3TS5B

Crystal structure of a light chain domain of scallop smooth muscle myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
ARLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
total genus 45
structure length 142
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B01
1KWOC 2PALA 3BOWB 3EVRA 1AVSA 3SJSA 1Y1UA 2JXCA 3BYAA 3SIBA 2OS8B 2Y1MA 2Y1NA 1NSHA 3TS5C 3I5FB 2KI6D 1F71A 1GJYA 1BJFA 1V1GA 1ZUZA 2JTTA 1J7RA 4MN0A 5F6TA 1ODBA 1EJ3A 2KQ6A 2LLSA 4I5KA 1NX2A 1OMRA 1JFKA 1OQPA 3KPXA 4CFRA 1OZSA 1KFUS 2K2FA 2RGIA 4I5NB 1S36A 2K7CA 3LK1A 4MZJA 2Y5IA 1IWQA 2HQWA 3OX6A 2M49B 1AHRA 3I5GB 4YI8A 1G4YR 1OMDA 4R1EA 1C7VA 2SASA 4JPZB 1A03A 3KF9A 1JSAA 1LA3A 4FQOA 1KQVA 1BMOA 2K2AA 3SIAA 3VRPA 3OB2B 2JQ6A 4NDDA 1JF0A 1BODA 3LK0A 3ICBA 1SNLA 4U8DA 1F70A 2OS8C 1ALVA 5FYXA 5KSZA 2DOQA 1J7QA 1LA0A 2PMYA 1B4CA 3I5FC 1BF5A 1TOPA 1WDCB 3CTNA 1B8RA 2FCDA 2LVVA 2JWWA 2LNKA 4PHMA 5BPJA 4OVNF 4D1EA 2NCPA 2BL0B 2JNXA 3CR4X 3JVTB 3PSRA 4OR9B 2JTZA 1SK6D 2F8PA 2AMIA 4MZKA 2O5GA 2KDHA 1Y0VH 2BKHB 3I5GC 1S6CA 3HCMA 3LLEA 1IJ6A 2LV7A 4DS7A 3PN7B 2M1UA 2CNPA 1J1DA 1K95A 3SG4A 2I2RE 1NWDA 1YX8A 1NCYA 1NX3A 2ZN9A 2BKIB 3SG3A 3D0YA 1G33A 3KO0A 1QIVA 1YRUB 4N1GA 2CBLA 1R6PA 1CTRA 1BU3A 2KI6C 1QX2A 1X02A 2CXJA 1V1FA 2M8UA 1S26D 2LCPA 1UP5A 1QATA 2LUXA 3VGOA 5IBWA 1Y1AA 1OSAA 2M97A 1A75A 1WDCC 3PALA 2KAVA 1F8HA 2FCEA 1KK8B 1FW4A 4C0KA 4GBAA 1AJ5A 2HF5A 1Q80A 1PULA 2F3ZA 1FI5A 2BL0C 3JVTC 5ER5A 1SR6C 1QX5B 2I94A 1R2UA 4AQJA 4CIDA 1DF0A 2K7DA 2LM5A 1LXFC 1M46A 5J3XA 4DCKA 4IL1A 2I7AA 2L4HA 3PN7C 4N1FA 2JOJA 1KSOA 1XK4A 2ZN8A 1GQMA 4HRHA 2PASA 3WHTB 1B8CA 1YVLA 4XJKA 1CLBA 1VRKA 1H8BA 1NPQA 2GGMA 1BR1B 1S3PA 1UHKA 1OZOA 2FOTA 2LP2A 3CR2A 4GUKA 1UURA 1OOJA 2LMUA 1E8AA 5CSIA 5JOLA 5AERA 4E68A 4OCIA 2HQ8A 1QTXA 2KBIA 2TN4A 3O6BA 1B47A 3DVEA 5D69A 2K61A 4GGFC 2AAOA 2GGZA 1XFZO 1M31A 1TCFA 1UHJA 1N2DA 4USLA 4MLWA 2WCFA 2KSPA 3NSOA 1SL7A 2M3WA 1F4OA 1AP4A 1J7OA 3LL8B 3QRXA 2BCXA 2JPTA 2MHHA 4MRXA 5CPVA 4UPGA 3K21A 1JFJA 2WCEA 3TDIA 4YGDB 1N65A 1AUIB 3EK8A 3GK4X 4ORCB 1OE9B 1YUTA 3CLNA 4HREE 1BR4B 1MF8B 2LE9B 3H4SE 1CMGA 4PHJA 5HKZA 1B8LA 1NIWA 1DGVA 2H61C 4PALA 2CT9A 1UHNA 5B8IB 1QVIZ 1IQ5A 1J55A 2MLEC 3MSEB 3CS1A 1WRZA 2BE6A 4MEWA 2F33A 3BUNB 2KHNA 2MJWB 1XK4C 2MRDA 2ZNDA 4C0LA 2ISDA 3KEVA 3I5IB 3KHEA 2NXQA 1B7TY 2OTGB 1S1EA 2JZIA 4QJ3B 2BCAA 4L9MA 5DKNA 1TNWA 3HX4A 1S5GZ 1UHHA 1B9AA 1CMFA 1EH2A 2G2BA 1CM1A 1TN4A 2NZ0A 1XFUO 2L0PA 4P5OE 2ZRTA 3FS7A 1CFCA 1F54A 1J7PA 1M45A 2HETA 2JNFA 2BBNA 2E6WA 1UWOA 1YRTB 1DGUA 1KSMA 4NDBA 1KFXL 1QIWA 1AJ4A 1SR6B 1SYMA 2CCMA 4FTGA 1CDLA 4GFTA 5PALA 1IQ3A 1QLSA 1JBAA 4ETOA 5HKWA 2D8NA 4MZLA 1RECA 1TNQA 2H2KA 1SCVA 2R2IA 2WCBA 1GGWA 3GK1A 4I5JA 4M2PA 5ER4X 3PLFB 1TNPA 2A4JA 5I8NA 1JC2A 1CDNA 1YVHA 1LKJA 4QJ5B 1TRFA 4AQIA 3I5IC 3BQ3A 4OV2A 2OTGC 2MAZA 1FF1A 2BBMA 2GV5A 1YUUA 2VRGA 1CKKA 1SL8A 2Y4QA 1CDPA 1FI6A 4GAOA 2M7NA 1XO5A 1PRWA 4TNCA 2OPOA 5HLOA 3DVKA 2F3YA 2EC6B 1S6IA 1WLMA 3FWCA 2KI4B 1SPYA 2Q91A 2KFFA 2LVJA 2K8MB 2KFGA 2F2PA 4A4BA 3EKJA 1NP8A 4ORBB 2M29A 1K96A 1LINA 2KQYA 2LMVA 1L2OB 1YR5A 1XYDA 1PALA 3SG2A 1M63B 1NUBA 2EGDA 3PM8A 4C0JA 3IQQA 1XFXO 3DVJA 5KU1A 1BLQA 3D0YB 1SCMB 4YGAA 4MBEA 3DF0A 1QVIY 4PE7A 2LLUA 3VROA 1QX7A 2PVBA 4CFQA 1BOCA 2O60A 5D7FA 2M9GA 1K8UA 2FJUB 1MXEA 1IRJA 1A75B 4BY4A 1MHOA 1SMGA 1DTLA 4WRIA 1Y1XA 1IG5A 1KK7Z 1XFYO 4BY5A 1EL4A 1K94A 4F0ZB 1DJXA 2P6BB 3LCPC 1XFVO 2EC6C 3DD4A 4HSZA 1QV1A 5HLVA 2G9BA 2KI4C 4PE4A 3OP0A 4DRWA 2L51A 1EG4A 1G8IA 1DF0B 4YGCB 5AXIA 1U5IA 1NCXA 1DVIA 5I2OA 1DJZA 1JF2A 1ZMZA 2JRFA 2JU0A 2KBMA 2L4IA 2LANA 3BXKA 1F4QA 4YGEB 1XVJA 3DVMA 2KGRA 4I5LB 4YI9A 5DKRA 1L2OC 3BOWA 3BUMB 1CLMA 1IH0A 1DJYA 1DJWA 1K93D 1K9KA 1K90D 1Y6WA 4XJKB 3WNXB 4AOMA 1RFJA 2B1UA 1SCMC 2I18A 2JXLA 2F2OA 4PCWA 4ZCVA 1CFDA 1C7WA 2KFHA 3SG7A 3O4YA 3VRNA 1W7IB 3AKAA 3O78A 1QV0A 4ZCUA 4JQ0D 1F55A 1AK8A 1DT7B 3M0WA 3A8RA 3OX5A 3NSIA 3NSKA 3EK4A 3SG6A 1CDMA 2KYFA 4HRGA 4PHNA 3GK2A 1KFUL 4XYNA 1KQMB 2JC2A 5DKQA 1W7JB 2KAXA 2K7OA 1QXPA 2MA2A 3TZ1A 2KYCA 1NCZA 4PHKA 1PK0D 3F45A 2WNDA 4PDZA 4JWQA 3NSLA 1HQVA 1QJTA 4GPLB 2HPSA 1UUSA 5TNCA 4DIRA 4OKHA 3C1VA 1MQ1A 1MUXA 3IQOA 2KAYA 3CGAA 4A4CA 1BG1A 5AFPA 1TCOB 1A29A 2LVIA 3D10A 4Q04A 3WXAA 1HT9A 3ZWHA 1MR8A 4CLNA 2LHIA 1NX0A 3JTDB 2SCPA 1OMVA 3AAJA 1KK7Y 3OHMB 1QLKA 4GGNA 1CFPA 4N5XA 4DUQA 1ZACA 5HKYA 1CB1A 3I5HB 1KQMC 2PSRA 1SRAA 1CLLA 1J1EA 1MWNA 1YX7A 3PFVA 1D1OA 1K2HA 2ZKMX 3GOFA 1SBJA 1XFWO 5I2LA 5KTYA 1XA5A 2L98A 1ALWA 3RLZA 1ZOTB 1KFXS 5I2QA 1UHIA 2JT3A 2NLNA 2Q4UA 4YBHB 1PSRA 1M39A 1YUSA 2CTNA 3SG5A 3VRRA 1WRLA 2JULA 4YGBB 1RK9A 2ZRSA 1LVCD 3BUXB 2WORA 2QACA 5CSNA 1JWDA 3CR5X 4M2QA 2BECA 2M7LA 1FPWA 1EXRA 5K89A 4NDCA 2IS9A 1SW8A 3PATA 2L50A 4GGFA 1N0YA 3IF7A 1H4BA 3BUWB 3JTDC 2M1KB 3ZNIA 5AEQA 3BUOB 1C07A 2EHBA 2BE4A 4PE1A 3OB1B 4M2OA 1JUOA 2QPTA 1B1GA 4WQ2A 2KOTA 4MSPA 3A4UB 1SL9A 1TTXA 2JT0A 1IJ5A 2K7BA 2L2EA 1K9UA 2JT8A 3CWGA 3I5HC 1PVBA 1ZFSA 4P2YB 1L7ZA 5G08A 2WOSA 1RJVA 2LUCA 3VRQA 5CSJA 4GNKB 3TUYB 3E3RA 1EG3A 5GQQC 1DJIA 2LHLA 1WY9A 2LC5A 3RM1A 1DMOA 1YTZC 1DJGA 1PSBA 4PE0A 1SKTA 1S5GY 4MRYA 1B7TZ 2MBXA 1RROA 1BT6A 2H61A 1KWOB 1IKUA 3O2PA 2V53A 2AUCA 2M0RA 5HYDA 2KGBC 5JJGA 2LLTA 2WC8A 1CFFA 2L5XB 3TS5B 2ZFDA 3DF0B 3NXAA 1S6JA 2PRUA 3AAKA 4MVFA 2KNEA 2LVKA 1GGZA 1K9PA 3EK7A 1A4PA 3TDUA 3WHUB 1NYAA 5AANA 2E30A 4QJ4B 2BCBA 1A2XA 3FIAA 1DJHA 1WLZA 1FBVA 4WQ3A 1TIZA 1SY9A 2LAPA 1IGVA 1RWYA 2COLB 2LP3A 3FWBA 1CNPA 3TUYC 1TNXA 1QASA 1KK8C 2NCOA 2ZNEA 4CPVA 2LMTA 1WRKA 3EVVA 4ORAB 3CZTX 1QS7A 3TDZA 3EVUA 2MLFC 1U5IB 4NQGA 2K0JA 4YRUA 1PVAA 1CM4A 3EKHA 4ICBA 1NX1A 5CSFA 1MXLC 1RTP1 1YURA 3AKBA 1KCYA
