3TS5B

Crystal structure of a light chain domain of scallop smooth muscle myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
ARLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
total genus 45
structure length 142
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B01
2LVIA 1K94A 4D1EA 5I8NA 1C07A 4GGNA 3SJSA 4HRHA 1SPYA 2M7NA 1SKTA 4MZLA 3VRQA 1B9AA 1AK8A 3JVTB 2H61C 1TTXA 1B7TY 1QJTA 4P5OE 1MQ1A 3HCMA 1J7OA 1DJXA 1JFJA 1SL7A 1B8LA 1NSHA 1YVHA 1JF2A 1QIVA 1SMGA 3TDUA 1FI6A 1IKUA 1J1EA 1YUUA 4L9MA 4NDCA 2JRFA 1YRTB 5TNCA 1M45A 2KFHA 1QLSA 5BPJA 1SCMC 1CTRA 1U5IA 2Y1MA 1SY9A 2QACA 1CLMA 1NX2A 4I5JA 1SCVA 4WQ2A 1SK6D 1EG3A 1S5GZ 3AKAA 3H4SE 2FCEA 5I2LA 1KFUL 1OZOA 1XFXO 2K61A 3A4UB 3JTDB 4AQJA 3BYAA 2M7LA 2IS9A 4YGEB 1UHNA 1WDCC 1NWDA 1Y6WA 1NUBA 1XYDA 4XYNA 3NXAA 2BL0B 5CSFA 4MN0A 2LLTA 3SG3A 2LAPA 2HQWA 1PSRA 2KYCA 3TUYC 2KBIA 2KQ6A 3LCPC 2NCPA 1ZACA 4GAOA 1DGUA 4QJ4B 2Y1NA 3KEVA 1LA3A 3OX5A 1ZOTB 1LVCD 1DJGA 3EVVA 5PALA 2K7DA 2LMTA 1PSBA 2MHHA 3BUXB 2M8UA 4GGFC 4XJKB 3F45A 1ZUZA 2PMYA 3KHEA 2LE9B 1DF0B 2AMIA 5D69A 4CLNA 1NX0A 4PCWA 1S3PA 1M39A 4A4BA 1KWOC 2KNEA 4FTGA 1WDCB 2DOQA 5HKZA 1VRKA 4MLWA 2WCFA 1KK8B 4AQIA 1ZMZA 3A8RA 4ZCVA 1LKJA 3BUWB 2LLSA 4I5LB 4PE0A 3RLZA 2G9BA 1DJYA 2AUCA 1DTLA 2M9GA 2K2FA 3FWCA 1OSAA 1EH2A 2LHLA 2QPTA 2WCEA 2JXLA 1B47A 2K2AA 2B1UA 1S1EA 4BY4A 1QX2A 1SRAA 1TNXA 2PASA 4DS7A 3NSLA 5DKNA 4OCIA 1QS7A 2BCBA 1M63B 2K7BA 4R1EA 3DF0B 4HSZA 1UURA 2K7CA 4QJ5B 3IF7A 1K95A 2K7OA 3AAKA 3I5GB 4MRXA 3WXAA 1V1GA 3PALA 2OTGC 1K8UA 4GGFA 4PHMA 1A4PA 1DJIA 1EL4A 1Y0VH 1QV0A 4N1FA 1IH0A 2FCDA 4MEWA 4CPVA 3TS5C 4MZJA 1CDLA 2HETA 1SW8A 1WRKA 3TZ1A 1BT6A 4YGCB 2V53A 2M97A 2Y5IA 1DMOA 1N0YA 1EJ3A 1LXFC 1W7JB 1GGZA 5KTYA 2WOSA 1K90D 2PVBA 1UHKA 1KFXL 1IG5A 1RJVA 1YX7A 3BXKA 1CMFA 1YRUB 1DJWA 1PK0D 4ORAB 1CFDA 1NX3A 1SYMA 1DJHA 2KSPA 4QJ3B 3NSKA 5AXIA 1CB1A 1TNWA 2EGDA 1G8IA 1M46A 1WLMA 2EC6C 1K9KA 1NCZA 5FYXA 4YI8A 2H2KA 2OTGB 1S6JA 2HPSA 3CWGA 1D1OA 1PVAA 1QLKA 1MXEA 1IRJA 1FW4A 3IQQA 3CS1A 1YURA 1J1DA 3CZTX 2ZN8A 2KGRA 1K2HA 1F70A 4BY5A 1OQPA 1CDNA 1XA5A 2ZNDA 4DCKA 1NIWA 1B4CA 1XFYO 4NQGA 1IWQA 3O4YA 4IL1A 4YRUA 1CLLA 1E8AA 2F2PA 1N65A 2RGIA 1Y1AA 1TCFA 5DKQA 1CFPA 1U5IB 3OX6A 2KI4C 2KI6D 4NDBA 1DT7B 1XFUO 3SG5A 2L4IA 1SL9A 4FQOA 4MRYA 1JF0A 2LVJA 1PRWA 5KU1A 3WHTB 1ALVA 2GGMA 1OMDA 3EVRA 4PALA 1DGVA 2FJUB 1GJYA 2OS8C 1WLZA 2F2OA 2JTTA 2I2RE 4PE4A 3AKBA 1QV1A 2BKHB 1F4OA 1MUXA 2KHNA 4CFRA 1OOJA 2KDHA 1AJ4A 1AVSA 3FWBA 1HT9A 1QXPA 3BUMB 1A29A 1L2OC 2KI4B 2PRUA 1YVLA 4HRGA 1YR5A 2ZNEA 4U8DA 4OVNF 1K9UA 4NDDA 1WRZA 1SCMB 1RK9A 1S26D 3PFVA 4PHJA 1ODBA 1RECA 1ALWA 1DJZA 1XFWO 2MRDA 4USLA 1F54A 1FI5A 1RTP1 1UWOA 2ZRTA 2MLEC 3EKJA 1DVIA 3SG6A 1HQVA 2OS8B 1QX5B 1KK7Y 4N1GA 5D7FA 4UPGA 5ER4X 3RM1A 5HYDA 2JOJA 3OHMB 3K21A 4C0LA 5JJGA 2LUCA 3QRXA 1UUSA 1TN4A 1KFUS 1UP5A 1A03A 1K96A 2O5GA 3TUYB 1F55A 1CNPA 3ZNIA 1L2OB 1IJ5A 1A75B 1NPQA 1SR6C 2HF5A 4GPLB 2L98A 1CM4A 3MSEB 2LHIA 2E6WA 2WNDA 2JT3A 4WQ3A 3EK8A 4N5XA 1PALA 4E68A 1A75A 2JQ6A 4I5KA 2JWWA 2GV5A 1NP8A 2NZ0A 5CSNA 1JBAA 1KWOB 4HREE 1YUTA 1MWNA 3SIAA 1WY9A 3EKHA 3HX4A 1F71A 1TIZA 3I5FC 4PE1A 1QIWA 3AAJA 1BMOA 1CFCA 2JC2A 4GUKA 5GQQC 2LANA 4GNKB 4ICBA 2MAZA 1SBJA 5B8IB 2WORA 3BOWB 3DVJA 1KSMA 1H4BA 1SR6B 3SG7A 3PLFB 3D0YA 2MBXA 1BU3A 2TN4A 1JFKA 2L51A 3BOWA 1AHRA 2KAYA 3D10A 2KAVA 2KGBC 2LV7A 2JNXA 1EXRA 1BJFA 1TNQA 1XK4C 1CLBA 4AOMA 2D8NA 2A4JA 3CGAA 2MLFC 1JWDA 2NLNA 4P2YB 1X02A 5AEQA 2CTNA 3TS5B 2LVVA 2ZRSA 3ZWHA 3EVUA 1J7RA 1C7VA 1J7PA 3DVKA 5HKYA 3BUNB 3GK2A 1S6CA 1IJ6A 1NX1A 1F8HA 1TNPA 2M3WA 1NCXA 1Y1UA 2KFFA 3O78A 1IQ3A 2JT0A 3FIAA 1GGWA 2I18A 1CMGA 1C7WA 4C0KA 2COLB 2L5XB 1KK7Z 2BCAA 4ORBB 3PM8A 2Y4QA 2LP2A 4C0JA 1TRFA 3OB1B 2KYFA 2EC6B 3LK0A 3M0WA 5JOLA 1TOPA 2ZKMX 3JTDC 4WRIA 1XFVO 4M2OA 5KSZA 1J55A 2BECA 5I2QA 1XK4A 3SG4A 3I5IC 5CSIA 3VRPA 2BCXA 1QTXA 2BL0C 2SCPA 3CR2A 3PSRA 2BE4A 1YUSA 1H8BA 1K9PA 4CIDA 1WRLA 2F33A 4DUQA 2E30A 2I94A 5K89A 1QASA 2LP3A 3GOFA 2L2EA 3O2PA 5HLVA 4DIRA 4CFQA 1JSAA 3KPXA 4JPZB 2L4HA 1XVJA 3NSIA 2CBLA 1KQMC 1L7ZA 2LM5A 2KBMA 2M29A 2OPOA 1IQ5A 3KO0A 1EG4A 3EK7A 2KOTA 1G33A 1QVIY 3FS7A 2M1UA 3LL8B 3VRRA 2KI6C 1Q80A 5CPVA 1S6IA 1FBVA 1MF8B 1MHOA 2L0PA 3CLNA 4ORCB 3PN7C 2WC8A 1OZSA 2LVKA 4YGBB 1BOCA 3I5IB 2MJWB 2JTZA 3WHUB 1KK8C 2AAOA 2PSRA 1BR4B 1N2DA 1R6PA 1RROA 2JT8A 2CNPA 2JZIA 2M0RA 4ETOA 3E3RA 5I2OA 1F4QA 5F6TA 2LMUA 1CM1A 4YBHB 5HLOA 2K8MB 5AANA 2O60A 2H61A 1AJ5A 2CCMA 5AERA 4JQ0D 1KQMB 2BBNA 1MXLC 4PDZA 2BBMA 3PATA 2F8PA 3LK1A 2PALA 1LA0A 4TNCA 3CR5X 3WNXB 2JU0A 2L50A 4GBAA 4DRWA 4F0ZB 2JULA 5ER5A 3DVMA 3I5GC 2I7AA 3PN7B 2F3ZA 1RFJA 1KSOA 2BE6A 2M1KB 2SASA 4XJKA 2G2BA 2WCBA 1PVBA 1DF0A 1UHHA 1W7IB 1SNLA 2KAXA 1B1GA 4PHNA 1CDPA 1G4YR 2F3YA 2LUXA 4YGDB 5HKWA 1BG1A 2Q4UA 1JC2A 2K0JA 1OE9B 1YX8A 1ZFSA 3EK4A 3NSOA 2JNFA 4M2QA 1S5GY 1AUIB 3OP0A 1SL8A 4OV2A 3D0YB 3VGOA 1UHJA 1FPWA 1GQMA 1PULA 2MA2A 4GFTA 4MSPA 1BF5A 1R2UA 3C1VA 2GGZA 3IQOA 1V1FA 1YTZC 1IGVA 1QX7A 1FF1A 1B7TZ 2JPTA 1OMRA 4JWQA 1CFFA 4MBEA 1B8CA 2FOTA 3DF0A 4MVFA 3BUOB 1KCYA 1K93D 4YI9A 2CT9A 3KF9A 2ZN9A 3O6BA 4ZCUA 1S36A 3DD4A 3OB2B 4M2PA 2LNKA 1OMVA 4Q04A 3CR4X 1BR1B 1BODA 4OR9B 2JXCA 1J7QA 2HQ8A 3VROA 3I5FB 3DVEA 3I5HC 4OKHA 5CSJA 5J3XA 5G08A 3SIBA 1QVIZ 2KQYA 1NYAA 2ZFDA 1M31A 2ISDA 3CTNA 4I5NB 3VRNA 4A4CA 1QATA 2Q91A 3JVTC 1XO5A 3ICBA 1UHIA 1CDMA 2P6BB 4PE7A 2NXQA 3GK1A 3TDIA 2EHBA 1BLQA 1NCYA 3LLEA 1JUOA 1RWYA 5DKRA 1KQVA 4YGAA 3SG2A 4MZKA 2M49B 3TDZA 3GK4X 4PHKA 5AFPA 1AP4A 2LCPA 1A2XA 2LMVA 3BQ3A 1XFZO 2LC5A 2CXJA 1CKKA 1B8RA 1LINA 2LLUA 2BKIB 5IBWA 2R2IA 1TCOB 1MR8A 1KFXS 2KFGA 1Y1XA 2NCOA 2VRGA 3I5HB
