3TS5B

Crystal structure of a light chain domain of scallop smooth muscle myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
b'ARLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
molecule tags Structural protein
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
total genus 45
structure length 142
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B01
4ORAB 1BOCA 1C7WA 1CMGA 2ZFDA 3SG4A 2JXLA 2M9GA 4N1FA 2BCAA 1IH0A 1BF5A 1DJGA 4R1EA 1B8LA 3EK4A 3IQOA 2CBLA 1WLZA 3FIAA 2WCFA 4MSPA 1S6CA 1V1FA 3QRXA 2P6BB 1JBAA 4CLNA 2FOTA 3JVTC 1XFWO 1YRTB 1A29A 2LMVA 3RM1A 4YI8A 1CKKA 2L50A 3RLZA 1R6PA 3OX5A 2HPSA 1IJ5A 2PVBA 1N65A 1K9PA 4CFQA 2HETA 2O60A 1BR4B 1FBVA 2QPTA 3BYAA 1Y1UA 1CTRA 1W7JB 2ZN8A 1HQVA 4IL1A 3SIAA 1B4CA 5CSIA 1AK8A 4NDCA 1NCZA 3SIBA 4M2PA 1A75B 1S1EA 2WNDA 1ZUZA 2JQ6A 1WRLA 2KI4C 3JTDC 4A4BA 3O4YA 4BY4A 2JULA 3LL8B 3DVMA 1BJFA 1S5GY 1JFKA 1KFXL 4JPZB 1L2OB 3I5FB 3SJSA 2KOTA 1AJ4A 4D1EA 3K21A 2F2PA 1F8HA 1QLKA 1YRUB 3BUOB 2QACA 1J7RA 3BUMB 1XO5A 1MWNA 4DRWA 1SYMA 2LMTA 3DVJA 1PVBA 3LCPC 4QJ3B 3CR5X 2K61A 5F6TA 2LNKA 5HKWA 2PSRA 1S6IA 1TTXA 1RTP1 2LE9B 1TN4A 4GGFC 1JF0A 1FF1A 2KAVA 2LP2A 1NCYA 1XFZO 2OS8C 1DJIA 2I94A 4N1GA 2LLTA 2K2FA 2HQWA 4GFTA 1EG4A 2MA2A 3TUYB 1CFDA 1KSMA 4OV2A 3M0WA 1MQ1A 1LVCD 1SCMB 2KBMA 2M3WA 1CFFA 2ZRTA 4I5JA 1N2DA 2MRDA 4YGEB 2M1KB 3NSOA 1QS7A 1OMVA 1BMOA 1XFXO 1S36A 1N0YA 2BE4A 2LUXA 1MHOA 1K94A 2SASA 4FTGA 3TS5C 1F70A 2L2EA 1B47A 1WLMA 3BXKA 1IQ5A 3LK0A 1AVSA 4GAOA 2F3ZA 3CS1A 1OSAA 1LKJA 5KSZA 3EKJA 4DIRA 1K96A 1YVLA 1QVIY 1A03A 1MF8B 2L5XB 4DUQA 2K0JA 1YUTA 1DJHA 1S5GZ 1Y6WA 1AP4A 2M49B 2D8NA 1KK8B 2CTNA 1ODBA 2KAYA 4L9MA 4WQ2A 1K9UA 1SK6D 4MZJA 1MUXA 1K90D 3HX4A 3CLNA 2L0PA 3BUXB 1J7OA 1CMFA 1SL7A 3DF0A 2OTGB 3OHMB 2BL0B 3EVUA 2KNEA 1KSOA 4ORBB 4PE1A 1OZSA 2CCMA 1WY9A 1PULA 4I5LB 4CPVA 2JXCA 5ER5A 1J7PA 2B1UA 1RFJA 3I5HB 4QJ5B 1LA0A 1X02A 4MEWA 2JZIA 2G9BA 2VRGA 2NXQA 1XK4C 4OR9B 3O2PA 3WHTB 2BBNA 1SL8A 4JWQA 2FCEA 2PALA 2ISDA 5HLOA 1B7TY 2G2BA 3ICBA 2Q4UA 1TCOB 4PHNA 3WNXB 5HKZA 1SR6B 2BCBA 3H4SE 3EKHA 1IG5A 1CNPA 1KFUL 1CLMA 3AAJA 3DVKA 4YGDB 3LK1A 3PATA 2BCXA 4E68A 5DKNA 3SG6A 1R2UA 2KSPA 2JWWA 4PHJA 1PSRA 1ZACA 5PALA 2EC6C 4U8DA 3CZTX 2COLB 5HLVA 1H8BA 2L4IA 1EG3A 2TN4A 3D0YB 1YURA 1DJXA 2GV5A 4GUKA 5KTYA 1GGZA 5FYXA 5G08A 1KFUS 3O78A 4MRXA 4M2QA 1KK7Z 1RJVA 1IQ3A 4BY5A 2L51A 2JRFA 2MLEC 1EH2A 5HKYA 1FPWA 3IQQA 5CSFA 2H61C 1WDCB 1NIWA 2JT0A 5D7FA 2FJUB 1SY9A 2F33A 4C0JA 2HF5A 1RECA 3HCMA 1H4BA 2I18A 1QATA 1EJ3A 2CT9A 1K9KA 2LMUA 1QLSA 2CXJA 2H2KA 2JC2A 2M7NA 1OQPA 3AKAA 3PFVA 1CDMA 1U5IA 2KQ6A 4GGNA 1OE9B 2LC5A 5AANA 1IRJA 2KBIA 4C0KA 3PLFB 3I5FC 1DMOA 1SKTA 3CWGA 2WCBA 1FI5A 2LVIA 2JTZA 1JUOA 3ZNIA 3BOWB 2K7CA 3VGOA 1YUSA 5I8NA 3KEVA 1E8AA 1K8UA 4GBAA 3CGAA 1LXFC 3I5IB 3WHUB 4XJKB 4OCIA 1UWOA 2L4HA 3D10A 2ZNDA 5JJGA 2KGRA 1G8IA 1QASA 3C1VA 4ORCB 1B8CA 4XYNA 1Y1XA 1NUBA 4MLWA 2NCOA 2MHHA 1UHIA 1TNPA 1QIWA 4ZCVA 1FW4A 4FQOA 2PMYA 4CFRA 2OS8B 2LHLA 1QV0A 3PN7B 3NSKA 4QJ4B 1SRAA 1ALWA 2KGBC 3BUWB 4PE4A 5BPJA 1XFVO 1J55A 2K2AA 1OZOA 3E3RA 1RROA 2KYCA 3BQ3A 2SCPA 3FS7A 4MVFA 2AUCA 3O6BA 4P5OE 2Y1NA 2KQYA 1LA3A 1Q80A 1D1OA 1JF2A 3OB1B 1UURA 1S26D 4M2OA 1QX2A 4DS7A 3SG3A 3TDIA 4PDZA 1MXEA 1C7VA 2ZKMX 4JQ0D 5DKRA 5DKQA 2M29A 1VRKA 4WRIA 2HQ8A 3JVTB 2NZ0A 2KAXA 3I5GC 1XFYO 2LUCA 2LLUA 1F4QA 1LINA 2KHNA 5CSNA 3FWBA 2FCDA 5K89A 1AHRA 4HRHA 2LM5A 3JTDB 1B7TZ 5AERA 3LLEA 4PHKA 1CDLA 5CPVA 5B8IB 2O5GA 3PSRA 4TNCA 3AAKA 1KK8C 3NSIA 4USLA 1NPQA 1WRZA 2JNXA 1MXLC 3D0YA 3TZ1A 1IWQA 2K7OA 4MN0A 4WQ3A 2ZN9A 4MZKA 4ZCUA 3DF0B 4Q04A 2GGZA 1B9AA 3KPXA 4YRUA 2KYFA 2BL0C 4PE0A 1CM1A 4AQIA 4I5KA 3SG5A 1SBJA 2V53A 2AMIA 2WC8A 2LVVA 1CLLA 4NDBA 3EVRA 1B1GA 1Y1AA 4MRYA 1KWOB 2JT3A 1M31A 2LLSA 1KQMC 1YR5A 1OMDA 1J1EA 1OOJA 1OMRA 1W7IB 1TNQA 1QV1A 1UHJA 4YGCB 1QX5B 4YBHB 1TNWA 1CM4A 1EXRA 3VROA 3GK1A 1YTZC 1KCYA 2JOJA 2K7DA 2WORA 1JC2A 1M39A 1SR6C 1YVHA 3EVVA 4MZLA 5I2LA 3EK7A 3PM8A 2R2IA 1NX1A 3FWCA 1BT6A 1IGVA 1YX8A 3KF9A 1IKUA 4A4CA 5TNCA 3OX6A 1NX0A 2EGDA 2LV7A 4XJKA 4GPLB 2E6WA 1QXPA 2H61A 1PALA 2KFHA 1SL9A 5AXIA 3TUYC 1DT7B 1KQVA 1NP8A 3CR4X 1AUIB 1B8RA 1ALVA 1ZFSA 1QJTA 2GGMA 1YUUA 4NDDA 3VRNA 4HREE 4OKHA 4PE7A 1K95A 1TOPA 3KHEA 1G33A 2BKIB 2KI6D 3A4UB 1M45A 2KI6C 2Y4QA 3BUNB 3TS5B 2K7BA 1NX3A 5AFPA 1WRKA 2WCEA 1IJ6A 1BG1A 5AEQA 1XVJA 1DJYA 2MAZA 3OB2B 1UHNA 4I5NB 1U5IB 3VRPA 1A2XA 1NYAA 4PALA 1NSHA 1DF0B 2KI4B 5J3XA 2M8UA 5ER4X 1TNXA 4P2YB 3BOWA 4NQGA 1PRWA 2OTGC 2BE6A 3GOFA 2F3YA 2JNFA 1L2OC 2CNPA 2L98A 1CFPA 3KO0A 1XFUO 5I2OA 3DD4A 2E30A 1DJWA 3I5HC 2WOSA 4CIDA 2M7LA 2KDHA 2M1UA 3CTNA 1DJZA 2BKHB 2PASA 2PRUA 1CLBA 3TDZA 2LHIA 1YX7A 2OPOA 1DGVA 1SW8A 5GQQC 1DGUA 1TCFA 5D69A 2JPTA 1GGWA 1F71A 2JT8A 1HT9A 5CSJA 2NLNA 2F2OA 4N5XA 1C07A 4YI9A 3PN7C 1QIVA 1AJ5A 1JWDA 1UP5A 1NCXA 4YGBB 2LANA 2BBMA 1SNLA 2MLFC 1S3PA 1UHHA 2EC6B 1JFJA 3ZWHA 2M97A 1DTLA 3CR2A 1SCMC 1SCVA 3DVEA 4ETOA 2NCPA 1A75A 1M46A 3NSLA 3WXAA 4OVNF 4C0LA 2RGIA 5IBWA 4AOMA 2JTTA 4PCWA 1BLQA 1BR1B 1M63B 2ZRSA 4UPGA 1A4PA 1MR8A 1JSAA 1F4OA 1ZMZA 1EL4A 1WDCC 2KFFA 3I5GB 5JOLA 1CDPA 2DOQA 1PK0D 1KK7Y 3OP0A 1SPYA 1G4YR 3SG2A 1ZOTB 1TIZA 1TRFA 4YGAA 4DCKA 1Y0VH 2AAOA 2Q91A 1J7QA 1K2HA 2LCPA 1F55A 1XA5A 3SG7A 1K93D 2JU0A 2IS9A 2LAPA 2LVKA 5KU1A 3F45A 4MBEA 2Y1MA 1CB1A 2I7AA 1S6JA 1KFXS 1CFCA 1UHKA 1SMGA 3VRQA 1NX2A 1RWYA 1J1DA 4GNKB 2K8MB 3I5IC 4F0ZB 4HRGA 3GK4X 3VRRA 2ZNEA 1BODA 3PALA 1PSBA 5I2QA 2LVJA 4HSZA 3TDUA 1QX7A 4ICBA 4AQJA 1BU3A 1DVIA 1CDNA 2F8PA 1KWOC 1XK4A 5HYDA 2KFGA 1RK9A 2BECA 1KQMB 2MJWB 3NXAA 2Y5IA 4PHMA 1PVAA 1NWDA 1DF0A 3EK8A 1XYDA 1QTXA 4GGFA 2M0RA 2MBXA 2LP3A 3MSEB 2A4JA 1F54A 1QVIZ 1UUSA 1V1GA 1GJYA 2EHBA 2I2RE 3AKBA 3GK2A 3IF7A 1FI6A 1GQMA 1L7ZA 3A8RA
