3TS5B

Crystal structure of a light chain domain of scallop smooth muscle myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
ARLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
total genus 45
structure length 142
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B01
2K0JA 4CPVA 4F0ZB 2EC6B 1M45A 1J7QA 1QX7A 4AQJA 4UPGA 2NLNA 3EK4A 3CWGA 2JXCA 3I5HB 4M2PA 3KEVA 5DKNA 2SASA 1TN4A 3VROA 1QXPA 1XVJA 1N0YA 1K9UA 1MR8A 1WRLA 2JNXA 2PVBA 2CT9A 4D1EA 1JWDA 3VGOA 1G8IA 2JNFA 2JQ6A 3QRXA 2CXJA 4A4BA 1UHHA 1Y0VH 3SG7A 2LUCA 1XK4A 1NCZA 2GV5A 5D7FA 2KQYA 2BBMA 4MZKA 3EK7A 2ZNDA 2M7LA 5D69A 3EVVA 1S36A 1QVIY 2JT0A 2LVJA 1SL9A 1K94A 4R1EA 2O5GA 1QATA 1OSAA 3CR4X 1RK9A 2PRUA 4TNCA 2FCEA 3A4UB 2NCOA 1N2DA 3GK1A 1IRJA 1X02A 3AAKA 3EVRA 1IH0A 2LNKA 1IQ5A 2H61C 3I5GC 2BCXA 4ORBB 3C1VA 1Y1AA 2GGMA 2M3WA 3FWBA 1BF5A 3OB2B 4DCKA 1B8CA 1S3PA 2WOSA 1OMRA 3TDUA 5DKQA 1KFUL 1CMFA 2KGBC 1BMOA 1RECA 3EVUA 1NCYA 3JTDB 4L9MA 3IF7A 2KOTA 1JF0A 3SG4A 1AHRA 4YI8A 1XFUO 2F33A 5CSNA 1SKTA 2ZKMX 1EH2A 3CS1A 1KWOB 2BL0B 2M1UA 4PHNA 3D0YA 2WC8A 1L7ZA 4GGFA 3DVKA 3GK4X 4PCWA 1OZOA 3CTNA 3SG2A 1F54A 1B7TZ 2SCPA 2JOJA 1UUSA 3PATA 3BUMB 1B47A 2WORA 1BU3A 3O2PA 3TS5C 4I5KA 2HQ8A 5HKWA 1TIZA 1QS7A 2KBMA 1JC2A 3E3RA 4QJ4B 1UP5A 3NSKA 4WQ2A 5FYXA 2WCEA 1IKUA 2L2EA 2LUXA 1CDNA 2H61A 1W7IB 2Y4QA 1AP4A 2MJWB 2ZN9A 5HYDA 1GQMA 1KK8B 1TOPA 2LANA 2A4JA 2BBNA 1QIWA 2Y5IA 2LHLA 2KBIA 2JU0A 4U8DA 3EKJA 4WQ3A 1OQPA 5HKYA 1NUBA 3A8RA 4PHJA 3KO0A 4YGCB 2BCBA 1SRAA 3O6BA 1IG5A 2LP2A 2H2KA 1FI5A 1LVCD 2EC6C 3PSRA 5AERA 3TUYB 1GGWA 1ZACA 3I5HC 2KFFA 1FI6A 1WRZA 3BOWB 4PE0A 1U5IA 3VRRA 4ZCVA 1J7OA 4MRXA 2JULA 3LLEA 4GBAA 3GK2A 4YGAA 1IJ5A 1JFKA 1B9AA 1RROA 1S5GZ 1SNLA 1XFVO 1XK4C 3BOWA 2F2PA 2PASA 5CSIA 1DTLA 1UHJA 1BJFA 1CLLA 1RTP1 1KFUS 2JTZA 4USLA 2K2AA 1R6PA 5AEQA 3HX4A 5CSJA 2ISDA 1IGVA 4MN0A 4N1GA 2L4IA 1OMVA 1S1EA 5I2OA 3OX5A 1A4PA 1SW8A 2FCDA 2EHBA 3RM1A 5HLOA 1F71A 2PALA 2MHHA 1NPQA 2E30A 3CR5X 1JBAA 1ZUZA 3DVJA 2JTTA 3OB1B 2KYFA 2I18A 2MA2A 1MHOA 5G08A 2I2RE 1OZSA 1HQVA 3BQ3A 3NSOA 1SL7A 5TNCA 1PULA 1SMGA 2HF5A 1UHNA 4CFRA 1CMGA 2JT8A 1EG4A 2F8PA 2MAZA 3AAJA 3JTDC 1TNWA 4ORCB 1YUSA 2LLSA 4ORAB 4C0JA 1ALVA 4GGFC 1A03A 1YTZC 4CLNA 1KWOC 2BL0C 1N65A 3SIBA 1F8HA 2IS9A 3I5FC 5K89A 1AUIB 4MZJA 1GJYA 1Y6WA 2I7AA 2KDHA 2QACA 4YGDB 4C0LA 1BOCA 4XYNA 2R2IA 1AVSA 1MWNA 1ZMZA 3BUNB 1S6CA 2ZRTA 5JJGA 2JRFA 1S6IA 1JFJA 4HRGA 1QX2A 5KSZA 4XJKB 5PALA 3SG3A 3WHUB 1OOJA 4YGEB 1UHKA 1NIWA 4P5OE 3D10A 1J55A 5AFPA 4N5XA 1SPYA 4IL1A 2K8MB 1QX5B 4GAOA 4YRUA 1J7PA 1PK0D 1J1EA 1YX7A 1KK8C 1NX1A 1WDCB 1E8AA 3MSEB 1VRKA 1SK6D 1FW4A 2JXLA 4ZCUA 3SG6A 1PRWA 5ER4X 1CFFA 1F4OA 2LCPA 3NXAA 4I5JA 2L4HA 2HETA 3NSIA 4ETOA 5B8IB 1NSHA 3PLFB 1NCXA 1QVIZ 1V1FA 1EJ3A 1TNXA 3F45A 1CTRA 2LVKA 2WNDA 4CFQA 2MRDA 3TUYC 1TRFA 3LK0A 4OKHA 2KI6C 1MQ1A 1K90D 1DJGA 1SBJA 2LC5A 2PMYA 3DD4A 5I2LA 1EXRA 1XYDA 1KSOA 1OE9B 2G2BA 2LV7A 4GGNA 4P2YB 2HPSA 3RLZA 1CLBA 4DRWA 1DVIA 1BR1B 1PSBA 3O4YA 2WCBA 1S26D 1C7WA 4FTGA 4QJ3B 2M0RA 2LLUA 3ZNIA 1CDMA 2KFHA 2KFGA 1XFZO 2CTNA 1MUXA 4ICBA 3WNXB 2NXQA 2ZN8A 3OHMB 1DGUA 4M2OA 1IJ6A 1UURA 2BECA 1YRTB 4E68A 1CM1A 1YUUA 2F3YA 3BXKA 2VRGA 1DJWA 1BLQA 2JT3A 2NZ0A 1CFPA 2L50A 2KAXA 1UWOA 1XA5A 3BUWB 4M2QA 1EG3A 2HQWA 5HLVA 1C7VA 3CGAA 3VRNA 4I5LB 2TN4A 2AUCA 3O78A 2RGIA 4HRHA 1NX0A 2L51A 1DGVA 1WLZA 1EL4A 2KAYA 2V53A 1BG1A 1GGZA 3CZTX 2Y1NA 1YVLA 2EGDA 5KTYA 5BPJA 4MLWA 1SCMB 1M39A 2I94A 2KHNA 4BY4A 1SR6B 1B4CA 5KU1A 1CDPA 1CFDA 1QASA 2D8NA 1IWQA 3JVTB 3KF9A 2MBXA 2OPOA 1QJTA 3TS5B 1PVBA 2Y1MA 1QTXA 4PDZA 5HKZA 4YI9A 2M97A 1Q80A 1LINA 1K93D 2M1KB 1LA3A 4MBEA 2Q4UA 3H4SE 2ZFDA 3WHTB 3NSLA 2K7DA 2OTGB 2OS8B 2BE4A 1B8RA 1H4BA 1YR5A 4PHKA 1RWYA 1TCOB 4MSPA 3LCPC 1TCFA 2BE6A 1AK8A 5ER5A 2M8UA 1M63B 2ZRSA 5JOLA 1D1OA 1DF0B 1KK7Z 4OR9B 2M7NA 1Y1XA 1FBVA 2LLTA 4JPZB 4DIRA 4MVFA 4NQGA 1BR4B 2LM5A 3ICBA 1DF0A 1M31A 1WDCC 1KFXL 1ODBA 3PM8A 4I5NB 1AJ4A 2LMUA 1CLMA 1YUTA 1J7RA 1F55A 1G4YR 3I5IB 3KPXA 1KSMA 2LP3A 2JC2A 4FQOA 4PE4A 1CFCA 1LXFC 1DJHA 4N1FA 3LK1A 1F4QA 2KYCA 1CB1A 1NP8A 3AKAA 2KI4B 2O60A 2L5XB 1SCVA 2Q91A 4MRYA 2WCFA 1DJXA 2F2OA 1YURA 3EKHA 3K21A 3PN7B 3OP0A 1CDLA 1SL8A 1Y1UA 3WXAA 1K95A 2KAVA 1KQMB 2B1UA 3FWCA 1RFJA 2MLEC 4MEWA 3DF0B 2JWWA 4XJKA 1FPWA 2K2FA 1L2OB 1JUOA 3DF0A 1TNPA 1QLKA 2KNEA 2KGRA 3IQQA 1B7TY 1B1GA 1PVAA 1LA0A 3BUOB 1KQVA 1R2UA 4JWQA 3TDZA 1IQ3A 1TNQA 2KSPA 2L0PA 3BUXB 3M0WA 1K96A 2COLB 1A29A 3EK8A 3SG5A 5I2QA 1F70A 3DVMA 4YGBB 2K7BA 4A4CA 2P6BB 4JQ0D 1WRKA 1MF8B 1QIVA 2ZNEA 2CCMA 1XO5A 2DOQA 1QLSA 2K7OA 1DJIA 1K9KA 3DVEA 2BCAA 3CR2A 4OV2A 2L98A 2FJUB 3IQOA 1G33A 2MLFC 3D0YB 4OVNF 4OCIA 2BKIB 1DJZA 1H8BA 2BKHB 3I5FB 4AOMA 1QV0A 1HT9A 1SCMC 1NX2A 1RJVA 3PALA 2M9GA 3CLNA 1FF1A 1SR6C 2QPTA 1KFXS 1XFWO 2E6WA 4GFTA 3JVTC 2LAPA 1B8LA 1XFXO 1DMOA 3SJSA 1WLMA 3FS7A 1JF2A 1DJYA 4PALA 5AANA 5AXIA 1CM4A 3VRPA 1DT7B 1QV1A 1W7JB 2K61A 2KQ6A 3BYAA 3I5GB 2AMIA 4GUKA 4NDDA 2M49B 2K7CA 5CPVA 1YVHA 1ZOTB 3FIAA 1ALWA 1YX8A 2OTGC 2LE9B 2OS8C 1LKJA 5CSFA 3VRQA 1S5GY 5DKRA 2CNPA 3SIAA 4WRIA 3AKBA 3ZWHA 1CNPA 1OMDA 2LVIA 4BY5A 2JPTA 4YBHB 1S6JA 1JSAA 5I8NA 1ZFSA 3LL8B 2FOTA 3PFVA 4HREE 1MXEA 1BODA 1MXLC 1SY9A 4NDBA 4MZLA 2NCPA 1NX3A 1M46A 5F6TA 2CBLA 4QJ5B 2AAOA 1KCYA 4CIDA 2KI6D 1U5IB 1PALA 1UHIA 2G9BA 2PSRA 3I5IC 2LMVA 1C07A 3OX6A 3KHEA 4GPLB 1XFYO 1BT6A 1A2XA 2KI4C 2GGZA 4AQIA 4NDCA 1K9PA 1AJ5A 2LHIA 1KK7Y 3PN7C 5J3XA 3TDIA 2LMTA 1J1DA 1NWDA 2LVVA 4GNKB 1TTXA 5IBWA 3HCMA 1YRUB 1KQMC 4Q04A 1A75B 1K8UA 1V1GA 1PSRA 4C0KA 1CKKA 1K2HA 5GQQC 1SYMA 1WY9A 1L2OC 3TZ1A 4PHMA 1A75A 2M29A 4HSZA 2F3ZA 4DS7A 4PE1A 1NYAA 4DUQA 3GOFA 2JZIA 4PE7A