chains in the Genus database with same CATH superfamily
2LVIA 1K94A 4D1EA 5I8NA 1C07A 4GGNA 3SJSA 1TUJA 4HRHA 1SPYA 2M7NA 1SKTA 4MZLA 3VRQA 1B9AA 1AK8A 3JVTB 2H61C 1TTXA 1B7TY 1QJTA 1T14A 4P5OE 1MQ1A 3HCMA 1J7OA 1DJXA 1JFJA 1SL7A 1B8LA 2YGUA 1NSHA 1YVHA 1JF2A 1QIVA 1SMGA 3D73A 3TDUA 1FI6A 1IKUA 3O4XA 1J1EA 1YUUA 4L9MA 4NDCA 2JRFA 3S0DA 1YRTB 5TNCA 1M45A 1SSEB 1QLSA 2KFHA 1SCMC 1OW4A 1CTRA 5BPJA 1U5IA 2Y1MA 1SY9A 3BJHA 2QACA 1CLMA 1NX2A 2WC5A 1SCVA 4I5JA 4WQ2A 1SK6D 1EG3A 1S5GZ 3AKAA 3H4SE 2FCEA 5I2LA 1KFUL 1OZOA 1XFXO 2K61A 3A4UB 3JTDB 4AQJA 3BYAA 2M7LA 2IS9A 4YGEB 1UHNA 4INXA 1WDCC 1NWDA 1Y6WA 1NUBA 1XYDA 4XYNA 3NXAA 2BL0B 5CSFA 4MN0A 2LLTA 3SG3A 2LAPA 3N7HA 2HQWA 1PSRA 2KYCA 3TUYC 2KBIA 2KQ6A 3LCPC 2NCPA 1ZACA 4GAOA 1DGUA 4QJ4B 2Y1NA 3KEVA 1LA3A 3OX5A 1ZOTB 1LVCD 1DJGA 3EVVA 5PALA 2K7DA 2LMTA 5D3OA 1PSBA 2MHHA 3BUXB 2M8UA 4GGFC 4XJKB 3F45A 1ZUZA 2PMYA 3KHEA 2LE9B 1DF0B 2AMIA 5D69A 4CLNA 1NX0A 4PCWA 1S3PA 1M39A 3CDNA 1KWOC 2KNEA 1DQEA 4A4BA 4FTGA 1WDCB 2DOQA 5HKZA 1VRKA 4MLWA 4INWA 2WCFA 1KK8B 2QEOA 3S0EA 4AQIA 1ZMZA 5FI7A 3A8RA 1DC1A 3D74A 4ZCVA 1LKJA 3BUWB 2LLSA 3OBVA 4I5LB 4PE0A 2G9BA 3RLZA 1DJYA 2AUCA 1DTLA 2M9GA 2K2FA 3FWCA 1OSAA 1EH2A 2LHLA 2QPTA 2WCEA 2JXLA 1B47A 2K2AA 3BFBA 2WCKA 2B1UA 1S1EA 4BY4A 1QX2A 1SRAA 1TNXA 2PASA 4DS7A 3NSLA 5DKNA 4OCIA 1QS7A 2BCBA 1M63B 2K7BA 4R1EA 3DF0B 4HSZA 1UURA 2K7CA 4QJ5B 2PYQA 3IF7A 1K95A 2K7OA 3AAKA 3I5GB 4MRXA 3WXAA 1V1GA 3V2LA 3PALA 3BFAA 2OTGC 1K8UA 4GGFA 4PHMA 1A4PA 1DJIA 1EL4A 1Y0VH 1QV0A 3CYZA 4N1FA 1IH0A 2FCDA 4MEWA 4CPVA 3TS5C 4MZJA 1CDLA 2HETA 3B86A 1SW8A 1WRKA 3TZ1A 1BT6A 4YGCB 2K60A 2V53A 2M97A 2Y5IA 1DMOA 1N0YA 1EJ3A 1LXFC 1W7JB 1GGZA 2QEBA 3EG5B 2WOSA 3FE6A 5KTYA 2WCLA 1K90D 2PVBA 1UHKA 1KFXL 1IG5A 1RJVA 1YX7A 3BXKA 1CMFA 1YRUB 1LS8A 1DJWA 1PK0D 4ORAB 1CFDA 1NX3A 1SYMA 1DJHA 2KSPA 4QJ3B 3R72A 5I94A 3B6XA 3NSKA 5AXIA 3S0AA 1CB1A 1TNWA 1XFRA 2EGDA 1G8IA 1M46A 1WLMA 2EC6C 1K9KA 1NCZA 5FYXA 4YI8A 2H2KA 2OTGB 1S6JA 2HPSA 3CWGA 3SS4A 1D1OA 3PJIA 1PVAA 1QLKA 1MXEA 1IRJA 1FW4A 3IQQA 3CS1A 1YURA 1J1DA 1C3ZA 3CZTX 2ZN8A 2KGRA 1K2HA 1F70A 4BY5A 1OQPA 1CDNA 3K1EA 1Z2CB 2L2CA 1XA5A 2ZNDA 1P28A 4DCKA 1NIWA 1B4CA 1XFYO 4NQGA 2QEVA 1W9ZA 1IWQA 3O4YA 4IL1A 4YRUA 1CLLA 1E8AA 2F2PA 1N65A 4KYNA 2RGIA 1Y1AA 1TCFA 5DKQA 1CFPA 1U5IB 3OX6A 2KI4C 2KI6D 3BFHA 4NDBA 1DT7B 1XFUO 3SG5A 2L4IA 1SL9A 3B88A 4FQOA 3SS3A 4MRYA 1JF0A 2LVJA 1PRWA 5KU1A 3WHTB 1ALVA 2P71A 2GGMA 1OMDA 5EL2A 2L5YA 3EVRA 4PALA 1DGVA 1QWVA 2FJUB 1GJYA 2OS8C 1WLZA 2F2OA 2JTTA 1DELA 2I2RE 4PE4A 3AKBA 3S0GA 1QV1A 2BKHB 1F4OA 1IIOA 1MUXA 2KHNA 4CFRA 3DYEA 1OOJA 2KDHA 1AJ4A 1AVSA 3FWBA 1HT9A 1QXPA 3BUMB 1A29A 1L2OC 2KI4B 2PRUA 1YVLA 3D78A 1YR5A 3D77A 2ZNEA 4HRGA 4U8DA 1C3YA 4OVNF 1K9UA 4NDDA 1WRZA 1SCMB 1RK9A 1S26D 3PFVA 4PHJA 1ODBA 1RECA 3IVTA 2GTEA 1OOIX 1ALWA 1DJZA 1XFWO 2MRDA 4USLA 1F54A 1FI5A 1RTP1 1UWOA 2ZRTA 2MLEC 3EKJA 1DVIA 3SG6A 1HQVA 2OS8B 1QX5B 1KK7Y 4N1GA 5D7FA 4UPGA 5ER4X 3RM1A 3R1PA 5HYDA 2JOJA 3OHMB 3K21A 4C0LA 5JJGA 2LUCA 3QRXA 1UUSA 1TN4A 1KFUS 1UP5A 3SS5A 1A03A 1K96A 2O5GA 3TUYB 1F55A 1CNPA 3ZNIA 5FI2A 1L2OB 1IJ5A 1A75B 1NPQA 1SR6C 2HF5A 3PM2A 3Q8IA 4GPLB 2L98A 1CM4A 3MSEB 2LHIA 2E6WA 2WNDA 2JT3A 4WQ3A 3EK8A 4N5XA 1PALA 4E68A 1A75A 2JQ6A 4I5KA 4OZDA 2JWWA 2GV5A 2WC6A 1NP8A 2NZ0A 3FE9A 5CSNA 1JBAA 1KWOB 4HREE 1YUTA 1MWNA 3SIAA 1WY9A 3EKHA 3HX4A 4IJ7A 1F71A 1TIZA 3FE8A 3S0BA 3I5FC 4PE1A 1QIWA 3AAJA 1BMOA 1CFCA 2JC2A 4GUKA 3D75A 2LANA 5GQQC 3B7AA 4GNKB 4ICBA 2MAZA 1SBJA 5B8IB 2WORA 3BOWB 3DVJA 1KSMA 1H4BA 1SR6B 3SG7A 3PLFB 3D0YA 2MBXA 1BU3A 2TN4A 1JFKA 2L51A 2P70A 3BOWA 1AHRA 2KAYA 3D10A 2KAVA 2KGBC 2LV7A 2JNXA 1EXRA 1BJFA 1TNQA 1XK4C 1CLBA 4AOMA 2D8NA 2A4JA 3CGAA 2MLFC 1OOFA 1GM0A 1JWDA 2NLNA 4P2YB 1TUZA 1X02A 5AEQA 2CTNA 3TS5B 2QDIA 2LVVA 2ZRSA 3ZWHA 3EVUA 1J7RA 1C7VA 1J7PA 3DVKA 5HKYA 3BUNB 3GK2A 1S6CA 1IJ6A 1NX1A 3VB1A 1TNPA 1F8HA 2M3WA 1NCXA 1Y1UA 2KFFA 3O78A 1IQ3A 2WCMA 2JT0A 3UNWA 3FIAA 1GGWA 2I18A 1CMGA 1C7WA 4C0KA 2COLB 2L5XB 1KK7Z 2BCAA 3NHIA 3OGNA 2Y4QA 3PM8A 4ORBB 2LP2A 2WCHA 4C0JA 1TRFA 3OB1B 2KYFA 2EC6B 3LK0A 3M0WA 5JOLA 1TOPA 2ZKMX 3JTDC 4WRIA 1XFVO 4M2OA 5KSZA 1J55A 2H8VA 2BECA 3D76A 5I2QA 1XK4A 3SG4A 3I5IC 5CSIA 3VRPA 2BCXA 1QTXA 2BL0C 1TWOA 2SCPA 3CR2A 3PSRA 2BE4A 1YUSA 1H8BA 1K9PA 4CIDA 1WRLA 4FQTA 2F33A 4DUQA 2E30A 2I94A 5K89A 1QASA 2LP3A 3GOFA 2L2EA 3O2PA 5HLVA 4DIRA 4CFQA 3RZSA 1JSAA 3KPXA 4JPZB 2L4HA 1XVJA 3NSIA 3L4LA 2CBLA 1KQMC 1L7ZA 2LM5A 2KBMA 2M29A 2OPOA 3NHTA 1IQ5A 3KO0A 1EG4A 3EK7A 2KOTA 1G33A 1QVIY 3FS7A 2M1UA 3LL8B 5DICA 3VRRA 2KI6C 1Q80A 2PQLA 1S6IA 1FBVA 1MF8B 5CPVA 1MHOA 2L0PA 2ERBA 3CLNA 4ORCB 3PN7C 2WC8A 2BAPA 1OZSA 2LVKA 4YGBB 1BOCA 3I5IB 2MJWB 3CZ0A 3DZTA 2JTZA 3L47A 3WHUB 5FI6A 3DY9A 1KK8C 2AAOA 2PSRA 1BR4B 1N2DA 1R6PA 1RROA 2JT8A 2CNPA 2JZIA 2M0RA 4ETOA 3E3RA 5I2OA 1F4QA 5F6TA 2LMUA 1CM1A 4YBHB 5HLOA 2K8MB 5AANA 2O60A 2JPOA 2H61A 1AJ5A 2CCMA 5AERA 4JQ0D 1OOHA 4F7FA 1KQMB 2BBNA 1MXLC 4PDZA 2BBMA 3PATA 2F8PA 3CZ1A 3LK1A 2FJYA 2PALA 1LA0A 4TNCA 3CR5X 3CZ2A 2JU0A 2KLEA 2L50A 2QEHA 4GBAA 2JULA 3WNXB 5ER5A 