chains in the Genus database with same CATH superfamily
1KWOC 2PALA 3BOWB 3DXLA 3EVRA 1AVSA 3SJSA 1Y1UA 3SS4A 2JXCA 1QWVA 3BFAA 3BYAA 3SS5A 3SIBA 2OS8B 2Y1MA 2Y1NA 1NSHA 3TS5C 3I5FB 2KI6D 1F71A 1GJYA 1BJFA 1V1GA 1ZUZA 2JTTA 1J7RA 4MN0A 5F6TA 1ODBA 1EJ3A 2KQ6A 2LLSA 4I5KA 1NX2A 1OMRA 1JFKA 1OQPA 4KYNA 3KPXA 4CFRA 1OZSA 1KFUS 2K2FA 2RGIA 4I5NB 1S36A 1TUZA 2K7CA 3LK1A 4MZJA 2Y5IA 1IWQA 2HQWA 3OX6A 2M49B 1AHRA 3I5GB 4YI8A 1G4YR 1OMDA 3B6XA 4R1EA 1C7VA 3FE9A 2QEHA 2SASA 4JPZB 1A03A 3KF9A 1JSAA 1LA3A 4FQOA 3B88A 1KQVA 1BMOA 3S0DA 2K2AA 3SIAA 3VRPA 3S0BA 3OB2B 2JQ6A 4NDDA 1JF0A 3UNWA 1BODA 3LK0A 3ICBA 1SNLA 4U8DA 1F70A 1OOFA 2OS8C 1ALVA 5FYXA 5KSZA 2DOQA 1J7QA 3DZTA 1LA0A 2PMYA 1B4CA 3I5FC 1BF5A 1TOPA 1WDCB 3CTNA 4F7FA 1B8RA 2YGUA 3EG5B 1W9ZA 2FCDA 2LVVA 2JWWA 2LNKA 4PHMA 5BPJA 4INXA 4OVNF 2FJYA 4D1EA 2NCPA 3R1VA 2BL0B 2JNXA 3CR4X 3JVTB 3PM2A 3PSRA 5FI6A 4OR9B 2JTZA 1SK6D 2F8PA 2AMIA 4MZKA 2O5GA 2KDHA 1OOIX 1Y0VH 2BKHB 3I5GC 1S6CA 3HCMA 3LLEA 1IJ6A 2LV7A 4DS7A 3PN7B 2M1UA 2CNPA 1J1DA 1K95A 3SG4A 2I2RE 1NWDA 1YX8A 1NCYA 1NX3A 2ZN9A 2BKIB 3SG3A 3D0YA 1G33A 3KO0A 1QIVA 1YRUB 4N1GA 2CBLA 1R6PA 1CTRA 1BU3A 2KI6C 1QX2A 1X02A 2CXJA 1V1FA 2M8UA 3L4LA 1S26D 2LCPA 1UP5A 1QATA 2LUXA 3VGOA 5IBWA 1Y1AA 1OSAA 2M97A 1A75A 1WDCC 2WCLA 3PALA 2KAVA 1C3YA 2FCEA 1F8HA 1KK8B 1T14A 1FW4A 4C0KA 4GBAA 2P70A 2L2CA 1AJ5A 2HF5A 1Q80A 1PULA 2KPHA 2F3ZA 1FI5A 5I94A 2BL0C 3JVTC 5ER5A 1SR6C 1QX5B 2I94A 1R2UA 4AQJA 4CIDA 1DF0A 2K7DA 2LM5A 1LXFC 1M46A 5J3XA 4DCKA 4IL1A 2WCJA 2I7AA 2L4HA 3L47A 3PN7C 4N1FA 2JOJA 1KSOA 1XK4A 2ZN8A 1GQMA 4HRHA 2PASA 3WHTB 1B8CA 1YVLA 3NHTA 4XJKA 1CLBA 1VRKA 3OBVA 1NPQA 2GGMA 2QEOA 1H8BA 1BR1B 1S3PA 1UHKA 3FE6A 1OZOA 2FOTA 3D76A 2LP2A 3CR2A 4GUKA 2JPOA 1UURA 1OOJA 2LMUA 1E8AA 5CSIA 5JOLA 5AERA 3B86A 3CABA 4E68A 4OCIA 2HQ8A 1QTXA 2KBIA 2TN4A 3O6BA 1B47A 3DVEA 5D69A 2K61A 4GGFC 3S0FA 2AAOA 2GGZA 1XFZO 1M31A 1TCFA 2QEVA 1UHJA 1N2DA 4USLA 4MLWA 2WCFA 2KSPA 3CZ2A 3NSOA 1SL7A 2M3WA 1F4OA 1AP4A 1J7OA 3LL8B 3Q8IA 3QRXA 2BCXA 2JPTA 2MHHA 4MRXA 5CPVA 4UPGA 3K21A 1JFJA 2WCEA 3TDIA 4YGDB 3CZ1A 1N65A 1AUIB 3EK8A 3GK4X 4ORCB 3D75A 1OE9B 1YUTA 3CLNA 4HREE 1BR4B 1MF8B 2LE9B 3BFBA 3D74A 3H4SE 1CMGA 3R1PA 4PHJA 5HKZA 1B8LA 1NIWA 1DGVA 2H61C 1IIOA 1DQEA 4PALA 2CT9A 1UHNA 5B8IB 1QVIZ 1IQ5A 1J55A 2MLEC 3MSEB 5DICA 3CS1A 1WRZA 3O4XA 4JKTA 2BE6A 4MEWA 2F33A 3BUNB 2KHNA 2MJWB 1XK4C 2MRDA 2ZNDA 4C0LA 2ISDA 3KEVA 3I5IB 3KHEA 2NXQA 1B7TY 2OTGB 1S1EA 2JZIA 4QJ3B 2BCAA 4L9MA 5DKNA 1TNWA 3HX4A 1S5GZ 1UHHA 1B9AA 2H8VA 1CMFA 1EH2A 2G2BA 1CM1A 1TN4A 2NZ0A 1XFUO 2L0PA 4P5OE 2ZRTA 3FS7A 1CFCA 1F54A 1DELA 1J7PA 1M45A 2HETA 2JNFA 2WC6A 2BBNA 2E6WA 1UWOA 1YRTB 1DGUA 3L4AA 1KSMA 4NDBA 1KFXL 1QIWA 1AJ4A 1SR6B 1SYMA 2CCMA 3B87A 3FE8A 4FTGA 1CDLA 4GFTA 5PALA 1IQ3A 1QLSA 1JBAA 4ETOA 5HKWA 2D8NA 4MZLA 1RECA 1XFRA 1TNQA 2H2KA 1SCVA 2R2IA 2WCBA 1GGWA 3GK1A 2PQLA 4I5JA 4M2PA 5ER4X 3PLFB 4FQTA 1TNPA 2A4JA 5I8NA 1JC2A 3CDNA 1CDNA 1YVHA 1LKJA 4QJ5B 5FI7A 1TRFA 5FI2A 3UO9A 4AQIA 3I5IC 3BQ3A 4OV2A 2OTGC 2MAZA 3NHIA 1FF1A 2BBMA 2GV5A 1YUUA 2VRGA 1CKKA 1SL8A 2Y4QA 1CDPA 1FI6A 4GAOA 2M7NA 1XO5A 1PRWA 4TNCA 2OPOA 5HLOA 3DVKA 2F3YA 2EC6B 1S6IA 1WLMA 3FWCA 2KI4B 1SPYA 2Q91A 2KFFA 2LVJA 1Z4HA 2K8MB 2KFGA 2F2PA 4A4BA 3EKJA 1NP8A 4ORBB 2M29A 3IVTA 1K96A 1LINA 2KQYA 2LMVA 1L2OB 1YR5A 1XYDA 1PALA 3SG2A 1M63B 1NUBA 2EGDA 3PM8A 4OZDA 3IQQA 4C0JA 1XFXO 3DVJA 5KU1A 1BLQA 3D0YB 3D77A 1SCMB 4YGAA 4MBEA 3DF0A 1QVIY 4PE7A 2LLUA 3V2LA 1DC1A 3VROA 1QX7A 2PVBA 4CFQA 1BOCA 2O60A 5D7FA 2M9GA 1K8UA 2FJUB 1MXEA 1IRJA 1A75B 4BY4A 1MHOA 1SMGA 1DTLA 4WRIA 1Y1XA 1IG5A 1KK7Z 1XFYO 3DYEA 1EL4A 1K94A 4BY5A 4F0ZB 1DJXA 2P6BB 3LCPC 1XFVO 2EC6C 3DD4A 4HSZA 1QV1A 5HLVA 2G9BA 2KI4C 4PE4A 3OP0A 4DRWA 2L51A 1EG4A 1G8IA 1DF0B 4YGCB 5AXIA 1U5IA 1NCXA 1DVIA 5I2OA 2WCHA 1DJZA 1JF2A 1ZMZA 2JRFA 2JU0A 2KBMA 2L4IA 2LANA 3BXKA 1F4QA 4YGEB 3CZ0A 1XVJA 3DVMA 2KGRA 4I5LB 4YI9A 5DKRA 1L2OC 4PT1A 3BOWA 3BUMB 3B7AA 1CLMA 1IH0A 1DJYA 1DJWA 1K93D 1K9KA 1K90D 1Y6WA 1TUJA 4XJKB 3S0EA 3WNXB 4AOMA 1RFJA 2B1UA 1SCMC 2I18A 2JXLA 2F2OA 4PCWA 4ZCVA 1CFDA 1C7WA 1OW4A 2KFHA 3SG7A 3O4YA 3VRNA 1W7IB 3AKAA 3O78A 1QV0A 4ZCUA 2PYQA 4JQ0D 1F55A 1AK8A 1DT7B 1P28A 3BFHA 3M0WA 3A8RA 3OX5A 3S0AA 3NSIA 3NSKA 2BNXA 3CYZA 3EK4A 4INWA 3SG6A 1CDMA 2KYFA 4HRGA 4PHNA 3GK2A 1KFUL 2QDIA 4XYNA 1KQMB 2JC2A 5DKQA 1W7JB 2KAXA 2K7OA 1QXPA 2MA2A 3TZ1A 1GM0A 2KYCA 1NCZA 4PHKA 1PK0D 3DY9A 3F45A 2WNDA 4PDZA 4JWQA 3NSLA 1HQVA 1QJTA 4GPLB 2HPSA 1UUSA 5TNCA 4DIRA 4OKHA 1DEKA 3C1VA 3D73A 1MQ1A 1MUXA 3IQOA 2KAYA 3CGAA 4A4CA 1BG1A 5AFPA 1TCOB 1A29A 2LVIA 2KLDA 3D10A 4Q04A 1HT9A 3WXAA 1MR8A 3ZWHA 4CLNA 2LHIA 1NX0A 3JTDB 2SCPA 1OMVA 3AAJA 1KK7Y 3OHMB 1QLKA 3BJHA 1C3ZA 4GGNA 1CFPA 4N5XA 3PJIA 5EL2A 2WC5A 4DUQA 1ZACA 2K60A 5HKYA 1CB1A 3I5HB 1KQMC 2PSRA 1SRAA 1CLLA 1J1EA 1MWNA 1YX7A 3PFVA 1D1OA 1K2HA 2ZKMX 3GOFA 1SBJA 1XFWO 5I2LA 5KTYA 3RZSA 1XA5A 2L98A 1ALWA 3N7HA 3RLZA 4JD9A 1ZOTB 1KFXS 5I2QA 1UHIA 2WCKA 2JT3A 2NLNA 2Q4UA 4YBHB 1PSRA 1M39A 1YUSA 2CTNA 3SG5A 3VRRA 1WRLA 1LS8A 2JULA 4YGBB 1RK9A 2ZRSA 1LVCD 3BUXB 