chains in the Genus database with same CATH superfamily
2K0JA 4CPVA 4F0ZB 2ERBA 2EC6B 1M45A 1T14A 2QEOA 4IJ7A 1J7QA 1QX7A 4AQJA 4UPGA 2NLNA 3EK4A 3CWGA 2JXCA 3I5HB 4M2PA 3D73A 3KEVA 5DKNA 2SASA 1TN4A 3VROA 1QXPA 1XVJA 1N0YA 1K9UA 1MR8A 1WRLA 2JNXA 2PVBA 1SSEB 1Z2CB 2CT9A 2PQLA 3UO9A 4D1EA 1JWDA 3VGOA 1G8IA 2JNFA 2JQ6A 2P71A 3QRXA 2CXJA 4A4BA 1UHHA 1Y0VH 3SG7A 2LUCA 1XK4A 1NCZA 2GV5A 5D7FA 2KQYA 2BBMA 4MZKA 3EK7A 2ZNDA 2M7LA 5D69A 1Z4HA 3EVVA 3SS4A 1S36A 1QVIY 2JT0A 2LVJA 1SL9A 1K94A 4R1EA 2O5GA 1QATA 1OSAA 3CR4X 1RK9A 2PRUA 4TNCA 2FCEA 2QEHA 3A4UB 2NCOA 1N2DA 3GK1A 1IRJA 1X02A 3AAKA 3EVRA 1IH0A 2LNKA 1IQ5A 2H61C 3I5GC 2H8VA 3R1OA 2BCXA 4ORBB 3C1VA 1Y1AA 2GGMA 2M3WA 3FWBA 1BF5A 3FE8A 3OB2B 4DCKA 1B8CA 1S3PA 2WOSA 1OMRA 3TDUA 5DKQA 1KFUL 1CMFA 2KGBC 1BMOA 1RECA 3EVUA 1NCYA 2FJYA 3JTDB 3IF7A 4L9MA 2KOTA 3B86A 3SS5A 1JF0A 3SG4A 1AHRA 3R72A 4YI8A 1XFUO 5FI2A 2F33A 5CSNA 1SKTA 2ZKMX 3CYZA 3PM2A 3CS1A 1KWOB 2BL0B 2M1UA 1EH2A 4PHNA 3D0YA 2WC8A 1L7ZA 4GGFA 3DVKA 3GK4X 4PCWA 1OZOA 3CTNA 3SG2A 1F54A 1B7TZ 2SCPA 2JOJA 1UUSA 3PATA 3BUMB 1B47A 2WORA 1BU3A 1IIOA 3O2PA 3TS5C 4I5KA 2HQ8A 5HKWA 1TIZA 1QS7A 3QMEA 2KBMA 1JC2A 3E3RA 4QJ4B 1UP5A 3NSKA 4WQ2A 5FYXA 2WCEA 1IKUA 2L2EA 2LUXA 3N7HA 1CDNA 2H61A 2YGUA 1W7IB 2Y4QA 1AP4A 3D74A 2MJWB 2ZN9A 5HYDA 1GQMA 1KK8B 1TOPA 2LANA 2A4JA 2BBNA 1QIWA 2Y5IA 2LHLA 2KBIA 4INWA 2JU0A 4U8DA 3EKJA 3O4XA 1W9ZA 4WQ3A 1OQPA 3RZSA 5HKYA 1NUBA 3SS3A 3A8RA 4JD9A 3PJIA 4PHJA 3KO0A 4KYNA 4YGCB 2BCBA 1SRAA 3O6BA 1IG5A 3NGVA 2LP2A 2H2KA 1FI5A 3DZTA 1LVCD 2EC6C 3PSRA 3CZ2A 5AERA 3TUYB 1GGWA 1ZACA 3I5HC 2KFFA 1FI6A 2QDIA 1WRZA 3BOWB 4PE0A 1U5IA 3VRRA 4ZCVA 1J7OA 4MRXA 2JULA 3LLEA 1OOIX 3GK2A 4GBAA 4YGAA 1IJ5A 1JFKA 1B9AA 1RROA 1S5GZ 1SNLA 1XFVO 1XK4C 3BOWA 2F2PA 2PASA 5CSIA 1DTLA 1UHJA 1BJFA 1CLLA 1RTP1 1KFUS 2JTZA 4USLA 3S0BA 2K2AA 1R6PA 5AEQA 3HX4A 5CSJA 2ISDA 1IGVA 4MN0A 4N1GA 2L4IA 3B87A 1OMVA 1S1EA 2P70A 5I2OA 3OX5A 3BFHA 1A4PA 1SW8A 2FCDA 2EHBA 3RM1A 5HLOA 1F71A 2PALA 2MHHA 1NPQA 2E30A 3CR5X 1JBAA 1ZUZA 3DVJA 2JTTA 3OB1B 2KYFA 2I18A 2MA2A 1MHOA 5G08A 2I2RE 1OZSA 1HQVA 3BQ3A 3CABA 3NSOA 1SL7A 2JPOA 5TNCA 1PULA 1SMGA 2HF5A 1UHNA 4CFRA 1CMGA 3L4LA 2JT8A 1EG4A 2F8PA 2MAZA 3AAJA 3D78A 3JTDC 1TNWA 4ORCB 1YUSA 2LLSA 2PYQA 4ORAB 4C0JA 1ALVA 4GGFC 1OOFA 1A03A 1YTZC 4CLNA 1KWOC 2BL0C 1N65A 3SIBA 1F8HA 2IS9A 3I5FC 5K89A 1AUIB 4MZJA 1GJYA 1Y6WA 2I7AA 2KDHA 2QACA 4YGDB 4C0LA 1BOCA 4XYNA 2R2IA 1AVSA 1MWNA 1ZMZA 3BUNB 1S6CA 2ZRTA 5JJGA 2JRFA 2L2CA 1S6IA 3EG5B 1JFJA 4HRGA 1QX2A 5KSZA 4XJKB 5PALA 3CZ1A 3SG3A 3WHUB 1OOJA 4YGEB 1UHKA 1NIWA 4P5OE 3D10A 1J55A 5AFPA 4N5XA 1SPYA 4IL1A 2K8MB 1QX5B 4GAOA 4YRUA 1J7PA 3DY9A 3DYEA 1PK0D 3R1VA 1J1EA 1YX7A 3D76A 1KK8C 4FQTA 1NX1A 1OW4A 1WDCB 1E8AA 3MSEB 1VRKA 1SK6D 1FW4A 2JXLA 4ZCUA 3SG6A 1PRWA 2GTEA 5ER4X 1CFFA 1F4OA 2LCPA 3NXAA 3OGNA 2L4HA 4I5JA 1DEKA 2HETA 3NSIA 4ETOA 5B8IB 1NSHA 3CDNA 2WCMA 3PLFB 1NCXA 1QVIZ 1V1FA 1EJ3A 1TNXA 3F45A 1CTRA 2LVKA 2WNDA 4CFQA 2MRDA 3TUYC 1TRFA 3LK0A 4OKHA 2KI6C 1MQ1A 1K90D 2K60A 1DJGA 1SBJA 2LC5A 2PMYA 3DD4A 3R1PA 1EXRA 5I2LA 1XYDA 1KSOA 1OE9B 2G2BA 2LV7A 4GGNA 4P2YB 3NHTA 2HPSA 3RLZA 1CLBA 4DRWA 1DVIA 1BR1B 1GM0A 1PSBA 3O4YA 2WCBA 1S26D 1C7WA 4FTGA 4QJ3B 2M0RA 1OOHA 2LLUA 3ZNIA 1CDMA 2KFHA 3OBVA 2KFGA 1XFZO 2CTNA 1MUXA 4ICBA 3WNXB 2NXQA 2ZN8A 3OHMB 1DGUA 4M2OA 1IJ6A 1UURA 2BECA 1YRTB 4E68A 1CM1A 1YUUA 2F3YA 3B6XA 3BXKA 2VRGA 1DJWA 1BLQA 2JT3A 2NZ0A 1CFPA 2L50A 2KAXA 1UWOA 1XA5A 3BUWB 4M2QA 1EG3A 2HQWA 5HLVA 1C7VA 3CGAA 3VRNA 3D75A 4I5LB 2TN4A 2BNXA 2QEVA 2AUCA 3O78A 2RGIA 4HRHA 1NX0A 2L51A 1DGVA 1WLZA 1EL4A 2KAYA 2V53A 1BG1A 1GGZA 1TUJA 3K1EA 3CZTX 2Y1NA 1YVLA 2EGDA 5KTYA 5FI7A 5BPJA 4MLWA 1SCMB 1M39A 1TWOA 2I94A 2KHNA 4BY4A 1SR6B 1B4CA 5KU1A 1CDPA 1CFDA 1QASA 2D8NA 1IWQA 3JVTB 3KF9A 2MBXA 2OPOA 1QJTA 3TS5B 1PVBA 2WC5A 2Y1MA 1QTXA 4PDZA 5HKZA 4YI9A 2M97A 1Q80A 1LINA 1K93D 2M1KB 1LA3A 4MBEA 2Q4UA 3H4SE 2ZFDA 3WHTB 3NSLA 2K7DA 2OTGB 2OS8B 3IVTA 2BE4A 1B8RA 1H4BA 1YR5A 4PHKA 1ORGA 1RWYA 1TCOB 1DQEA 3LCPC 1TCFA 4MSPA 3FE9A 2BE6A 1AK8A 5ER5A 2KLEA 1M63B 2M8UA 2ZRSA 2WCHA 5JOLA 1D1OA 1DF0B 1KK7Z 4OR9B 2M7NA 1Y1XA 1FBVA 2LLTA 2WCLA 4JPZB 4DIRA 4MVFA 4NQGA 1BR4B 2LM5A 3S0FA 3BJHA 5HL1A 3BFBA 3ICBA 1DF0A 1M31A 1WDCC 1KFXL 1ODBA 3PM8A 4I5NB 1AJ4A 2LMUA 1CLMA 1YUTA 1J7RA 1F55A 1G4YR 3I5IB 3KPXA 3S0GA 1KSMA 2LP3A 2JC2A 3B7AA 4FQOA 4PE4A 1LXFC 1DJHA 5DICA 1CFCA 4N1FA 3LK1A 1F4QA 2KYCA 1CB1A 1NP8A 3AKAA 3NHIA 2KI4B 2O60A 2L5XB 1SCVA 2Q91A 4MRYA 2WCFA 3UNWA 1DJXA 2F2OA 4INXA 1YURA 2QEBA 3EKHA 3K21A 3PN7B 3Q8IA 3OP0A 1CDLA 1SL8A 1Y1UA 3WXAA 1K95A 2KAVA 3VB1A 1KQMB 2B1UA 3FWCA 1RFJA 1TUZA 2MLEC 4MEWA 3DF0B 1P28A 1C3YA 2JWWA 4XJKA 1FPWA 2K2FA 1L2OB 5EL2A 1JUOA 3DF0A 1TNPA 1QLKA 2KNEA 2KGRA 3IQQA 5I94A 1B7TY 1B1GA 1PVAA 1LA0A 3BUOB 1KQVA 1R2UA 4JWQA 3TDZA 3S0DA 1IQ3A 1TNQA 2KSPA 2L0PA 3BFAA 3BUXB 3M0WA 2KLDA 1K96A 2COLB 1A29A 3EK8A 3SG5A 5I2QA 1F70A 3DVMA 4YGBB 2K7BA 4A4CA 2P6BB 5D3OA 4JQ0D 2WCKA 1WRKA 1MF8B 1DELA 1QIVA 2ZNEA 2CCMA 1XO5A 2DOQA 1QLSA 2K7OA 1DJIA 1K9KA 3DVEA 2BCAA 3CR2A 4OV2A 2L98A 1LS8A 