4DRWA 3DVMA 4F0ZB 3I5GC 1OOGA 2I7AA 3PN7B 2F3ZA 1RFJA 1KSOA 2BE6A 3QMEA 2M1KB 1ORGA 2SASA 4XJKA 2G2BA 2WCBA 1PVBA 1DF0A 1UHHA 1W7IB 1SNLA 2KAXA 1B1GA 4PHNA 1CDPA 1G4YR 2F3YA 2LUXA 4YGDB 5HKWA 1BG1A 2Q4UA 1JC2A 2K0JA 1OE9B 1YX8A 1ZFSA 3EK4A 3NSOA 2JNFA 4M2QA 1S5GY 1AUIB 3OP0A 1SL8A 4OV2A 3D0YB 3VGOA 1UHJA 1FPWA 1GQMA 1PULA 2MA2A 4GFTA 5HL1A 4MSPA 1BF5A 1R2UA 3C1VA 2GGZA 3IQOA 1V1FA 4JKTA 4PT1A 1YTZC 1IGVA 1QX7A 1FF1A 1B7TZ 2JPTA 1OMRA 4JWQA 1CFFA 4MBEA 1B8CA 2FOTA 3DF0A 4MVFA 3BUOB 1KCYA 1K93D 4YI9A 2CT9A 3KF9A 2ZN9A 3O6BA 4ZCUA 1S36A 1Z4HA 2KLDA 3DD4A 3OB2B 4M2PA 2LNKA 1OMVA 4Q04A 3CR4X 1BR1B 1BODA 4OR9B 2JXCA 1J7QA 2HQ8A 3CABA 2BNXA 3I5FB 3VROA 3DVEA 3I5HC 4OKHA 5CSJA 3L4AA 5G08A 5J3XA 3SIBA 1QVIZ 2KQYA 1NYAA 2ZFDA 1M31A 2ISDA 3CTNA 4I5NB 3VRNA 4A4CA 1QATA 2Q91A 3JVTC 1DEKA 1XO5A 3ICBA 1UHIA 1CDMA 3R1OA 2P6BB 4PE7A 2NXQA 3GK1A 3UO9A 3TDIA 2EHBA 1BLQA 1NCYA 3LLEA 1JUOA 1RWYA 2WCJA 3S0FA 3B87A 5DKRA 1KQVA 4YGAA 3SG2A 4MZKA 2M49B 3TDZA 3GK4X 4PHKA 5AFPA 3R1VA 1AP4A 2LCPA 1A2XA 2LMVA 2KPHA 3BQ3A 1XFZO 2LC5A 2CXJA 1CKKA 1B8RA 1LINA 2LLUA 2BKIB 5IBWA 2R2IA 4JD9A 1TCOB 3NGVA 1MR8A 3DXLA 1KFXS 2KFGA 1Y1XA 2NCOA 2VRGA 3I5HB
chains in the Genus database with same CATH topology
2LVIA 1K94A 4D1EA 5I8NA 1C07A 4GGNA 3SJSA 4HRHA 1SPYA 2M7NA 1SKTA 4MZLA 3VRQA 1B9AA 1AK8A 3JVTB 2H61C 1TTXA 1B7TY 1QJTA 4P5OE 1MQ1A 3HCMA 1J7OA 1DJXA 1JFJA 1SL7A 1B8LA 1NSHA 1YVHA 1JF2A 1QIVA 1SMGA 3TDUA 1FI6A 1IKUA 1J1EA 1YUUA 4L9MA 4NDCA 2JRFA 1YRTB 5TNCA 1M45A 2KFHA 1QLSA 5BPJA 1SCMC 1CTRA 1U5IA 2Y1MA 1SY9A 2QACA 1CLMA 1NX2A 4I5JA 1SCVA 4WQ2A 1SK6D 1EG3A 1S5GZ 3AKAA 3H4SE 2FCEA 5I2LA 1KFUL 1OZOA 1XFXO 2K61A 3A4UB 3JTDB 4AQJA 3BYAA 2M7LA 2IS9A 4YGEB 1UHNA 1WDCC 1NWDA 1Y6WA 1NUBA 1XYDA 4XYNA 3NXAA 2BL0B 5CSFA 4MN0A 2LLTA 3SG3A 2LAPA 2HQWA 1PSRA 2KYCA 3TUYC 2KBIA 2KQ6A 3LCPC 2NCPA 1ZACA 4GAOA 1DGUA 4QJ4B 2Y1NA 3KEVA 1LA3A 3OX5A 1ZOTB 1LVCD 1DJGA 3EVVA 5PALA 2K7DA 2LMTA 1PSBA 2MHHA 3BUXB 2M8UA 4GGFC 4XJKB 3F45A 1ZUZA 2PMYA 3KHEA 2LE9B 1DF0B 2AMIA 5D69A 4CLNA 1NX0A 4PCWA 1S3PA 1M39A 4A4BA 1KWOC 2KNEA 4FTGA 1WDCB 2DOQA 5HKZA 1VRKA 4MLWA 2WCFA 1KK8B 4AQIA 1ZMZA 3A8RA 4ZCVA 1LKJA 3BUWB 2LLSA 4I5LB 4PE0A 3RLZA 2G9BA 1DJYA 2AUCA 1DTLA 2M9GA 2K2FA 3FWCA 1OSAA 1EH2A 2LHLA 2QPTA 2WCEA 2JXLA 1B47A 2K2AA 2B1UA 1S1EA 4BY4A 1QX2A 1SRAA 1TNXA 2PASA 4DS7A 3NSLA 5DKNA 4OCIA 1QS7A 2BCBA 1M63B 2K7BA 4R1EA 3DF0B 4HSZA 1UURA 2K7CA 4QJ5B 3IF7A 1K95A 2K7OA 3AAKA 3I5GB 4MRXA 3WXAA 1V1GA 3PALA 2OTGC 1K8UA 4GGFA 4PHMA 1A4PA 1DJIA 1EL4A 1Y0VH 1QV0A 4N1FA 1IH0A 2FCDA 4MEWA 4CPVA 3TS5C 4MZJA 1CDLA 2HETA 1SW8A 1WRKA 3TZ1A 1BT6A 4YGCB 2V53A 2M97A 2Y5IA 1DMOA 1N0YA 1EJ3A 1LXFC 1W7JB 1GGZA 5KTYA 2WOSA 1K90D 2PVBA 1UHKA 1KFXL 1IG5A 1RJVA 1YX7A 3BXKA 1CMFA 1YRUB 1DJWA 1PK0D 4ORAB 1CFDA 1NX3A 1SYMA 1DJHA 2KSPA 4QJ3B 3NSKA 5AXIA 1CB1A 1TNWA 2EGDA 1G8IA 1M46A 1WLMA 2EC6C 1K9KA 1NCZA 5FYXA 4YI8A 2H2KA 2OTGB 1S6JA 2HPSA 3CWGA 1D1OA 1PVAA 1QLKA 1MXEA 1IRJA 1FW4A 3IQQA 3CS1A 1YURA 1J1DA 3CZTX 2ZN8A 2KGRA 1K2HA 1F70A 4BY5A 1OQPA 1CDNA 1XA5A 2ZNDA 4DCKA 1NIWA 1B4CA 1XFYO 4NQGA 1IWQA 3O4YA 4IL1A 4YRUA 1CLLA 1E8AA 2F2PA 1N65A 2RGIA 1Y1AA 1TCFA 5DKQA 1CFPA 1U5IB 3OX6A 2KI4C 2KI6D 4NDBA 1DT7B 1XFUO 3SG5A 2L4IA 1SL9A 4FQOA 4MRYA 1JF0A 2LVJA 1PRWA 5KU1A 3WHTB 1ALVA 2GGMA 1OMDA 3EVRA 4PALA 1DGVA 2FJUB 1GJYA 2OS8C 1WLZA 2F2OA 2JTTA 2I2RE 4PE4A 3AKBA 1QV1A 2BKHB 1F4OA 1MUXA 2KHNA 4CFRA 1OOJA 2KDHA 1AJ4A 1AVSA 3FWBA 1HT9A 1QXPA 3BUMB 1A29A 1L2OC 2KI4B 2PRUA 1YVLA 4HRGA 1YR5A 2ZNEA 4U8DA 4OVNF 1K9UA 4NDDA 1WRZA 1SCMB 1RK9A 1S26D 3PFVA 4PHJA 1ODBA 1RECA 1ALWA 1DJZA 1XFWO 2MRDA 4USLA 1F54A 1FI5A 1RTP1 1UWOA 2ZRTA 2MLEC 3EKJA 1DVIA 3SG6A 1HQVA 2OS8B 1QX5B 1KK7Y 4N1GA 5D7FA 4UPGA 5ER4X 3RM1A 5HYDA 2JOJA 3OHMB 3K21A 4C0LA 5JJGA 2LUCA 3QRXA 1UUSA 1TN4A 1KFUS 1UP5A 1A03A 1K96A 2O5GA 3TUYB 1F55A 1CNPA 3ZNIA 1L2OB 1IJ5A 1A75B 1NPQA 1SR6C 2HF5A 4GPLB 2L98A 1CM4A 3MSEB 2LHIA 2E6WA 2WNDA 2JT3A 4WQ3A 3EK8A 4N5XA 1PALA 4E68A 1A75A 2JQ6A 4I5KA 2JWWA 2GV5A 1NP8A 2NZ0A 5CSNA 1JBAA 1KWOB 4HREE 1YUTA 1MWNA 3SIAA 1WY9A 3EKHA 3HX4A 1F71A 1TIZA 3I5FC 4PE1A 1QIWA 3AAJA 1BMOA 1CFCA 2JC2A 4GUKA 5GQQC 2LANA 4GNKB 4ICBA 2MAZA 1SBJA 5B8IB 2WORA 3BOWB 3DVJA 1KSMA 1H4BA 1SR6B 3SG7A 3PLFB 3D0YA 2MBXA 1BU3A 2TN4A 1JFKA 2L51A 3BOWA 1AHRA 2KAYA 3D10A 2KAVA 2KGBC 2LV7A 2JNXA 1EXRA 1BJFA 1TNQA 1XK4C 1CLBA 4AOMA 2D8NA 2A4JA 3CGAA 2MLFC 1JWDA 2NLNA 4P2YB 1X02A 5AEQA 2CTNA 3TS5B 2LVVA 2ZRSA 3ZWHA 3EVUA 1J7RA 1C7VA 1J7PA 3DVKA 5HKYA 3BUNB 3GK2A 1S6CA 1IJ6A 1NX1A 1F8HA 1TNPA 2M3WA 1NCXA 1Y1UA 2KFFA 3O78A 1IQ3A 2JT0A 3FIAA 1GGWA 2I18A 1CMGA 1C7WA 4C0KA 2COLB 2L5XB 1KK7Z 2BCAA 4ORBB 3PM8A 2Y4QA 2LP2A 4C0JA 1TRFA 3OB1B 2KYFA 2EC6B 3LK0A 3M0WA 5JOLA 1TOPA 2ZKMX 3JTDC 4WRIA 1XFVO 4M2OA 5KSZA 1J55A 2BECA 5I2QA 1XK4A 3SG4A 3I5IC 5CSIA 3VRPA 2BCXA 1QTXA 2BL0C 2SCPA 3CR2A 3PSRA 2BE4A 1YUSA 1H8BA 1K9PA 4CIDA 1WRLA 2F33A 4DUQA 2E30A 2I94A 5K89A 1QASA 2LP3A 3GOFA 2L2EA 3O2PA 5HLVA 4DIRA 4CFQA 1JSAA 3KPXA 4JPZB 2L4HA 1XVJA 3NSIA 2CBLA 1KQMC 1L7ZA 2LM5A 2KBMA 2M29A 2OPOA 1IQ5A 3KO0A 1EG4A 3EK7A 2KOTA 1G33A 1QVIY 3FS7A 2M1UA 3LL8B 3VRRA 2KI6C 1Q80A 5CPVA 1S6IA 1FBVA 1MF8B 1MHOA 2L0PA 3CLNA 4ORCB 3PN7C 2WC8A 1OZSA 2LVKA 4YGBB 1BOCA 3I5IB 2MJWB 2JTZA 3WHUB 1KK8C 2AAOA 2PSRA 1BR4B 1N2DA 1R6PA 1RROA 2JT8A 2CNPA 2JZIA 2M0RA 4ETOA 3E3RA 5I2OA 1F4QA 5F6TA 2LMUA 1CM1A 