chains in the Genus database with same CATH superfamily
4ORAB 1BOCA 1C7WA 1CMGA 2ZFDA 2BAPA 3SG4A 2JXLA 2M9GA 4N1FA 2BCAA 3BFHA 1IH0A 1BF5A 1DJGA 4R1EA 3N7HA 1B8LA 3EK4A 2FJYA 2CBLA 2H8VA 3IQOA 1WLZA 3FIAA 2WCFA 4MSPA 1S6CA 1V1FA 3QRXA 2P6BB 1JBAA 4CLNA 2FOTA 3JVTC 1XFWO 1YRTB 1A29A 2LMVA 3PJIA 4YI8A 3RM1A 1CKKA 1OW4A 2L50A 3RLZA 1R6PA 3OX5A 2HPSA 2KLDA 1IJ5A 2PVBA 1N65A 1K9PA 4CFQA 2HETA 2O60A 1BR4B 1FBVA 2QPTA 3SS3A 3BYAA 1Y1UA 1CTRA 1W7JB 2ZN8A 1DELA 1HQVA 3R1OA 4IL1A 3SIAA 1B4CA 5CSIA 1AK8A 1OOGA 1NCZA 4NDCA 3SIBA 4M2PA 1A75B 1S1EA 2WNDA 1ZUZA 2JQ6A 1WRLA 2KI4C 3JTDC 3R1VA 3O4YA 4A4BA 4BY4A 2JULA 3LL8B 3DVMA 1ORGA 1BJFA 1S5GY 1JFKA 2P71A 1KFXL 4INWA 4JPZB 1L2OB 3CZ0A 3I5FB 3SJSA 2KOTA 1AJ4A 4D1EA 3K21A 2F2PA 1F8HA 1QLKA 1C3YA 1YRUB 2YGUA 3BUOB 2QACA 1J7RA 2QEBA 3BUMB 1XO5A 1MWNA 4DRWA 1SYMA 2LMTA 3DVJA 1PVBA 3DY9A 3LCPC 4JKTA 3CR5X 2K61A 4QJ3B 2LNKA 5F6TA 2PSRA 5HKWA 1S6IA 1TTXA 5FI2A 1RTP1 2LE9B 1TN4A 4GGFC 1JF0A 3VB1A 1FF1A 3K1EA 2KAVA 2LP2A 1NCYA 1XFZO 2OS8C 1DJIA 2I94A 4N1GA 2LLTA 2K2FA 3B7AA 2HQWA 2WCJA 4GFTA 1DC1A 1EG4A 2MA2A 3TUYB 1CFDA 1KSMA 4OV2A 3M0WA 1MQ1A 1LVCD 1SCMB 2KBMA 2M3WA 1CFFA 2ZRTA 4I5JA 1N2DA 3O4XA 1TUZA 2MRDA 4YGEB 2M1KB 3NSOA 1QS7A 1OMVA 1BMOA 1XFXO 1S36A 1N0YA 2BE4A 2L5YA 2LUXA 4INXA 1MHOA 1K94A 2SASA 4FTGA 3B87A 3TS5C 2QEVA 1F70A 3R72A 2L2EA 1B47A 1WLMA 2JPOA 3BXKA 1IQ5A 3LK0A 3PM2A 1AVSA 5EL2A 4GAOA 2F3ZA 3CS1A 3SS4A 1OSAA 3DZTA 1LKJA 5KSZA 3EKJA 4DIRA 1K96A 1YVLA 1QVIY 1A03A 1MF8B 2L5XB 4DUQA 2K0JA 1YUTA 1DJHA 1S5GZ 1Y6WA 1AP4A 2M49B 2D8NA 1KK8B 2CTNA 3IVTA 2PQLA 1ODBA 3S0FA 2KAYA 2PYQA 4L9MA 4WQ2A 1K9UA 1SK6D 4MZJA 3S0BA 4FQTA 1MUXA 2WC6A 1K90D 3BJHA 3HX4A 3CLNA 2L0PA 3BUXB 1J7OA 1CMFA 1SL7A 3DF0A 2OTGB 5I94A 3OHMB 2BL0B 3EVUA 2KNEA 1KSOA 4ORBB 4PE1A 1OZSA 2CCMA 1WY9A 1PULA 4I5LB 4CPVA 2JXCA 5ER5A 1J7PA 2B1UA 1RFJA 3I5HB 4QJ5B 1LA0A 1X02A 4MEWA 2JZIA 2G9BA 1TWOA 2VRGA 2NXQA 1XK4C 4OR9B 3O2PA 3WHTB 4KYNA 2BBNA 1SL8A 4JWQA 2FCEA 2PALA 2ISDA 5HLOA 1B7TY 2G2BA 3ICBA 2Q4UA 1TCOB 4PHNA 3NHIA 2WCKA 3WNXB 5HKZA 1SR6B 2BCBA 3H4SE 3EKHA 1IG5A 3NGVA 1CNPA 1KFUL 1CLMA 3AAJA 1P28A 3DVKA 4YGDB 3LK1A 3PATA 2BCXA 4E68A 5DKNA 3SG6A 1R2UA 2KSPA 2JWWA 4PHJA 1PSRA 1ZACA 5PALA 3CDNA 3DYEA 2EC6C 4U8DA 3CZTX 2COLB 3NHTA 5HLVA 1H8BA 2L4IA 1EG3A 2TN4A 3D0YB 1YURA 1DJXA 2GV5A 4GUKA 5KTYA 1GGZA 5FYXA 5G08A 1KFUS 1C3ZA 4OZDA 3O78A 1Z2CB 4M2QA 4MRXA 1KK7Z 1RJVA 1IQ3A 4BY5A 2L51A 2JRFA 2MLEC 1EH2A 5HKYA 1FPWA 3IQQA 2KPHA 5CSFA 2H61C 1WDCB 1NIWA 2JT0A 3DXLA 3FE9A 5D7FA 2FJUB 1SY9A 2F33A 4C0JA 2HF5A 1RECA 3HCMA 1H4BA 2I18A 1QATA 3D76A 1EJ3A 2CT9A 1K9KA 2LMUA 2CXJA 1QLSA 2H2KA 2JC2A 2M7NA 1OQPA 3AKAA 3PFVA 1CDMA 1U5IA 2KQ6A 4GGNA 1OE9B 2LC5A 5AANA 1IRJA 2KBIA 1DQEA 3PLFB 3I5FC 4C0KA 1DMOA 1SKTA 3CWGA 2WCBA 3SS5A 1FI5A 2LVIA 2JTZA 3BFBA 1JUOA 3L47A 3ZNIA 3BOWB 2K7CA 3VGOA 1YUSA 5I8NA 1OOHA 3KEVA 1E8AA 1K8UA 4GBAA 3CGAA 1LXFC 3I5IB 3S0EA 3WHUB 4XJKB 3Q8IA 4OCIA 1UWOA 2P70A 3CABA 2L4HA 3D10A 2ZNDA 5JJGA 2KGRA 1G8IA 1QASA 3RZSA 1GM0A 3C1VA 4ORCB 1B8CA 4XYNA 1Y1XA 1NUBA 4MLWA 2NCOA 4IJ7A 3V2LA 3FE8A 2MHHA 1UHIA 1TNPA 1QIWA 4ZCVA 1FW4A 4FQOA 2PMYA 5FI6A 2OS8B 4CFRA 2LHLA 1QV0A 3PN7B 3NSKA 4QJ4B 1SRAA 1ALWA 1W9ZA 2KGBC 3BUWB 4PE4A 3CYZA 5BPJA 2QEOA 1XFVO 1J55A 2K2AA 1OZOA 3E3RA 1RROA 2KYCA 3BQ3A 2SCPA 3FS7A 4MVFA 3D74A 2AUCA 3O6BA 4P5OE 2Y1NA 2KQYA 1LA3A 1Q80A 1D1OA 1JF2A 3OB1B 1UURA 1S26D 4M2OA 1QX2A 4DS7A 3SG3A 3TDIA 4PDZA 1MXEA 1C7VA 2ZKMX 4JQ0D 5DKRA 5DKQA 2M29A 1VRKA 4WRIA 3B6XA 2HQ8A 3JVTB 2NZ0A 2KAXA 3I5GC 1XFYO 3CZ1A 2LUCA 5FI7A 2GTEA 2LLUA 1F4QA 1LINA 2KHNA 5CSNA 3FWBA 2FCDA 5K89A 1AHRA 4HRHA 2LM5A 3JTDB 1B7TZ 3FE6A 5AERA 3LLEA 4PHKA 1CDLA 5CPVA 5B8IB 1T14A 2O5GA 3PSRA 4TNCA 3AAKA 1KK8C 3NSIA 3B88A 4USLA 1NPQA 1WRZA 2JNXA 1MXLC 3D0YA 3TZ1A 1IWQA 2K7OA 4MN0A 4WQ3A 2ZN9A 4MZKA 4ZCUA 3DF0B 4Q04A 1XFRA 2GGZA 1B9AA 3KPXA 4YRUA 2KYFA 2BL0C 4PE0A 1CM1A 1LS8A 4AQIA 4I5KA 3SG5A 1SBJA 2V53A 2AMIA 2WC8A 2LVVA 1CLLA 4NDBA 3D78A 3EVRA 1Y1AA 1B1GA 3BFAA 4MRYA 2ERBA 1KWOB 2JT3A 1M31A 2LLSA 1KQMC 1YR5A 3D73A 5HL1A 1OMDA 1J1EA 1OOJA 1OMRA 1W7IB 1TNQA 1QV1A 1UHJA 4YGCB 1QX5B 4YBHB 1TNWA 1CM4A 1EXRA 3VROA 3GK1A 1YTZC 1KCYA 2JOJA 2K7DA 2WORA 1JC2A 1M39A 1SR6C 1YVHA 3EVVA 4MZLA 5I2LA 3EK7A 3PM8A 2R2IA 1OOIX 1NX1A 3FWCA 1BT6A 1IGVA 1SSEB 1YX8A 3KF9A 1IKUA 4A4CA 5TNCA 3OX6A 1NX0A 2EGDA 2LV7A 4XJKA 4GPLB 2E6WA 1QXPA 2H61A 1PALA 2KFHA 1SL9A 5AXIA 3TUYC 4F7FA 1DT7B 1KQVA 1NP8A 3CR4X 3OGNA 3D75A 1AUIB 1B8RA 1ALVA 1ZFSA 1QJTA 2GGMA 1YUUA 2QDIA 4NDDA 3VRNA 4HREE 4OKHA 4PE7A 1K95A 2QEHA 1TOPA 3KHEA 1G33A 2BKIB 2KI6D 3A4UB 1M45A 2KI6C 2Y4QA 3BUNB 2WC5A 5DICA 3TS5B 2K7BA 1NX3A 5AFPA 1WRKA 2WCEA 1IJ6A 3UNWA 1BG1A 5AEQA 1XVJA 1DJYA 2MAZA 3OB2B 1UHNA 4I5NB 1U5IB 3VRPA 1A2XA 1NYAA 3S0DA 4PALA 1NSHA 1DF0B 2KI4B 5J3XA 2M8UA 5ER4X 1TNXA 4P2YB 3BOWA 3OBVA 4NQGA 1PRWA 2OTGC 2BE6A 3GOFA 2F3YA 2JNFA 1L2OC 2CNPA 2L98A 1CFPA 3KO0A 1XFUO 5I2OA 3DD4A 2E30A 1DJWA 3I5HC 2WOSA 2WCLA 3EG5B 4CIDA 2M7LA 2KDHA 2M1UA 3CTNA 1DJZA 2BKHB 