2FJUB 1G33A 2MLFC 3IQOA 2L5YA 3D0YB 4OVNF 5FI6A 4OCIA 2BKIB 1DJZA 3L4AA 3L47A 1H8BA 2WC6A 2BKHB 3I5FB 4AOMA 1QV0A 1HT9A 1OOGA 1SCMC 1NX2A 1RJVA 3PALA 2M9GA 3CLNA 1FF1A 1SR6C 2QPTA 1C3ZA 1KFXS 1XFWO 2E6WA 4GFTA 3JVTC 2LAPA 1B8LA 1XFXO 1DMOA 3SJSA 1WLMA 3FS7A 1JF2A 1DJYA 4PALA 5AANA 5AXIA 3V2LA 1CM4A 3VRPA 1DT7B 1QV1A 1W7JB 2K61A 2KQ6A 3BYAA 3I5GB 2AMIA 4GUKA 4NDDA 2M49B 2K7CA 5CPVA 1YVHA 1ZOTB 3FIAA 1ALWA 1YX8A 2OTGC 2LE9B 2OS8C 1LKJA 5CSFA 3S0EA 3DXLA 3VRQA 1S5GY 5DKRA 2CNPA 3SIAA 4WRIA 3AKBA 3ZWHA 1CNPA 1OMDA 2LVIA 4JKTA 4OZDA 2JPTA 4YBHB 4BY5A 1S6JA 3D77A 1JSAA 1DC1A 5I8NA 1ZFSA 3LL8B 4F7FA 2FOTA 3PFVA 4HREE 1MXEA 1BODA 1MXLC 1SY9A 4NDBA 4MZLA 2NCPA 1NX3A 3FE6A 1M46A 5F6TA 2CBLA 4QJ5B 2AAOA 1KCYA 4CIDA 2KI6D 1U5IB 1PALA 1UHIA 2G9BA 2PSRA 3I5IC 2LMVA 1C07A 3OX6A 3KHEA 4GPLB 1XFYO 1BT6A 1A2XA 2KI4C 2GGZA 3CZ0A 4NDCA 4AQIA 1K9PA 1AJ5A 2LHIA 1KK7Y 3PN7C 5J3XA 3TDIA 2LMTA 1J1DA 1NWDA 2LVVA 4GNKB 1TTXA 5IBWA 2WCJA 3HCMA 1YRUB 1QWVA 3S0AA 1KQMC 2BAPA 4Q04A 1A75B 1K8UA 1V1GA 1PSRA 4C0KA 1CKKA 1K2HA 5GQQC 2KPHA 1SYMA 1WY9A 1L2OC 3TZ1A 4PHMA 1XFRA 1A75A 2M29A 4HSZA 2F3ZA 3B88A 4DS7A 4PE1A 1NYAA 4DUQA 4PT1A 3GOFA 2JZIA 4PE7A
chains in the Genus database with same CATH topology
2K0JA 4CPVA 4F0ZB 2EC6B 1M45A 1J7QA 1QX7A 4AQJA 4UPGA 2NLNA 3EK4A 3CWGA 2JXCA 3I5HB 4M2PA 3KEVA 5DKNA 2SASA 1TN4A 3VROA 1QXPA 1XVJA 1N0YA 1K9UA 1MR8A 1WRLA 2JNXA 2PVBA 2CT9A 4D1EA 1JWDA 3VGOA 1G8IA 2JNFA 2JQ6A 3QRXA 2CXJA 4A4BA 1UHHA 1Y0VH 3SG7A 2LUCA 1XK4A 1NCZA 2GV5A 5D7FA 2KQYA 2BBMA 4MZKA 3EK7A 2ZNDA 2M7LA 5D69A 3EVVA 1S36A 1QVIY 2JT0A 2LVJA 1SL9A 1K94A 4R1EA 2O5GA 1QATA 1OSAA 3CR4X 1RK9A 2PRUA 4TNCA 2FCEA 3A4UB 2NCOA 1N2DA 3GK1A 1IRJA 1X02A 3AAKA 3EVRA 1IH0A 2LNKA 1IQ5A 2H61C 3I5GC 2BCXA 4ORBB 3C1VA 1Y1AA 2GGMA 2M3WA 3FWBA 1BF5A 3OB2B 4DCKA 1B8CA 1S3PA 2WOSA 1OMRA 3TDUA 5DKQA 1KFUL 1CMFA 2KGBC 1BMOA 1RECA 3EVUA 1NCYA 3JTDB 4L9MA 3IF7A 2KOTA 1JF0A 3SG4A 1AHRA 4YI8A 1XFUO 2F33A 5CSNA 1SKTA 2ZKMX 1EH2A 3CS1A 1KWOB 2BL0B 2M1UA 4PHNA 3D0YA 2WC8A 1L7ZA 4GGFA 3DVKA 3GK4X 4PCWA 1OZOA 3CTNA 3SG2A 1F54A 1B7TZ 2SCPA 2JOJA 1UUSA 3PATA 3BUMB 1B47A 2WORA 1BU3A 3O2PA 3TS5C 4I5KA 2HQ8A 5HKWA 1TIZA 1QS7A 2KBMA 1JC2A 3E3RA 4QJ4B 1UP5A 3NSKA 4WQ2A 5FYXA 2WCEA 1IKUA 2L2EA 2LUXA 1CDNA 2H61A 1W7IB 2Y4QA 1AP4A 2MJWB 2ZN9A 5HYDA 1GQMA 1KK8B 1TOPA 2LANA 2A4JA 2BBNA 1QIWA 2Y5IA 2LHLA 2KBIA 2JU0A 4U8DA 3EKJA 4WQ3A 1OQPA 5HKYA 1NUBA 3A8RA 4PHJA 3KO0A 4YGCB 2BCBA 1SRAA 3O6BA 1IG5A 2LP2A 2H2KA 1FI5A 1LVCD 2EC6C 3PSRA 5AERA 3TUYB 1GGWA 1ZACA 3I5HC 2KFFA 1FI6A 1WRZA 3BOWB 4PE0A 1U5IA 3VRRA 4ZCVA 1J7OA 4MRXA 2JULA 3LLEA 4GBAA 3GK2A 4YGAA 1IJ5A 1JFKA 1B9AA 1RROA 1S5GZ 1SNLA 1XFVO 1XK4C 3BOWA 2F2PA 2PASA 5CSIA 1DTLA 1UHJA 1BJFA 1CLLA 1RTP1 1KFUS 2JTZA 4USLA 2K2AA 1R6PA 5AEQA 3HX4A 5CSJA 2ISDA 1IGVA 4MN0A 4N1GA 2L4IA 1OMVA 1S1EA 5I2OA 3OX5A 1A4PA 1SW8A 2FCDA 2EHBA 3RM1A 5HLOA 1F71A 2PALA 2MHHA 1NPQA 2E30A 3CR5X 1JBAA 1ZUZA 3DVJA 2JTTA 3OB1B 2KYFA 2I18A 2MA2A 1MHOA 5G08A 2I2RE 1OZSA 1HQVA 3BQ3A 3NSOA 1SL7A 5TNCA 1PULA 1SMGA 2HF5A 1UHNA 4CFRA 1CMGA 2JT8A 1EG4A 2F8PA 2MAZA 3AAJA 3JTDC 1TNWA 4ORCB 1YUSA 2LLSA 4ORAB 4C0JA 1ALVA 4GGFC 1A03A 1YTZC 4CLNA 1KWOC 2BL0C 1N65A 3SIBA 1F8HA 2IS9A 3I5FC 5K89A 1AUIB 4MZJA 1GJYA 1Y6WA 2I7AA 2KDHA 2QACA 4YGDB 4C0LA 1BOCA 4XYNA 2R2IA 1AVSA 1MWNA 1ZMZA 3BUNB 1S6CA 2ZRTA 5JJGA 2JRFA 1S6IA 1JFJA 4HRGA 1QX2A 5KSZA 4XJKB 5PALA 3SG3A 3WHUB 1OOJA 4YGEB 1UHKA 1NIWA 4P5OE 3D10A 1J55A 5AFPA 4N5XA 1SPYA 4IL1A 2K8MB 1QX5B 4GAOA 4YRUA 1J7PA 1PK0D 1J1EA 1YX7A 1KK8C 1NX1A 1WDCB 1E8AA 3MSEB 1VRKA 1SK6D 1FW4A 2JXLA 4ZCUA 3SG6A 1PRWA 5ER4X 1CFFA 1F4OA 2LCPA 3NXAA 4I5JA 2L4HA 2HETA 3NSIA 4ETOA 5B8IB 1NSHA 3PLFB 1NCXA 1QVIZ 1V1FA 1EJ3A 1TNXA 3F45A 1CTRA 2LVKA 2WNDA 4CFQA 2MRDA 3TUYC 1TRFA 3LK0A 4OKHA 2KI6C 1MQ1A 1K90D 1DJGA 1SBJA 2LC5A 2PMYA 3DD4A 5I2LA 1EXRA 1XYDA 1KSOA 1OE9B 2G2BA 2LV7A 4GGNA 4P2YB 2HPSA 3RLZA 1CLBA 4DRWA 1DVIA 1BR1B 1PSBA 3O4YA 2WCBA 1S26D 1C7WA 4FTGA 4QJ3B 2M0RA 2LLUA 3ZNIA 1CDMA 2KFHA 2KFGA 1XFZO 2CTNA 1MUXA 4ICBA 3WNXB 2NXQA 2ZN8A 3OHMB 1DGUA 4M2OA 1IJ6A 1UURA 2BECA 1YRTB 4E68A 1CM1A 1YUUA 2F3YA 3BXKA 2VRGA 1DJWA 1BLQA 2JT3A 2NZ0A 1CFPA 2L50A 2KAXA 1UWOA 1XA5A 3BUWB 4M2QA 1EG3A 2HQWA 5HLVA 1C7VA 3CGAA 3VRNA 4I5LB 2TN4A 2AUCA 3O78A 2RGIA 4HRHA 1NX0A 2L51A 1DGVA 1WLZA 1EL4A 2KAYA 2V53A 1BG1A 1GGZA 3CZTX 2Y1NA 1YVLA 2EGDA 5KTYA 5BPJA 4MLWA 1SCMB 1M39A 2I94A 2KHNA 4BY4A 1SR6B 1B4CA 5KU1A 1CDPA 1CFDA 1QASA 2D8NA 1IWQA 3JVTB 3KF9A 2MBXA 2OPOA 1QJTA 3TS5B 1PVBA 2Y1MA 1QTXA 4PDZA 5HKZA 4YI9A 2M97A 1Q80A 1LINA 1K93D 2M1KB 1LA3A 4MBEA 2Q4UA 3H4SE 2ZFDA 3WHTB 3NSLA 2K7DA 2OTGB 2OS8B 2BE4A 1B8RA 1H4BA 1YR5A 4PHKA 1RWYA 1TCOB 4MSPA 3LCPC 1TCFA 2BE6A 1AK8A 5ER5A 2M8UA 1M63B 2ZRSA 5JOLA 1D1OA 1DF0B 1KK7Z 4OR9B 2M7NA 1Y1XA 1FBVA 2LLTA 4JPZB 4DIRA 4MVFA 4NQGA 1BR4B 2LM5A 3ICBA 1DF0A 1M31A 1WDCC 1KFXL 1ODBA 3PM8A 4I5NB 1AJ4A 2LMUA 1CLMA 1YUTA 1J7RA 1F55A 1G4YR 3I5IB 3KPXA 1KSMA 2LP3A 2JC2A 4FQOA 4PE4A 1CFCA 1LXFC 1DJHA 4N1FA 3LK1A 1F4QA 2KYCA 1CB1A 1NP8A 3AKAA 2KI4B 2O60A 2L5XB 1SCVA 2Q91A 4MRYA 2WCFA 1DJXA 2F2OA 1YURA 3EKHA 3K21A 3PN7B 3OP0A 1CDLA 1SL8A 1Y1UA 3WXAA 1K95A 2KAVA 1KQMB 2B1UA 3FWCA 1RFJA 2MLEC 4MEWA 3DF0B 2JWWA 4XJKA 1FPWA 2K2FA 1L2OB 1JUOA 3DF0A 1TNPA 1QLKA 2KNEA 2KGRA 3IQQA 1B7TY 1B1GA 1PVAA 1LA0A 3BUOB 1KQVA 1R2UA 4JWQA 3TDZA 1IQ3A 1TNQA 2KSPA 2L0PA 