4YBHB 5HLOA 2K8MB 5AANA 2O60A 2H61A 1AJ5A 2CCMA 5AERA 4JQ0D 1KQMB 2BBNA 1MXLC 4PDZA 2BBMA 3PATA 2F8PA 3LK1A 2PALA 1LA0A 4TNCA 3CR5X 3WNXB 2JU0A 2L50A 4GBAA 4DRWA 4F0ZB 2JULA 5ER5A 3DVMA 3I5GC 2I7AA 3PN7B 2F3ZA 1RFJA 1KSOA 2BE6A 2M1KB 2SASA 4XJKA 2G2BA 2WCBA 1PVBA 1DF0A 1UHHA 1W7IB 1SNLA 2KAXA 1B1GA 4PHNA 1CDPA 1G4YR 2F3YA 2LUXA 4YGDB 5HKWA 1BG1A 2Q4UA 1JC2A 2K0JA 1OE9B 1YX8A 1ZFSA 3EK4A 3NSOA 2JNFA 4M2QA 1S5GY 1AUIB 3OP0A 1SL8A 4OV2A 3D0YB 3VGOA 1UHJA 1FPWA 1GQMA 1PULA 2MA2A 4GFTA 4MSPA 1BF5A 1R2UA 3C1VA 2GGZA 3IQOA 1V1FA 1YTZC 1IGVA 1QX7A 1FF1A 1B7TZ 2JPTA 1OMRA 4JWQA 1CFFA 4MBEA 1B8CA 2FOTA 3DF0A 4MVFA 3BUOB 1KCYA 1K93D 4YI9A 2CT9A 3KF9A 2ZN9A 3O6BA 4ZCUA 1S36A 3DD4A 3OB2B 4M2PA 2LNKA 1OMVA 4Q04A 3CR4X 1BR1B 1BODA 4OR9B 2JXCA 1J7QA 2HQ8A 3VROA 3I5FB 3DVEA 3I5HC 4OKHA 5CSJA 5J3XA 5G08A 3SIBA 1QVIZ 2KQYA 1NYAA 2ZFDA 1M31A 2ISDA 3CTNA 4I5NB 3VRNA 4A4CA 1QATA 2Q91A 3JVTC 1XO5A 3ICBA 1UHIA 1CDMA 2P6BB 4PE7A 2NXQA 3GK1A 3TDIA 2EHBA 1BLQA 1NCYA 3LLEA 1JUOA 1RWYA 5DKRA 1KQVA 4YGAA 3SG2A 4MZKA 2M49B 3TDZA 3GK4X 4PHKA 5AFPA 1AP4A 2LCPA 1A2XA 2LMVA 3BQ3A 1XFZO 2LC5A 2CXJA 1CKKA 1B8RA 1LINA 2LLUA 2BKIB 5IBWA 2R2IA 1TCOB 1MR8A 1KFXS 2KFGA 1Y1XA 2NCOA 2VRGA 3I5HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVI A;  1K94 A;  4D1E A;  5I8N A;  1C07 A;  4GGN A;  3SJS A;  4HRH A;  1SPY A;  2M7N A;  1SKT A;  4MZL A;  3VRQ A;  1B9A A;  1AK8 A;  3JVT B;  2H61 C;  1TTX A;  1B7T Y;  1QJT A;  4P5O E;  1MQ1 A;  3HCM A;  1J7O A;  1DJX A;  1JFJ A;  1SL7 A;  1B8L A;  1NSH A;  1YVH A;  1JF2 A;  1QIV A;  1SMG A;  3TDU A;  1FI6 A;  1IKU A;  1J1E A;  1YUU A;  4L9M A;  4NDC A;  2JRF A;  1YRT B;  5TNC A;  1M45 A;  2KFH A;  1QLS A;  5BPJ A;  1SCM C;  1CTR A;  1U5I A;  2Y1M A;  1SY9 A;  2QAC A;  1CLM A;  1NX2 A;  4I5J A;  1SCV A;  4WQ2 A;  1SK6 D;  1EG3 A;  1S5G Z;  3AKA A;  3H4S E;  2FCE A;  5I2L A;  1KFU L;  1OZO A;  1XFX O;  2K61 A;  3A4U B;  3JTD B;  4AQJ A;  3BYA A;  2M7L A;  2IS9 A;  4YGE B;  1UHN A;  1WDC C;  1NWD A;  1Y6W A;  1NUB A;  1XYD A;  4XYN A;  3NXA A;  2BL0 B;  5CSF A;  4MN0 A;  2LLT A;  3SG3 A;  2LAP A;  2HQW A;  1PSR A;  2KYC A;  3TUY C;  2KBI A;  2KQ6 A;  3LCP C;  2NCP A;  1ZAC A;  4GAO A;  1DGU A;  4QJ4 B;  2Y1N A;  3KEV A;  1LA3 A;  3OX5 A;  1ZOT B;  1LVC D;  1DJG A;  3EVV A;  5PAL A;  2K7D A;  2LMT A;  1PSB A;  2MHH A;  3BUX B;  2M8U A;  4GGF C;  4XJK B;  3F45 A;  1ZUZ A;  2PMY A;  3KHE A;  2LE9 B;  1DF0 B;  2AMI A;  5D69 A;  4CLN A;  1NX0 A;  4PCW A;  1S3P A;  1M39 A;  4A4B A;  1KWO C;  2KNE A;  4FTG A;  1WDC B;  2DOQ A;  5HKZ A;  1VRK A;  4MLW A;  2WCF A;  1KK8 B;  4AQI A;  1ZMZ A;  3A8R A;  4ZCV A;  1LKJ A;  3BUW B;  2LLS A;  4I5L B;  4PE0 A;  3RLZ A;  2G9B A;  1DJY A;  2AUC A;  1DTL A;  2M9G A;  2K2F A;  3FWC A;  1OSA A;  1EH2 A;  2LHL A;  2QPT A;  2WCE A;  2JXL A;  1B47 A;  2K2A A;  2B1U A;  1S1E A;  4BY4 A;  1QX2 A;  1SRA A;  1TNX A;  2PAS A;  4DS7 A;  3NSL A;  5DKN A;  4OCI A;  1QS7 A;  2BCB A;  1M63 B;  2K7B A;  4R1E A;  3DF0 B;  4HSZ A;  1UUR A;  2K7C A;  4QJ5 B;  3IF7 A;  1K95 A;  2K7O A;  3AAK A;  3I5G B;  4MRX A;  3WXA A;  1V1G A;  3PAL A;  2OTG C;  1K8U A;  4GGF A;  4PHM A;  1A4P A;  1DJI A;  1EL4 A;  1Y0V H;  1QV0 A;  4N1F A;  1IH0 A;  2FCD A;  4MEW A;  4CPV A;  3TS5 C;  4MZJ A;  1CDL A;  2HET A;  1SW8 A;  1WRK A;  3TZ1 A;  1BT6 A;  4YGC B;  2V53 A;  2M97 A;  2Y5I A;  1DMO A;  1N0Y A;  1EJ3 A;  1LXF C;  1W7J B;  1GGZ A;  5KTY A;  2WOS A;  1K90 D;  2PVB A;  1UHK A;  1KFX L;  1IG5 A;  1RJV A;  1YX7 A;  3BXK A;  1CMF A;  1YRU B;  1DJW A;  1PK0 D;  4ORA B;  1CFD A;  1NX3 A;  1SYM A;  1DJH A;  2KSP A;  4QJ3 B;  3NSK A;  5AXI A;  1CB1 A;  1TNW A;  2EGD A;  1G8I A;  1M46 A;  1WLM A;  2EC6 C;  1K9K A;  1NCZ A;  5FYX A;  4YI8 A;  2H2K A;  2OTG B;  1S6J A;  2HPS A;  3CWG A;  1D1O A;  1PVA A;  1QLK A;  1MXE A;  1IRJ A;  1FW4 A;  3IQQ A;  3CS1 A;  1YUR A;  1J1D A;  3CZT X;  2ZN8 A;  2KGR A;  1K2H A;  1F70 A;  4BY5 A;  1OQP A;  1CDN A;  1XA5 A;  2ZND A;  4DCK A;  1NIW A;  1B4C A;  1XFY O;  4NQG A;  1IWQ A;  3O4Y A;  4IL1 A;  4YRU A;  1CLL A;  1E8A A;  2F2P A;  1N65 A;  2RGI A;  1Y1A A;  1TCF A;  5DKQ A;  1CFP A;  1U5I B;  3OX6 A;  2KI4 C;  2KI6 D;  4NDB A;  1DT7 B;  1XFU O;  3SG5 A;  2L4I A;  1SL9 A;  4FQO A;  4MRY A;  1JF0 A;  2LVJ A;  1PRW A;  5KU1 A;  3WHT B;  1ALV A;  2GGM A;  1OMD A;  3EVR A;  4PAL A;  1DGV A;  2FJU B;  1GJY A;  2OS8 C;  1WLZ A;  2F2O A;  2JTT A;  2I2R E;  4PE4 A;  3AKB A;  1QV1 A;  2BKH B;  1F4O A;  1MUX A;  2KHN A;  4CFR A;  1OOJ A;  2KDH A;  1AJ4 A;  1AVS A;  3FWB A;  1HT9 A;  1QXP A;  3BUM B;  1A29 A;  1L2O C;  2KI4 B;  2PRU A;  1YVL A;  4HRG A;  1YR5 A;  2ZNE A;  4U8D A;  4OVN F;  1K9U A;  4NDD A;  1WRZ A;  1SCM B;  1RK9 A;  1S26 D;  3PFV A;  4PHJ A;  1ODB A;  1REC A;  1ALW A;  1DJZ A;  1XFW O;  2MRD A;  4USL A;  1F54 A;  1FI5 A;  1RTP 1;  1UWO A;  2ZRT A;  2MLE C;  3EKJ A;  1DVI A;  3SG6 A;  1HQV A;  2OS8 B;  1QX5 B;  1KK7 Y;  4N1G A;  5D7F A;  4UPG A;  5ER4 X;  3RM1 A;  5HYD A;  2JOJ A;  3OHM B;  3K21 A;  4C0L A;  5JJG A;  2LUC A;  3QRX A;  1UUS A;  1TN4 A;  1KFU S;  1UP5 A;  1A03 A;  1K96 A;  2O5G A;  3TUY B;  1F55 A;  1CNP A;  3ZNI A;  1L2O B;  1IJ5 A;  1A75 B;  1NPQ A;  1SR6 C;  2HF5 A;  4GPL B;  2L98 A;  1CM4 A;  3MSE B;  2LHI A;  2E6W A;  2WND A;  2JT3 A;  4WQ3 A;  3EK8 A;  4N5X A;  