2BAPA 2WORA 2QACA 5CSNA 3OGNA 1JWDA 3CR5X 4M2QA 2BECA 2M7LA 1FPWA 2GTEA 1EXRA 5K89A 4NDCA 2IS9A 1SW8A 3PATA 2L50A 4GGFA 1N0YA 3IF7A 1H4BA 3BUWB 3JTDC 1ORGA 2KLEA 2M1KB 3ZNIA 5AEQA 3S0GA 3BUOB 1C07A 2EHBA 2BE4A 4PE1A 3OB1B 4M2OA 1JUOA 2QPTA 1B1GA 4WQ2A 2KOTA 4MSPA 3A4UB 1SL9A 1OOGA 1TTXA 2JT0A 1IJ5A 2K7BA 2L2EA 1K9UA 2JT8A 2L5YA 2WCMA 1PVBA 1ZFSA 3CWGA 3I5HC 3SS3A 4P2YB 1L7ZA 2ERBA 5G08A 1Z2CB 1RJVA 2LUCA 2WOSA 3VRQA 5HL1A 5CSJA 4GNKB 3TUYB 3E3RA 1EG3A 5GQQC 1DJIA 2LHLA 1WY9A 2LC5A 1TWOA 3RM1A 1DMOA 1YTZC 1DJGA 1PSBA 3QMEA 4PE0A 1SKTA 3D78A 1S5GY 4MRYA 1B7TZ 2MBXA 1RROA 3R1OA 1BT6A 2H61A 1KWOB 1IKUA 3O2PA 2V53A 2AUCA 2M0RA 5HYDA 2KGBC 5JJGA 2LLTA 2WC8A 1CFFA 2L5XB 3TS5B 2ZFDA 3DF0B 3NGVA 3NXAA 1S6JA 2PRUA 3R72A 3AAKA 4MVFA 2KNEA 2LVKA 1GGZA 1K9PA 4IJ7A 5D3OA 3EK7A 2P71A 1A4PA 3TDUA 2QEBA 3K1EA 1NYAA 3WHUB 5AANA 2E30A 4QJ4B 1A2XA 2BCBA 3FIAA 1DJHA 1WLZA 1FBVA 4WQ3A 1TIZA 1SY9A 2LAPA 1SSEB 1IGVA 1RWYA 2COLB 2LP3A 3FWBA 1CNPA 3TUYC 1TNXA 1QASA 1KK8C 2NCOA 2ZNEA 4CPVA 2LMTA 1WRKA 3EVVA 4ORAB 3CZTX 1QS7A 3TDZA 3EVUA 3VB1A 2MLFC 1U5IB 4NQGA 2K0JA 4YRUA 1PVAA 1CM4A 3EKHA 4ICBA 1NX1A 5CSFA 1MXLC 1RTP1 1YURA 3AKBA 1OOHA 1KCYA
chains in the Genus database with same CATH topology
1KWOC 2PALA 3BOWB 3EVRA 1AVSA 3SJSA 1Y1UA 2JXCA 3BYAA 3SIBA 2OS8B 2Y1MA 2Y1NA 1NSHA 3TS5C 3I5FB 2KI6D 1F71A 1GJYA 1BJFA 1V1GA 1ZUZA 2JTTA 1J7RA 4MN0A 5F6TA 1ODBA 1EJ3A 2KQ6A 2LLSA 4I5KA 1NX2A 1OMRA 1JFKA 1OQPA 3KPXA 4CFRA 1OZSA 1KFUS 2K2FA 2RGIA 4I5NB 1S36A 2K7CA 3LK1A 4MZJA 2Y5IA 1IWQA 2HQWA 3OX6A 2M49B 1AHRA 3I5GB 4YI8A 1G4YR 1OMDA 4R1EA 1C7VA 2SASA 4JPZB 1A03A 3KF9A 1JSAA 1LA3A 4FQOA 1KQVA 1BMOA 2K2AA 3SIAA 3VRPA 3OB2B 2JQ6A 4NDDA 1JF0A 1BODA 3LK0A 3ICBA 1SNLA 4U8DA 1F70A 2OS8C 1ALVA 5FYXA 5KSZA 2DOQA 1J7QA 1LA0A 2PMYA 1B4CA 3I5FC 1BF5A 1TOPA 1WDCB 3CTNA 1B8RA 2FCDA 2LVVA 2JWWA 2LNKA 4PHMA 5BPJA 4OVNF 4D1EA 2NCPA 2BL0B 2JNXA 3CR4X 3JVTB 3PSRA 4OR9B 2JTZA 1SK6D 2F8PA 2AMIA 4MZKA 2O5GA 2KDHA 1Y0VH 2BKHB 3I5GC 1S6CA 3HCMA 3LLEA 1IJ6A 2LV7A 4DS7A 3PN7B 2M1UA 2CNPA 1J1DA 1K95A 3SG4A 2I2RE 1NWDA 1YX8A 1NCYA 1NX3A 2ZN9A 2BKIB 3SG3A 3D0YA 1G33A 3KO0A 1QIVA 1YRUB 4N1GA 2CBLA 1R6PA 1CTRA 1BU3A 2KI6C 1QX2A 1X02A 2CXJA 1V1FA 2M8UA 1S26D 2LCPA 1UP5A 1QATA 2LUXA 3VGOA 5IBWA 1Y1AA 1OSAA 2M97A 1A75A 1WDCC 3PALA 2KAVA 1F8HA 2FCEA 1KK8B 1FW4A 4C0KA 4GBAA 1AJ5A 2HF5A 1Q80A 1PULA 2F3ZA 1FI5A 2BL0C 3JVTC 5ER5A 1SR6C 1QX5B 2I94A 1R2UA 4AQJA 4CIDA 1DF0A 2K7DA 2LM5A 1LXFC 1M46A 5J3XA 4DCKA 4IL1A 2I7AA 2L4HA 3PN7C 4N1FA 2JOJA 1KSOA 1XK4A 2ZN8A 1GQMA 4HRHA 2PASA 3WHTB 1B8CA 1YVLA 4XJKA 1CLBA 1VRKA 1H8BA 1NPQA 2GGMA 1BR1B 1S3PA 1UHKA 1OZOA 2FOTA 2LP2A 3CR2A 4GUKA 1UURA 1OOJA 2LMUA 1E8AA 5CSIA 5JOLA 5AERA 4E68A 4OCIA 2HQ8A 1QTXA 2KBIA 2TN4A 3O6BA 1B47A 3DVEA 5D69A 2K61A 4GGFC 2AAOA 2GGZA 1XFZO 1M31A 1TCFA 1UHJA 1N2DA 4USLA 4MLWA 2WCFA 2KSPA 3NSOA 1SL7A 2M3WA 1F4OA 1AP4A 1J7OA 3LL8B 3QRXA 2BCXA 2JPTA 2MHHA 4MRXA 5CPVA 4UPGA 3K21A 1JFJA 2WCEA 3TDIA 4YGDB 1N65A 1AUIB 3EK8A 3GK4X 4ORCB 1OE9B 1YUTA 3CLNA 4HREE 1BR4B 1MF8B 2LE9B 3H4SE 1CMGA 4PHJA 5HKZA 1B8LA 1NIWA 1DGVA 2H61C 4PALA 2CT9A 1UHNA 5B8IB 1QVIZ 1IQ5A 1J55A 2MLEC 3MSEB 3CS1A 1WRZA 2BE6A 4MEWA 2F33A 3BUNB 2KHNA 2MJWB 1XK4C 2MRDA 2ZNDA 4C0LA 2ISDA 3KEVA 3I5IB 3KHEA 2NXQA 1B7TY 2OTGB 1S1EA 2JZIA 4QJ3B 2BCAA 4L9MA 5DKNA 1TNWA 3HX4A 1S5GZ 1UHHA 1B9AA 1CMFA 1EH2A 2G2BA 1CM1A 1TN4A 2NZ0A 1XFUO 2L0PA 4P5OE 2ZRTA 3FS7A 1CFCA 1F54A 1J7PA 1M45A 2HETA 2JNFA 2BBNA 2E6WA 1UWOA 1YRTB 1DGUA 1KSMA 4NDBA 1KFXL 1QIWA 1AJ4A 1SR6B 1SYMA 2CCMA 4FTGA 1CDLA 4GFTA 5PALA 1IQ3A 1QLSA 1JBAA 4ETOA 5HKWA 2D8NA 4MZLA 1RECA 1TNQA 2H2KA 1SCVA 2R2IA 2WCBA 1GGWA 3GK1A 4I5JA 4M2PA 5ER4X 3PLFB 1TNPA 2A4JA 5I8NA 1JC2A 1CDNA 1YVHA 1LKJA 4QJ5B 1TRFA 4AQIA 3I5IC 3BQ3A 4OV2A 2OTGC 2MAZA 1FF1A 2BBMA 2GV5A 1YUUA 2VRGA 1CKKA 1SL8A 2Y4QA 1CDPA 1FI6A 4GAOA 2M7NA 1XO5A 1PRWA 4TNCA 2OPOA 5HLOA 3DVKA 2F3YA 2EC6B 1S6IA 1WLMA 3FWCA 2KI4B 1SPYA 2Q91A 2KFFA 2LVJA 2K8MB 2KFGA 2F2PA 4A4BA 3EKJA 1NP8A 4ORBB 2M29A 1K96A 1LINA 2KQYA 2LMVA 1L2OB 1YR5A 1XYDA 1PALA 3SG2A 1M63B 1NUBA 2EGDA 3PM8A 4C0JA 3IQQA 1XFXO 3DVJA 5KU1A 1BLQA 3D0YB 1SCMB 4YGAA 4MBEA 3DF0A 1QVIY 4PE7A 2LLUA 3VROA 1QX7A 2PVBA 4CFQA 1BOCA 2O60A 5D7FA 2M9GA 1K8UA 2FJUB 1MXEA 1IRJA 1A75B 4BY4A 1MHOA 1SMGA 1DTLA 4WRIA 1Y1XA 1IG5A 1KK7Z 1XFYO 4BY5A 1EL4A 1K94A 4F0ZB 1DJXA 2P6BB 3LCPC 1XFVO 2EC6C 3DD4A 4HSZA 1QV1A 5HLVA 2G9BA 2KI4C 4PE4A 3OP0A 4DRWA 2L51A 1EG4A 1G8IA 1DF0B 4YGCB 5AXIA 1U5IA 1NCXA 1DVIA 5I2OA 1DJZA 1JF2A 1ZMZA 2JRFA 2JU0A 2KBMA 2L4IA 2LANA 3BXKA 1F4QA 4YGEB 1XVJA 3DVMA 2KGRA 4I5LB 4YI9A 5DKRA 1L2OC 3BOWA 3BUMB 1CLMA 1IH0A 1DJYA 1DJWA 1K93D 1K9KA 1K90D 1Y6WA 4XJKB 3WNXB 4AOMA 1RFJA 2B1UA 1SCMC 2I18A 2JXLA 2F2OA 4PCWA 4ZCVA 1CFDA 1C7WA 2KFHA 3SG7A 3O4YA 3VRNA 1W7IB 3AKAA 3O78A 1QV0A 4ZCUA 4JQ0D 1F55A 1AK8A 1DT7B 3M0WA 3A8RA 3OX5A 3NSIA 3NSKA 3EK4A 3SG6A 1CDMA 2KYFA 4HRGA 4PHNA 3GK2A 1KFUL 4XYNA 1KQMB 2JC2A 5DKQA 1W7JB 2KAXA 2K7OA 1QXPA 2MA2A 3TZ1A 2KYCA 1NCZA 4PHKA 1PK0D 3F45A 2WNDA 4PDZA 4JWQA 3NSLA 1HQVA 1QJTA 4GPLB 2HPSA 1UUSA 5TNCA 4DIRA 4OKHA 3C1VA 1MQ1A 1MUXA 3IQOA 2KAYA 3CGAA 4A4CA 1BG1A 5AFPA 1TCOB 1A29A 2LVIA 3D10A 4Q04A 3WXAA 1HT9A 3ZWHA 1MR8A 4CLNA 2LHIA 1NX0A 3JTDB 2SCPA 1OMVA 3AAJA 1KK7Y 3OHMB 1QLKA 4GGNA 1CFPA 4N5XA 4DUQA 1ZACA 5HKYA 1CB1A 3I5HB 1KQMC 2PSRA 1SRAA 1CLLA 1J1EA 1MWNA 1YX7A 3PFVA 