1QWVA 2PASA 2PRUA 4PT1A 1CLBA 3TDZA 2LHIA 1YX7A 2OPOA 1DGVA 1SW8A 3D77A 5GQQC 1DGUA 1TCFA 5D69A 2JPTA 1GGWA 1F71A 2JT8A 1HT9A 3L4LA 1DEKA 5CSJA 2NLNA 2F2OA 4N5XA 1C07A 4YI9A 3PN7C 1QIVA 3CZ2A 1AJ5A 1JWDA 1UP5A 1NCXA 3L4AA 3S0AA 4YGBB 2WCHA 2LANA 2BBMA 1SNLA 2MLFC 1S3PA 1UHHA 2EC6B 1JFJA 3ZWHA 2M97A 1DTLA 4JD9A 3CR2A 1SCMC 1SCVA 3DVEA 4ETOA 2NCPA 1A75A 1M46A 3NSLA 3WXAA 4OVNF 4C0LA 2RGIA 5IBWA 4AOMA 2JTTA 1IIOA 4PCWA 1BLQA 1BR1B 1M63B 2K60A 2ZRSA 4UPGA 1A4PA 1MR8A 1JSAA 1F4OA 1ZMZA 1EL4A 1WDCC 2KFFA 3I5GB 5JOLA 1CDPA 2DOQA 1PK0D 1KK7Y 3OP0A 1SPYA 1G4YR 3QMEA 1ZOTB 3SG2A 1TIZA 1TRFA 4YGAA 4DCKA 1OOFA 1Y0VH 2AAOA 2Q91A 3B86A 1J7QA 1K2HA 2LCPA 3R1PA 1F55A 1XA5A 3SG7A 1K93D 2JU0A 2IS9A 2LAPA 2LVKA 5KU1A 3F45A 2BNXA 2L2CA 4MBEA 2Y1MA 1CB1A 2I7AA 1S6JA 1KFXS 1CFCA 1UHKA 1SMGA 3VRQA 1NX2A 1RWYA 1J1DA 4GNKB 1Z4HA 2K8MB 3I5IC 1TUJA 4F0ZB 4HRGA 3GK4X 3VRRA 2ZNEA 1BODA 3PALA 1PSBA 5I2QA 2LVJA 4HSZA 3TDUA 1QX7A 4ICBA 4AQJA 1BU3A 1DVIA 1CDNA 2F8PA 1KWOC 1XK4A 3S0GA 2KFGA 5HYDA 1RK9A 2BECA 1KQMB 3UO9A 2MJWB 3NXAA 2Y5IA 4PHMA 1PVAA 1NWDA 1DF0A 3EK8A 2KLEA 1XYDA 1QTXA 4GGFA 2M0RA 5D3OA 2WCMA 2MBXA 2LP3A 3MSEB 2A4JA 1F54A 1QVIZ 1UUSA 1V1GA 1GJYA 2EHBA 2I2RE 3AKBA 3GK2A 3IF7A 1FI6A 1GQMA 1L7ZA 3A8RA
chains in the Genus database with same CATH topology
4ORAB 1BOCA 1C7WA 1CMGA 2ZFDA 3SG4A 2JXLA 2M9GA 4N1FA 2BCAA 1IH0A 1BF5A 1DJGA 4R1EA 1B8LA 3EK4A 3IQOA 2CBLA 1WLZA 3FIAA 2WCFA 4MSPA 1S6CA 1V1FA 3QRXA 2P6BB 1JBAA 4CLNA 2FOTA 3JVTC 1XFWO 1YRTB 1A29A 2LMVA 3RM1A 4YI8A 1CKKA 2L50A 3RLZA 1R6PA 3OX5A 2HPSA 1IJ5A 2PVBA 1N65A 1K9PA 4CFQA 2HETA 2O60A 1BR4B 1FBVA 2QPTA 3BYAA 1Y1UA 1CTRA 1W7JB 2ZN8A 1HQVA 4IL1A 3SIAA 1B4CA 5CSIA 1AK8A 4NDCA 1NCZA 3SIBA 4M2PA 1A75B 1S1EA 2WNDA 1ZUZA 2JQ6A 1WRLA 2KI4C 3JTDC 4A4BA 3O4YA 4BY4A 2JULA 3LL8B 3DVMA 1BJFA 1S5GY 1JFKA 1KFXL 4JPZB 1L2OB 3I5FB 3SJSA 2KOTA 1AJ4A 4D1EA 3K21A 2F2PA 1F8HA 1QLKA 1YRUB 3BUOB 2QACA 1J7RA 3BUMB 1XO5A 1MWNA 4DRWA 1SYMA 2LMTA 3DVJA 1PVBA 3LCPC 4QJ3B 3CR5X 2K61A 5F6TA 2LNKA 5HKWA 2PSRA 1S6IA 1TTXA 1RTP1 2LE9B 1TN4A 4GGFC 1JF0A 1FF1A 2KAVA 2LP2A 1NCYA 1XFZO 2OS8C 1DJIA 2I94A 4N1GA 2LLTA 2K2FA 2HQWA 4GFTA 1EG4A 2MA2A 3TUYB 1CFDA 1KSMA 4OV2A 3M0WA 1MQ1A 1LVCD 1SCMB 2KBMA 2M3WA 1CFFA 2ZRTA 4I5JA 1N2DA 2MRDA 4YGEB 2M1KB 3NSOA 1QS7A 1OMVA 1BMOA 1XFXO 1S36A 1N0YA 2BE4A 2LUXA 1MHOA 1K94A 2SASA 4FTGA 3TS5C 1F70A 2L2EA 1B47A 1WLMA 3BXKA 1IQ5A 3LK0A 1AVSA 4GAOA 2F3ZA 3CS1A 1OSAA 1LKJA 5KSZA 3EKJA 4DIRA 1K96A 1YVLA 1QVIY 1A03A 1MF8B 2L5XB 4DUQA 2K0JA 1YUTA 1DJHA 1S5GZ 1Y6WA 1AP4A 2M49B 2D8NA 1KK8B 2CTNA 1ODBA 2KAYA 4L9MA 4WQ2A 1K9UA 1SK6D 4MZJA 1MUXA 1K90D 3HX4A 3CLNA 2L0PA 3BUXB 1J7OA 1CMFA 1SL7A 3DF0A 2OTGB 3OHMB 2BL0B 3EVUA 2KNEA 1KSOA 4ORBB 4PE1A 1OZSA 2CCMA 1WY9A 1PULA 4I5LB 4CPVA 2JXCA 5ER5A 1J7PA 2B1UA 1RFJA 3I5HB 4QJ5B 1LA0A 1X02A 4MEWA 2JZIA 2G9BA 2VRGA 2NXQA 1XK4C 4OR9B 3O2PA 3WHTB 2BBNA 1SL8A 4JWQA 2FCEA 2PALA 2ISDA 5HLOA 1B7TY 2G2BA 3ICBA 2Q4UA 1TCOB 4PHNA 3WNXB 5HKZA 1SR6B 2BCBA 3H4SE 3EKHA 1IG5A 1CNPA 1KFUL 1CLMA 3AAJA 3DVKA 4YGDB 3LK1A 3PATA 2BCXA 4E68A 5DKNA 3SG6A 1R2UA 2KSPA 2JWWA 4PHJA 1PSRA 1ZACA 5PALA 2EC6C 4U8DA 3CZTX 2COLB 5HLVA 1H8BA 2L4IA 1EG3A 2TN4A 3D0YB 1YURA 1DJXA 2GV5A 4GUKA 5KTYA 1GGZA 5FYXA 5G08A 1KFUS 3O78A 4MRXA 4M2QA 1KK7Z 1RJVA 1IQ3A 4BY5A 2L51A 2JRFA 2MLEC 1EH2A 5HKYA 1FPWA 3IQQA 5CSFA 2H61C 1WDCB 1NIWA 2JT0A 5D7FA 2FJUB 1SY9A 2F33A 4C0JA 2HF5A 1RECA 3HCMA 1H4BA 2I18A 1QATA 1EJ3A 2CT9A 1K9KA 2LMUA 1QLSA 2CXJA 2H2KA 2JC2A 2M7NA 1OQPA 3AKAA 3PFVA 1CDMA 1U5IA 2KQ6A 4GGNA 1OE9B 2LC5A 5AANA 1IRJA 2KBIA 4C0KA 3PLFB 3I5FC 1DMOA 1SKTA 3CWGA 2WCBA 1FI5A 2LVIA 2JTZA 1JUOA 3ZNIA 3BOWB 2K7CA 3VGOA 1YUSA 5I8NA 3KEVA 1E8AA 1K8UA 4GBAA 3CGAA 1LXFC 3I5IB 3WHUB 4XJKB 4OCIA 1UWOA 2L4HA 3D10A 2ZNDA 5JJGA 2KGRA 1G8IA 1QASA 3C1VA 4ORCB 1B8CA 4XYNA 1Y1XA 1NUBA 4MLWA 2NCOA 2MHHA 1UHIA 1TNPA 1QIWA 4ZCVA 1FW4A 4FQOA 2PMYA 4CFRA 2OS8B 2LHLA 1QV0A 3PN7B 3NSKA 4QJ4B 1SRAA 1ALWA 2KGBC 3BUWB 4PE4A 5BPJA 1XFVO 1J55A 2K2AA 1OZOA 3E3RA 1RROA 2KYCA 3BQ3A 2SCPA 3FS7A 4MVFA 2AUCA 3O6BA 4P5OE 2Y1NA 2KQYA 1LA3A 1Q80A 1D1OA 1JF2A 3OB1B 1UURA 1S26D 4M2OA 1QX2A 4DS7A 3SG3A 3TDIA 4PDZA 1MXEA 1C7VA 2ZKMX 4JQ0D 5DKRA 5DKQA 2M29A 1VRKA 4WRIA 2HQ8A 3JVTB 2NZ0A 2KAXA 3I5GC 1XFYO 2LUCA 2LLUA 1F4QA 1LINA 2KHNA 5CSNA 3FWBA 2FCDA 5K89A 1AHRA 4HRHA 2LM5A 3JTDB 1B7TZ 5AERA 3LLEA 4PHKA 1CDLA 5CPVA 5B8IB 2O5GA 3PSRA 4TNCA 3AAKA 1KK8C 3NSIA 4USLA 1NPQA 1WRZA 2JNXA 1MXLC 3D0YA 3TZ1A 1IWQA 2K7OA 4MN0A 4WQ3A 2ZN9A 4MZKA 4ZCUA 3DF0B 4Q04A 2GGZA 1B9AA 3KPXA 4YRUA 2KYFA 2BL0C 4PE0A 1CM1A 4AQIA 4I5KA 3SG5A 1SBJA 2V53A 2AMIA 2WC8A 2LVVA 1CLLA 4NDBA 3EVRA 1B1GA 1Y1AA 4MRYA 1KWOB 2JT3A 1M31A 2LLSA 1KQMC 1YR5A 1OMDA 1J1EA 1OOJA 1OMRA 1W7IB 1TNQA 1QV1A 1UHJA 4YGCB 1QX5B 4YBHB 1TNWA 1CM4A 1EXRA 3VROA 3GK1A 1YTZC 1KCYA 2JOJA 2K7DA 2WORA 1JC2A 1M39A 1SR6C 1YVHA 3EVVA 4MZLA 5I2LA 3EK7A 3PM8A 2R2IA 1NX1A 3FWCA 1BT6A 1IGVA 1YX8A 3KF9A 1IKUA 4A4CA 5TNCA 3OX6A 1NX0A 2EGDA 2LV7A 4XJKA 4GPLB 2E6WA 1QXPA 2H61A 1PALA 2KFHA 1SL9A 5AXIA 3TUYC 1DT7B 1KQVA 1NP8A 3CR4X 1AUIB 1B8RA 1ALVA 1ZFSA 1QJTA 2GGMA 1YUUA 4NDDA 3VRNA 4HREE 4OKHA 4PE7A 1K95A 1TOPA 3KHEA 1G33A 2BKIB 2KI6D 3A4UB 1M45A 2KI6C 2Y4QA 3BUNB 3TS5B 2K7BA 1NX3A 5AFPA 1WRKA 2WCEA 1IJ6A 1BG1A 5AEQA 1XVJA 1DJYA 2MAZA 3OB2B 1UHNA 4I5NB 1U5IB 3VRPA 1A2XA 1NYAA 4PALA 1NSHA 1DF0B 2KI4B 5J3XA 2M8UA 5ER4X 