1PAL A;  4E68 A;  1A75 A;  2JQ6 A;  4I5K A;  2JWW A;  2GV5 A;  1NP8 A;  2NZ0 A;  5CSN A;  1JBA A;  1KWO B;  4HRE E;  1YUT A;  1MWN A;  3SIA A;  1WY9 A;  3EKH A;  3HX4 A;  1F71 A;  1TIZ A;  3I5F C;  4PE1 A;  1QIW A;  3AAJ A;  1BMO A;  1CFC A;  2JC2 A;  4GUK A;  5GQQ C;  2LAN A;  4GNK B;  4ICB A;  2MAZ A;  1SBJ A;  5B8I B;  2WOR A;  3BOW B;  3DVJ A;  1KSM A;  1H4B A;  1SR6 B;  3SG7 A;  3PLF B;  3D0Y A;  2MBX A;  1BU3 A;  2TN4 A;  1JFK A;  2L51 A;  3BOW A;  1AHR A;  2KAY A;  3D10 A;  2KAV A;  2KGB C;  2LV7 A;  2JNX A;  1EXR A;  1BJF A;  1TNQ A;  1XK4 C;  1CLB A;  4AOM A;  2D8N A;  2A4J A;  3CGA A;  2MLF C;  1JWD A;  2NLN A;  4P2Y B;  1X02 A;  5AEQ A;  2CTN A;  3TS5 B;  2LVV A;  2ZRS A;  3ZWH A;  3EVU A;  1J7R A;  1C7V A;  1J7P A;  3DVK A;  5HKY A;  3BUN B;  3GK2 A;  1S6C A;  1IJ6 A;  1NX1 A;  1F8H A;  1TNP A;  2M3W A;  1NCX A;  1Y1U A;  2KFF A;  3O78 A;  1IQ3 A;  2JT0 A;  3FIA A;  1GGW A;  2I18 A;  1CMG A;  1C7W A;  4C0K A;  2COL B;  2L5X B;  1KK7 Z;  2BCA A;  4ORB B;  3PM8 A;  2Y4Q A;  2LP2 A;  4C0J A;  1TRF A;  3OB1 B;  2KYF A;  2EC6 B;  3LK0 A;  3M0W A;  5JOL A;  1TOP A;  2ZKM X;  3JTD C;  4WRI A;  1XFV O;  4M2O A;  5KSZ A;  1J55 A;  2BEC A;  5I2Q A;  1XK4 A;  3SG4 A;  3I5I C;  5CSI A;  3VRP A;  2BCX A;  1QTX A;  2BL0 C;  2SCP A;  3CR2 A;  3PSR A;  2BE4 A;  1YUS A;  1H8B A;  1K9P A;  4CID A;  1WRL A;  2F33 A;  4DUQ A;  2E30 A;  2I94 A;  5K89 A;  1QAS A;  2LP3 A;  3GOF A;  2L2E A;  3O2P A;  5HLV A;  4DIR A;  4CFQ A;  1JSA A;  3KPX A;  4JPZ B;  2L4H A;  1XVJ A;  3NSI A;  2CBL A;  1KQM C;  1L7Z A;  2LM5 A;  2KBM A;  2M29 A;  2OPO A;  1IQ5 A;  3KO0 A;  1EG4 A;  3EK7 A;  2KOT A;  1G33 A;  1QVI Y;  3FS7 A;  2M1U A;  3LL8 B;  3VRR A;  2KI6 C;  1Q80 A;  5CPV A;  1S6I A;  1FBV A;  1MF8 B;  1MHO A;  2L0P A;  3CLN A;  4ORC B;  3PN7 C;  2WC8 A;  1OZS A;  2LVK A;  4YGB B;  1BOC A;  3I5I B;  2MJW B;  2JTZ A;  3WHU B;  1KK8 C;  2AAO A;  2PSR A;  1BR4 B;  1N2D A;  1R6P A;  1RRO A;  2JT8 A;  2CNP A;  2JZI A;  2M0R A;  4ETO A;  3E3R A;  5I2O A;  1F4Q A;  5F6T A;  2LMU A;  1CM1 A;  4YBH B;  5HLO A;  2K8M B;  5AAN A;  2O60 A;  2H61 A;  1AJ5 A;  2CCM A;  5AER A;  4JQ0 D;  1KQM B;  2BBN A;  1MXL C;  4PDZ A;  2BBM A;  3PAT A;  2F8P A;  3LK1 A;  2PAL A;  1LA0 A;  4TNC A;  3CR5 X;  3WNX B;  2JU0 A;  2L50 A;  4GBA A;  4DRW A;  4F0Z B;  2JUL A;  5ER5 A;  3DVM A;  3I5G C;  2I7A A;  3PN7 B;  2F3Z A;  1RFJ A;  1KSO A;  2BE6 A;  2M1K B;  2SAS A;  4XJK A;  2G2B A;  2WCB A;  1PVB A;  1DF0 A;  1UHH A;  1W7I B;  1SNL A;  2KAX A;  1B1G A;  4PHN A;  1CDP A;  1G4Y R;  2F3Y A;  2LUX A;  4YGD B;  5HKW A;  1BG1 A;  2Q4U A;  1JC2 A;  2K0J A;  1OE9 B;  1YX8 A;  1ZFS A;  3EK4 A;  3NSO A;  2JNF A;  4M2Q A;  1S5G Y;  1AUI B;  3OP0 A;  1SL8 A;  4OV2 A;  3D0Y B;  3VGO A;  1UHJ A;  1FPW A;  1GQM A;  1PUL A;  2MA2 A;  4GFT A;  4MSP A;  1BF5 A;  1R2U A;  3C1V A;  2GGZ A;  3IQO A;  1V1F A;  1YTZ C;  1IGV A;  1QX7 A;  1FF1 A;  1B7T Z;  2JPT A;  1OMR A;  4JWQ A;  1CFF A;  4MBE A;  1B8C A;  2FOT A;  3DF0 A;  4MVF A;  3BUO B;  1KCY A;  1K93 D;  4YI9 A;  2CT9 A;  3KF9 A;  2ZN9 A;  3O6B A;  4ZCU A;  1S36 A;  3DD4 A;  3OB2 B;  4M2P A;  2LNK A;  1OMV A;  4Q04 A;  3CR4 X;  1BR1 B;  1BOD A;  4OR9 B;  2JXC A;  1J7Q A;  2HQ8 A;  3VRO A;  3I5F B;  3DVE A;  3I5H C;  4OKH A;  5CSJ A;  5J3X A;  5G08 A;  3SIB A;  1QVI Z;  2KQY A;  1NYA A;  2ZFD A;  1M31 A;  2ISD A;  3CTN A;  4I5N B;  3VRN A;  4A4C A;  1QAT A;  2Q91 A;  3JVT C;  1XO5 A;  3ICB A;  1UHI A;  1CDM A;  2P6B B;  4PE7 A;  2NXQ A;  3GK1 A;  3TDI A;  2EHB A;  1BLQ A;  1NCY A;  3LLE A;  1JUO A;  1RWY A;  5DKR A;  1KQV A;  4YGA A;  3SG2 A;  4MZK A;  2M49 B;  3TDZ A;  3GK4 X;  4PHK A;  5AFP A;  1AP4 A;  2LCP A;  1A2X A;  2LMV A;  3BQ3 A;  1XFZ O;  2LC5 A;  2CXJ A;  1CKK A;  1B8R A;  1LIN A;  2LLU A;  2BKI B;  5IBW A;  2R2I A;  1TCO B;  1MR8 A;  1KFX S;  2KFG A;  1Y1X A;  2NCO A;  2VRG A;  3I5H B; 
#chains in the Genus database with same CATH topology
 2LVI A;  1K94 A;  4D1E A;  5I8N A;  1C07 A;  4GGN A;  3SJS A;  1TUJ A;  4HRH A;  1SPY A;  2M7N A;  1SKT A;  4MZL A;  3VRQ A;  1B9A A;  1AK8 A;  3JVT B;  2H61 C;  1TTX A;  1B7T Y;  1QJT A;  1T14 A;  4P5O E;  1MQ1 A;  3HCM A;  1J7O A;  1DJX A;  1JFJ A;  1SL7 A;  1B8L A;  2YGU A;  1NSH A;  1YVH A;  1JF2 A;  1QIV A;  1SMG A;  3D73 A;  3TDU A;  1FI6 A;  1IKU A;  3O4X A;  1J1E A;  1YUU A;  4L9M A;  4NDC A;  2JRF A;  3S0D A;  1YRT B;  5TNC A;  1M45 A;  1SSE B;  1QLS A;  2KFH A;  1SCM C;  1OW4 A;  1CTR A;  5BPJ A;  1U5I A;  2Y1M A;  1SY9 A;  3BJH A;  2QAC A;  1CLM A;  1NX2 A;  2WC5 A;  1SCV A;  4I5J A;  4WQ2 A;  1SK6 D;  1EG3 A;  1S5G Z;  3AKA A;  3H4S E;  2FCE A;  5I2L A;  1KFU L;  1OZO A;  1XFX O;  2K61 A;  3A4U B;  3JTD B;  4AQJ A;  3BYA A;  2M7L A;  2IS9 A;  4YGE B;  1UHN A;  4INX A;  1WDC C;  1NWD A;  1Y6W A;  1NUB A;  1XYD A;  4XYN A;  3NXA A;  2BL0 B;  5CSF A;  4MN0 A;  2LLT A;  3SG3 A;  2LAP A;  3N7H A;  2HQW A;  1PSR A;  2KYC A;  3TUY C;  2KBI A;  2KQ6 A;  3LCP C;  2NCP A;  1ZAC A;  4GAO A;  1DGU A;  4QJ4 B;  2Y1N A;  3KEV A;  1LA3 A;  3OX5 A;  1ZOT B;  1LVC D;  1DJG A;  3EVV A;  5PAL A;  2K7D A;  2LMT A;  5D3O A;  1PSB A;  2MHH A;  3BUX B;  2M8U A;  4GGF C;  4XJK B;  3F45 A;  1ZUZ A;  2PMY A;  3KHE A;  2LE9 B;  1DF0 B;  2AMI A;  5D69 A;  4CLN A;  1NX0 A;  4PCW A;  1S3P A;  1M39 