3BUXB 3M0WA 1K96A 2COLB 1A29A 3EK8A 3SG5A 5I2QA 1F70A 3DVMA 4YGBB 2K7BA 4A4CA 2P6BB 4JQ0D 1WRKA 1MF8B 1QIVA 2ZNEA 2CCMA 1XO5A 2DOQA 1QLSA 2K7OA 1DJIA 1K9KA 3DVEA 2BCAA 3CR2A 4OV2A 2L98A 2FJUB 3IQOA 1G33A 2MLFC 3D0YB 4OVNF 4OCIA 2BKIB 1DJZA 1H8BA 2BKHB 3I5FB 4AOMA 1QV0A 1HT9A 1SCMC 1NX2A 1RJVA 3PALA 2M9GA 3CLNA 1FF1A 1SR6C 2QPTA 1KFXS 1XFWO 2E6WA 4GFTA 3JVTC 2LAPA 1B8LA 1XFXO 1DMOA 3SJSA 1WLMA 3FS7A 1JF2A 1DJYA 4PALA 5AANA 5AXIA 1CM4A 3VRPA 1DT7B 1QV1A 1W7JB 2K61A 2KQ6A 3BYAA 3I5GB 2AMIA 4GUKA 4NDDA 2M49B 2K7CA 5CPVA 1YVHA 1ZOTB 3FIAA 1ALWA 1YX8A 2OTGC 2LE9B 2OS8C 1LKJA 5CSFA 3VRQA 1S5GY 5DKRA 2CNPA 3SIAA 4WRIA 3AKBA 3ZWHA 1CNPA 1OMDA 2LVIA 4BY5A 2JPTA 4YBHB 1S6JA 1JSAA 5I8NA 1ZFSA 3LL8B 2FOTA 3PFVA 4HREE 1MXEA 1BODA 1MXLC 1SY9A 4NDBA 4MZLA 2NCPA 1NX3A 1M46A 5F6TA 2CBLA 4QJ5B 2AAOA 1KCYA 4CIDA 2KI6D 1U5IB 1PALA 1UHIA 2G9BA 2PSRA 3I5IC 2LMVA 1C07A 3OX6A 3KHEA 4GPLB 1XFYO 1BT6A 1A2XA 2KI4C 2GGZA 4AQIA 4NDCA 1K9PA 1AJ5A 2LHIA 1KK7Y 3PN7C 5J3XA 3TDIA 2LMTA 1J1DA 1NWDA 2LVVA 4GNKB 1TTXA 5IBWA 3HCMA 1YRUB 1KQMC 4Q04A 1A75B 1K8UA 1V1GA 1PSRA 4C0KA 1CKKA 1K2HA 5GQQC 1SYMA 1WY9A 1L2OC 3TZ1A 4PHMA 1A75A 2M29A 4HSZA 2F3ZA 4DS7A 4PE1A 1NYAA 4DUQA 3GOFA 2JZIA 4PE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0J A;  4CPV A;  4F0Z B;  2EC6 B;  1M45 A;  1J7Q A;  1QX7 A;  4AQJ A;  4UPG A;  2NLN A;  3EK4 A;  3CWG A;  2JXC A;  3I5H B;  4M2P A;  3KEV A;  5DKN A;  2SAS A;  1TN4 A;  3VRO A;  1QXP A;  1XVJ A;  1N0Y A;  1K9U A;  1MR8 A;  1WRL A;  2JNX A;  2PVB A;  2CT9 A;  4D1E A;  1JWD A;  3VGO A;  1G8I A;  2JNF A;  2JQ6 A;  3QRX A;  2CXJ A;  4A4B A;  1UHH A;  1Y0V H;  3SG7 A;  2LUC A;  1XK4 A;  1NCZ A;  2GV5 A;  5D7F A;  2KQY A;  2BBM A;  4MZK A;  3EK7 A;  2ZND A;  2M7L A;  5D69 A;  3EVV A;  1S36 A;  1QVI Y;  2JT0 A;  2LVJ A;  1SL9 A;  1K94 A;  4R1E A;  2O5G A;  1QAT A;  1OSA A;  3CR4 X;  1RK9 A;  2PRU A;  4TNC A;  2FCE A;  3A4U B;  2NCO A;  1N2D A;  3GK1 A;  1IRJ A;  1X02 A;  3AAK A;  3EVR A;  1IH0 A;  2LNK A;  1IQ5 A;  2H61 C;  3I5G C;  2BCX A;  4ORB B;  3C1V A;  1Y1A A;  2GGM A;  2M3W A;  3FWB A;  1BF5 A;  3OB2 B;  4DCK A;  1B8C A;  1S3P A;  2WOS A;  1OMR A;  3TDU A;  5DKQ A;  1KFU L;  1CMF A;  2KGB C;  1BMO A;  1REC A;  3EVU A;  1NCY A;  3JTD B;  4L9M A;  3IF7 A;  2KOT A;  1JF0 A;  3SG4 A;  1AHR A;  4YI8 A;  1XFU O;  2F33 A;  5CSN A;  1SKT A;  2ZKM X;  1EH2 A;  3CS1 A;  1KWO B;  2BL0 B;  2M1U A;  4PHN A;  3D0Y A;  2WC8 A;  1L7Z A;  4GGF A;  3DVK A;  3GK4 X;  4PCW A;  1OZO A;  3CTN A;  3SG2 A;  1F54 A;  1B7T Z;  2SCP A;  2JOJ A;  1UUS A;  3PAT A;  3BUM B;  1B47 A;  2WOR A;  1BU3 A;  3O2P A;  3TS5 C;  4I5K A;  2HQ8 A;  5HKW A;  1TIZ A;  1QS7 A;  2KBM A;  1JC2 A;  3E3R A;  4QJ4 B;  1UP5 A;  3NSK A;  4WQ2 A;  5FYX A;  2WCE A;  1IKU A;  2L2E A;  2LUX A;  1CDN A;  2H61 A;  1W7I B;  2Y4Q A;  1AP4 A;  2MJW B;  2ZN9 A;  5HYD A;  1GQM A;  1KK8 B;  1TOP A;  2LAN A;  2A4J A;  2BBN A;  1QIW A;  2Y5I A;  2LHL A;  2KBI A;  2JU0 A;  4U8D A;  3EKJ A;  4WQ3 A;  1OQP A;  5HKY A;  1NUB A;  3A8R A;  4PHJ A;  3KO0 A;  4YGC B;  2BCB A;  1SRA A;  3O6B A;  1IG5 A;  2LP2 A;  2H2K A;  1FI5 A;  1LVC D;  2EC6 C;  3PSR A;  5AER A;  3TUY B;  1GGW A;  1ZAC A;  3I5H C;  2KFF A;  1FI6 A;  1WRZ A;  3BOW B;  4PE0 A;  1U5I A;  3VRR A;  4ZCV A;  1J7O A;  4MRX A;  2JUL A;  3LLE A;  4GBA A;  3GK2 A;  4YGA A;  1IJ5 A;  1JFK A;  1B9A A;  1RRO A;  1S5G Z;  1SNL A;  1XFV O;  1XK4 C;  3BOW A;  2F2P A;  2PAS A;  5CSI A;  1DTL A;  1UHJ A;  1BJF A;  1CLL A;  1RTP 1;  1KFU S;  2JTZ A;  4USL A;  2K2A A;  1R6P A;  5AEQ A;  3HX4 A;  5CSJ A;  2ISD A;  1IGV A;  4MN0 A;  4N1G A;  2L4I A;  1OMV A;  1S1E A;  5I2O A;  3OX5 A;  1A4P A;  1SW8 A;  2FCD A;  2EHB A;  3RM1 A;  5HLO A;  1F71 A;  2PAL A;  2MHH A;  1NPQ A;  2E30 A;  3CR5 X;  1JBA A;  1ZUZ A;  3DVJ A;  2JTT A;  3OB1 B;  2KYF A;  2I18 A;  2MA2 A;  1MHO A;  5G08 A;  2I2R E;  1OZS A;  1HQV A;  3BQ3 A;  3NSO A;  1SL7 A;  5TNC A;  1PUL A;  1SMG A;  2HF5 A;  1UHN A;  4CFR A;  1CMG A;  2JT8 A;  1EG4 A;  2F8P A;  2MAZ A;  3AAJ A;  3JTD C;  1TNW A;  4ORC B;  1YUS A;  2LLS A;  4ORA B;  4C0J A;  1ALV A;  4GGF C;  1A03 A;  1YTZ C;  4CLN A;  1KWO C;  2BL0 C;  1N65 A;  3SIB A;  1F8H A;  2IS9 A;  3I5F C;  5K89 A;  1AUI B;  4MZJ A;  1GJY A;  1Y6W A;  2I7A A;  2KDH A;  2QAC A;  4YGD B;  4C0L A;  1BOC A;  4XYN A;  2R2I A;  1AVS A;  1MWN A;  1ZMZ A;  3BUN B;  1S6C A;  2ZRT A;  5JJG A;  2JRF A;  1S6I A;  1JFJ A;  4HRG A;  1QX2 A;  5KSZ A;  4XJK B;  5PAL A;  3SG3 A;  3WHU B;  1OOJ A;  4YGE B;  1UHK A;  1NIW A;  4P5O E;  3D10 A;  1J55 A;  5AFP A;  4N5X A;  1SPY A;  4IL1 A;  2K8M B;  1QX5 B;  4GAO A;  4YRU A;  1J7P A;  1PK0 D;  1J1E A;  1YX7 A;  1KK8 C;  1NX1 A;  1WDC B;  1E8A A;  3MSE B;  1VRK A;  1SK6 D;  1FW4 A;  2JXL A;  4ZCU A;  3SG6 A;  1PRW A;  5ER4 X;  1CFF A;  1F4O A;  2LCP A;  3NXA A;  4I5J A;  2L4H A;  2HET A;  3NSI A;  4ETO A;  5B8I B;  1NSH A;  3PLF B;  1NCX A;  1QVI Z;  1V1F A;  1EJ3 A;  1TNX A;  3F45 A;  1CTR A;  2LVK A;  2WND A;  4CFQ A;  2MRD A;  3TUY C;  1TRF A;  3LK0 A;  4OKH A;  2KI6 C;  1MQ1 A;  1K90 D;  1DJG A;  1SBJ A;  2LC5 A;  2PMY A;  3DD4 A;  5I2L A;  1EXR A;  1XYD A;  1KSO A;  1OE9 B;  2G2B A;  2LV7 A;  4GGN A;  4P2Y B;  2HPS A;  3RLZ A;  1CLB A;  4DRW A;  1DVI A;  1BR1 B;  1PSB A;  3O4Y A;  2WCB A;  1S26 D;  1C7W A;  