1TNXA 4P2YB 3BOWA 4NQGA 1PRWA 2OTGC 2BE6A 3GOFA 2F3YA 2JNFA 1L2OC 2CNPA 2L98A 1CFPA 3KO0A 1XFUO 5I2OA 3DD4A 2E30A 1DJWA 3I5HC 2WOSA 4CIDA 2M7LA 2KDHA 2M1UA 3CTNA 1DJZA 2BKHB 2PASA 2PRUA 1CLBA 3TDZA 2LHIA 1YX7A 2OPOA 1DGVA 1SW8A 5GQQC 1DGUA 1TCFA 5D69A 2JPTA 1GGWA 1F71A 2JT8A 1HT9A 5CSJA 2NLNA 2F2OA 4N5XA 1C07A 4YI9A 3PN7C 1QIVA 1AJ5A 1JWDA 1UP5A 1NCXA 4YGBB 2LANA 2BBMA 1SNLA 2MLFC 1S3PA 1UHHA 2EC6B 1JFJA 3ZWHA 2M97A 1DTLA 3CR2A 1SCMC 1SCVA 3DVEA 4ETOA 2NCPA 1A75A 1M46A 3NSLA 3WXAA 4OVNF 4C0LA 2RGIA 5IBWA 4AOMA 2JTTA 4PCWA 1BLQA 1BR1B 1M63B 2ZRSA 4UPGA 1A4PA 1MR8A 1JSAA 1F4OA 1ZMZA 1EL4A 1WDCC 2KFFA 3I5GB 5JOLA 1CDPA 2DOQA 1PK0D 1KK7Y 3OP0A 1SPYA 1G4YR 3SG2A 1ZOTB 1TIZA 1TRFA 4YGAA 4DCKA 1Y0VH 2AAOA 2Q91A 1J7QA 1K2HA 2LCPA 1F55A 1XA5A 3SG7A 1K93D 2JU0A 2IS9A 2LAPA 2LVKA 5KU1A 3F45A 4MBEA 2Y1MA 1CB1A 2I7AA 1S6JA 1KFXS 1CFCA 1UHKA 1SMGA 3VRQA 1NX2A 1RWYA 1J1DA 4GNKB 2K8MB 3I5IC 4F0ZB 4HRGA 3GK4X 3VRRA 2ZNEA 1BODA 3PALA 1PSBA 5I2QA 2LVJA 4HSZA 3TDUA 1QX7A 4ICBA 4AQJA 1BU3A 1DVIA 1CDNA 2F8PA 1KWOC 1XK4A 5HYDA 2KFGA 1RK9A 2BECA 1KQMB 2MJWB 3NXAA 2Y5IA 4PHMA 1PVAA 1NWDA 1DF0A 3EK8A 1XYDA 1QTXA 4GGFA 2M0RA 2MBXA 2LP3A 3MSEB 2A4JA 1F54A 1QVIZ 1UUSA 1V1GA 1GJYA 2EHBA 2I2RE 3AKBA 3GK2A 3IF7A 1FI6A 1GQMA 1L7ZA 3A8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORA B;  1BOC A;  1C7W A;  1CMG A;  2ZFD A;  3SG4 A;  2JXL A;  2M9G A;  4N1F A;  2BCA A;  1IH0 A;  1BF5 A;  1DJG A;  4R1E A;  1B8L A;  3EK4 A;  3IQO A;  2CBL A;  1WLZ A;  3FIA A;  2WCF A;  4MSP A;  1S6C A;  1V1F A;  3QRX A;  2P6B B;  1JBA A;  4CLN A;  2FOT A;  3JVT C;  1XFW O;  1YRT B;  1A29 A;  2LMV A;  3RM1 A;  4YI8 A;  1CKK A;  2L50 A;  3RLZ A;  1R6P A;  3OX5 A;  2HPS A;  1IJ5 A;  2PVB A;  1N65 A;  1K9P A;  4CFQ A;  2HET A;  2O60 A;  1BR4 B;  1FBV A;  2QPT A;  3BYA A;  1Y1U A;  1CTR A;  1W7J B;  2ZN8 A;  1HQV A;  4IL1 A;  3SIA A;  1B4C A;  5CSI A;  1AK8 A;  4NDC A;  1NCZ A;  3SIB A;  4M2P A;  1A75 B;  1S1E A;  2WND A;  1ZUZ A;  2JQ6 A;  1WRL A;  2KI4 C;  3JTD C;  4A4B A;  3O4Y A;  4BY4 A;  2JUL A;  3LL8 B;  3DVM A;  1BJF A;  1S5G Y;  1JFK A;  1KFX L;  4JPZ B;  1L2O B;  3I5F B;  3SJS A;  2KOT A;  1AJ4 A;  4D1E A;  3K21 A;  2F2P A;  1F8H A;  1QLK A;  1YRU B;  3BUO B;  2QAC A;  1J7R A;  3BUM B;  1XO5 A;  1MWN A;  4DRW A;  1SYM A;  2LMT A;  3DVJ A;  1PVB A;  3LCP C;  4QJ3 B;  3CR5 X;  2K61 A;  5F6T A;  2LNK A;  5HKW A;  2PSR A;  1S6I A;  1TTX A;  1RTP 1;  2LE9 B;  1TN4 A;  4GGF C;  1JF0 A;  1FF1 A;  2KAV A;  2LP2 A;  1NCY A;  1XFZ O;  2OS8 C;  1DJI A;  2I94 A;  4N1G A;  2LLT A;  2K2F A;  2HQW A;  4GFT A;  1EG4 A;  2MA2 A;  3TUY B;  1CFD A;  1KSM A;  4OV2 A;  3M0W A;  1MQ1 A;  1LVC D;  1SCM B;  2KBM A;  2M3W A;  1CFF A;  2ZRT A;  4I5J A;  1N2D A;  2MRD A;  4YGE B;  2M1K B;  3NSO A;  1QS7 A;  1OMV A;  1BMO A;  1XFX O;  1S36 A;  1N0Y A;  2BE4 A;  2LUX A;  1MHO A;  1K94 A;  2SAS A;  4FTG A;  3TS5 C;  1F70 A;  2L2E A;  1B47 A;  1WLM A;  3BXK A;  1IQ5 A;  3LK0 A;  1AVS A;  4GAO A;  2F3Z A;  3CS1 A;  1OSA A;  1LKJ A;  5KSZ A;  3EKJ A;  4DIR A;  1K96 A;  1YVL A;  1QVI Y;  1A03 A;  1MF8 B;  2L5X B;  4DUQ A;  2K0J A;  1YUT A;  1DJH A;  1S5G Z;  1Y6W A;  1AP4 A;  2M49 B;  2D8N A;  1KK8 B;  2CTN A;  1ODB A;  2KAY A;  4L9M A;  4WQ2 A;  1K9U A;  1SK6 D;  4MZJ A;  1MUX A;  1K90 D;  3HX4 A;  3CLN A;  2L0P A;  3BUX B;  1J7O A;  1CMF A;  1SL7 A;  3DF0 A;  2OTG B;  3OHM B;  2BL0 B;  3EVU A;  2KNE A;  1KSO A;  4ORB B;  4PE1 A;  1OZS A;  2CCM A;  1WY9 A;  1PUL A;  4I5L B;  4CPV A;  2JXC A;  5ER5 A;  1J7P A;  2B1U A;  1RFJ A;  3I5H B;  4QJ5 B;  1LA0 A;  1X02 A;  4MEW A;  2JZI A;  2G9B A;  2VRG A;  2NXQ A;  1XK4 C;  4OR9 B;  3O2P A;  3WHT B;  2BBN A;  1SL8 A;  4JWQ A;  2FCE A;  2PAL A;  2ISD A;  5HLO A;  1B7T Y;  2G2B A;  3ICB A;  2Q4U A;  1TCO B;  4PHN A;  3WNX B;  5HKZ A;  1SR6 B;  2BCB A;  3H4S E;  3EKH A;  1IG5 A;  1CNP A;  1KFU L;  1CLM A;  3AAJ A;  3DVK A;  4YGD B;  3LK1 A;  3PAT A;  2BCX A;  4E68 A;  5DKN A;  3SG6 A;  1R2U A;  2KSP A;  2JWW A;  4PHJ A;  1PSR A;  1ZAC A;  5PAL A;  2EC6 C;  4U8D A;  3CZT X;  2COL B;  5HLV A;  1H8B A;  2L4I A;  1EG3 A;  2TN4 A;  3D0Y B;  1YUR A;  1DJX A;  2GV5 A;  4GUK A;  5KTY A;  1GGZ A;  5FYX A;  5G08 A;  1KFU S;  3O78 A;  4MRX A;  4M2Q A;  1KK7 Z;  1RJV A;  1IQ3 A;  4BY5 A;  2L51 A;  2JRF A;  2MLE C;  1EH2 A;  5HKY A;  1FPW A;  3IQQ A;  5CSF A;  2H61 C;  1WDC B;  1NIW A;  2JT0 A;  5D7F A;  2FJU B;  1SY9 A;  2F33 A;  4C0J A;  2HF5 A;  1REC A;  3HCM A;  1H4B A;  2I18 A;  1QAT A;  1EJ3 A;  2CT9 A;  1K9K A;  2LMU A;  1QLS A;  2CXJ A;  2H2K A;  2JC2 A;  2M7N A;  1OQP A;  3AKA A;  3PFV A;  1CDM A;  1U5I A;  2KQ6 A;  4GGN A;  1OE9 B;  2LC5 A;  5AAN A;  1IRJ A;  2KBI A;  4C0K A;  3PLF B;  3I5F C;  1DMO A;  1SKT A;  3CWG A;  2WCB A;  1FI5 A;  2LVI A;  2JTZ A;  1JUO A;  3ZNI A;  3BOW B;  2K7C A;  3VGO A;  1YUS A;  5I8N A;  3KEV A;  1E8A A;  1K8U A;  4GBA A;  3CGA A;  1LXF C;  3I5I B;  3WHU B;  4XJK B;  4OCI A;  1UWO A;  2L4H A;  3D10 A;  2ZND A;  5JJG A;  2KGR A;  1G8I A;  1QAS A;  3C1V A;  4ORC B;  1B8C A;  4XYN A;  1Y1X A;  1NUB A;  4MLW A;  2NCO A;  2MHH A;  1UHI A;  1TNP A;  1QIW A;  4ZCV A;  1FW4 A;  4FQO A;  2PMY A;  4CFR A;  2OS8 B;  2LHL A;  1QV0 A;  3PN7 B;  3NSK A;  4QJ4 B;  1SRA A;  1ALW A;  2KGB C;  3BUW B;  4PE4 A;  5BPJ A;  1XFV O;  1J55 A;  2K2A A;  