  4GGN A;  3I5F C;  2JC2 A;  1GQM A;  3PN7 C;  5F6T A;  1IKU A;  5DKN A;  3EK4 A;  5CSJ A;  1J7R A;  1KK7 Z;  2B1U A;  1TN4 A;  5HLO A;  1QIV A;  5AER A;  1NPQ A;  1DT7 B;  1S5G Y;  3PN7 B;  3GK4 X;  1CM4 A;  3D10 A;  3OX5 A;  3EVR A;  1CTR A;  1YX7 A;  2BCA A;  1PAL A;  1TNP A;  1BOD A;  1LVC D;  1DTL A;  4C0L A;  1QS7 A;  1SCM B;  2Y4Q A;  1AP4 A;  1AUI B;  2NCO A;  1EL4 A;  2I2R E;  1A75 A;  5CSF A;  2ZN9 A;  1XFV O;  4PE4 A;  2BCB A;  1SYM A;  4YGC B;  1S3P A;  1L2O B;  3DVM A;  3CLN A;  4Q04 A;  3VRN A;  1LKJ A;  2M3W A;  1UUS A;  2CT9 A;  4YRU A;  4C0K A;  3JTD C;  3IQQ A;  1BR1 B;  4L9M A;  3SG2 A;  1WDC B;  3HX4 A;  2KAY A;  2LMT A;  1G33 A;  3LCP C;  4CID A;  3NXA A;  3WHU B;  3NSL A;  2WCB A;  1K90 D;  3KPX A;  1AHR A;  2JTZ A;  3F45 A;  3BUX B;  1B4C A;  3OB1 B;  2JT8 A;  3I5H C;  1UWO A;  2NXQ A;  1DF0 B;  2M7N A;  4MRX A;  5HKW A;  1C7W A;  1DGV A;  2E30 A;  4MLW A;  4PCW A;  2G9B A;  3C1V A;  1JWD A;  3NSK A;  1G4Y R;  4NDD A;  1B8C A;  2M1U A;  3BXK A;  4NQG A;  4USL A;  3H4S E;  3VRO A;  4GAO A;  2G2B A;  4E68 A;  2M9G A;  4FTG A;  2M97 A;  2JQ6 A;  1M46 A;  2LAP A;  4DS7 A;  4M2P A;  1ALW A;  1CB1 A;  3GK2 A;  1PVA A;  2LHL A;  4GGF C;  4YGA A;  4WRI A;  2BBN A;  4GPL B;  1B1G A;  2Y5I A;  2AAO A;  2KYC A;  2JWW A;  3OHM B;  1A2X A;  2LVK A;  3ICB A;  4CPV A;  2LLT A;  2PAS A;  1VRK A;  1DJG A;  1WRK A;  2ZFD A;  5I2O A;  3LK1 A;  1YUS A;  2V53 A;  1DJY A;  2LM5 A;  3OB2 B;  1K8U A;  2QAC A;  1CKK A;  1A29 A;  1PK0 D;  1K95 A;  1W7J B;  1XFW O;  2KAX A;  1CLM A;  2BE4 A;  1N0Y A;  1YR5 A;  4HRH A;  5DKQ A;  2FOT A;  3EKJ A;  2BBM A;  1K9P A;  1TRF A;  2ZND A;  2MRD A;  1SPY A;  2OPO A;  2LMU A;  2KQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...