4FTG A;  4QJ3 B;  2M0R A;  2LLU A;  3ZNI A;  1CDM A;  2KFH A;  2KFG A;  1XFZ O;  2CTN A;  1MUX A;  4ICB A;  3WNX B;  2NXQ A;  2ZN8 A;  3OHM B;  1DGU A;  4M2O A;  1IJ6 A;  1UUR A;  2BEC A;  1YRT B;  4E68 A;  1CM1 A;  1YUU A;  2F3Y A;  3BXK A;  2VRG A;  1DJW A;  1BLQ A;  2JT3 A;  2NZ0 A;  1CFP A;  2L50 A;  2KAX A;  1UWO A;  1XA5 A;  3BUW B;  4M2Q A;  1EG3 A;  2HQW A;  5HLV A;  1C7V A;  3CGA A;  3VRN A;  4I5L B;  2TN4 A;  2AUC A;  3O78 A;  2RGI A;  4HRH A;  1NX0 A;  2L51 A;  1DGV A;  1WLZ A;  1EL4 A;  2KAY A;  2V53 A;  1BG1 A;  1GGZ A;  3CZT X;  2Y1N A;  1YVL A;  2EGD A;  5KTY A;  5BPJ A;  4MLW A;  1SCM B;  1M39 A;  2I94 A;  2KHN A;  4BY4 A;  1SR6 B;  1B4C A;  5KU1 A;  1CDP A;  1CFD A;  1QAS A;  2D8N A;  1IWQ A;  3JVT B;  3KF9 A;  2MBX A;  2OPO A;  1QJT A;  3TS5 B;  1PVB A;  2Y1M A;  1QTX A;  4PDZ A;  5HKZ A;  4YI9 A;  2M97 A;  1Q80 A;  1LIN A;  1K93 D;  2M1K B;  1LA3 A;  4MBE A;  2Q4U A;  3H4S E;  2ZFD A;  3WHT B;  3NSL A;  2K7D A;  2OTG B;  2OS8 B;  2BE4 A;  1B8R A;  1H4B A;  1YR5 A;  4PHK A;  1RWY A;  1TCO B;  4MSP A;  3LCP C;  1TCF A;  2BE6 A;  1AK8 A;  5ER5 A;  2M8U A;  1M63 B;  2ZRS A;  5JOL A;  1D1O A;  1DF0 B;  1KK7 Z;  4OR9 B;  2M7N A;  1Y1X A;  1FBV A;  2LLT A;  4JPZ B;  4DIR A;  4MVF A;  4NQG A;  1BR4 B;  2LM5 A;  3ICB A;  1DF0 A;  1M31 A;  1WDC C;  1KFX L;  1ODB A;  3PM8 A;  4I5N B;  1AJ4 A;  2LMU A;  1CLM A;  1YUT A;  1J7R A;  1F55 A;  1G4Y R;  3I5I B;  3KPX A;  1KSM A;  2LP3 A;  2JC2 A;  4FQO A;  4PE4 A;  1CFC A;  1LXF C;  1DJH A;  4N1F A;  3LK1 A;  1F4Q A;  2KYC A;  1CB1 A;  1NP8 A;  3AKA A;  2KI4 B;  2O60 A;  2L5X B;  1SCV A;  2Q91 A;  4MRY A;  2WCF A;  1DJX A;  2F2O A;  1YUR A;  3EKH A;  3K21 A;  3PN7 B;  3OP0 A;  1CDL A;  1SL8 A;  1Y1U A;  3WXA A;  1K95 A;  2KAV A;  1KQM B;  2B1U A;  3FWC A;  1RFJ A;  2MLE C;  4MEW A;  3DF0 B;  2JWW A;  4XJK A;  1FPW A;  2K2F A;  1L2O B;  1JUO A;  3DF0 A;  1TNP A;  1QLK A;  2KNE A;  2KGR A;  3IQQ A;  1B7T Y;  1B1G A;  1PVA A;  1LA0 A;  3BUO B;  1KQV A;  1R2U A;  4JWQ A;  3TDZ A;  1IQ3 A;  1TNQ A;  2KSP A;  2L0P A;  3BUX B;  3M0W A;  1K96 A;  2COL B;  1A29 A;  3EK8 A;  3SG5 A;  5I2Q A;  1F70 A;  3DVM A;  4YGB B;  2K7B A;  4A4C A;  2P6B B;  4JQ0 D;  1WRK A;  1MF8 B;  1QIV A;  2ZNE A;  2CCM A;  1XO5 A;  2DOQ A;  1QLS A;  2K7O A;  1DJI A;  1K9K A;  3DVE A;  2BCA A;  3CR2 A;  4OV2 A;  2L98 A;  2FJU B;  3IQO A;  1G33 A;  2MLF C;  3D0Y B;  4OVN F;  4OCI A;  2BKI B;  1DJZ A;  1H8B A;  2BKH B;  3I5F B;  4AOM A;  1QV0 A;  1HT9 A;  1SCM C;  1NX2 A;  1RJV A;  3PAL A;  2M9G A;  3CLN A;  1FF1 A;  1SR6 C;  2QPT A;  1KFX S;  1XFW O;  2E6W A;  4GFT A;  3JVT C;  2LAP A;  1B8L A;  1XFX O;  1DMO A;  3SJS A;  1WLM A;  3FS7 A;  1JF2 A;  1DJY A;  4PAL A;  5AAN A;  5AXI A;  1CM4 A;  3VRP A;  1DT7 B;  1QV1 A;  1W7J B;  2K61 A;  2KQ6 A;  3BYA A;  3I5G B;  2AMI A;  4GUK A;  4NDD A;  2M49 B;  2K7C A;  5CPV A;  1YVH A;  1ZOT B;  3FIA A;  1ALW A;  1YX8 A;  2OTG C;  2LE9 B;  2OS8 C;  1LKJ A;  5CSF A;  3VRQ A;  1S5G Y;  5DKR A;  2CNP A;  3SIA A;  4WRI A;  3AKB A;  3ZWH A;  1CNP A;  1OMD A;  2LVI A;  4BY5 A;  2JPT A;  4YBH B;  1S6J A;  1JSA A;  5I8N A;  1ZFS A;  3LL8 B;  2FOT A;  3PFV A;  4HRE E;  1MXE A;  1BOD A;  1MXL C;  1SY9 A;  4NDB A;  4MZL A;  2NCP A;  1NX3 A;  1M46 A;  5F6T A;  2CBL A;  4QJ5 B;  2AAO A;  1KCY A;  4CID A;  2KI6 D;  1U5I B;  1PAL A;  1UHI A;  2G9B A;  2PSR A;  3I5I C;  2LMV A;  1C07 A;  3OX6 A;  3KHE A;  4GPL B;  1XFY O;  1BT6 A;  1A2X A;  2KI4 C;  2GGZ A;  4AQI A;  4NDC A;  1K9P A;  1AJ5 A;  2LHI A;  1KK7 Y;  3PN7 C;  5J3X A;  3TDI A;  2LMT A;  1J1D A;  1NWD A;  2LVV A;  4GNK B;  1TTX A;  5IBW A;  3HCM A;  1YRU B;  1KQM C;  4Q04 A;  1A75 B;  1K8U A;  1V1G A;  1PSR A;  4C0K A;  1CKK A;  1K2H A;  5GQQ C;  1SYM A;  1WY9 A;  1L2O C;  3TZ1 A;  4PHM A;  1A75 A;  2M29 A;  4HSZ A;  2F3Z A;  4DS7 A;  4PE1 A;  1NYA A;  4DUQ A;  3GOF A;  2JZI A;  4PE7 A; 
#chains in the Genus database with same CATH topology
 2K0J A;  4CPV A;  4F0Z B;  2ERB A;  2EC6 B;  1M45 A;  1T14 A;  2QEO A;  4IJ7 A;  1J7Q A;  1QX7 A;  4AQJ A;  4UPG A;  2NLN A;  3EK4 A;  3CWG A;  2JXC A;  3I5H B;  4M2P A;  3D73 A;  3KEV A;  5DKN A;  2SAS A;  1TN4 A;  3VRO A;  1QXP A;  1XVJ A;  1N0Y A;  1K9U A;  1MR8 A;  1WRL A;  2JNX A;  2PVB A;  1SSE B;  1Z2C B;  2CT9 A;  2PQL A;  3UO9 A;  4D1E A;  1JWD A;  3VGO A;  1G8I A;  2JNF A;  2JQ6 A;  2P71 A;  3QRX A;  2CXJ A;  4A4B A;  1UHH A;  1Y0V H;  3SG7 A;  2LUC A;  1XK4 A;  1NCZ A;  2GV5 A;  5D7F A;  2KQY A;  2BBM A;  4MZK A;  3EK7 A;  2ZND A;  2M7L A;  5D69 A;  1Z4H A;  3EVV A;  3SS4 A;  1S36 A;  1QVI Y;  2JT0 A;  2LVJ A;  1SL9 A;  1K94 A;  4R1E A;  2O5G A;  1QAT A;  1OSA A;  3CR4 X;  1RK9 A;  2PRU A;  4TNC A;  2FCE A;  2QEH A;  3A4U B;  2NCO A;  1N2D A;  3GK1 A;  1IRJ A;  1X02 A;  3AAK A;  3EVR A;  1IH0 A;  2LNK A;  1IQ5 A;  2H61 C;  3I5G C;  2H8V A;  3R1O A;  2BCX A;  4ORB B;  3C1V A;  1Y1A A;  2GGM A;  2M3W A;  3FWB A;  1BF5 A;  3FE8 A;  3OB2 B;  4DCK A;  1B8C A;  1S3P A;  2WOS A;  1OMR A;  3TDU A;  5DKQ A;  1KFU L;  1CMF A;  2KGB C;  1BMO A;  1REC A;  3EVU A;  1NCY A;  2FJY A;  3JTD B;  3IF7 A;  4L9M A;  2KOT A;  3B86 A;  3SS5 A;  1JF0 A;  3SG4 A;  1AHR A;  3R72 A;  4YI8 A;  1XFU O;  5FI2 A;  2F33 A;  5CSN A;  1SKT A;  2ZKM X;  3CYZ A;  3PM2 A;  3CS1 A;  1KWO B;  2BL0 B;  2M1U