1OZO A;  3E3R A;  1RRO A;  2KYC A;  3BQ3 A;  2SCP A;  3FS7 A;  4MVF A;  2AUC A;  3O6B A;  4P5O E;  2Y1N A;  2KQY A;  1LA3 A;  1Q80 A;  1D1O A;  1JF2 A;  3OB1 B;  1UUR A;  1S26 D;  4M2O A;  1QX2 A;  4DS7 A;  3SG3 A;  3TDI A;  4PDZ A;  1MXE A;  1C7V A;  2ZKM X;  4JQ0 D;  5DKR A;  5DKQ A;  2M29 A;  1VRK A;  4WRI A;  2HQ8 A;  3JVT B;  2NZ0 A;  2KAX A;  3I5G C;  1XFY O;  2LUC A;  2LLU A;  1F4Q A;  1LIN A;  2KHN A;  5CSN A;  3FWB A;  2FCD A;  5K89 A;  1AHR A;  4HRH A;  2LM5 A;  3JTD B;  1B7T Z;  5AER A;  3LLE A;  4PHK A;  1CDL A;  5CPV A;  5B8I B;  2O5G A;  3PSR A;  4TNC A;  3AAK A;  1KK8 C;  3NSI A;  4USL A;  1NPQ A;  1WRZ A;  2JNX A;  1MXL C;  3D0Y A;  3TZ1 A;  1IWQ A;  2K7O A;  4MN0 A;  4WQ3 A;  2ZN9 A;  4MZK A;  4ZCU A;  3DF0 B;  4Q04 A;  2GGZ A;  1B9A A;  3KPX A;  4YRU A;  2KYF A;  2BL0 C;  4PE0 A;  1CM1 A;  4AQI A;  4I5K A;  3SG5 A;  1SBJ A;  2V53 A;  2AMI A;  2WC8 A;  2LVV A;  1CLL A;  4NDB A;  3EVR A;  1B1G A;  1Y1A A;  4MRY A;  1KWO B;  2JT3 A;  1M31 A;  2LLS A;  1KQM C;  1YR5 A;  1OMD A;  1J1E A;  1OOJ A;  1OMR A;  1W7I B;  1TNQ A;  1QV1 A;  1UHJ A;  4YGC B;  1QX5 B;  4YBH B;  1TNW A;  1CM4 A;  1EXR A;  3VRO A;  3GK1 A;  1YTZ C;  1KCY A;  2JOJ A;  2K7D A;  2WOR A;  1JC2 A;  1M39 A;  1SR6 C;  1YVH A;  3EVV A;  4MZL A;  5I2L A;  3EK7 A;  3PM8 A;  2R2I A;  1NX1 A;  3FWC A;  1BT6 A;  1IGV A;  1YX8 A;  3KF9 A;  1IKU A;  4A4C A;  5TNC A;  3OX6 A;  1NX0 A;  2EGD A;  2LV7 A;  4XJK A;  4GPL B;  2E6W A;  1QXP A;  2H61 A;  1PAL A;  2KFH A;  1SL9 A;  5AXI A;  3TUY C;  1DT7 B;  1KQV A;  1NP8 A;  3CR4 X;  1AUI B;  1B8R A;  1ALV A;  1ZFS A;  1QJT A;  2GGM A;  1YUU A;  4NDD A;  3VRN A;  4HRE E;  4OKH A;  4PE7 A;  1K95 A;  1TOP A;  3KHE A;  1G33 A;  2BKI B;  2KI6 D;  3A4U B;  1M45 A;  2KI6 C;  2Y4Q A;  3BUN B;  3TS5 B;  2K7B A;  1NX3 A;  5AFP A;  1WRK A;  2WCE A;  1IJ6 A;  1BG1 A;  5AEQ A;  1XVJ A;  1DJY A;  2MAZ A;  3OB2 B;  1UHN A;  4I5N B;  1U5I B;  3VRP A;  1A2X A;  1NYA A;  4PAL A;  1NSH A;  1DF0 B;  2KI4 B;  5J3X A;  2M8U A;  5ER4 X;  1TNX A;  4P2Y B;  3BOW A;  4NQG A;  1PRW A;  2OTG C;  2BE6 A;  3GOF A;  2F3Y A;  2JNF A;  1L2O C;  2CNP A;  2L98 A;  1CFP A;  3KO0 A;  1XFU O;  5I2O A;  3DD4 A;  2E30 A;  1DJW A;  3I5H C;  2WOS A;  4CID A;  2M7L A;  2KDH A;  2M1U A;  3CTN A;  1DJZ A;  2BKH B;  2PAS A;  2PRU A;  1CLB A;  3TDZ A;  2LHI A;  1YX7 A;  2OPO A;  1DGV A;  1SW8 A;  5GQQ C;  1DGU A;  1TCF A;  5D69 A;  2JPT A;  1GGW A;  1F71 A;  2JT8 A;  1HT9 A;  5CSJ A;  2NLN A;  2F2O A;  4N5X A;  1C07 A;  4YI9 A;  3PN7 C;  1QIV A;  1AJ5 A;  1JWD A;  1UP5 A;  1NCX A;  4YGB B;  2LAN A;  2BBM A;  1SNL A;  2MLF C;  1S3P A;  1UHH A;  2EC6 B;  1JFJ A;  3ZWH A;  2M97 A;  1DTL A;  3CR2 A;  1SCM C;  1SCV A;  3DVE A;  4ETO A;  2NCP A;  1A75 A;  1M46 A;  3NSL A;  3WXA A;  4OVN F;  4C0L A;  2RGI A;  5IBW A;  4AOM A;  2JTT A;  4PCW A;  1BLQ A;  1BR1 B;  1M63 B;  2ZRS A;  4UPG A;  1A4P A;  1MR8 A;  1JSA A;  1F4O A;  1ZMZ A;  1EL4 A;  1WDC C;  2KFF A;  3I5G B;  5JOL A;  1CDP A;  2DOQ A;  1PK0 D;  1KK7 Y;  3OP0 A;  1SPY A;  1G4Y R;  3SG2 A;  1ZOT B;  1TIZ A;  1TRF A;  4YGA A;  4DCK A;  1Y0V H;  2AAO A;  2Q91 A;  1J7Q A;  1K2H A;  2LCP A;  1F55 A;  1XA5 A;  3SG7 A;  1K93 D;  2JU0 A;  2IS9 A;  2LAP A;  2LVK A;  5KU1 A;  3F45 A;  4MBE A;  2Y1M A;  1CB1 A;  2I7A A;  1S6J A;  1KFX S;  1CFC A;  1UHK A;  1SMG A;  3VRQ A;  1NX2 A;  1RWY A;  1J1D A;  4GNK B;  2K8M B;  3I5I C;  4F0Z B;  4HRG A;  3GK4 X;  3VRR A;  2ZNE A;  1BOD A;  3PAL A;  1PSB A;  5I2Q A;  2LVJ A;  4HSZ A;  3TDU A;  1QX7 A;  4ICB A;  4AQJ A;  1BU3 A;  1DVI A;  1CDN A;  2F8P A;  1KWO C;  1XK4 A;  5HYD A;  2KFG A;  1RK9 A;  2BEC A;  1KQM B;  2MJW B;  3NXA A;  2Y5I A;  4PHM A;  1PVA A;  1NWD A;  1DF0 A;  3EK8 A;  1XYD A;  1QTX A;  4GGF A;  2M0R A;  2MBX A;  2LP3 A;  3MSE B;  2A4J A;  1F54 A;  1QVI Z;  1UUS A;  1V1G A;  1GJY A;  2EHB A;  2I2R E;  3AKB A;  3GK2 A;  3IF7 A;  1FI6 A;  1GQM A;  1L7Z A;  3A8R A; 
#chains in the Genus database with same CATH topology
 4ORA B;  1BOC A;  1C7W A;  1CMG A;  2ZFD A;  2BAP A;  3SG4 A;  2JXL A;  2M9G A;  4N1F A;  2BCA A;  3BFH A;  1IH0 A;  1BF5 A;  1DJG A;  4R1E A;  3N7H A;  1B8L A;  3EK4 A;  2FJY A;  2CBL A;  2H8V A;  3IQO A;  1WLZ A;  3FIA A;  2WCF A;  4MSP A;  1S6C A;  1V1F A;  3QRX A;  2P6B B;  1JBA A;  4CLN A;  2FOT A;  3JVT C;  1XFW O;  1YRT B;  1A29 A;  2LMV A;  3PJI A;  4YI8 A;  3RM1 A;  1CKK A;  1OW4 A;  2L50 A;  3RLZ A;  1R6P A;  3OX5 A;  2HPS A;  2KLD A;  1IJ5 A;  2PVB A;  1N65 A;  1K9P A;  4CFQ A;  2HET A;  2O60 A;  1BR4 B;  1FBV A;  2QPT A;  3SS3 A;  3BYA A;  1Y1U A;  1CTR A;  1W7J B;  2ZN8 A;  1DEL A;  1HQV A;  3R1O A;  4IL1 A;  3SIA A;  1B4C A;  5CSI A;  1AK8 A;  1OOG A;  1NCZ A;  4NDC A;  3SIB A;  4M2P A;  1A75 B;  1S1E A;  2WND A;  1ZUZ A;  2JQ6 A;  1WRL A;  2KI4 C;  3JTD C;  3R1V A;  3O4Y A;  4A4B A;  4BY4 A;  2JUL A;  3LL8 B;  3DVM A;  1ORG A;  1BJF A;  1S5G Y;  1JFK A;  2P71 A;  1KFX L;  4INW A;  4JPZ B;  1L2O B;  3CZ0 A;  3I5F B;  3SJS A;  2KOT A;  1AJ4 A;  4D1E A;  3K21 A;  2F2P A;  1F8H A;  1QLK A;  1C3Y A;  1YRU B;  2YGU A;  3BUO B;  2QAC A;  1J7R A;  2QEB A;  3BUM B;  1XO5 A;  1MWN A;  4DRW A;  1SYM A;  2LMT A;  3DVJ A;  1PVB A;  3DY9 A;  3LCP C;  4JKT A;  3CR5 X;  2K61 A;  4QJ3 B;  2LNK A;  5F6T A;  2PSR A;  5HKW A;  1S6I A;  1TTX A;  5FI2 