3TS5B

Crystal structure of a light chain domain of scallop smooth muscle myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
ARLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Myosin heavy chain
total genus 45
structure length 142
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B01
1B8RA 1F4QA 1ODBA 1ALWA 1E8AA 1QX7A 1RK9A 1SKTA 1ZUZA 5FYXA 3ZNIA 4PE7A 1XVJA 1OOJA 3O78A 5CSFA 1IQ3A 1M63B 3BUMB 1ZACA 4PE0A 1SRAA 2JWWA 1TNQA 3KEVA 2I94A 3EK4A 5DKQA 4QJ4B 2K61A 2OTGC 3OX5A 3NSIA 1KQMC 1LA3A 4BY5A 1GGWA 2ZN8A 3PALA 2L50A 1C7VA 2WCEA 5DKNA 1OQPA 1SCVA 1RROA 2JZIA 3SIBA 1QIVA 1CLBA 3PATA 2MJWB 3SG7A 1NPQA 2GV5A 1QXPA 2AMIA 2KBIA 2ZNEA 3SG3A 1UHKA 4YRUA 3KO0A 4R1EA 2WORA 3OB2B 5B8IB 1DGVA 2PALA 3KF9A 4GBAA 1XFWO 1CLMA 1XK4C 1YUSA 1WRLA 3GK2A 4YGEB 1YVHA 2JXCA 1BLQA 1HT9A 4E68A 1EG3A 1RWYA 1KK7Y 1AP4A 2QPTA 1IH0A 2KGBC 4QJ3B 2OPOA 1F8HA 2Q4UA 1PSRA 2L5XB 2I18A 3AAJA 2KAXA 2EGDA 3FWBA 3WNXB 3AAKA 1XA5A 5KU1A 1D1OA 2KNEA 1JWDA 1C07A 3A4UB 1RFJA 1NCZA 1A29A 1DF0A 5D69A 4C0KA 2ZN9A 3TDZA 5AEQA 3NSOA 3OX6A 3HCMA 3CS1A 2E30A 2F3ZA 3TZ1A 1BF5A 2LVVA 2KYCA 1YUUA 1LINA 1IKUA 5K89A 1SBJA 1L2OC 4U8DA 3I5FB 4DRWA 1BJFA 3F45A 1AVSA 3O4YA 2KHNA 1WY9A 2LMUA 5HKWA 1VRKA 2F33A 3EVVA 2O60A 2M9GA 1QATA 1XK4A 1MQ1A 2Y5IA 2LV7A 3DF0A 1MF8B 5CPVA 1B8LA 2LHIA 1SL9A 2NCPA 3I5IB 1K9KA 1AJ5A 1OMRA 2JPTA 3K21A 1WLMA 1R2UA 2EC6B 2KI6D 2MHHA 2AAOA 2KOTA 2LNKA 1H4BA 4XJKA 3NSKA 2JU0A 4DIRA 4GGNA 1CLLA 4ETOA 4WQ2A 3I5HC 2LP3A 1S5GZ 5I2QA 1UWOA 1FBVA 1G33A 1S5GY 3QRXA 1KFXL 1CFFA 2EC6C 5BPJA 1EXRA 1K94A 3TDIA 1MHOA 1F4OA 1IWQA 1WRKA 1SPYA 3VRQA 1RTP1 1Y0VH 2BCXA 1M46A 5CSNA 4MZLA 2R2IA 2LM5A 3DD4A 1H8BA 2JT8A 1UUSA 3I5HB 1N65A 3TS5B 3FS7A 2SASA 2JNFA 3RM1A 3SG6A 1W7IB 2CBLA 2MRDA 1N2DA 4N1FA 4WRIA 5ER5A 1UHJA 1YURA 2GGZA 4N5XA 2BKHB 