A;  1EH2 A;  4PHN A;  3D0Y A;  2WC8 A;  1L7Z A;  4GGF A;  3DVK A;  3GK4 X;  4PCW A;  1OZO A;  3CTN A;  3SG2 A;  1F54 A;  1B7T Z;  2SCP A;  2JOJ A;  1UUS A;  3PAT A;  3BUM B;  1B47 A;  2WOR A;  1BU3 A;  1IIO A;  3O2P A;  3TS5 C;  4I5K A;  2HQ8 A;  5HKW A;  1TIZ A;  1QS7 A;  3QME A;  2KBM A;  1JC2 A;  3E3R A;  4QJ4 B;  1UP5 A;  3NSK A;  4WQ2 A;  5FYX A;  2WCE A;  1IKU A;  2L2E A;  2LUX A;  3N7H A;  1CDN A;  2H61 A;  2YGU A;  1W7I B;  2Y4Q A;  1AP4 A;  3D74 A;  2MJW B;  2ZN9 A;  5HYD A;  1GQM A;  1KK8 B;  1TOP A;  2LAN A;  2A4J A;  2BBN A;  1QIW A;  2Y5I A;  2LHL A;  2KBI A;  4INW A;  2JU0 A;  4U8D A;  3EKJ A;  3O4X A;  1W9Z A;  4WQ3 A;  1OQP A;  3RZS A;  5HKY A;  1NUB A;  3SS3 A;  3A8R A;  4JD9 A;  3PJI A;  4PHJ A;  3KO0 A;  4KYN A;  4YGC B;  2BCB A;  1SRA A;  3O6B A;  1IG5 A;  3NGV A;  2LP2 A;  2H2K A;  1FI5 A;  3DZT A;  1LVC D;  2EC6 C;  3PSR A;  3CZ2 A;  5AER A;  3TUY B;  1GGW A;  1ZAC A;  3I5H C;  2KFF A;  1FI6 A;  2QDI A;  1WRZ A;  3BOW B;  4PE0 A;  1U5I A;  3VRR A;  4ZCV A;  1J7O A;  4MRX A;  2JUL A;  3LLE A;  1OOI X;  3GK2 A;  4GBA A;  4YGA A;  1IJ5 A;  1JFK A;  1B9A A;  1RRO A;  1S5G Z;  1SNL A;  1XFV O;  1XK4 C;  3BOW A;  2F2P A;  2PAS A;  5CSI A;  1DTL A;  1UHJ A;  1BJF A;  1CLL A;  1RTP 1;  1KFU S;  2JTZ A;  4USL A;  3S0B A;  2K2A A;  1R6P A;  5AEQ A;  3HX4 A;  5CSJ A;  2ISD A;  1IGV A;  4MN0 A;  4N1G A;  2L4I A;  3B87 A;  1OMV A;  1S1E A;  2P70 A;  5I2O A;  3OX5 A;  3BFH A;  1A4P A;  1SW8 A;  2FCD A;  2EHB A;  3RM1 A;  5HLO A;  1F71 A;  2PAL A;  2MHH A;  1NPQ A;  2E30 A;  3CR5 X;  1JBA A;  1ZUZ A;  3DVJ A;  2JTT A;  3OB1 B;  2KYF A;  2I18 A;  2MA2 A;  1MHO A;  5G08 A;  2I2R E;  1OZS A;  1HQV A;  3BQ3 A;  3CAB A;  3NSO A;  1SL7 A;  2JPO A;  5TNC A;  1PUL A;  1SMG A;  2HF5 A;  1UHN A;  4CFR A;  1CMG A;  3L4L A;  2JT8 A;  1EG4 A;  2F8P A;  2MAZ A;  3AAJ A;  3D78 A;  3JTD C;  1TNW A;  4ORC B;  1YUS A;  2LLS A;  2PYQ A;  4ORA B;  4C0J A;  1ALV A;  4GGF C;  1OOF A;  1A03 A;  1YTZ C;  4CLN A;  1KWO C;  2BL0 C;  1N65 A;  3SIB A;  1F8H A;  2IS9 A;  3I5F C;  5K89 A;  1AUI B;  4MZJ A;  1GJY A;  1Y6W A;  2I7A A;  2KDH A;  2QAC A;  4YGD B;  4C0L A;  1BOC A;  4XYN A;  2R2I A;  1AVS A;  1MWN A;  1ZMZ A;  3BUN B;  1S6C A;  2ZRT A;  5JJG A;  2JRF A;  2L2C A;  1S6I A;  3EG5 B;  1JFJ A;  4HRG A;  1QX2 A;  5KSZ A;  4XJK B;  5PAL A;  3CZ1 A;  3SG3 A;  3WHU B;  1OOJ A;  4YGE B;  1UHK A;  1NIW A;  4P5O E;  3D10 A;  1J55 A;  5AFP A;  4N5X A;  1SPY A;  4IL1 A;  2K8M B;  1QX5 B;  4GAO A;  4YRU A;  1J7P A;  3DY9 A;  3DYE A;  1PK0 D;  3R1V A;  1J1E A;  1YX7 A;  3D76 A;  1KK8 C;  4FQT A;  1NX1 A;  1OW4 A;  1WDC B;  1E8A A;  3MSE B;  1VRK A;  1SK6 D;  1FW4 A;  2JXL A;  4ZCU A;  3SG6 A;  1PRW A;  2GTE A;  5ER4 X;  1CFF A;  1F4O A;  2LCP A;  3NXA A;  3OGN A;  2L4H A;  4I5J A;  1DEK A;  2HET A;  3NSI A;  4ETO A;  5B8I B;  1NSH A;  3CDN A;  2WCM A;  3PLF B;  1NCX A;  1QVI Z;  1V1F A;  1EJ3 A;  1TNX A;  3F45 A;  1CTR A;  2LVK A;  2WND A;  4CFQ A;  2MRD A;  3TUY C;  1TRF A;  3LK0 A;  4OKH A;  2KI6 C;  1MQ1 A;  1K90 D;  2K60 A;  1DJG A;  1SBJ A;  2LC5 A;  2PMY A;  3DD4 A;  3R1P A;  1EXR A;  5I2L A;  1XYD A;  1KSO A;  1OE9 B;  2G2B A;  2LV7 A;  4GGN A;  4P2Y B;  3NHT A;  2HPS A;  3RLZ A;  1CLB A;  4DRW A;  1DVI A;  1BR1 B;  1GM0 A;  1PSB A;  3O4Y A;  2WCB A;  1S26 D;  1C7W A;  4FTG A;  4QJ3 B;  2M0R A;  1OOH A;  2LLU A;  3ZNI A;  1CDM A;  2KFH A;  3OBV A;  2KFG A;  1XFZ O;  2CTN A;  1MUX A;  4ICB A;  3WNX B;  2NXQ A;  2ZN8 A;  3OHM B;  1DGU A;  4M2O A;  1IJ6 A;  1UUR A;  2BEC A;  1YRT B;  4E68 A;  1CM1 A;  1YUU A;  2F3Y A;  3B6X A;  3BXK A;  2VRG A;  1DJW A;  1BLQ A;  2JT3 A;  2NZ0 A;  1CFP A;  2L50 A;  2KAX A;  1UWO A;  1XA5 A;  3BUW B;  4M2Q A;  1EG3 A;  2HQW A;  5HLV A;  1C7V A;  3CGA A;  3VRN A;  3D75 A;  4I5L B;  2TN4 A;  2BNX A;  2QEV A;  2AUC A;  3O78 A;  2RGI A;  4HRH A;  1NX0 A;  2L51 A;  1DGV A;  1WLZ A;  1EL4 A;  2KAY A;  2V53 A;  1BG1 A;  1GGZ A;  1TUJ A;  3K1E A;  3CZT X;  2Y1N A;  1YVL A;  2EGD A;  5KTY A;  5FI7 A;  5BPJ A;  4MLW A;  1SCM B;  1M39 A;  1TWO A;  2I94 A;  2KHN A;  4BY4 A;  1SR6 B;  1B4C A;  5KU1 A;  1CDP A;  1CFD A;  1QAS A;  2D8N A;  1IWQ A;  3JVT B;  3KF9 A;  2MBX A;  2OPO A;  1QJT A;  3TS5 B;  1PVB A;  2WC5 A;  2Y1M A;  1QTX A;  4PDZ A;  5HKZ A;  4YI9 A;  2M97 A;  1Q80 A;  1LIN A;  1K93 D;  2M1K B;  1LA3 A;  4MBE A;  2Q4U A;  3H4S E;  2ZFD A;  3WHT B;  3NSL A;  2K7D A;  2OTG B;  2OS8 B;  3IVT A;  2BE4 A;  1B8R A;  1H4B A;  1YR5 A;  4PHK A;  1ORG A;  1RWY A;  1TCO B;  1DQE A;  3LCP C;  1TCF A;  4MSP A;  3FE9 A;  2BE6 A;  1AK8 A;  5ER5 A;  2KLE A;  1M63 B;  2M8U A;  2ZRS A;  2WCH A;  5JOL A;  1D1O A;  1DF0 B;  1KK7 Z;  4OR9 B;  2M7N A;  1Y1X A;  1FBV A;  2LLT A;  2WCL A;  4JPZ B;  4DIR A;  4MVF A;  4NQG A;  1BR4 B;  2LM5 A;  3S0F A;  3BJH A;  5HL1 A;  3BFB A;  3ICB A;  1DF0 A;  1M31 A;  1WDC C;  1KFX L;  1ODB A;  3PM8 A;  4I5N B;  1AJ4 A;  2LMU A;  1CLM A;  1YUT A;  1J7R A;  1F55 A;  1G4Y R;  3I5I B;  3KPX A;  3S0G A;  1KSM A;  2LP3 A;  2JC2 A;  3B7A A;  4FQO A;  4PE4 A;  1LXF C;  1DJH A;  5DIC A;  1CFC A;  4N1F A;  3LK1 A;  1F4Q A;  2KYC A;  1CB1 A;  1NP8 A;  3AKA A;  3NHI A;  2KI4 B;  2O60 A;  2L5X B;  1SCV A;  2Q91 A;  4MRY A;  2WCF A;  3UNW A;  1DJX A;  2F2O A;  4INX A;  1YUR A;  2QEB A;  3EKH A;  3K21 