A;  1RTP 1;  2LE9 B;  1TN4 A;  4GGF C;  1JF0 A;  3VB1 A;  1FF1 A;  3K1E A;  2KAV A;  2LP2 A;  1NCY A;  1XFZ O;  2OS8 C;  1DJI A;  2I94 A;  4N1G A;  2LLT A;  2K2F A;  3B7A A;  2HQW A;  2WCJ A;  4GFT A;  1DC1 A;  1EG4 A;  2MA2 A;  3TUY B;  1CFD A;  1KSM A;  4OV2 A;  3M0W A;  1MQ1 A;  1LVC D;  1SCM B;  2KBM A;  2M3W A;  1CFF A;  2ZRT A;  4I5J A;  1N2D A;  3O4X A;  1TUZ A;  2MRD A;  4YGE B;  2M1K B;  3NSO A;  1QS7 A;  1OMV A;  1BMO A;  1XFX O;  1S36 A;  1N0Y A;  2BE4 A;  2L5Y A;  2LUX A;  4INX A;  1MHO A;  1K94 A;  2SAS A;  4FTG A;  3B87 A;  3TS5 C;  2QEV A;  1F70 A;  3R72 A;  2L2E A;  1B47 A;  1WLM A;  2JPO A;  3BXK A;  1IQ5 A;  3LK0 A;  3PM2 A;  1AVS A;  5EL2 A;  4GAO A;  2F3Z A;  3CS1 A;  3SS4 A;  1OSA A;  3DZT A;  1LKJ A;  5KSZ A;  3EKJ A;  4DIR A;  1K96 A;  1YVL A;  1QVI Y;  1A03 A;  1MF8 B;  2L5X B;  4DUQ A;  2K0J A;  1YUT A;  1DJH A;  1S5G Z;  1Y6W A;  1AP4 A;  2M49 B;  2D8N A;  1KK8 B;  2CTN A;  3IVT A;  2PQL A;  1ODB A;  3S0F A;  2KAY A;  2PYQ A;  4L9M A;  4WQ2 A;  1K9U A;  1SK6 D;  4MZJ A;  3S0B A;  4FQT A;  1MUX A;  2WC6 A;  1K90 D;  3BJH A;  3HX4 A;  3CLN A;  2L0P A;  3BUX B;  1J7O A;  1CMF A;  1SL7 A;  3DF0 A;  2OTG B;  5I94 A;  3OHM B;  2BL0 B;  3EVU A;  2KNE A;  1KSO A;  4ORB B;  4PE1 A;  1OZS A;  2CCM A;  1WY9 A;  1PUL A;  4I5L B;  4CPV A;  2JXC A;  5ER5 A;  1J7P A;  2B1U A;  1RFJ A;  3I5H B;  4QJ5 B;  1LA0 A;  1X02 A;  4MEW A;  2JZI A;  2G9B A;  1TWO A;  2VRG A;  2NXQ A;  1XK4 C;  4OR9 B;  3O2P A;  3WHT B;  4KYN A;  2BBN A;  1SL8 A;  4JWQ A;  2FCE A;  2PAL A;  2ISD A;  5HLO A;  1B7T Y;  2G2B A;  3ICB A;  2Q4U A;  1TCO B;  4PHN A;  3NHI A;  2WCK A;  3WNX B;  5HKZ A;  1SR6 B;  2BCB A;  3H4S E;  3EKH A;  1IG5 A;  3NGV A;  1CNP A;  1KFU L;  1CLM A;  3AAJ A;  1P28 A;  3DVK A;  4YGD B;  3LK1 A;  3PAT A;  2BCX A;  4E68 A;  5DKN A;  3SG6 A;  1R2U A;  2KSP A;  2JWW A;  4PHJ A;  1PSR A;  1ZAC A;  5PAL A;  3CDN A;  3DYE A;  2EC6 C;  4U8D A;  3CZT X;  2COL B;  3NHT A;  5HLV A;  1H8B A;  2L4I A;  1EG3 A;  2TN4 A;  3D0Y B;  1YUR A;  1DJX A;  2GV5 A;  4GUK A;  5KTY A;  1GGZ A;  5FYX A;  5G08 A;  1KFU S;  1C3Z A;  4OZD A;  3O78 A;  1Z2C B;  4M2Q A;  4MRX A;  1KK7 Z;  1RJV A;  1IQ3 A;  4BY5 A;  2L51 A;  2JRF A;  2MLE C;  1EH2 A;  5HKY A;  1FPW A;  3IQQ A;  2KPH A;  5CSF A;  2H61 C;  1WDC B;  1NIW A;  2JT0 A;  3DXL A;  3FE9 A;  5D7F A;  2FJU B;  1SY9 A;  2F33 A;  4C0J A;  2HF5 A;  1REC A;  3HCM A;  1H4B A;  2I18 A;  1QAT A;  3D76 A;  1EJ3 A;  2CT9 A;  1K9K A;  2LMU A;  2CXJ A;  1QLS A;  2H2K A;  2JC2 A;  2M7N A;  1OQP A;  3AKA A;  3PFV A;  1CDM A;  1U5I A;  2KQ6 A;  4GGN A;  1OE9 B;  2LC5 A;  5AAN A;  1IRJ A;  2KBI A;  1DQE A;  3PLF B;  3I5F C;  4C0K A;  1DMO A;  1SKT A;  3CWG A;  2WCB A;  3SS5 A;  1FI5 A;  2LVI A;  2JTZ A;  3BFB A;  1JUO A;  3L47 A;  3ZNI A;  3BOW B;  2K7C A;  3VGO A;  1YUS A;  5I8N A;  1OOH A;  3KEV A;  1E8A A;  1K8U A;  4GBA A;  3CGA A;  1LXF C;  3I5I B;  3S0E A;  3WHU B;  4XJK B;  3Q8I A;  4OCI A;  1UWO A;  2P70 A;  3CAB A;  2L4H A;  3D10 A;  2ZND A;  5JJG A;  2KGR A;  1G8I A;  1QAS A;  3RZS A;  1GM0 A;  3C1V A;  4ORC B;  1B8C A;  4XYN A;  1Y1X A;  1NUB A;  4MLW A;  2NCO A;  4IJ7 A;  3V2L A;  3FE8 A;  2MHH A;  1UHI A;  1TNP A;  1QIW A;  4ZCV A;  1FW4 A;  4FQO A;  2PMY A;  5FI6 A;  2OS8 B;  4CFR A;  2LHL A;  1QV0 A;  3PN7 B;  3NSK A;  4QJ4 B;  1SRA A;  1ALW A;  1W9Z A;  2KGB C;  3BUW B;  4PE4 A;  3CYZ A;  5BPJ A;  2QEO A;  1XFV O;  1J55 A;  2K2A A;  1OZO A;  3E3R A;  1RRO A;  2KYC A;  3BQ3 A;  2SCP A;  3FS7 A;  4MVF A;  3D74 A;  2AUC A;  3O6B A;  4P5O E;  2Y1N A;  2KQY A;  1LA3 A;  1Q80 A;  1D1O A;  1JF2 A;  3OB1 B;  1UUR A;  1S26 D;  4M2O A;  1QX2 A;  4DS7 A;  3SG3 A;  3TDI A;  4PDZ A;  1MXE A;  1C7V A;  2ZKM X;  4JQ0 D;  5DKR A;  5DKQ A;  2M29 A;  1VRK A;  4WRI A;  3B6X A;  2HQ8 A;  3JVT B;  2NZ0 A;  2KAX A;  3I5G C;  1XFY O;  3CZ1 A;  2LUC A;  5FI7 A;  2GTE A;  2LLU A;  1F4Q A;  1LIN A;  2KHN A;  5CSN A;  3FWB A;  2FCD A;  5K89 A;  1AHR A;  4HRH A;  2LM5 A;  3JTD B;  1B7T Z;  3FE6 A;  5AER A;  3LLE A;  4PHK A;  1CDL A;  5CPV A;  5B8I B;  1T14 A;  2O5G A;  3PSR A;  4TNC A;  3AAK A;  1KK8 C;  3NSI A;  3B88 A;  4USL A;  1NPQ A;  1WRZ A;  2JNX A;  1MXL C;  3D0Y A;  3TZ1 A;  1IWQ A;  2K7O A;  4MN0 A;  4WQ3 A;  2ZN9 A;  4MZK A;  4ZCU A;  3DF0 B;  4Q04 A;  1XFR A;  2GGZ A;  1B9A A;  3KPX A;  4YRU A;  2KYF A;  2BL0 C;  4PE0 A;  1CM1 A;  1LS8 A;  4AQI A;  4I5K A;  3SG5 A;  1SBJ A;  2V53 A;  2AMI A;  2WC8 A;  2LVV A;  1CLL A;  4NDB A;  3D78 A;  3EVR A;  1Y1A A;  1B1G A;  3BFA A;  4MRY A;  2ERB A;  1KWO B;  2JT3 A;  1M31 A;  2LLS A;  1KQM C;  1YR5 A;  3D73 A;  5HL1 A;  1OMD A;  1J1E A;  1OOJ A;  1OMR A;  1W7I B;  1TNQ A;  1QV1 A;  1UHJ A;  4YGC B;  1QX5 B;  4YBH B;  1TNW A;  1CM4 A;  1EXR A;  3VRO A;  3GK1 A;  1YTZ C;  1KCY A;  2JOJ A;  2K7D A;  2WOR A;  1JC2 A;  1M39 A;  1SR6 C;  1YVH A;  3EVV A;  4MZL A;  5I2L A;  3EK7 A;  3PM8 A;  2R2I A;  1OOI X;  1NX1 A;  3FWC A;  1BT6 A;  1IGV A;  1SSE B;  1YX8 A;  3KF9 A;  1IKU A;  4A4C A;  5TNC A;  3OX6 A;  1NX0 A;  2EGD A;  2LV7 A;  4XJK A;  4GPL B;  2E6W A;  1QXP A;  2H61 A;  1PAL A;  2KFH A;  1SL9 A;  5AXI A;  3TUY C;  4F7F A;  1DT7 B;  1KQV A;  1NP8 A;  3CR4 X;  3OGN A;  3D75 A;  1AUI B;  1B8R A;  1ALV A;  1ZFS A;  1QJT A;  2GGM A;  1YUU A;  2QDI A;  4NDD A;  3VRN A;  