A;  3CDN A;  1KWO C;  2KNE A;  1DQE A;  4A4B A;  4FTG A;  1WDC B;  2DOQ A;  5HKZ A;  1VRK A;  4MLW A;  4INW A;  2WCF A;  1KK8 B;  2QEO A;  3S0E A;  4AQI A;  1ZMZ A;  5FI7 A;  3A8R A;  1DC1 A;  3D74 A;  4ZCV A;  1LKJ A;  3BUW B;  2LLS A;  3OBV A;  4I5L B;  4PE0 A;  2G9B A;  3RLZ A;  1DJY A;  2AUC A;  1DTL A;  2M9G A;  2K2F A;  3FWC A;  1OSA A;  1EH2 A;  2LHL A;  2QPT A;  2WCE A;  2JXL A;  1B47 A;  2K2A A;  3BFB A;  2WCK A;  2B1U A;  1S1E A;  4BY4 A;  1QX2 A;  1SRA A;  1TNX A;  2PAS A;  4DS7 A;  3NSL A;  5DKN A;  4OCI A;  1QS7 A;  2BCB A;  1M63 B;  2K7B A;  4R1E A;  3DF0 B;  4HSZ A;  1UUR A;  2K7C A;  4QJ5 B;  2PYQ A;  3IF7 A;  1K95 A;  2K7O A;  3AAK A;  3I5G B;  4MRX A;  3WXA A;  1V1G A;  3V2L A;  3PAL A;  3BFA A;  2OTG C;  1K8U A;  4GGF A;  4PHM A;  1A4P A;  1DJI A;  1EL4 A;  1Y0V H;  1QV0 A;  3CYZ A;  4N1F A;  1IH0 A;  2FCD A;  4MEW A;  4CPV A;  3TS5 C;  4MZJ A;  1CDL A;  2HET A;  3B86 A;  1SW8 A;  1WRK A;  3TZ1 A;  1BT6 A;  4YGC B;  2K60 A;  2V53 A;  2M97 A;  2Y5I A;  1DMO A;  1N0Y A;  1EJ3 A;  1LXF C;  1W7J B;  1GGZ A;  2QEB A;  3EG5 B;  2WOS A;  3FE6 A;  5KTY A;  2WCL A;  1K90 D;  2PVB A;  1UHK A;  1KFX L;  1IG5 A;  1RJV A;  1YX7 A;  3BXK A;  1CMF A;  1YRU B;  1LS8 A;  1DJW A;  1PK0 D;  4ORA B;  1CFD A;  1NX3 A;  1SYM A;  1DJH A;  2KSP A;  4QJ3 B;  3R72 A;  5I94 A;  3B6X A;  3NSK A;  5AXI A;  3S0A A;  1CB1 A;  1TNW A;  1XFR A;  2EGD A;  1G8I A;  1M46 A;  1WLM A;  2EC6 C;  1K9K A;  1NCZ A;  5FYX A;  4YI8 A;  2H2K A;  2OTG B;  1S6J A;  2HPS A;  3CWG A;  3SS4 A;  1D1O A;  3PJI A;  1PVA A;  1QLK A;  1MXE A;  1IRJ A;  1FW4 A;  3IQQ A;  3CS1 A;  1YUR A;  1J1D A;  1C3Z A;  3CZT X;  2ZN8 A;  2KGR A;  1K2H A;  1F70 A;  4BY5 A;  1OQP A;  1CDN A;  3K1E A;  1Z2C B;  2L2C A;  1XA5 A;  2ZND A;  1P28 A;  4DCK A;  1NIW A;  1B4C A;  1XFY O;  4NQG A;  2QEV A;  1W9Z A;  1IWQ A;  3O4Y A;  4IL1 A;  4YRU A;  1CLL A;  1E8A A;  2F2P A;  1N65 A;  4KYN A;  2RGI A;  1Y1A A;  1TCF A;  5DKQ A;  1CFP A;  1U5I B;  3OX6 A;  2KI4 C;  2KI6 D;  3BFH A;  4NDB A;  1DT7 B;  1XFU O;  3SG5 A;  2L4I A;  1SL9 A;  3B88 A;  4FQO A;  3SS3 A;  4MRY A;  1JF0 A;  2LVJ A;  1PRW A;  5KU1 A;  3WHT B;  1ALV A;  2P71 A;  2GGM A;  1OMD A;  5EL2 A;  2L5Y A;  3EVR A;  4PAL A;  1DGV A;  1QWV A;  2FJU B;  1GJY A;  2OS8 C;  1WLZ A;  2F2O A;  2JTT A;  1DEL A;  2I2R E;  4PE4 A;  3AKB A;  3S0G A;  1QV1 A;  2BKH B;  1F4O A;  1IIO A;  1MUX A;  2KHN A;  4CFR A;  3DYE A;  1OOJ A;  2KDH A;  1AJ4 A;  1AVS A;  3FWB A;  1HT9 A;  1QXP A;  3BUM B;  1A29 A;  1L2O C;  2KI4 B;  2PRU A;  1YVL A;  3D78 A;  1YR5 A;  3D77 A;  2ZNE A;  4HRG A;  4U8D A;  1C3Y A;  4OVN F;  1K9U A;  4NDD A;  1WRZ A;  1SCM B;  1RK9 A;  1S26 D;  3PFV A;  4PHJ A;  1ODB A;  1REC A;  3IVT A;  2GTE A;  1OOI X;  1ALW A;  1DJZ A;  1XFW O;  2MRD A;  4USL A;  1F54 A;  1FI5 A;  1RTP 1;  1UWO A;  2ZRT A;  2MLE C;  3EKJ A;  1DVI A;  3SG6 A;  1HQV A;  2OS8 B;  1QX5 B;  1KK7 Y;  4N1G A;  5D7F A;  4UPG A;  5ER4 X;  3RM1 A;  3R1P A;  5HYD A;  2JOJ A;  3OHM B;  3K21 A;  4C0L A;  5JJG A;  2LUC A;  3QRX A;  1UUS A;  1TN4 A;  1KFU S;  1UP5 A;  3SS5 A;  1A03 A;  1K96 A;  2O5G A;  3TUY B;  1F55 A;  1CNP A;  3ZNI A;  5FI2 A;  1L2O B;  1IJ5 A;  1A75 B;  1NPQ A;  1SR6 C;  2HF5 A;  3PM2 A;  3Q8I A;  4GPL B;  2L98 A;  1CM4 A;  3MSE B;  2LHI A;  2E6W A;  2WND A;  2JT3 A;  4WQ3 A;  3EK8 A;  4N5X A;  1PAL A;  4E68 A;  1A75 A;  2JQ6 A;  4I5K A;  4OZD A;  2JWW A;  2GV5 A;  2WC6 A;  1NP8 A;  2NZ0 A;  3FE9 A;  5CSN A;  1JBA A;  1KWO B;  4HRE E;  1YUT A;  1MWN A;  3SIA A;  1WY9 A;  3EKH A;  3HX4 A;  4IJ7 A;  1F71 A;  1TIZ A;  3FE8 A;  3S0B A;  3I5F C;  4PE1 A;  1QIW A;  3AAJ A;  1BMO A;  1CFC A;  2JC2 A;  4GUK A;  3D75 A;  2LAN A;  5GQQ C;  3B7A A;  4GNK B;  4ICB A;  2MAZ A;  1SBJ A;  5B8I B;  2WOR A;  3BOW B;  3DVJ A;  1KSM A;  1H4B A;  1SR6 B;  3SG7 A;  3PLF B;  3D0Y A;  2MBX A;  1BU3 A;  2TN4 A;  1JFK A;  2L51 A;  2P70 A;  3BOW A;  1AHR A;  2KAY A;  3D10 A;  2KAV A;  2KGB C;  2LV7 A;  2JNX A;  1EXR A;  1BJF A;  1TNQ A;  1XK4 C;  1CLB A;  4AOM A;  2D8N A;  2A4J A;  3CGA A;  2MLF C;  1OOF A;  1GM0 A;  1JWD A;  2NLN A;  4P2Y B;  1TUZ A;  1X02 A;  5AEQ A;  2CTN A;  3TS5 B;  2QDI A;  2LVV A;  2ZRS A;  3ZWH A;  3EVU A;  1J7R A;  1C7V A;  1J7P A;  3DVK A;  5HKY A;  3BUN B;  3GK2 A;  1S6C A;  1IJ6 A;  1NX1 A;  3VB1 A;  1TNP A;  1F8H A;  2M3W A;  1NCX A;  1Y1U A;  2KFF A;  3O78 A;  1IQ3 A;  2WCM A;  2JT0 A;  3UNW A;  3FIA A;  1GGW A;  2I18 A;  1CMG A;  1C7W A;  4C0K A;  2COL B;  2L5X B;  1KK7 Z;  2BCA A;  3NHI A;  3OGN A;  2Y4Q A;  3PM8 A;  4ORB B;  2LP2 A;  2WCH A;  4C0J A;  1TRF A;  3OB1 B;  2KYF A;  2EC6 B;  3LK0 A;  3M0W A;  5JOL A;  1TOP A;  2ZKM X;  3JTD C;  4WRI A;  1XFV O;  4M2O A;  5KSZ A;  1J55 A;  2H8V A;  2BEC A;  3D76 A;  5I2Q A;  1XK4 A;  3SG4 A;  3I5I C;  5CSI A;  3VRP A;  2BCX A;  1QTX A;  2BL0 C;  1TWO A;  2SCP A;  3CR2 A;  3PSR A;  2BE4 A;  1YUS A;  1H8B A;  1K9P A;  4CID A;  1WRL A;  4FQT A;  2F33 A;  4DUQ A;  2E30 A;  2I94 A;  5K89 A;  1QAS A;  2LP3 A;  3GOF A;  2L2E A;  3O2P A;  5HLV A;  4DIR A;  4CFQ A;  3RZS A;  1JSA A;  3KPX A;  4JPZ B;  2L4H A;  1XVJ A;  3NSI A;  3L4L A;  2CBL A;  1KQM C;  1L7Z A;  2LM5 A;  2KBM A;  2M29 A;  2OPO A;  3NHT A;  1IQ5 A;  3KO0 A;  1EG4 A;  3EK7 A;  2KOT A;  1G33 A;  1QVI Y;  3FS7 A;  2M1U A;  