A;  3PN7 B;  3Q8I A;  3OP0 A;  1CDL A;  1SL8 A;  1Y1U A;  3WXA A;  1K95 A;  2KAV A;  3VB1 A;  1KQM B;  2B1U A;  3FWC A;  1RFJ A;  1TUZ A;  2MLE C;  4MEW A;  3DF0 B;  1P28 A;  1C3Y A;  2JWW A;  4XJK A;  1FPW A;  2K2F A;  1L2O B;  5EL2 A;  1JUO A;  3DF0 A;  1TNP A;  1QLK A;  2KNE A;  2KGR A;  3IQQ A;  5I94 A;  1B7T Y;  1B1G A;  1PVA A;  1LA0 A;  3BUO B;  1KQV A;  1R2U A;  4JWQ A;  3TDZ A;  3S0D A;  1IQ3 A;  1TNQ A;  2KSP A;  2L0P A;  3BFA A;  3BUX B;  3M0W A;  2KLD A;  1K96 A;  2COL B;  1A29 A;  3EK8 A;  3SG5 A;  5I2Q A;  1F70 A;  3DVM A;  4YGB B;  2K7B A;  4A4C A;  2P6B B;  5D3O A;  4JQ0 D;  2WCK A;  1WRK A;  1MF8 B;  1DEL A;  1QIV A;  2ZNE A;  2CCM A;  1XO5 A;  2DOQ A;  1QLS A;  2K7O A;  1DJI A;  1K9K A;  3DVE A;  2BCA A;  3CR2 A;  4OV2 A;  2L98 A;  1LS8 A;  2FJU B;  1G33 A;  2MLF C;  3IQO A;  2L5Y A;  3D0Y B;  4OVN F;  5FI6 A;  4OCI A;  2BKI B;  1DJZ A;  3L4A A;  3L47 A;  1H8B A;  2WC6 A;  2BKH B;  3I5F B;  4AOM A;  1QV0 A;  1HT9 A;  1OOG A;  1SCM C;  1NX2 A;  1RJV A;  3PAL A;  2M9G A;  3CLN A;  1FF1 A;  1SR6 C;  2QPT A;  1C3Z A;  1KFX S;  1XFW O;  2E6W A;  4GFT A;  3JVT C;  2LAP A;  1B8L A;  1XFX O;  1DMO A;  3SJS A;  1WLM A;  3FS7 A;  1JF2 A;  1DJY A;  4PAL A;  5AAN A;  5AXI A;  3V2L A;  1CM4 A;  3VRP A;  1DT7 B;  1QV1 A;  1W7J B;  2K61 A;  2KQ6 A;  3BYA A;  3I5G B;  2AMI A;  4GUK A;  4NDD A;  2M49 B;  2K7C A;  5CPV A;  1YVH A;  1ZOT B;  3FIA A;  1ALW A;  1YX8 A;  2OTG C;  2LE9 B;  2OS8 C;  1LKJ A;  5CSF A;  3S0E A;  3DXL A;  3VRQ A;  1S5G Y;  5DKR A;  2CNP A;  3SIA A;  4WRI A;  3AKB A;  3ZWH A;  1CNP A;  1OMD A;  2LVI A;  4JKT A;  4OZD A;  2JPT A;  4YBH B;  4BY5 A;  1S6J A;  3D77 A;  1JSA A;  1DC1 A;  5I8N A;  1ZFS A;  3LL8 B;  4F7F A;  2FOT A;  3PFV A;  4HRE E;  1MXE A;  1BOD A;  1MXL C;  1SY9 A;  4NDB A;  4MZL A;  2NCP A;  1NX3 A;  3FE6 A;  1M46 A;  5F6T A;  2CBL A;  4QJ5 B;  2AAO A;  1KCY A;  4CID A;  2KI6 D;  1U5I B;  1PAL A;  1UHI A;  2G9B A;  2PSR A;  3I5I C;  2LMV A;  1C07 A;  3OX6 A;  3KHE A;  4GPL B;  1XFY O;  1BT6 A;  1A2X A;  2KI4 C;  2GGZ A;  3CZ0 A;  4NDC A;  4AQI A;  1K9P A;  1AJ5 A;  2LHI A;  1KK7 Y;  3PN7 C;  5J3X A;  3TDI A;  2LMT A;  1J1D A;  1NWD A;  2LVV A;  4GNK B;  1TTX A;  5IBW A;  2WCJ A;  3HCM A;  1YRU B;  1QWV A;  3S0A A;  1KQM C;  2BAP A;  4Q04 A;  1A75 B;  1K8U A;  1V1G A;  1PSR A;  4C0K A;  1CKK A;  1K2H A;  5GQQ C;  2KPH A;  1SYM A;  1WY9 A;  1L2O C;  3TZ1 A;  4PHM A;  1XFR A;  1A75 A;  2M29 A;  4HSZ A;  2F3Z A;  3B88 A;  4DS7 A;  4PE1 A;  1NYA A;  4DUQ A;  4PT1 A;  3GOF A;  2JZI A;  4PE7 A; 
#chains in the Genus database with same CATH homology
 2K0J A;  4CPV A;  4F0Z B;  2EC6 B;  1M45 A;  1J7Q A;  1QX7 A;  4AQJ A;  4UPG A;  2NLN A;  3EK4 A;  3CWG A;  2JXC A;  3I5H B;  4M2P A;  3KEV A;  5DKN A;  2SAS A;  1TN4 A;  3VRO A;  1QXP A;  1XVJ A;  1N0Y A;  1K9U A;  1MR8 A;  1WRL A;  2JNX A;  2PVB A;  2CT9 A;  4D1E A;  1JWD A;  3VGO A;  1G8I A;  2JNF A;  2JQ6 A;  3QRX A;  2CXJ A;  4A4B A;  1UHH A;  1Y0V H;  3SG7 A;  2LUC A;  1XK4 A;  1NCZ A;  2GV5 A;  5D7F A;  2KQY A;  2BBM A;  4MZK A;  3EK7 A;  2ZND A;  2M7L A;  5D69 A;  3EVV A;  1S36 A;  1QVI Y;  2JT0 A;  2LVJ A;  1SL9 A;  1K94 A;  4R1E A;  2O5G A;  1QAT A;  1OSA A;  3CR4 X;  1RK9 A;  2PRU A;  4TNC A;  2FCE A;  3A4U B;  2NCO A;  1N2D A;  3GK1 A;  1IRJ A;  1X02 A;  3AAK A;  3EVR A;  1IH0 A;  2LNK A;  1IQ5 A;  2H61 C;  3I5G C;  2BCX A;  4ORB B;  3C1V A;  1Y1A A;  2GGM A;  2M3W A;  3FWB A;  1BF5 A;  3OB2 B;  4DCK A;  1B8C A;  1S3P A;  2WOS A;  1OMR A;  3TDU A;  5DKQ A;  1KFU L;  1CMF A;  2KGB C;  1BMO A;  1REC A;  3EVU A;  1NCY A;  3JTD B;  4L9M A;  3IF7 A;  2KOT A;  1JF0 A;  3SG4 A;  1AHR A;  4YI8 A;  1XFU O;  2F33 A;  5CSN A;  1SKT A;  2ZKM X;  1EH2 A;  3CS1 A;  1KWO B;  2BL0 B;  2M1U A;  4PHN A;  3D0Y A;  2WC8 A;  1L7Z A;  4GGF A;  3DVK A;  3GK4 X;  4PCW A;  1OZO A;  3CTN A;  3SG2 A;  1F54 A;  1B7T Z;  2SCP A;  2JOJ A;  1UUS A;  3PAT A;  3BUM B;  1B47 A;  2WOR A;  1BU3 A;  3O2P A;  3TS5 C;  4I5K A;  2HQ8 A;  5HKW A;  1TIZ A;  1QS7 A;  2KBM A;  1JC2 A;  3E3R A;  4QJ4 B;  1UP5 A;  3NSK A;  4WQ2 A;  5FYX A;  2WCE A;  1IKU A;  2L2E A;  2LUX A;  1CDN A;  2H61 A;  1W7I B;  2Y4Q A;  1AP4 A;  2MJW B;  2ZN9 A;  5HYD A;  1GQM A;  1KK8 B;  1TOP A;  2LAN A;  2A4J A;  2BBN A;  1QIW A;  2Y5I A;  2LHL A;  2KBI A;  2JU0 A;  4U8D A;  3EKJ A;  4WQ3 A;  1OQP A;  5HKY A;  1NUB A;  3A8R A;  4PHJ A;  3KO0 A;  4YGC B;  2BCB A;  1SRA A;  3O6B A;  1IG5 A;  2LP2 A;  2H2K A;  1FI5 A;  1LVC D;  2EC6 C;  3PSR A;  5AER A;  3TUY B;  1GGW A;  1ZAC A;  3I5H C;  2KFF A;  1FI6 A;  1WRZ A;  3BOW B;  4PE0 A;  1U5I A;  3VRR A;  4ZCV A;  1J7O A;  4MRX A;  2JUL A;  3LLE A;  4GBA A;  3GK2 A;  4YGA A;  1IJ5 A;  1JFK A;  1B9A A;  1RRO A;  1S5G Z;  1SNL A;  1XFV O;  1XK4 C;  3BOW A;  2F2P A;  2PAS A;  5CSI A;  1DTL A;  1UHJ A;  1BJF A;  1CLL A;  1RTP 1;  1KFU S;  2JTZ A;  4USL A;  2K2A A;  1R6P A;  5AEQ A;  3HX4 A;  5CSJ A;  2ISD A;  1IGV A;  4MN0 A;  4N1G A;  2L4I A;  1OMV A;  1S1E A;  5I2O A;  3OX5 A;  1A4P A;  1SW8 A;  2FCD A;  2EHB A;  3RM1 A;  5HLO A;  1F71 A;  2PAL A;  2MHH A;  1NPQ A;  2E30 A;  3CR5 X;  1JBA A;  1ZUZ A;  3DVJ A;  2JTT A;  3OB1 B;  2KYF A;  2I18 A;  2MA2 A;  1MHO A;  5G08 A;  2I2R E;  1OZS A;  1HQV A;  3BQ3 A;  3NSO A;  1SL7 A;  5TNC A;  1PUL A;  1SMG A;  