4HRE E;  4OKH A;  4PE7 A;  1K95 A;  2QEH A;  1TOP A;  3KHE A;  1G33 A;  2BKI B;  2KI6 D;  3A4U B;  1M45 A;  2KI6 C;  2Y4Q A;  3BUN B;  2WC5 A;  5DIC A;  3TS5 B;  2K7B A;  1NX3 A;  5AFP A;  1WRK A;  2WCE A;  1IJ6 A;  3UNW A;  1BG1 A;  5AEQ A;  1XVJ A;  1DJY A;  2MAZ A;  3OB2 B;  1UHN A;  4I5N B;  1U5I B;  3VRP A;  1A2X A;  1NYA A;  3S0D A;  4PAL A;  1NSH A;  1DF0 B;  2KI4 B;  5J3X A;  2M8U A;  5ER4 X;  1TNX A;  4P2Y B;  3BOW A;  3OBV A;  4NQG A;  1PRW A;  2OTG C;  2BE6 A;  3GOF A;  2F3Y A;  2JNF A;  1L2O C;  2CNP A;  2L98 A;  1CFP A;  3KO0 A;  1XFU O;  5I2O A;  3DD4 A;  2E30 A;  1DJW A;  3I5H C;  2WOS A;  2WCL A;  3EG5 B;  4CID A;  2M7L A;  2KDH A;  2M1U A;  3CTN A;  1DJZ A;  2BKH B;  1QWV A;  2PAS A;  2PRU A;  4PT1 A;  1CLB A;  3TDZ A;  2LHI A;  1YX7 A;  2OPO A;  1DGV A;  1SW8 A;  3D77 A;  5GQQ C;  1DGU A;  1TCF A;  5D69 A;  2JPT A;  1GGW A;  1F71 A;  2JT8 A;  1HT9 A;  3L4L A;  1DEK A;  5CSJ A;  2NLN A;  2F2O A;  4N5X A;  1C07 A;  4YI9 A;  3PN7 C;  1QIV A;  3CZ2 A;  1AJ5 A;  1JWD A;  1UP5 A;  1NCX A;  3L4A A;  3S0A A;  4YGB B;  2WCH A;  2LAN A;  2BBM A;  1SNL A;  2MLF C;  1S3P A;  1UHH A;  2EC6 B;  1JFJ A;  3ZWH A;  2M97 A;  1DTL A;  4JD9 A;  3CR2 A;  1SCM C;  1SCV A;  3DVE A;  4ETO A;  2NCP A;  1A75 A;  1M46 A;  3NSL A;  3WXA A;  4OVN F;  4C0L A;  2RGI A;  5IBW A;  4AOM A;  2JTT A;  1IIO A;  4PCW A;  1BLQ A;  1BR1 B;  1M63 B;  2K60 A;  2ZRS A;  4UPG A;  1A4P A;  1MR8 A;  1JSA A;  1F4O A;  1ZMZ A;  1EL4 A;  1WDC C;  2KFF A;  3I5G B;  5JOL A;  1CDP A;  2DOQ A;  1PK0 D;  1KK7 Y;  3OP0 A;  1SPY A;  1G4Y R;  3QME A;  1ZOT B;  3SG2 A;  1TIZ A;  1TRF A;  4YGA A;  4DCK A;  1OOF A;  1Y0V H;  2AAO A;  2Q91 A;  3B86 A;  1J7Q A;  1K2H A;  2LCP A;  3R1P A;  1F55 A;  1XA5 A;  3SG7 A;  1K93 D;  2JU0 A;  2IS9 A;  2LAP A;  2LVK A;  5KU1 A;  3F45 A;  2BNX A;  2L2C A;  4MBE A;  2Y1M A;  1CB1 A;  2I7A A;  1S6J A;  1KFX S;  1CFC A;  1UHK A;  1SMG A;  3VRQ A;  1NX2 A;  1RWY A;  1J1D A;  4GNK B;  1Z4H A;  2K8M B;  3I5I C;  1TUJ A;  4F0Z B;  4HRG A;  3GK4 X;  3VRR A;  2ZNE A;  1BOD A;  3PAL A;  1PSB A;  5I2Q A;  2LVJ A;  4HSZ A;  3TDU A;  1QX7 A;  4ICB A;  4AQJ A;  1BU3 A;  1DVI A;  1CDN A;  2F8P A;  1KWO C;  1XK4 A;  3S0G A;  2KFG A;  5HYD A;  1RK9 A;  2BEC A;  1KQM B;  3UO9 A;  2MJW B;  3NXA A;  2Y5I A;  4PHM A;  1PVA A;  1NWD A;  1DF0 A;  3EK8 A;  2KLE A;  1XYD A;  1QTX A;  4GGF A;  2M0R A;  5D3O A;  2WCM A;  2MBX A;  2LP3 A;  3MSE B;  2A4J A;  1F54 A;  1QVI Z;  1UUS A;  1V1G A;  1GJY A;  2EHB A;  2I2R E;  3AKB A;  3GK2 A;  3IF7 A;  1FI6 A;  1GQM A;  1L7Z A;  3A8R A; 
#chains in the Genus database with same CATH homology
 4ORA B;  1BOC A;  1C7W A;  1CMG A;  2ZFD A;  3SG4 A;  2JXL A;  2M9G A;  4N1F A;  2BCA A;  1IH0 A;  1BF5 A;  1DJG A;  4R1E A;  1B8L A;  3EK4 A;  3IQO A;  2CBL A;  1WLZ A;  3FIA A;  2WCF A;  4MSP A;  1S6C A;  1V1F A;  3QRX A;  2P6B B;  1JBA A;  4CLN A;  2FOT A;  3JVT C;  1XFW O;  1YRT B;  1A29 A;  2LMV A;  3RM1 A;  4YI8 A;  1CKK A;  2L50 A;  3RLZ A;  1R6P A;  3OX5 A;  2HPS A;  1IJ5 A;  2PVB A;  1N65 A;  1K9P A;  4CFQ A;  2HET A;  2O60 A;  1BR4 B;  1FBV A;  2QPT A;  3BYA A;  1Y1U A;  1CTR A;  1W7J B;  2ZN8 A;  1HQV A;  4IL1 A;  3SIA A;  1B4C A;  5CSI A;  1AK8 A;  4NDC A;  1NCZ A;  3SIB A;  4M2P A;  1A75 B;  1S1E A;  2WND A;  1ZUZ A;  2JQ6 A;  1WRL A;  2KI4 C;  3JTD C;  4A4B A;  3O4Y A;  4BY4 A;  2JUL A;  3LL8 B;  3DVM A;  1BJF A;  1S5G Y;  1JFK A;  1KFX L;  4JPZ B;  1L2O B;  3I5F B;  3SJS A;  2KOT A;  1AJ4 A;  4D1E A;  3K21 A;  2F2P A;  1F8H A;  1QLK A;  1YRU B;  3BUO B;  2QAC A;  1J7R A;  3BUM B;  1XO5 A;  1MWN A;  4DRW A;  1SYM A;  2LMT A;  3DVJ A;  1PVB A;  3LCP C;  4QJ3 B;  3CR5 X;  2K61 A;  5F6T A;  2LNK A;  5HKW A;  2PSR A;  1S6I A;  1TTX A;  1RTP 1;  2LE9 B;  1TN4 A;  4GGF C;  1JF0 A;  1FF1 A;  2KAV A;  2LP2 A;  1NCY A;  1XFZ O;  2OS8 C;  1DJI A;  2I94 A;  4N1G A;  2LLT A;  2K2F A;  2HQW A;  4GFT A;  1EG4 A;  2MA2 A;  3TUY B;  1CFD A;  1KSM A;  4OV2 A;  3M0W A;  1MQ1 A;  1LVC D;  1SCM B;  2KBM A;  2M3W A;  1CFF A;  2ZRT A;  4I5J A;  1N2D A;  2MRD A;  4YGE B;  2M1K B;  3NSO A;  1QS7 A;  1OMV A;  1BMO A;  1XFX O;  1S36 A;  1N0Y A;  2BE4 A;  2LUX A;  1MHO A;  1K94 A;  2SAS A;  4FTG A;  3TS5 C;  1F70 A;  2L2E A;  1B47 A;  1WLM A;  3BXK A;  1IQ5 A;  3LK0 A;  1AVS A;  4GAO A;  2F3Z A;  3CS1 A;  1OSA A;  1LKJ A;  5KSZ A;  3EKJ A;  4DIR A;  1K96 A;  1YVL A;  1QVI Y;  1A03 A;  1MF8 B;  2L5X B;  4DUQ A;  2K0J A;  1YUT A;  1DJH A;  1S5G Z;  1Y6W A;  1AP4 A;  2M49 B;  2D8N A;  1KK8 B;  2CTN A;  1ODB A;  2KAY A;  4L9M A;  4WQ2 A;  1K9U A;  1SK6 D;  4MZJ A;  1MUX A;  1K90 D;  3HX4 A;  3CLN A;  2L0P A;  3BUX B;  1J7O A;  1CMF A;  1SL7 A;  3DF0 A;  2OTG B;  3OHM B;  2BL0 B;  3EVU A;  2KNE A;  1KSO A;  4ORB B;  4PE1 A;  1OZS A;  2CCM A;  1WY9 A;  1PUL A;  4I5L B;  4CPV A;  2JXC A;  5ER5 A;  1J7P A;  2B1U A;  1RFJ A;  3I5H B;  4QJ5 B;  1LA0 A;  1X02 A;  4MEW A;  2JZI A;  2G9B A;  2VRG A;  2NXQ A;  1XK4 C;  4OR9 B;  3O2P A;  3WHT B;  2BBN A;  1SL8 A;  4JWQ A;  2FCE A;  2PAL A;  2ISD A;  5HLO A;  1B7T Y;  2G2B A;  3ICB A;  2Q4U A;  1TCO B;  4PHN A;  3WNX B;  5HKZ A;  1SR6 B;  2BCB A;  3H4S E;  3EKH A;  1IG5 A;  1CNP A;  1KFU L;  1CLM A;  3AAJ A;  3DVK A;  4YGD B;  3LK1 A;  3PAT A;  2BCX A;  4E68 A;  5DKN A;  3SG6 A;  1R2U A;  2KSP A;  2JWW A;  