3LL8 B;  5DIC A;  3VRR A;  2KI6 C;  1Q80 A;  2PQL A;  1S6I A;  1FBV A;  1MF8 B;  5CPV A;  1MHO A;  2L0P A;  2ERB A;  3CLN A;  4ORC B;  3PN7 C;  2WC8 A;  2BAP A;  1OZS A;  2LVK A;  4YGB B;  1BOC A;  3I5I B;  2MJW B;  3CZ0 A;  3DZT A;  2JTZ A;  3L47 A;  3WHU B;  5FI6 A;  3DY9 A;  1KK8 C;  2AAO A;  2PSR A;  1BR4 B;  1N2D A;  1R6P A;  1RRO A;  2JT8 A;  2CNP A;  2JZI A;  2M0R A;  4ETO A;  3E3R A;  5I2O A;  1F4Q A;  5F6T A;  2LMU A;  1CM1 A;  4YBH B;  5HLO A;  2K8M B;  5AAN A;  2O60 A;  2JPO A;  2H61 A;  1AJ5 A;  2CCM A;  5AER A;  4JQ0 D;  1OOH A;  4F7F A;  1KQM B;  2BBN A;  1MXL C;  4PDZ A;  2BBM A;  3PAT A;  2F8P A;  3CZ1 A;  3LK1 A;  2FJY A;  2PAL A;  1LA0 A;  4TNC A;  3CR5 X;  3CZ2 A;  2JU0 A;  2KLE A;  2L50 A;  2QEH A;  4GBA A;  2JUL A;  3WNX B;  5ER5 A;  4DRW A;  3DVM A;  4F0Z B;  3I5G C;  1OOG A;  2I7A A;  3PN7 B;  2F3Z A;  1RFJ A;  1KSO A;  2BE6 A;  3QME A;  2M1K B;  1ORG A;  2SAS A;  4XJK A;  2G2B A;  2WCB A;  1PVB A;  1DF0 A;  1UHH A;  1W7I B;  1SNL A;  2KAX A;  1B1G A;  4PHN A;  1CDP A;  1G4Y R;  2F3Y A;  2LUX A;  4YGD B;  5HKW A;  1BG1 A;  2Q4U A;  1JC2 A;  2K0J A;  1OE9 B;  1YX8 A;  1ZFS A;  3EK4 A;  3NSO A;  2JNF A;  4M2Q A;  1S5G Y;  1AUI B;  3OP0 A;  1SL8 A;  4OV2 A;  3D0Y B;  3VGO A;  1UHJ A;  1FPW A;  1GQM A;  1PUL A;  2MA2 A;  4GFT A;  5HL1 A;  4MSP A;  1BF5 A;  1R2U A;  3C1V A;  2GGZ A;  3IQO A;  1V1F A;  4JKT A;  4PT1 A;  1YTZ C;  1IGV A;  1QX7 A;  1FF1 A;  1B7T Z;  2JPT A;  1OMR A;  4JWQ A;  1CFF A;  4MBE A;  1B8C A;  2FOT A;  3DF0 A;  4MVF A;  3BUO B;  1KCY A;  1K93 D;  4YI9 A;  2CT9 A;  3KF9 A;  2ZN9 A;  3O6B A;  4ZCU A;  1S36 A;  1Z4H A;  2KLD A;  3DD4 A;  3OB2 B;  4M2P A;  2LNK A;  1OMV A;  4Q04 A;  3CR4 X;  1BR1 B;  1BOD A;  4OR9 B;  2JXC A;  1J7Q A;  2HQ8 A;  3CAB A;  2BNX A;  3I5F B;  3VRO A;  3DVE A;  3I5H C;  4OKH A;  5CSJ A;  3L4A A;  5G08 A;  5J3X A;  3SIB A;  1QVI Z;  2KQY A;  1NYA A;  2ZFD A;  1M31 A;  2ISD A;  3CTN A;  4I5N B;  3VRN A;  4A4C A;  1QAT A;  2Q91 A;  3JVT C;  1DEK A;  1XO5 A;  3ICB A;  1UHI A;  1CDM A;  3R1O A;  2P6B B;  4PE7 A;  2NXQ A;  3GK1 A;  3UO9 A;  3TDI A;  2EHB A;  1BLQ A;  1NCY A;  3LLE A;  1JUO A;  1RWY A;  2WCJ A;  3S0F A;  3B87 A;  5DKR A;  1KQV A;  4YGA A;  3SG2 A;  4MZK A;  2M49 B;  3TDZ A;  3GK4 X;  4PHK A;  5AFP A;  3R1V A;  1AP4 A;  2LCP A;  1A2X A;  2LMV A;  2KPH A;  3BQ3 A;  1XFZ O;  2LC5 A;  2CXJ A;  1CKK A;  1B8R A;  1LIN A;  2LLU A;  2BKI B;  5IBW A;  2R2I A;  4JD9 A;  1TCO B;  3NGV A;  1MR8 A;  3DXL A;  1KFX S;  2KFG A;  1Y1X A;  2NCO A;  2VRG A;  3I5H B; 
#chains in the Genus database with same CATH homology
 2LVI A;  1K94 A;  4D1E A;  5I8N A;  1C07 A;  4GGN A;  3SJS A;  4HRH A;  1SPY A;  2M7N A;  1SKT A;  4MZL A;  3VRQ A;  1B9A A;  1AK8 A;  3JVT B;  2H61 C;  1TTX A;  1B7T Y;  1QJT A;  4P5O E;  1MQ1 A;  3HCM A;  1J7O A;  1DJX A;  1JFJ A;  1SL7 A;  1B8L A;  1NSH A;  1YVH A;  1JF2 A;  1QIV A;  1SMG A;  3TDU A;  1FI6 A;  1IKU A;  1J1E A;  1YUU A;  4L9M A;  4NDC A;  2JRF A;  1YRT B;  5TNC A;  1M45 A;  2KFH A;  1QLS A;  5BPJ A;  1SCM C;  1CTR A;  1U5I A;  2Y1M A;  1SY9 A;  2QAC A;  1CLM A;  1NX2 A;  4I5J A;  1SCV A;  4WQ2 A;  1SK6 D;  1EG3 A;  1S5G Z;  3AKA A;  3H4S E;  2FCE A;  5I2L A;  1KFU L;  1OZO A;  1XFX O;  2K61 A;  3A4U B;  3JTD B;  4AQJ A;  3BYA A;  2M7L A;  2IS9 A;  4YGE B;  1UHN A;  1WDC C;  1NWD A;  1Y6W A;  1NUB A;  1XYD A;  4XYN A;  3NXA A;  2BL0 B;  5CSF A;  4MN0 A;  2LLT A;  3SG3 A;  2LAP A;  2HQW A;  1PSR A;  2KYC A;  3TUY C;  2KBI A;  2KQ6 A;  3LCP C;  2NCP A;  1ZAC A;  4GAO A;  1DGU A;  4QJ4 B;  2Y1N A;  3KEV A;  1LA3 A;  3OX5 A;  1ZOT B;  1LVC D;  1DJG A;  3EVV A;  5PAL A;  2K7D A;  2LMT A;  1PSB A;  2MHH A;  3BUX B;  2M8U A;  4GGF C;  4XJK B;  3F45 A;  1ZUZ A;  2PMY A;  3KHE A;  2LE9 B;  1DF0 B;  2AMI A;  5D69 A;  4CLN A;  1NX0 A;  4PCW A;  1S3P A;  1M39 A;  4A4B A;  1KWO C;  2KNE A;  4FTG A;  1WDC B;  2DOQ A;  5HKZ A;  1VRK A;  4MLW A;  2WCF A;  1KK8 B;  4AQI A;  1ZMZ A;  3A8R A;  4ZCV A;  1LKJ A;  3BUW B;  2LLS A;  4I5L B;  4PE0 A;  3RLZ A;  2G9B A;  1DJY A;  2AUC A;  1DTL A;  2M9G A;  2K2F A;  3FWC A;  1OSA A;  1EH2 A;  2LHL A;  2QPT A;  2WCE A;  2JXL A;  1B47 A;  2K2A A;  2B1U A;  1S1E A;  4BY4 A;  1QX2 A;  1SRA A;  1TNX A;  2PAS A;  4DS7 A;  3NSL A;  5DKN A;  4OCI A;  1QS7 A;  2BCB A;  1M63 B;  2K7B A;  4R1E A;  3DF0 B;  4HSZ A;  1UUR A;  2K7C A;  4QJ5 B;  3IF7 A;  1K95 A;  2K7O A;  3AAK A;  3I5G B;  4MRX A;  3WXA A;  1V1G A;  3PAL A;  2OTG C;  1K8U A;  4GGF A;  4PHM A;  1A4P A;  1DJI A;  1EL4 A;  1Y0V H;  1QV0 A;  4N1F A;  1IH0 A;  2FCD A;  4MEW A;  4CPV A;  3TS5 C;  4MZJ A;  1CDL A;  2HET A;  1SW8 A;  1WRK A;  3TZ1 A;  1BT6 A;  4YGC B;  2V53 A;  2M97 A;  2Y5I A;  1DMO A;  1N0Y A;  1EJ3 A;  1LXF C;  1W7J B;  1GGZ A;  5KTY A;  2WOS A;  1K90 D;  2PVB A;  1UHK A;  1KFX L;  1IG5 A;  1RJV A;  1YX7 A;  3BXK A;  1CMF A;  1YRU B;  1DJW A;  1PK0 D;  4ORA B;  1CFD A;  1NX3 A;  1SYM A;  1DJH A;  2KSP A;  4QJ3 B;  3NSK A;  5AXI A;  1CB1 A;  1TNW A;  2EGD A;  1G8I A;  1M46 A;  1WLM A;  2EC6 C;  1K9K A;  1NCZ A;  5FYX A;  4YI8 A;  2H2K A;  2OTG B;  1S6J A;  2HPS A;  3CWG A;  1D1O A;  1PVA A;  1QLK A;  1MXE A;  1IRJ A;  1FW4 A;  3IQQ A;  3CS1 A;  1YUR A;  1J1D A;  3CZT X;  2ZN8 A;  2KGR A;  1K2H A;  1F70 A;  4BY5 A;  1OQP A;  1CDN A;  