1D1OA 1K2HA 2ZKMX 3GOFA 1SBJA 1XFWO 5I2LA 5KTYA 1XA5A 2L98A 1ALWA 3RLZA 1ZOTB 1KFXS 5I2QA 1UHIA 2JT3A 2NLNA 2Q4UA 4YBHB 1PSRA 1M39A 1YUSA 2CTNA 3SG5A 3VRRA 1WRLA 2JULA 4YGBB 1RK9A 2ZRSA 1LVCD 3BUXB 2WORA 2QACA 5CSNA 1JWDA 3CR5X 4M2QA 2BECA 2M7LA 1FPWA 1EXRA 5K89A 4NDCA 2IS9A 1SW8A 3PATA 2L50A 4GGFA 1N0YA 3IF7A 1H4BA 3BUWB 3JTDC 2M1KB 3ZNIA 5AEQA 3BUOB 1C07A 2EHBA 2BE4A 4PE1A 3OB1B 4M2OA 1JUOA 2QPTA 1B1GA 4WQ2A 2KOTA 4MSPA 3A4UB 1SL9A 1TTXA 2JT0A 1IJ5A 2K7BA 2L2EA 1K9UA 2JT8A 3CWGA 3I5HC 1PVBA 1ZFSA 4P2YB 1L7ZA 5G08A 2WOSA 1RJVA 2LUCA 3VRQA 5CSJA 4GNKB 3TUYB 3E3RA 1EG3A 5GQQC 1DJIA 2LHLA 1WY9A 2LC5A 3RM1A 1DMOA 1YTZC 1DJGA 1PSBA 4PE0A 1SKTA 1S5GY 4MRYA 1B7TZ 2MBXA 1RROA 1BT6A 2H61A 1KWOB 1IKUA 3O2PA 2V53A 2AUCA 2M0RA 5HYDA 2KGBC 5JJGA 2LLTA 2WC8A 1CFFA 2L5XB 3TS5B 2ZFDA 3DF0B 3NXAA 1S6JA 2PRUA 3AAKA 4MVFA 2KNEA 2LVKA 1GGZA 1K9PA 3EK7A 1A4PA 3TDUA 3WHUB 1NYAA 5AANA 2E30A 4QJ4B 2BCBA 1A2XA 3FIAA 1DJHA 1WLZA 1FBVA 4WQ3A 1TIZA 1SY9A 2LAPA 1IGVA 1RWYA 2COLB 2LP3A 3FWBA 1CNPA 3TUYC 1TNXA 1QASA 1KK8C 2NCOA 2ZNEA 4CPVA 2LMTA 1WRKA 3EVVA 4ORAB 3CZTX 1QS7A 3TDZA 3EVUA 2MLFC 1U5IB 4NQGA 2K0JA 4YRUA 1PVAA 1CM4A 3EKHA 4ICBA 1NX1A 5CSFA 1MXLC 1RTP1 1YURA 3AKBA 1KCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KWO C;  2PAL A;  3BOW B;  3EVR A;  1AVS A;  3SJS A;  1Y1U A;  2JXC A;  3BYA A;  3SIB A;  2OS8 B;  2Y1M A;  2Y1N A;  1NSH A;  3TS5 C;  3I5F B;  2KI6 D;  1F71 A;  1GJY A;  1BJF A;  1V1G A;  1ZUZ A;  2JTT A;  1J7R A;  4MN0 A;  5F6T A;  1ODB A;  1EJ3 A;  2KQ6 A;  2LLS A;  4I5K A;  1NX2 A;  1OMR A;  1JFK A;  1OQP A;  3KPX A;  4CFR A;  1OZS A;  1KFU S;  2K2F A;  2RGI A;  4I5N B;  1S36 A;  2K7C A;  3LK1 A;  4MZJ A;  2Y5I A;  1IWQ A;  2HQW A;  3OX6 A;  2M49 B;  1AHR A;  3I5G B;  4YI8 A;  1G4Y R;  1OMD A;  4R1E A;  1C7V A;  2SAS A;  4JPZ B;  1A03 A;  3KF9 A;  1JSA A;  1LA3 A;  4FQO A;  1KQV A;  1BMO A;  2K2A A;  3SIA A;  3VRP A;  3OB2 B;  2JQ6 A;  4NDD A;  1JF0 A;  1BOD A;  3LK0 A;  3ICB A;  1SNL A;  4U8D A;  1F70 A;  2OS8 C;  1ALV A;  5FYX A;  5KSZ A;  2DOQ A;  1J7Q A;  1LA0 A;  2PMY A;  1B4C A;  3I5F C;  1BF5 A;  1TOP A;  1WDC B;  3CTN A;  1B8R A;  2FCD A;  2LVV A;  2JWW A;  2LNK A;  4PHM A;  5BPJ A;  4OVN F;  4D1E A;  2NCP A;  2BL0 B;  2JNX A;  3CR4 X;  3JVT B;  3PSR A;  4OR9 B;  2JTZ A;  1SK6 D;  2F8P A;  2AMI A;  4MZK A;  2O5G A;  2KDH A;  1Y0V H;  2BKH B;  3I5G C;  1S6C A;  3HCM A;  3LLE A;  1IJ6 A;  2LV7 A;  4DS7 A;  3PN7 B;  2M1U A;  2CNP A;  1J1D A;  1K95 A;  3SG4 A;  2I2R E;  1NWD A;  1YX8 A;  1NCY A;  1NX3 A;  2ZN9 A;  2BKI B;  3SG3 A;  3D0Y A;  1G33 A;  3KO0 A;  1QIV A;  1YRU B;  4N1G A;  2CBL A;  1R6P A;  1CTR A;  1BU3 A;  2KI6 C;  1QX2 A;  1X02 A;  2CXJ A;  1V1F A;  2M8U A;  1S26 D;  2LCP A;  1UP5 A;  1QAT A;  2LUX A;  3VGO A;  5IBW A;  1Y1A A;  1OSA A;  2M97 A;  1A75 A;  1WDC C;  3PAL A;  2KAV A;  1F8H A;  2FCE A;  1KK8 B;  1FW4 A;  4C0K A;  4GBA A;  1AJ5 A;  2HF5 A;  1Q80 A;  1PUL A;  2F3Z A;  1FI5 A;  2BL0 C;  3JVT C;  5ER5 A;  1SR6 C;  1QX5 B;  2I94 A;  1R2U A;  4AQJ A;  4CID A;  1DF0 A;  2K7D A;  2LM5 A;  1LXF C;  1M46 A;  5J3X A;  4DCK A;  4IL1 A;  2I7A A;  2L4H A;  3PN7 C;  4N1F A;  2JOJ A;  1KSO A;  1XK4 A;  2ZN8 A;  1GQM A;  4HRH A;  2PAS A;  3WHT B;  1B8C A;  1YVL A;  4XJK A;  1CLB A;  1VRK A;  1H8B A;  1NPQ A;  2GGM A;  1BR1 B;  1S3P A;  1UHK A;  1OZO A;  2FOT A;  2LP2 A;  3CR2 A;  4GUK A;  1UUR A;  1OOJ A;  2LMU A;  1E8A A;  5CSI A;  5JOL A;  5AER A;  4E68 A;  4OCI A;  2HQ8 A;  1QTX A;  2KBI A;  2TN4 A;  3O6B A;  1B47 A;  3DVE A;  5D69 A;  2K61 A;  4GGF C;  2AAO A;  2GGZ A;  1XFZ O;  1M31 A;  1TCF A;  1UHJ A;  1N2D A;  4USL A;  4MLW A;  2WCF A;  2KSP A;  3NSO A;  1SL7 A;  2M3W A;  1F4O A;  1AP4 A;  1J7O A;  3LL8 B;  3QRX A;  2BCX A;  2JPT A;  2MHH A;  4MRX A;  5CPV A;  4UPG A;  3K21 A;  1JFJ A;  2WCE A;  3TDI A;  4YGD B;  1N65 A;  1AUI B;  3EK8 A;  3GK4 X;  4ORC B;  1OE9 B;  1YUT A;  3CLN A;  4HRE E;  1BR4 B;  1MF8 B;  2LE9 B;  3H4S E;  1CMG A;  4PHJ A;  5HKZ A;  1B8L A;  1NIW A;  1DGV A;  2H61 C;  4PAL A;  2CT9 A;  1UHN A;  5B8I B;  1QVI Z;  1IQ5 A;  1J55 A;  2MLE C;  3MSE B;  3CS1 A;  1WRZ A;  2BE6 A;  4MEW A;  2F33 A;  3BUN B;  2KHN A;  2MJW B;  1XK4 C;  2MRD A;  2ZND A;  4C0L A;  2ISD A;  3KEV A;  3I5I B;  3KHE A;  2NXQ A;  1B7T Y;  2OTG B;  1S1E A;  2JZI A;  4QJ3 B;  2BCA A;  4L9M A;  5DKN A;  1TNW A;  3HX4 A;  1S5G Z;  1UHH A;  1B9A A;  1CMF A;  1EH2 A;  2G2B A;  1CM1 A;  1TN4 A;  2NZ0 A;  1XFU O;  2L0P A;  4P5O E;  2ZRT A;  3FS7 A;  1CFC A;  1F54 A;  1J7P A;  1M45 A;  2HET A;  2JNF A;  2BBN A;  2E6W A;  1UWO A;  1YRT B;  1DGU A;  1KSM A;  4NDB A;  1KFX L;  1QIW A;  1AJ4 A;  1SR6 B;  1SYM A;  2CCM A;  4FTG A;  1CDL A;  4GFT A;  5PAL A;  1IQ3 A;  1QLS A;  1JBA A;  4ETO A;  5HKW A;  2D8N A;  4MZL A;  1REC A;  1TNQ A;  2H2K A;  1SCV A;  2R2I A;  2WCB A;  1GGW A;  3GK1 A;  4I5J A;  4M2P A;  5ER4 X;  3PLF B;  1TNP A;  2A4J A;  5I8N A;  1JC2 A;  1CDN A;  1YVH A;  1LKJ A;  4QJ5 B;  1TRF A;  4AQI A;  3I5I C;  3BQ3 A;  4OV2 A;  2OTG C;  2MAZ A;  1FF1 A;  2BBM A;  2GV5 A;  1YUU A;  2VRG A;  1CKK A;  1SL8 A;  2Y4Q A;  1CDP A;  1FI6 A;  4GAO A;  2M7N A;  1XO5 A;  1PRW A;  4TNC A;  2OPO A;  5HLO A;  3DVK A;  2F3Y A;  2EC6 B;  1S6I A;  1WLM A;  3FWC A;  2KI4 B;  1SPY A;  2Q91 A;  2KFF A;  2LVJ A;  2K8M B;  