4PHJ A;  1PSR A;  1ZAC A;  5PAL A;  2EC6 C;  4U8D A;  3CZT X;  2COL B;  5HLV A;  1H8B A;  2L4I A;  1EG3 A;  2TN4 A;  3D0Y B;  1YUR A;  1DJX A;  2GV5 A;  4GUK A;  5KTY A;  1GGZ A;  5FYX A;  5G08 A;  1KFU S;  3O78 A;  4MRX A;  4M2Q A;  1KK7 Z;  1RJV A;  1IQ3 A;  4BY5 A;  2L51 A;  2JRF A;  2MLE C;  1EH2 A;  5HKY A;  1FPW A;  3IQQ A;  5CSF A;  2H61 C;  1WDC B;  1NIW A;  2JT0 A;  5D7F A;  2FJU B;  1SY9 A;  2F33 A;  4C0J A;  2HF5 A;  1REC A;  3HCM A;  1H4B A;  2I18 A;  1QAT A;  1EJ3 A;  2CT9 A;  1K9K A;  2LMU A;  1QLS A;  2CXJ A;  2H2K A;  2JC2 A;  2M7N A;  1OQP A;  3AKA A;  3PFV A;  1CDM A;  1U5I A;  2KQ6 A;  4GGN A;  1OE9 B;  2LC5 A;  5AAN A;  1IRJ A;  2KBI A;  4C0K A;  3PLF B;  3I5F C;  1DMO A;  1SKT A;  3CWG A;  2WCB A;  1FI5 A;  2LVI A;  2JTZ A;  1JUO A;  3ZNI A;  3BOW B;  2K7C A;  3VGO A;  1YUS A;  5I8N A;  3KEV A;  1E8A A;  1K8U A;  4GBA A;  3CGA A;  1LXF C;  3I5I B;  3WHU B;  4XJK B;  4OCI A;  1UWO A;  2L4H A;  3D10 A;  2ZND A;  5JJG A;  2KGR A;  1G8I A;  1QAS A;  3C1V A;  4ORC B;  1B8C A;  4XYN A;  1Y1X A;  1NUB A;  4MLW A;  2NCO A;  2MHH A;  1UHI A;  1TNP A;  1QIW A;  4ZCV A;  1FW4 A;  4FQO A;  2PMY A;  4CFR A;  2OS8 B;  2LHL A;  1QV0 A;  3PN7 B;  3NSK A;  4QJ4 B;  1SRA A;  1ALW A;  2KGB C;  3BUW B;  4PE4 A;  5BPJ A;  1XFV O;  1J55 A;  2K2A A;  1OZO A;  3E3R A;  1RRO A;  2KYC A;  3BQ3 A;  2SCP A;  3FS7 A;  4MVF A;  2AUC A;  3O6B A;  4P5O E;  2Y1N A;  2KQY A;  1LA3 A;  1Q80 A;  1D1O A;  1JF2 A;  3OB1 B;  1UUR A;  1S26 D;  4M2O A;  1QX2 A;  4DS7 A;  3SG3 A;  3TDI A;  4PDZ A;  1MXE A;  1C7V A;  2ZKM X;  4JQ0 D;  5DKR A;  5DKQ A;  2M29 A;  1VRK A;  4WRI A;  2HQ8 A;  3JVT B;  2NZ0 A;  2KAX A;  3I5G C;  1XFY O;  2LUC A;  2LLU A;  1F4Q A;  1LIN A;  2KHN A;  5CSN A;  3FWB A;  2FCD A;  5K89 A;  1AHR A;  4HRH A;  2LM5 A;  3JTD B;  1B7T Z;  5AER A;  3LLE A;  4PHK A;  1CDL A;  5CPV A;  5B8I B;  2O5G A;  3PSR A;  4TNC A;  3AAK A;  1KK8 C;  3NSI A;  4USL A;  1NPQ A;  1WRZ A;  2JNX A;  1MXL C;  3D0Y A;  3TZ1 A;  1IWQ A;  2K7O A;  4MN0 A;  4WQ3 A;  2ZN9 A;  4MZK A;  4ZCU A;  3DF0 B;  4Q04 A;  2GGZ A;  1B9A A;  3KPX A;  4YRU A;  2KYF A;  2BL0 C;  4PE0 A;  1CM1 A;  4AQI A;  4I5K A;  3SG5 A;  1SBJ A;  2V53 A;  2AMI A;  2WC8 A;  2LVV A;  1CLL A;  4NDB A;  3EVR A;  1B1G A;  1Y1A A;  4MRY A;  1KWO B;  2JT3 A;  1M31 A;  2LLS A;  1KQM C;  1YR5 A;  1OMD A;  1J1E A;  1OOJ A;  1OMR A;  1W7I B;  1TNQ A;  1QV1 A;  1UHJ A;  4YGC B;  1QX5 B;  4YBH B;  1TNW A;  1CM4 A;  1EXR A;  3VRO A;  3GK1 A;  1YTZ C;  1KCY A;  2JOJ A;  2K7D A;  2WOR A;  1JC2 A;  1M39 A;  1SR6 C;  1YVH A;  3EVV A;  4MZL A;  5I2L A;  3EK7 A;  3PM8 A;  2R2I A;  1NX1 A;  3FWC A;  1BT6 A;  1IGV A;  1YX8 A;  3KF9 A;  1IKU A;  4A4C A;  5TNC A;  3OX6 A;  1NX0 A;  2EGD A;  2LV7 A;  4XJK A;  4GPL B;  2E6W A;  1QXP A;  2H61 A;  1PAL A;  2KFH A;  1SL9 A;  5AXI A;  3TUY C;  1DT7 B;  1KQV A;  1NP8 A;  3CR4 X;  1AUI B;  1B8R A;  1ALV A;  1ZFS A;  1QJT A;  2GGM A;  1YUU A;  4NDD A;  3VRN A;  4HRE E;  4OKH A;  4PE7 A;  1K95 A;  1TOP A;  3KHE A;  1G33 A;  2BKI B;  2KI6 D;  3A4U B;  1M45 A;  2KI6 C;  2Y4Q A;  3BUN B;  3TS5 B;  2K7B A;  1NX3 A;  5AFP A;  1WRK A;  2WCE A;  1IJ6 A;  1BG1 A;  5AEQ A;  1XVJ A;  1DJY A;  2MAZ A;  3OB2 B;  1UHN A;  4I5N B;  1U5I B;  3VRP A;  1A2X A;  1NYA A;  4PAL A;  1NSH A;  1DF0 B;  2KI4 B;  5J3X A;  2M8U A;  5ER4 X;  1TNX A;  4P2Y B;  3BOW A;  4NQG A;  1PRW A;  2OTG C;  2BE6 A;  3GOF A;  2F3Y A;  2JNF A;  1L2O C;  2CNP A;  2L98 A;  1CFP A;  3KO0 A;  1XFU O;  5I2O A;  3DD4 A;  2E30 A;  1DJW A;  3I5H C;  2WOS A;  4CID A;  2M7L A;  2KDH A;  2M1U A;  3CTN A;  1DJZ A;  2BKH B;  2PAS A;  2PRU A;  1CLB A;  3TDZ A;  2LHI A;  1YX7 A;  2OPO A;  1DGV A;  1SW8 A;  5GQQ C;  1DGU A;  1TCF A;  5D69 A;  2JPT A;  1GGW A;  1F71 A;  2JT8 A;  1HT9 A;  5CSJ A;  2NLN A;  2F2O A;  4N5X A;  1C07 A;  4YI9 A;  3PN7 C;  1QIV A;  1AJ5 A;  1JWD A;  1UP5 A;  1NCX A;  4YGB B;  2LAN A;  2BBM A;  1SNL A;  2MLF C;  1S3P A;  1UHH A;  2EC6 B;  1JFJ A;  3ZWH A;  2M97 A;  1DTL A;  3CR2 A;  1SCM C;  1SCV A;  3DVE A;  4ETO A;  2NCP A;  1A75 A;  1M46 A;  3NSL A;  3WXA A;  4OVN F;  4C0L A;  2RGI A;  5IBW A;  4AOM A;  2JTT A;  4PCW A;  1BLQ A;  1BR1 B;  1M63 B;  2ZRS A;  4UPG A;  1A4P A;  1MR8 A;  1JSA A;  1F4O A;  1ZMZ A;  1EL4 A;  1WDC C;  2KFF A;  3I5G B;  5JOL A;  1CDP A;  2DOQ A;  1PK0 D;  1KK7 Y;  3OP0 A;  1SPY A;  1G4Y R;  3SG2 A;  1ZOT B;  1TIZ A;  1TRF A;  4YGA A;  4DCK A;  1Y0V H;  2AAO A;  2Q91 A;  1J7Q A;  1K2H A;  2LCP A;  1F55 A;  1XA5 A;  3SG7 A;  1K93 D;  2JU0 A;  2IS9 A;  2LAP A;  2LVK A;  5KU1 A;  3F45 A;  4MBE A;  2Y1M A;  1CB1 A;  2I7A A;  1S6J A;  1KFX S;  1CFC A;  1UHK A;  1SMG A;  3VRQ A;  1NX2 A;  1RWY A;  1J1D A;  4GNK B;  2K8M B;  3I5I C;  4F0Z B;  4HRG A;  3GK4 X;  3VRR A;  2ZNE A;  1BOD A;  3PAL A;  1PSB A;  5I2Q A;  2LVJ A;  4HSZ A;  3TDU A;  1QX7 A;  4ICB A;  4AQJ A;  1BU3 A;  1DVI A;  1CDN A;  2F8P A;  1KWO C;  1XK4 A;  5HYD A;  2KFG A;  1RK9 A;  2BEC A;  1KQM B;  2MJW B;  3NXA A;  2Y5I A;  4PHM A;  1PVA A;  1NWD A;  1DF0 A;  3EK8 A;  1XYD A;  1QTX A;  4GGF A;  2M0R A;  2MBX A;  2LP3 A;  3MSE B;  2A4J A;  1F54 A;  1QVI Z;  1UUS A;  1V1G A;  1GJY A;  2EHB A;  2I2R E;  3AKB A;  3GK2 A;  3IF7 A;  1FI6 A;  1GQM A;  1L7Z A;  3A8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...