1XA5 A;  2ZND A;  4DCK A;  1NIW A;  1B4C A;  1XFY O;  4NQG A;  1IWQ A;  3O4Y A;  4IL1 A;  4YRU A;  1CLL A;  1E8A A;  2F2P A;  1N65 A;  2RGI A;  1Y1A A;  1TCF A;  5DKQ A;  1CFP A;  1U5I B;  3OX6 A;  2KI4 C;  2KI6 D;  4NDB A;  1DT7 B;  1XFU O;  3SG5 A;  2L4I A;  1SL9 A;  4FQO A;  4MRY A;  1JF0 A;  2LVJ A;  1PRW A;  5KU1 A;  3WHT B;  1ALV A;  2GGM A;  1OMD A;  3EVR A;  4PAL A;  1DGV A;  2FJU B;  1GJY A;  2OS8 C;  1WLZ A;  2F2O A;  2JTT A;  2I2R E;  4PE4 A;  3AKB A;  1QV1 A;  2BKH B;  1F4O A;  1MUX A;  2KHN A;  4CFR A;  1OOJ A;  2KDH A;  1AJ4 A;  1AVS A;  3FWB A;  1HT9 A;  1QXP A;  3BUM B;  1A29 A;  1L2O C;  2KI4 B;  2PRU A;  1YVL A;  4HRG A;  1YR5 A;  2ZNE A;  4U8D A;  4OVN F;  1K9U A;  4NDD A;  1WRZ A;  1SCM B;  1RK9 A;  1S26 D;  3PFV A;  4PHJ A;  1ODB A;  1REC A;  1ALW A;  1DJZ A;  1XFW O;  2MRD A;  4USL A;  1F54 A;  1FI5 A;  1RTP 1;  1UWO A;  2ZRT A;  2MLE C;  3EKJ A;  1DVI A;  3SG6 A;  1HQV A;  2OS8 B;  1QX5 B;  1KK7 Y;  4N1G A;  5D7F A;  4UPG A;  5ER4 X;  3RM1 A;  5HYD A;  2JOJ A;  3OHM B;  3K21 A;  4C0L A;  5JJG A;  2LUC A;  3QRX A;  1UUS A;  1TN4 A;  1KFU S;  1UP5 A;  1A03 A;  1K96 A;  2O5G A;  3TUY B;  1F55 A;  1CNP A;  3ZNI A;  1L2O B;  1IJ5 A;  1A75 B;  1NPQ A;  1SR6 C;  2HF5 A;  4GPL B;  2L98 A;  1CM4 A;  3MSE B;  2LHI A;  2E6W A;  2WND A;  2JT3 A;  4WQ3 A;  3EK8 A;  4N5X A;  1PAL A;  4E68 A;  1A75 A;  2JQ6 A;  4I5K A;  2JWW A;  2GV5 A;  1NP8 A;  2NZ0 A;  5CSN A;  1JBA A;  1KWO B;  4HRE E;  1YUT A;  1MWN A;  3SIA A;  1WY9 A;  3EKH A;  3HX4 A;  1F71 A;  1TIZ A;  3I5F C;  4PE1 A;  1QIW A;  3AAJ A;  1BMO A;  1CFC A;  2JC2 A;  4GUK A;  5GQQ C;  2LAN A;  4GNK B;  4ICB A;  2MAZ A;  1SBJ A;  5B8I B;  2WOR A;  3BOW B;  3DVJ A;  1KSM A;  1H4B A;  1SR6 B;  3SG7 A;  3PLF B;  3D0Y A;  2MBX A;  1BU3 A;  2TN4 A;  1JFK A;  2L51 A;  3BOW A;  1AHR A;  2KAY A;  3D10 A;  2KAV A;  2KGB C;  2LV7 A;  2JNX A;  1EXR A;  1BJF A;  1TNQ A;  1XK4 C;  1CLB A;  4AOM A;  2D8N A;  2A4J A;  3CGA A;  2MLF C;  1JWD A;  2NLN A;  4P2Y B;  1X02 A;  5AEQ A;  2CTN A;  3TS5 B;  2LVV A;  2ZRS A;  3ZWH A;  3EVU A;  1J7R A;  1C7V A;  1J7P A;  3DVK A;  5HKY A;  3BUN B;  3GK2 A;  1S6C A;  1IJ6 A;  1NX1 A;  1F8H A;  1TNP A;  2M3W A;  1NCX A;  1Y1U A;  2KFF A;  3O78 A;  1IQ3 A;  2JT0 A;  3FIA A;  1GGW A;  2I18 A;  1CMG A;  1C7W A;  4C0K A;  2COL B;  2L5X B;  1KK7 Z;  2BCA A;  4ORB B;  3PM8 A;  2Y4Q A;  2LP2 A;  4C0J A;  1TRF A;  3OB1 B;  2KYF A;  2EC6 B;  3LK0 A;  3M0W A;  5JOL A;  1TOP A;  2ZKM X;  3JTD C;  4WRI A;  1XFV O;  4M2O A;  5KSZ A;  1J55 A;  2BEC A;  5I2Q A;  1XK4 A;  3SG4 A;  3I5I C;  5CSI A;  3VRP A;  2BCX A;  1QTX A;  2BL0 C;  2SCP A;  3CR2 A;  3PSR A;  2BE4 A;  1YUS A;  1H8B A;  1K9P A;  4CID A;  1WRL A;  2F33 A;  4DUQ A;  2E30 A;  2I94 A;  5K89 A;  1QAS A;  2LP3 A;  3GOF A;  2L2E A;  3O2P A;  5HLV A;  4DIR A;  4CFQ A;  1JSA A;  3KPX A;  4JPZ B;  2L4H A;  1XVJ A;  3NSI A;  2CBL A;  1KQM C;  1L7Z A;  2LM5 A;  2KBM A;  2M29 A;  2OPO A;  1IQ5 A;  3KO0 A;  1EG4 A;  3EK7 A;  2KOT A;  1G33 A;  1QVI Y;  3FS7 A;  2M1U A;  3LL8 B;  3VRR A;  2KI6 C;  1Q80 A;  5CPV A;  1S6I A;  1FBV A;  1MF8 B;  1MHO A;  2L0P A;  3CLN A;  4ORC B;  3PN7 C;  2WC8 A;  1OZS A;  2LVK A;  4YGB B;  1BOC A;  3I5I B;  2MJW B;  2JTZ A;  3WHU B;  1KK8 C;  2AAO A;  2PSR A;  1BR4 B;  1N2D A;  1R6P A;  1RRO A;  2JT8 A;  2CNP A;  2JZI A;  2M0R A;  4ETO A;  3E3R A;  5I2O A;  1F4Q A;  5F6T A;  2LMU A;  1CM1 A;  4YBH B;  5HLO A;  2K8M B;  5AAN A;  2O60 A;  2H61 A;  1AJ5 A;  2CCM A;  5AER A;  4JQ0 D;  1KQM B;  2BBN A;  1MXL C;  4PDZ A;  2BBM A;  3PAT A;  2F8P A;  3LK1 A;  2PAL A;  1LA0 A;  4TNC A;  3CR5 X;  3WNX B;  2JU0 A;  2L50 A;  4GBA A;  4DRW A;  4F0Z B;  2JUL A;  5ER5 A;  3DVM A;  3I5G C;  2I7A A;  3PN7 B;  2F3Z A;  1RFJ A;  1KSO A;  2BE6 A;  2M1K B;  2SAS A;  4XJK A;  2G2B A;  2WCB A;  1PVB A;  1DF0 A;  1UHH A;  1W7I B;  1SNL A;  2KAX A;  1B1G A;  4PHN A;  1CDP A;  1G4Y R;  2F3Y A;  2LUX A;  4YGD B;  5HKW A;  1BG1 A;  2Q4U A;  1JC2 A;  2K0J A;  1OE9 B;  1YX8 A;  1ZFS A;  3EK4 A;  3NSO A;  2JNF A;  4M2Q A;  1S5G Y;  1AUI B;  3OP0 A;  1SL8 A;  4OV2 A;  3D0Y B;  3VGO A;  1UHJ A;  1FPW A;  1GQM A;  1PUL A;  2MA2 A;  4GFT A;  4MSP A;  1BF5 A;  1R2U A;  3C1V A;  2GGZ A;  3IQO A;  1V1F A;  1YTZ C;  1IGV A;  1QX7 A;  1FF1 A;  1B7T Z;  2JPT A;  1OMR A;  4JWQ A;  1CFF A;  4MBE A;  1B8C A;  2FOT A;  3DF0 A;  4MVF A;  3BUO B;  1KCY A;  1K93 D;  4YI9 A;  2CT9 A;  3KF9 A;  2ZN9 A;  3O6B A;  4ZCU A;  1S36 A;  3DD4 A;  3OB2 B;  4M2P A;  2LNK A;  1OMV A;  4Q04 A;  3CR4 X;  1BR1 B;  1BOD A;  4OR9 B;  2JXC A;  1J7Q A;  2HQ8 A;  3VRO A;  3I5F B;  3DVE A;  3I5H C;  4OKH A;  5CSJ A;  5J3X A;  5G08 A;  3SIB A;  1QVI Z;  2KQY A;  1NYA A;  2ZFD A;  1M31 A;  2ISD A;  3CTN A;  4I5N B;  3VRN A;  4A4C A;  1QAT A;  2Q91 A;  3JVT C;  1XO5 A;  3ICB A;  1UHI A;  1CDM A;  2P6B B;  4PE7 A;  2NXQ A;  3GK1 A;  3TDI A;  2EHB A;  1BLQ A;  1NCY A;  3LLE A;  1JUO A;  1RWY A;  5DKR A;  1KQV A;  4YGA A;  3SG2 A;  4MZK A;  2M49 B;  3TDZ A;  3GK4 X;  4PHK A;  5AFP A;  1AP4 A;  2LCP A;  1A2X A;  2LMV A;  3BQ3 A;  1XFZ O;  2LC5 A;  2CXJ A;  1CKK A;  1B8R A;  1LIN A;  2LLU A;  2BKI B;  5IBW A;  2R2I A;  1TCO B;  1MR8 A;  1KFX S;  2KFG A;  1Y1X A;  2NCO A;  2VRG A;  3I5H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...