2KFG A;  2F2P A;  4A4B A;  3EKJ A;  1NP8 A;  4ORB B;  2M29 A;  1K96 A;  1LIN A;  2KQY A;  2LMV A;  1L2O B;  1YR5 A;  1XYD A;  1PAL A;  3SG2 A;  1M63 B;  1NUB A;  2EGD A;  3PM8 A;  4C0J A;  3IQQ A;  1XFX O;  3DVJ A;  5KU1 A;  1BLQ A;  3D0Y B;  1SCM B;  4YGA A;  4MBE A;  3DF0 A;  1QVI Y;  4PE7 A;  2LLU A;  3VRO A;  1QX7 A;  2PVB A;  4CFQ A;  1BOC A;  2O60 A;  5D7F A;  2M9G A;  1K8U A;  2FJU B;  1MXE A;  1IRJ A;  1A75 B;  4BY4 A;  1MHO A;  1SMG A;  1DTL A;  4WRI A;  1Y1X A;  1IG5 A;  1KK7 Z;  1XFY O;  4BY5 A;  1EL4 A;  1K94 A;  4F0Z B;  1DJX A;  2P6B B;  3LCP C;  1XFV O;  2EC6 C;  3DD4 A;  4HSZ A;  1QV1 A;  5HLV A;  2G9B A;  2KI4 C;  4PE4 A;  3OP0 A;  4DRW A;  2L51 A;  1EG4 A;  1G8I A;  1DF0 B;  4YGC B;  5AXI A;  1U5I A;  1NCX A;  1DVI A;  5I2O A;  1DJZ A;  1JF2 A;  1ZMZ A;  2JRF A;  2JU0 A;  2KBM A;  2L4I A;  2LAN A;  3BXK A;  1F4Q A;  4YGE B;  1XVJ A;  3DVM A;  2KGR A;  4I5L B;  4YI9 A;  5DKR A;  1L2O C;  3BOW A;  3BUM B;  1CLM A;  1IH0 A;  1DJY A;  1DJW A;  1K93 D;  1K9K A;  1K90 D;  1Y6W A;  4XJK B;  3WNX B;  4AOM A;  1RFJ A;  2B1U A;  1SCM C;  2I18 A;  2JXL A;  2F2O A;  4PCW A;  4ZCV A;  1CFD A;  1C7W A;  2KFH A;  3SG7 A;  3O4Y A;  3VRN A;  1W7I B;  3AKA A;  3O78 A;  1QV0 A;  4ZCU A;  4JQ0 D;  1F55 A;  1AK8 A;  1DT7 B;  3M0W A;  3A8R A;  3OX5 A;  3NSI A;  3NSK A;  3EK4 A;  3SG6 A;  1CDM A;  2KYF A;  4HRG A;  4PHN A;  3GK2 A;  1KFU L;  4XYN A;  1KQM B;  2JC2 A;  5DKQ A;  1W7J B;  2KAX A;  2K7O A;  1QXP A;  2MA2 A;  3TZ1 A;  2KYC A;  1NCZ A;  4PHK A;  1PK0 D;  3F45 A;  2WND A;  4PDZ A;  4JWQ A;  3NSL A;  1HQV A;  1QJT A;  4GPL B;  2HPS A;  1UUS A;  5TNC A;  4DIR A;  4OKH A;  3C1V A;  1MQ1 A;  1MUX A;  3IQO A;  2KAY A;  3CGA A;  4A4C A;  1BG1 A;  5AFP A;  1TCO B;  1A29 A;  2LVI A;  3D10 A;  4Q04 A;  3WXA A;  1HT9 A;  3ZWH A;  1MR8 A;  4CLN A;  2LHI A;  1NX0 A;  3JTD B;  2SCP A;  1OMV A;  3AAJ A;  1KK7 Y;  3OHM B;  1QLK A;  4GGN A;  1CFP A;  4N5X A;  4DUQ A;  1ZAC A;  5HKY A;  1CB1 A;  3I5H B;  1KQM C;  2PSR A;  1SRA A;  1CLL A;  1J1E A;  1MWN A;  1YX7 A;  3PFV A;  1D1O A;  1K2H A;  2ZKM X;  3GOF A;  1SBJ A;  1XFW O;  5I2L A;  5KTY A;  1XA5 A;  2L98 A;  1ALW A;  3RLZ A;  1ZOT B;  1KFX S;  5I2Q A;  1UHI A;  2JT3 A;  2NLN A;  2Q4U A;  4YBH B;  1PSR A;  1M39 A;  1YUS A;  2CTN A;  3SG5 A;  3VRR A;  1WRL A;  2JUL A;  4YGB B;  1RK9 A;  2ZRS A;  1LVC D;  3BUX B;  2WOR A;  2QAC A;  5CSN A;  1JWD A;  3CR5 X;  4M2Q A;  2BEC A;  2M7L A;  1FPW A;  1EXR A;  5K89 A;  4NDC A;  2IS9 A;  1SW8 A;  3PAT A;  2L50 A;  4GGF A;  1N0Y A;  3IF7 A;  1H4B A;  3BUW B;  3JTD C;  2M1K B;  3ZNI A;  5AEQ A;  3BUO B;  1C07 A;  2EHB A;  2BE4 A;  4PE1 A;  3OB1 B;  4M2O A;  1JUO A;  2QPT A;  1B1G A;  4WQ2 A;  2KOT A;  4MSP A;  3A4U B;  1SL9 A;  1TTX A;  2JT0 A;  1IJ5 A;  2K7B A;  2L2E A;  1K9U A;  2JT8 A;  3CWG A;  3I5H C;  1PVB A;  1ZFS A;  4P2Y B;  1L7Z A;  5G08 A;  2WOS A;  1RJV A;  2LUC A;  3VRQ A;  5CSJ A;  4GNK B;  3TUY B;  3E3R A;  1EG3 A;  5GQQ C;  1DJI A;  2LHL A;  1WY9 A;  2LC5 A;  3RM1 A;  1DMO A;  1YTZ C;  1DJG A;  1PSB A;  4PE0 A;  1SKT A;  1S5G Y;  4MRY A;  1B7T Z;  2MBX A;  1RRO A;  1BT6 A;  2H61 A;  1KWO B;  1IKU A;  3O2P A;  2V53 A;  2AUC A;  2M0R A;  5HYD A;  2KGB C;  5JJG A;  2LLT A;  2WC8 A;  1CFF A;  2L5X B;  3TS5 B;  2ZFD A;  3DF0 B;  3NXA A;  1S6J A;  2PRU A;  3AAK A;  4MVF A;  2KNE A;  2LVK A;  1GGZ A;  1K9P A;  3EK7 A;  1A4P A;  3TDU A;  3WHU B;  1NYA A;  5AAN A;  2E30 A;  4QJ4 B;  2BCB A;  1A2X A;  3FIA A;  1DJH A;  1WLZ A;  1FBV A;  4WQ3 A;  1TIZ A;  1SY9 A;  2LAP A;  1IGV A;  1RWY A;  2COL B;  2LP3 A;  3FWB A;  1CNP A;  3TUY C;  1TNX A;  1QAS A;  1KK8 C;  2NCO A;  2ZNE A;  4CPV A;  2LMT A;  1WRK A;  3EVV A;  4ORA B;  3CZT X;  1QS7 A;  3TDZ A;  3EVU A;  2MLF C;  1U5I B;  4NQG A;  2K0J A;  4YRU A;  1PVA A;  1CM4 A;  3EKH A;  4ICB A;  1NX1 A;  5CSF A;  1MXL C;  1RTP 1;  1YUR A;  3AKB A;  1KCY A; 
#chains in the Genus database with same CATH topology
 1KWO C;  2PAL A;  3BOW B;  3DXL A;  3EVR A;  1AVS A;  3SJS A;  1Y1U A;  3SS4 A;  2JXC A;  1QWV A;  3BFA A;  3BYA A;  3SS5 A;  3SIB A;  2OS8 B;  2Y1M A;  2Y1N A;  1NSH A;  3TS5 C;  3I5F B;  2KI6 D;  1F71 A;  1GJY A;  1BJF A;  1V1G A;  1ZUZ A;  2JTT A;  1J7R A;  4MN0 A;  5F6T A;  1ODB A;  1EJ3 A;  2KQ6 A;  2LLS A;  4I5K A;  1NX2 A;  1OMR A;  1JFK A;  1OQP A;  4KYN A;  3KPX A;  4CFR A;  1OZS A;  1KFU S;  2K2F A;  2RGI A;  4I5N B;  1S36 A;  1TUZ A;  2K7C A;  3LK1 A;  4MZJ A;  2Y5I A;  1IWQ A;  2HQW A;  3OX6 A;  2M49 B;  1AHR A;  3I5G B;  4YI8 A;  1G4Y R;  1OMD A;  3B6X A;  4R1E A;  1C7V A;  3FE9 A;  2QEH A;  2SAS A;  4JPZ B;  1A03 A;  3KF9 A;  1JSA A;  1LA3 A;  4FQO A;  3B88 A;  1KQV A;  1BMO A;  3S0D A;  2K2A A;  3SIA A;  3VRP A;  3S0B A;  3OB2 B;  2JQ6 A;  4NDD A;  1JF0 A;  3UNW A;  1BOD A;  3LK0 A;  3ICB A;  1SNL A;  4U8D A;  1F70 A;  1OOF A;  2OS8 C;  1ALV A;  5FYX A;  5KSZ A;  2DOQ A;  1J7Q A;  3DZT A;  1LA0 A;  2PMY A;  1B4C A;  3I5F C;  1BF5 A;  1TOP A;  1WDC B;  3CTN A;  4F7F A;  1B8R A;  2YGU A;  3EG5 B;  1W9Z A;  2FCD A;  2LVV A;  2JWW A;  2LNK A;  4PHM A;  5BPJ A;  4INX A;  4OVN F;  2FJY A;  4D1E A;  2NCP A;  3R1V A;  2BL0 B;  2JNX A;  3CR4 X;  3JVT B;  3PM2 A;  3PSR A;  5FI6 A;  4OR9 B;  2JTZ A;  1SK6 D;  2F8P A;  2AMI A;  4MZK A;  2O5G A;  2KDH A;  1OOI X;  1Y0V H;  