2HF5 A;  1UHN A;  4CFR A;  1CMG A;  2JT8 A;  1EG4 A;  2F8P A;  2MAZ A;  3AAJ A;  3JTD C;  1TNW A;  4ORC B;  1YUS A;  2LLS A;  4ORA B;  4C0J A;  1ALV A;  4GGF C;  1A03 A;  1YTZ C;  4CLN A;  1KWO C;  2BL0 C;  1N65 A;  3SIB A;  1F8H A;  2IS9 A;  3I5F C;  5K89 A;  1AUI B;  4MZJ A;  1GJY A;  1Y6W A;  2I7A A;  2KDH A;  2QAC A;  4YGD B;  4C0L A;  1BOC A;  4XYN A;  2R2I A;  1AVS A;  1MWN A;  1ZMZ A;  3BUN B;  1S6C A;  2ZRT A;  5JJG A;  2JRF A;  1S6I A;  1JFJ A;  4HRG A;  1QX2 A;  5KSZ A;  4XJK B;  5PAL A;  3SG3 A;  3WHU B;  1OOJ A;  4YGE B;  1UHK A;  1NIW A;  4P5O E;  3D10 A;  1J55 A;  5AFP A;  4N5X A;  1SPY A;  4IL1 A;  2K8M B;  1QX5 B;  4GAO A;  4YRU A;  1J7P A;  1PK0 D;  1J1E A;  1YX7 A;  1KK8 C;  1NX1 A;  1WDC B;  1E8A A;  3MSE B;  1VRK A;  1SK6 D;  1FW4 A;  2JXL A;  4ZCU A;  3SG6 A;  1PRW A;  5ER4 X;  1CFF A;  1F4O A;  2LCP A;  3NXA A;  4I5J A;  2L4H A;  2HET A;  3NSI A;  4ETO A;  5B8I B;  1NSH A;  3PLF B;  1NCX A;  1QVI Z;  1V1F A;  1EJ3 A;  1TNX A;  3F45 A;  1CTR A;  2LVK A;  2WND A;  4CFQ A;  2MRD A;  3TUY C;  1TRF A;  3LK0 A;  4OKH A;  2KI6 C;  1MQ1 A;  1K90 D;  1DJG A;  1SBJ A;  2LC5 A;  2PMY A;  3DD4 A;  5I2L A;  1EXR A;  1XYD A;  1KSO A;  1OE9 B;  2G2B A;  2LV7 A;  4GGN A;  4P2Y B;  2HPS A;  3RLZ A;  1CLB A;  4DRW A;  1DVI A;  1BR1 B;  1PSB A;  3O4Y A;  2WCB A;  1S26 D;  1C7W A;  4FTG A;  4QJ3 B;  2M0R A;  2LLU A;  3ZNI A;  1CDM A;  2KFH A;  2KFG A;  1XFZ O;  2CTN A;  1MUX A;  4ICB A;  3WNX B;  2NXQ A;  2ZN8 A;  3OHM B;  1DGU A;  4M2O A;  1IJ6 A;  1UUR A;  2BEC A;  1YRT B;  4E68 A;  1CM1 A;  1YUU A;  2F3Y A;  3BXK A;  2VRG A;  1DJW A;  1BLQ A;  2JT3 A;  2NZ0 A;  1CFP A;  2L50 A;  2KAX A;  1UWO A;  1XA5 A;  3BUW B;  4M2Q A;  1EG3 A;  2HQW A;  5HLV A;  1C7V A;  3CGA A;  3VRN A;  4I5L B;  2TN4 A;  2AUC A;  3O78 A;  2RGI A;  4HRH A;  1NX0 A;  2L51 A;  1DGV A;  1WLZ A;  1EL4 A;  2KAY A;  2V53 A;  1BG1 A;  1GGZ A;  3CZT X;  2Y1N A;  1YVL A;  2EGD A;  5KTY A;  5BPJ A;  4MLW A;  1SCM B;  1M39 A;  2I94 A;  2KHN A;  4BY4 A;  1SR6 B;  1B4C A;  5KU1 A;  1CDP A;  1CFD A;  1QAS A;  2D8N A;  1IWQ A;  3JVT B;  3KF9 A;  2MBX A;  2OPO A;  1QJT A;  3TS5 B;  1PVB A;  2Y1M A;  1QTX A;  4PDZ A;  5HKZ A;  4YI9 A;  2M97 A;  1Q80 A;  1LIN A;  1K93 D;  2M1K B;  1LA3 A;  4MBE A;  2Q4U A;  3H4S E;  2ZFD A;  3WHT B;  3NSL A;  2K7D A;  2OTG B;  2OS8 B;  2BE4 A;  1B8R A;  1H4B A;  1YR5 A;  4PHK A;  1RWY A;  1TCO B;  4MSP A;  3LCP C;  1TCF A;  2BE6 A;  1AK8 A;  5ER5 A;  2M8U A;  1M63 B;  2ZRS A;  5JOL A;  1D1O A;  1DF0 B;  1KK7 Z;  4OR9 B;  2M7N A;  1Y1X A;  1FBV A;  2LLT A;  4JPZ B;  4DIR A;  4MVF A;  4NQG A;  1BR4 B;  2LM5 A;  3ICB A;  1DF0 A;  1M31 A;  1WDC C;  1KFX L;  1ODB A;  3PM8 A;  4I5N B;  1AJ4 A;  2LMU A;  1CLM A;  1YUT A;  1J7R A;  1F55 A;  1G4Y R;  3I5I B;  3KPX A;  1KSM A;  2LP3 A;  2JC2 A;  4FQO A;  4PE4 A;  1CFC A;  1LXF C;  1DJH A;  4N1F A;  3LK1 A;  1F4Q A;  2KYC A;  1CB1 A;  1NP8 A;  3AKA A;  2KI4 B;  2O60 A;  2L5X B;  1SCV A;  2Q91 A;  4MRY A;  2WCF A;  1DJX A;  2F2O A;  1YUR A;  3EKH A;  3K21 A;  3PN7 B;  3OP0 A;  1CDL A;  1SL8 A;  1Y1U A;  3WXA A;  1K95 A;  2KAV A;  1KQM B;  2B1U A;  3FWC A;  1RFJ A;  2MLE C;  4MEW A;  3DF0 B;  2JWW A;  4XJK A;  1FPW A;  2K2F A;  1L2O B;  1JUO A;  3DF0 A;  1TNP A;  1QLK A;  2KNE A;  2KGR A;  3IQQ A;  1B7T Y;  1B1G A;  1PVA A;  1LA0 A;  3BUO B;  1KQV A;  1R2U A;  4JWQ A;  3TDZ A;  1IQ3 A;  1TNQ A;  2KSP A;  2L0P A;  3BUX B;  3M0W A;  1K96 A;  2COL B;  1A29 A;  3EK8 A;  3SG5 A;  5I2Q A;  1F70 A;  3DVM A;  4YGB B;  2K7B A;  4A4C A;  2P6B B;  4JQ0 D;  1WRK A;  1MF8 B;  1QIV A;  2ZNE A;  2CCM A;  1XO5 A;  2DOQ A;  1QLS A;  2K7O A;  1DJI A;  1K9K A;  3DVE A;  2BCA A;  3CR2 A;  4OV2 A;  2L98 A;  2FJU B;  3IQO A;  1G33 A;  2MLF C;  3D0Y B;  4OVN F;  4OCI A;  2BKI B;  1DJZ A;  1H8B A;  2BKH B;  3I5F B;  4AOM A;  1QV0 A;  1HT9 A;  1SCM C;  1NX2 A;  1RJV A;  3PAL A;  2M9G A;  3CLN A;  1FF1 A;  1SR6 C;  2QPT A;  1KFX S;  1XFW O;  2E6W A;  4GFT A;  3JVT C;  2LAP A;  1B8L A;  1XFX O;  1DMO A;  3SJS A;  1WLM A;  3FS7 A;  1JF2 A;  1DJY A;  4PAL A;  5AAN A;  5AXI A;  1CM4 A;  3VRP A;  1DT7 B;  1QV1 A;  1W7J B;  2K61 A;  2KQ6 A;  3BYA A;  3I5G B;  2AMI A;  4GUK A;  4NDD A;  2M49 B;  2K7C A;  5CPV A;  1YVH A;  1ZOT B;  3FIA A;  1ALW A;  1YX8 A;  2OTG C;  2LE9 B;  2OS8 C;  1LKJ A;  5CSF A;  3VRQ A;  1S5G Y;  5DKR A;  2CNP A;  3SIA A;  4WRI A;  3AKB A;  3ZWH A;  1CNP A;  1OMD A;  2LVI A;  4BY5 A;  2JPT A;  4YBH B;  1S6J A;  1JSA A;  5I8N A;  1ZFS A;  3LL8 B;  2FOT A;  3PFV A;  4HRE E;  1MXE A;  1BOD A;  1MXL C;  1SY9 A;  4NDB A;  4MZL A;  2NCP A;  1NX3 A;  1M46 A;  5F6T A;  2CBL A;  4QJ5 B;  2AAO A;  1KCY A;  4CID A;  2KI6 D;  1U5I B;  1PAL A;  1UHI A;  2G9B A;  2PSR A;  3I5I C;  2LMV A;  1C07 A;  3OX6 A;  3KHE A;  4GPL B;  1XFY O;  1BT6 A;  1A2X A;  2KI4 C;  2GGZ A;  4AQI A;  4NDC A;  1K9P A;  1AJ5 A;  2LHI A;  1KK7 Y;  3PN7 C;  5J3X A;  3TDI A;  2LMT A;  1J1D A;  1NWD A;  2LVV A;  4GNK B;  1TTX A;  5IBW A;  3HCM A;  1YRU B;  1KQM C;  4Q04 A;  1A75 B;  1K8U A;  1V1G A;  1PSR A;  4C0K A;  1CKK A;  1K2H A;  5GQQ C;  1SYM A;  1WY9 A;  1L2O C;  3TZ1 A;  4PHM A;  1A75 A;  2M29 A;  4HSZ A;  2F3Z A;  4DS7 A;  4PE1 A;  1NYA A;  4DUQ A;  3GOF A;  2JZI A;  4PE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...