2BKH B;  3I5G C;  1S6C A;  3HCM A;  3LLE A;  1IJ6 A;  2LV7 A;  4DS7 A;  3PN7 B;  2M1U A;  2CNP A;  1J1D A;  1K95 A;  3SG4 A;  2I2R E;  1NWD A;  1YX8 A;  1NCY A;  1NX3 A;  2ZN9 A;  2BKI B;  3SG3 A;  3D0Y A;  1G33 A;  3KO0 A;  1QIV A;  1YRU B;  4N1G A;  2CBL A;  1R6P A;  1CTR A;  1BU3 A;  2KI6 C;  1QX2 A;  1X02 A;  2CXJ A;  1V1F A;  2M8U A;  3L4L A;  1S26 D;  2LCP A;  1UP5 A;  1QAT A;  2LUX A;  3VGO A;  5IBW A;  1Y1A A;  1OSA A;  2M97 A;  1A75 A;  1WDC C;  2WCL A;  3PAL A;  2KAV A;  1C3Y A;  2FCE A;  1F8H A;  1KK8 B;  1T14 A;  1FW4 A;  4C0K A;  4GBA A;  2P70 A;  2L2C A;  1AJ5 A;  2HF5 A;  1Q80 A;  1PUL A;  2KPH A;  2F3Z A;  1FI5 A;  5I94 A;  2BL0 C;  3JVT C;  5ER5 A;  1SR6 C;  1QX5 B;  2I94 A;  1R2U A;  4AQJ A;  4CID A;  1DF0 A;  2K7D A;  2LM5 A;  1LXF C;  1M46 A;  5J3X A;  4DCK A;  4IL1 A;  2WCJ A;  2I7A A;  2L4H A;  3L47 A;  3PN7 C;  4N1F A;  2JOJ A;  1KSO A;  1XK4 A;  2ZN8 A;  1GQM A;  4HRH A;  2PAS A;  3WHT B;  1B8C A;  1YVL A;  3NHT A;  4XJK A;  1CLB A;  1VRK A;  3OBV A;  1NPQ A;  2GGM A;  2QEO A;  1H8B A;  1BR1 B;  1S3P A;  1UHK A;  3FE6 A;  1OZO A;  2FOT A;  3D76 A;  2LP2 A;  3CR2 A;  4GUK A;  2JPO A;  1UUR A;  1OOJ A;  2LMU A;  1E8A A;  5CSI A;  5JOL A;  5AER A;  3B86 A;  3CAB A;  4E68 A;  4OCI A;  2HQ8 A;  1QTX A;  2KBI A;  2TN4 A;  3O6B A;  1B47 A;  3DVE A;  5D69 A;  2K61 A;  4GGF C;  3S0F A;  2AAO A;  2GGZ A;  1XFZ O;  1M31 A;  1TCF A;  2QEV A;  1UHJ A;  1N2D A;  4USL A;  4MLW A;  2WCF A;  2KSP A;  3CZ2 A;  3NSO A;  1SL7 A;  2M3W A;  1F4O A;  1AP4 A;  1J7O A;  3LL8 B;  3Q8I A;  3QRX A;  2BCX A;  2JPT A;  2MHH A;  4MRX A;  5CPV A;  4UPG A;  3K21 A;  1JFJ A;  2WCE A;  3TDI A;  4YGD B;  3CZ1 A;  1N65 A;  1AUI B;  3EK8 A;  3GK4 X;  4ORC B;  3D75 A;  1OE9 B;  1YUT A;  3CLN A;  4HRE E;  1BR4 B;  1MF8 B;  2LE9 B;  3BFB A;  3D74 A;  3H4S E;  1CMG A;  3R1P A;  4PHJ A;  5HKZ A;  1B8L A;  1NIW A;  1DGV A;  2H61 C;  1IIO A;  1DQE A;  4PAL A;  2CT9 A;  1UHN A;  5B8I B;  1QVI Z;  1IQ5 A;  1J55 A;  2MLE C;  3MSE B;  5DIC A;  3CS1 A;  1WRZ A;  3O4X A;  4JKT A;  2BE6 A;  4MEW A;  2F33 A;  3BUN B;  2KHN A;  2MJW B;  1XK4 C;  2MRD A;  2ZND A;  4C0L A;  2ISD A;  3KEV A;  3I5I B;  3KHE A;  2NXQ A;  1B7T Y;  2OTG B;  1S1E A;  2JZI A;  4QJ3 B;  2BCA A;  4L9M A;  5DKN A;  1TNW A;  3HX4 A;  1S5G Z;  1UHH A;  1B9A A;  2H8V A;  1CMF A;  1EH2 A;  2G2B A;  1CM1 A;  1TN4 A;  2NZ0 A;  1XFU O;  2L0P A;  4P5O E;  2ZRT A;  3FS7 A;  1CFC A;  1F54 A;  1DEL A;  1J7P A;  1M45 A;  2HET A;  2JNF A;  2WC6 A;  2BBN A;  2E6W A;  1UWO A;  1YRT B;  1DGU A;  3L4A A;  1KSM A;  4NDB A;  1KFX L;  1QIW A;  1AJ4 A;  1SR6 B;  1SYM A;  2CCM A;  3B87 A;  3FE8 A;  4FTG A;  1CDL A;  4GFT A;  5PAL A;  1IQ3 A;  1QLS A;  1JBA A;  4ETO A;  5HKW A;  2D8N A;  4MZL A;  1REC A;  1XFR A;  1TNQ A;  2H2K A;  1SCV A;  2R2I A;  2WCB A;  1GGW A;  3GK1 A;  2PQL A;  4I5J A;  4M2P A;  5ER4 X;  3PLF B;  4FQT A;  1TNP A;  2A4J A;  5I8N A;  1JC2 A;  3CDN A;  1CDN A;  1YVH A;  1LKJ A;  4QJ5 B;  5FI7 A;  1TRF A;  5FI2 A;  3UO9 A;  4AQI A;  3I5I C;  3BQ3 A;  4OV2 A;  2OTG C;  2MAZ A;  3NHI A;  1FF1 A;  2BBM A;  2GV5 A;  1YUU A;  2VRG A;  1CKK A;  1SL8 A;  2Y4Q A;  1CDP A;  1FI6 A;  4GAO A;  2M7N A;  1XO5 A;  1PRW A;  4TNC A;  2OPO A;  5HLO A;  3DVK A;  2F3Y A;  2EC6 B;  1S6I A;  1WLM A;  3FWC A;  2KI4 B;  1SPY A;  2Q91 A;  2KFF A;  2LVJ A;  1Z4H A;  2K8M B;  2KFG A;  2F2P A;  4A4B A;  3EKJ A;  1NP8 A;  4ORB B;  2M29 A;  3IVT A;  1K96 A;  1LIN A;  2KQY A;  2LMV A;  1L2O B;  1YR5 A;  1XYD A;  1PAL A;  3SG2 A;  1M63 B;  1NUB A;  2EGD A;  3PM8 A;  4OZD A;  3IQQ A;  4C0J A;  1XFX O;  3DVJ A;  5KU1 A;  1BLQ A;  3D0Y B;  3D77 A;  1SCM B;  4YGA A;  4MBE A;  3DF0 A;  1QVI Y;  4PE7 A;  2LLU A;  3V2L A;  1DC1 A;  3VRO A;  1QX7 A;  2PVB A;  4CFQ A;  1BOC A;  2O60 A;  5D7F A;  2M9G A;  1K8U A;  2FJU B;  1MXE A;  1IRJ A;  1A75 B;  4BY4 A;  1MHO A;  1SMG A;  1DTL A;  4WRI A;  1Y1X A;  1IG5 A;  1KK7 Z;  1XFY O;  3DYE A;  1EL4 A;  1K94 A;  4BY5 A;  4F0Z B;  1DJX A;  2P6B B;  3LCP C;  1XFV O;  2EC6 C;  3DD4 A;  4HSZ A;  1QV1 A;  5HLV A;  2G9B A;  2KI4 C;  4PE4 A;  3OP0 A;  4DRW A;  2L51 A;  1EG4 A;  1G8I A;  1DF0 B;  4YGC B;  5AXI A;  1U5I A;  1NCX A;  1DVI A;  5I2O A;  2WCH A;  1DJZ A;  1JF2 A;  1ZMZ A;  2JRF A;  2JU0 A;  2KBM A;  2L4I A;  2LAN A;  3BXK A;  1F4Q A;  4YGE B;  3CZ0 A;  1XVJ A;  3DVM A;  2KGR A;  4I5L B;  4YI9 A;  5DKR A;  1L2O C;  4PT1 A;  3BOW A;  3BUM B;  3B7A A;  1CLM A;  1IH0 A;  1DJY A;  1DJW A;  1K93 D;  1K9K A;  1K90 D;  1Y6W A;  1TUJ A;  4XJK B;  3S0E A;  3WNX B;  4AOM A;  1RFJ A;  2B1U A;  1SCM C;  2I18 A;  2JXL A;  2F2O A;  4PCW A;  4ZCV A;  1CFD A;  1C7W A;  1OW4 A;  2KFH A;  3SG7 A;  3O4Y A;  3VRN A;  1W7I B;  3AKA A;  3O78 A;  1QV0 A;  4ZCU A;  2PYQ A;  4JQ0 D;  1F55 A;  1AK8 A;  1DT7 B;  1P28 A;  3BFH A;  3M0W A;  3A8R A;  3OX5 A;  3S0A A;  3NSI A;  3NSK A;  2BNX A;  3CYZ A;  3EK4 A;  4INW A;  3SG6 A;  1CDM A;  2KYF A;  4HRG A;  4PHN A;  3GK2 A;  1KFU L;  2QDI A;  4XYN A;  1KQM B;  2JC2 A;  5DKQ A;  1W7J B;  2KAX A;  2K7O A;  1QXP A;  2MA2 A;  3TZ1 A;  1GM0 A;  2KYC A;  1NCZ A;  4PHK A;  1PK0 D;  3DY9 A;  3F45 A;  2WND A;  4PDZ A;  4JWQ A;  3NSL A;  1HQV A;  1QJT A;  4GPL B;  2HPS A;  1UUS A;  5TNC A;  4DIR A;  4OKH A;  1DEK A;  3C1V A;  3D73 A;  1MQ1 A;  1MUX A;  3IQO A;  2KAY A;  3CGA A;  4A4C A;  1BG1 A;  5AFP A;  1TCO B;  1A29 A;  2LVI A;  2KLD A;  3D10 A;  4Q04 A;  1HT9 A;  3WXA A;  1MR8 A;  3ZWH A;  4CLN A;  2LHI A;  1NX0 A;  3JTD B;  2SCP A;  1OMV A;  3AAJ A;  1KK7 Y;  3OHM B;  1QLK A;  3BJH A;  1C3Z A;  4GGN A;  1CFP A;  4N5X A;  3PJI A;  5EL2 A;  2WC5 A;  4DUQ A;  1ZAC A;  2K60 A;  5HKY A;  1CB1 A;  3I5H B;  1KQM C;  2PSR A;  1SRA A;  1CLL A;  1J1E A;  1MWN A;  1YX7 A;  3PFV A;  1D1O A;  1K2H A;  2ZKM X;  3GOF A;  1SBJ A;  1XFW O;  5I2L A;  5KTY A;  3RZS A;  1XA5 A;  2L98 A;  1ALW A;  3N7H A;  3RLZ A;  4JD9 A;  1ZOT B;  1KFX S;  5I2Q A;  1UHI A;  2WCK A;  2JT3 A;  2NLN A;  2Q4U A;  4YBH B;  1PSR A;  1M39 A;  1YUS A;  2CTN A;  3SG5 A;  3VRR A;  1WRL A;  1LS8 A;  2JUL A;  4YGB B;  1RK9 A;  2ZRS A;  1LVC D;  3BUX B;  2BAP A;  2WOR A;  2QAC A;  5CSN A;  3OGN A;  1JWD A;  3CR5 X;  4M2Q A;  2BEC A;  2M7L A;  1FPW A;  2GTE A;  1EXR A;  5K89 A;  4NDC A;  2IS9 A;  1SW8 A;  3PAT A;  2L50 A;  4GGF A;  1N0Y A;  3IF7 A;  1H4B A;  3BUW B;  3JTD C;  1ORG A;  2KLE A;  2M1K B;  3ZNI A;  5AEQ A;  3S0G A;  3BUO B;  1C07 A;  2EHB A;  2BE4 A;  4PE1 A;  3OB1 B;  4M2O A;  1JUO A;  2QPT A;  1B1G A;  4WQ2 A;  2KOT A;  4MSP A;  3A4U B;  1SL9 A;  1OOG A;  1TTX A;  2JT0 A;  1IJ5 A;  2K7B A;  2L2E A;  1K9U A;  2JT8 A;  2L5Y A;  2WCM A;  1PVB A;  1ZFS A;  3CWG A;  3I5H C;  3SS3 A;  4P2Y B;  1L7Z A;  2ERB A;  5G08 A;  1Z2C B;  1RJV A;  2LUC A;  2WOS A;  3VRQ A;  5HL1 A;  5CSJ A;  4GNK B;  3TUY B;  3E3R A;  1EG3 A;  5GQQ C;  1DJI A;  2LHL A;  1WY9 A;  2LC5 A;  1TWO A;  3RM1 A;  1DMO A;  1YTZ C;  1DJG A;  1PSB A;  3QME A;  4PE0 A;  1SKT A;  3D78 A;  1S5G Y;  4MRY A;  1B7T Z;  2MBX A;  1RRO A;  3R1O A;  1BT6 A;  2H61 A;  1KWO B;  1IKU A;  3O2P A;  2V53 A;  2AUC A;  2M0R A;  5HYD A;  2KGB C;  5JJG A;  2LLT A;  2WC8 A;  1CFF A;  2L5X B;  3TS5 B;  2ZFD A;  3DF0 B;  3NGV A;  3NXA A;  1S6J A;  2PRU A;  3R72 A;  3AAK A;  4MVF A;  2KNE A;  2LVK A;  1GGZ A;  1K9P A;  4IJ7 A;  5D3O A;  3EK7 A;  2P71 A;  1A4P A;  3TDU A;  2QEB A;  3K1E A;  1NYA A;  3WHU B;  5AAN A;  2E30 A;  4QJ4 B;  1A2X A;  2BCB A;  3FIA A;  1DJH A;  1WLZ A;  1FBV A;  4WQ3 A;  1TIZ A;  1SY9 A;  2LAP A;  1SSE B;  1IGV A;  1RWY A;  2COL B;  2LP3 A;  3FWB A;  1CNP A;  3TUY C;  1TNX A;  1QAS A;  1KK8 C;  2NCO A;  2ZNE A;  4CPV A;  2LMT A;  1WRK A;  3EVV A;  4ORA B;  3CZT X;  1QS7 A;  3TDZ A;  3EVU A;  3VB1 A;  2MLF C;  1U5I B;  4NQG A;  2K0J A;  4YRU A;  1PVA A;  1CM4 A;  3EKH A;  4ICB A;  1NX1 A;  5CSF A;  1MXL C;  1RTP 1;  1YUR A;  3AKB A;  1OOH A;  1KCY A; 
#chains in the Genus database with same CATH homology
 1KWO C;  2PAL A;  3BOW B;  3EVR A;  1AVS A;  3SJS A;  1Y1U A;  2JXC A;  3BYA A;  3SIB A;  2OS8 B;  2Y1M A;  2Y1N A;  1NSH A;  3TS5 C;  3I5F B;  2KI6 D;  1F71 A;  1GJY A;  1BJF A;  1V1G A;  1ZUZ A;  2JTT A;  1J7R A;  4MN0 A;  5F6T A;  1ODB A;  1EJ3 A;  2KQ6 A;  2LLS A;  4I5K A;  1NX2 A;  1OMR A;  1JFK A;  1OQP A;  3KPX A;  4CFR A;  1OZS A;  1KFU S;  2K2F A;  2RGI A;  4I5N B;  1S36 A;  2K7C A;  3LK1 A;  4MZJ A;  2Y5I A;  1IWQ A;  2HQW A;  3OX6 A;  2M49 B;  1AHR A;  3I5G B;  4YI8 A;  1G4Y R;  1OMD A;  4R1E A;  1C7V A;  2SAS A;  4JPZ B;  1A03 A;  3KF9 A;  1JSA A;  1LA3 A;  4FQO A;  1KQV A;  1BMO A;  2K2A A;  3SIA A;  3VRP A;  3OB2 B;  2JQ6 A;  4NDD A;  1JF0 A;  1BOD A;  3LK0 A;  3ICB A;  1SNL A;  4U8D A;  1F70 A;  2OS8 C;  1ALV A;  5FYX A;  5KSZ A;  2DOQ A;  1J7Q A;  1LA0 A;  2PMY A;  1B4C A;  3I5F C;  1BF5 A;  1TOP A;  1WDC B;  3CTN A;  1B8R A;  2FCD A;  2LVV A;  2JWW A;  2LNK A;  4PHM A;  5BPJ A;  4OVN F;  4D1E A;  2NCP A;  2BL0 B;  2JNX A;  3CR4 X;  3JVT B;  3PSR A;  4OR9 B;  2JTZ A;  1SK6 D;  2F8P A;  2AMI A;  4MZK A;  2O5G A;  2KDH A;  1Y0V H;  2BKH B;  3I5G C;  1S6C A;  3HCM A;  3LLE A;  1IJ6 A;  2LV7 A;  4DS7 A;  3PN7 B;  2M1U A;  2CNP A;  1J1D A;  1K95 A;  3SG4 A;  2I2R E;  1NWD A;  1YX8 A;  1NCY A;  1NX3 A;  2ZN9 A;  2BKI B;  3SG3 A;  3D0Y A;  1G33 A;  3KO0 A;  1QIV A;  1YRU B;  4N1G A;  2CBL A;  1R6P A;  1CTR A;  1BU3 A;  2KI6 C;  1QX2 A;  1X02 A;  2CXJ A;  1V1F A;  2M8U A;  1S26 D;  2LCP A;  1UP5 A;  1QAT A;  2LUX A;  3VGO A;  5IBW A;  1Y1A A;  1OSA A;  2M97 A;  1A75 A;  1WDC C;  3PAL A;  2KAV A;  1F8H A;  2FCE A;  1KK8 B;  1FW4 A;  4C0K A;  4GBA A;  1AJ5 A;  2HF5 A;  1Q80 A;  1PUL A;  2F3Z A;  1FI5 A;  2BL0 C;  3JVT C;  5ER5 A;  1SR6 C;  1QX5 B;  2I94 A;  1R2U A;  4AQJ A;  4CID A;  1DF0 A;  2K7D A;  2LM5 A;  1LXF C;  1M46 A;  5J3X A;  4DCK A;  4IL1 A;  2I7A A;  2L4H A;  3PN7 C;  4N1F A;  2JOJ A;  1KSO A;  1XK4 A;  2ZN8 A;  1GQM A;  4HRH A;  2PAS A;  3WHT B;  1B8C A;  1YVL A;  4XJK A;  1CLB A;  1VRK A;  1H8B A;  1NPQ A;  2GGM A;  1BR1 B;  1S3P A;  1UHK A;  1OZO A;  2FOT A;  2LP2 A;  3CR2 A;  4GUK A;  1UUR A;  1OOJ A;  2LMU A;  1E8A A;  5CSI A;  5JOL A;  5AER A;  4E68 A;  4OCI A;  2HQ8 A;  1QTX A;  2KBI A;  2TN4 A;  3O6B A;  1B47 A;  3DVE A;  5D69 A;  2K61 A;  4GGF C;  2AAO A;  2GGZ A;  1XFZ O;  1M31 A;  1TCF A;  1UHJ A;  1N2D A;  4USL A;  4MLW A;  2WCF A;  2KSP A;  3NSO A;  1SL7 A;  2M3W A;  1F4O A;  1AP4 A;  1J7O A;  3LL8 B;  3QRX A;  2BCX A;  2JPT A;  2MHH A;  4MRX A;  5CPV A;  4UPG A;  3K21 A;  1JFJ A;  2WCE A;  3TDI A;  4YGD B;  1N65 A;  1AUI B;  3EK8 A;  3GK4 X;  4ORC B;  1OE9 B;  1YUT A;  3CLN A;  4HRE E;  1BR4 B;  1MF8 B;  2LE9 B;  3H4S E;  1CMG A;  4PHJ A;  5HKZ A;  1B8L A;  1NIW A;  1DGV A;  2H61 C;  4PAL A;  2CT9 A;  1UHN A;  5B8I B;  1QVI Z;  1IQ5 A;  1J55 A;  2MLE C;  3MSE B;  3CS1 A;  1WRZ A;  2BE6 A;  4MEW A;  2F33 A;  3BUN B;  2KHN A;  2MJW B;  1XK4 C;  2MRD A;  2ZND A;  4C0L A;  2ISD A;  3KEV A;  3I5I B;  3KHE A;  2NXQ A;  1B7T Y;  2OTG B;  1S1E A;  2JZI A;  4QJ3 B;  2BCA A;  4L9M A;  5DKN A;  1TNW A;  3HX4 A;  1S5G Z;  1UHH A;  1B9A A;  1CMF A;  1EH2 A;  2G2B A;  1CM1 A;  1TN4 A;  2NZ0 A;  1XFU O;  2L0P A;  4P5O E;  2ZRT A;  3FS7 A;  1CFC A;  1F54 A;  1J7P A;  1M45 A;  2HET A;  2JNF A;  2BBN A;  2E6W A;  1UWO A;  1YRT B;  1DGU A;  1KSM A;  4NDB A;  1KFX L;  1QIW A;  1AJ4 A;  1SR6 B;  1SYM A;  2CCM A;  4FTG A;  1CDL A;  4GFT A;  5PAL A;  1IQ3 A;  1QLS A;  1JBA A;  4ETO A;  5HKW A;  2D8N A;  4MZL A;  1REC A;  1TNQ A;  2H2K A;  1SCV A;  2R2I A;  2WCB A;  1GGW A;  3GK1 A;  4I5J A;  4M2P A;  5ER4 X;  3PLF B;  1TNP A;  2A4J A;  5I8N A;  1JC2 A;  1CDN A;  1YVH A;  1LKJ A;  4QJ5 B;  1TRF A;  4AQI A;  3I5I C;  3BQ3 A;  4OV2 A;  2OTG C;  2MAZ A;  1FF1 A;  2BBM A;  2GV5 A;  1YUU A;  2VRG A;  1CKK A;  1SL8 A;  2Y4Q A;  1CDP A;  1FI6 A;  4GAO A;  2M7N A;  1XO5 A;  1PRW A;  4TNC A;  2OPO A;  5HLO A;  3DVK A;  2F3Y A;  2EC6 B;  1S6I A;  1WLM A;  3FWC A;  2KI4 B;  1SPY A;  2Q91 A;  2KFF A;  2LVJ A;  2K8M B;  2KFG A;  2F2P A;  4A4B A;  3EKJ A;  1NP8 A;  4ORB B;  2M29 A;  1K96 A;  1LIN A;  2KQY A;  2LMV A;  1L2O B;  1YR5 A;  1XYD A;  1PAL A;  3SG2 A;  1M63 B;  1NUB A;  2EGD A;  3PM8 A;  4C0J A;  3IQQ A;  1XFX O;  3DVJ A;  5KU1 A;  1BLQ A;  3D0Y B;  1SCM B;  4YGA A;  4MBE A;  3DF0 A;  1QVI Y;  4PE7 A;  2LLU A;  3VRO A;  1QX7 A;  2PVB A;  4CFQ A;  1BOC A;  2O60 A;  5D7F A;  2M9G A;  1K8U A;  2FJU B;  1MXE A;  1IRJ A;  1A75 B;  4BY4 A;  1MHO A;  1SMG A;  1DTL A;  4WRI A;  1Y1X A;  1IG5 A;  1KK7 Z;  1XFY O;  4BY5 A;  1EL4 A;  1K94 A;  4F0Z B;  1DJX A;  2P6B B;  3LCP C;  1XFV O;  2EC6 C;  3DD4 A;  4HSZ A;  1QV1 A;  5HLV A;  2G9B A;  2KI4 C;  4PE4 A;  3OP0 A;  4DRW A;  2L51 A;  1EG4 A;  1G8I A;  1DF0 B;  4YGC B;  5AXI A;  1U5I A;  1NCX A;  1DVI A;  5I2O A;  1DJZ A;  1JF2 A;  1ZMZ A;  2JRF A;  2JU0 A;  2KBM A;  2L4I A;  2LAN A;  3BXK A;  1F4Q A;  4YGE B;  1XVJ A;  3DVM A;  2KGR A;  4I5L B;  4YI9 A;  5DKR A;  1L2O C;  3BOW A;  3BUM B;  1CLM A;  1IH0 A;  1DJY A;  1DJW A;  1K93 D;  1K9K A;  1K90 D;  1Y6W A;  4XJK B;  3WNX B;  4AOM A;  1RFJ A;  2B1U A;  1SCM C;  2I18 A;  2JXL A;  2F2O A;  4PCW A;  4ZCV A;  1CFD A;  1C7W A;  2KFH A;  3SG7 A;  3O4Y A;  3VRN A;  1W7I B;  3AKA A;  3O78 A;  1QV0 A;  4ZCU A;  4JQ0 D;  1F55 A;  1AK8 A;  1DT7 B;  3M0W A;  3A8R A;  3OX5 A;  3NSI A;  3NSK A;  3EK4 A;  3SG6 A;  1CDM A;  2KYF A;  4HRG A;  4PHN A;  3GK2 A;  1KFU L;  4XYN A;  1KQM B;  2JC2 A;  5DKQ A;  1W7J B;  2KAX A;  2K7O A;  1QXP A;  2MA2 A;  3TZ1 A;  2KYC A;  1NCZ A;  4PHK A;  1PK0 D;  3F45 A;  2WND A;  4PDZ A;  4JWQ A;  3NSL A;  1HQV A;  1QJT A;  4GPL B;  2HPS A;  1UUS A;  5TNC A;  4DIR A;  4OKH A;  3C1V A;  1MQ1 A;  1MUX A;  3IQO A;  2KAY A;  3CGA A;  4A4C A;  1BG1 A;  5AFP A;  1TCO B;  1A29 A;  2LVI A;  3D10 A;  4Q04 A;  3WXA A;  1HT9 A;  3ZWH A;  1MR8 A;  4CLN A;  2LHI A;  1NX0 A;  3JTD B;  2SCP A;  1OMV A;  3AAJ A;  1KK7 Y;  3OHM B;  1QLK A;  4GGN A;  1CFP A;  4N5X A;  4DUQ A;  1ZAC A;  5HKY A;  1CB1 A;  3I5H B;  1KQM C;  2PSR A;  1SRA A;  1CLL A;  1J1E A;  1MWN A;  1YX7 A;  3PFV A;  1D1O A;  1K2H A;  2ZKM X;  3GOF A;  1SBJ A;  1XFW O;  5I2L A;  5KTY A;  1XA5 A;  2L98 A;  1ALW A;  3RLZ A;  1ZOT B;  1KFX S;  5I2Q A;  1UHI A;  2JT3 A;  2NLN A;  2Q4U A;  4YBH B;  1PSR A;  1M39 A;  1YUS A;  2CTN A;  3SG5 A;  3VRR A;  1WRL A;  2JUL A;  4YGB B;  1RK9 A;  2ZRS A;  1LVC D;  3BUX B;  2WOR A;  2QAC A;  5CSN A;  1JWD A;  3CR5 X;  4M2Q A;  2BEC A;  2M7L A;  1FPW A;  1EXR A;  5K89 A;  4NDC A;  2IS9 A;  1SW8 A;  3PAT A;  2L50 A;  4GGF A;  1N0Y A;  3IF7 A;  1H4B A;  3BUW B;  3JTD C;  2M1K B;  3ZNI A;  5AEQ A;  3BUO B;  1C07 A;  2EHB A;  2BE4 A;  4PE1 A;  3OB1 B;  4M2O A;  1JUO A;  2QPT A;  1B1G A;  4WQ2 A;  2KOT A;  4MSP A;  3A4U B;  1SL9 A;  1TTX A;  2JT0 A;  1IJ5 A;  2K7B A;  2L2E A;  1K9U A;  2JT8 A;  3CWG A;  3I5H C;  1PVB A;  1ZFS A;  4P2Y B;  1L7Z A;  5G08 A;  2WOS A;  1RJV A;  2LUC A;  3VRQ A;  5CSJ A;  4GNK B;  3TUY B;  3E3R A;  1EG3 A;  5GQQ C;  1DJI A;  2LHL A;  1WY9 A;  2LC5 A;  3RM1 A;  1DMO A;  1YTZ C;  1DJG A;  1PSB A;  4PE0 A;  1SKT A;  1S5G Y;  4MRY A;  1B7T Z;  2MBX A;  1RRO A;  1BT6 A;  2H61 A;  1KWO B;  1IKU A;  3O2P A;  2V53 A;  2AUC A;  2M0R A;  5HYD A;  2KGB C;  5JJG A;  2LLT A;  2WC8 A;  1CFF A;  2L5X B;  3TS5 B;  2ZFD A;  3DF0 B;  3NXA A;  1S6J A;  2PRU A;  3AAK A;  4MVF A;  2KNE A;  2LVK A;  1GGZ A;  1K9P A;  3EK7 A;  1A4P A;  3TDU A;  3WHU B;  1NYA A;  5AAN A;  2E30 A;  4QJ4 B;  2BCB A;  1A2X A;  3FIA A;  1DJH A;  1WLZ A;  1FBV A;  4WQ3 A;  1TIZ A;  1SY9 A;  2LAP A;  1IGV A;  1RWY A;  2COL B;  2LP3 A;  3FWB A;  1CNP A;  3TUY C;  1TNX A;  1QAS A;  1KK8 C;  2NCO A;  2ZNE A;  4CPV A;  2LMT A;  1WRK A;  3EVV A;  4ORA B;  3CZT X;  1QS7 A;  3TDZ A;  3EVU A;  2MLF C;  1U5I B;  4NQG A;  2K0J A;  4YRU A;  1PVA A;  1CM4 A;  3EKH A;  4ICB A;  1NX1 A;  5CSF A;  1MXL C;  1RTP 1;  1YUR A;  3AKB A;  1KCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...