4C0JA 5KTYA 5PALA 2JQ6A 1WDCB 3ZWHA 1K8UA 2BL0C 3IQQA 2K2FA 1IQ5A 4WQ3A 2JTTA 1OMVA 3NSLA 4L9MA 2KGRA 5GQQC 2M3WA 4YGBB 3ICBA 2P6BB 2L51A 1ALVA 1KWOC 1KCYA 1WDCC 2LLUA 4YGAA 1DTLA 4YGDB 2PASA 4MRXA 1WRZA 2KAVA 1GJYA 4GPLB 1QV0A 1JC2A 1UHHA 1CDLA 4BY4A 1NIWA 1S6CA 2FOTA 2BBMA 2KFHA 3SJSA 1JUOA 2B1UA 4PALA 1M45A 2KFFA 4I5LB 3SG2A 2LLTA 2LVJA 1MR8A 3TDUA 1DMOA 4MBEA 5J3XA 1XFZO 1IJ5A 1FI5A 5HKZA 2JT3A 1RJVA 3DVMA 1JFJA 2MA2A 1YRUB 1OMDA 2Y1MA 3PLFB 2LHLA 3JVTC 2HF5A 2JRFA 1L2OB 1QLKA 2FJUB 2MLEC 1KWOB 1TNXA 4CFRA 2BL0B 1CFCA 1CKKA 2KAYA 2KBMA 1NSHA 1SL7A 1EL4A 2M1UA 1YRTB 5IBWA 1Y6WA 1G8IA 1TN4A 4M2OA 2KI4C 2V53A 1K2HA 2BECA 2DOQA 3PSRA 3OB1B 2MBXA 3TUYC 5ER4X 1TIZA 1ZMZA 3VGOA 2KI6C 2CCMA 1SCMC 1JF0A 3EKHA 3GOFA 1J55A 4I5JA 2COLB 5HYDA 3BQ3A 3LCPC 1GGZA 2GGMA 4D1EA 2KQ6A 1ZFSA 2A4JA 2BCAA 1V1FA 1DT7B 2ZNDA 5HLOA 1KQMB 1DJGA 3SG5A 5G08A 3CTNA 1PRWA 2WCFA 4GAOA 1TNPA 3VRNA 1QIWA 4GUKA 1AK8A 1N0YA 5HLVA 1OZOA 1NX0A 3BUOB 1CMFA 4HRHA 3KPXA 1NYAA 1S1EA 4MZJA 2L98A 3M0WA 1CMGA 1QVIZ 2LCPA 4YI9A 1FI6A 1XYDA 2NXQA 4AOMA 4M2PA 4QJ5B 3OP0A 5DKRA 2HQ8A 1XFYO 3KHEA 3LLEA 1J7PA 1A75A 2WNDA 1S3PA 5HKYA 1KFUS 1MXEA 3CLNA 1OE9B 1CFDA 4NDDA 3SIAA 4PDZA 2K7OA 2M0RA 1BU3A 3DF0B 1KFUL 1K9PA 1W7JB 4A4CA 2CTNA 1WLZA 2I7AA 1AHRA 1OSAA 2JTZA 1QLSA 1NX1A 1S6JA 1SY9A 4USLA 2FCEA 2RGIA 5AXIA 1SNLA 1QX5B 2PVBA 1QS7A 3EVRA 2H2KA 2L4IA 2LUXA 1K93D 1L7ZA 2H61C 2BE6A 3WXAA 3WHTB 4GGFA 1B1GA 1FW4A 1S26D 5CSJA 1S36A 3LK1A 4ORCB 1UHNA 4OCIA 2ZKMX 2LE9B 3BOWA 1PVAA 1SK6D 1EG4A 1BT6A 3TUYB 1PULA 1K96A 1PVBA 2LMVA 4MN0A 1CM1A 1Y1AA 4OVNF 1V1GA 1R6PA 1YX8A 3OHMB 1JFKA 3TS5C 2LP2A 1F70A 2JT0A 1J7RA 5D7FA 1QASA 4GGFC 2LLSA 1F55A 1M31A 2H61A 3VROA 1F54A 1Q80A 2CNPA 2Q91A 3VRRA 4I5KA 1MWNA 3EK7A 1B7TZ 2HQWA 1K90D 1BR1B 2CT9A 4DS7A 2ISDA 2KDHA 1CDMA 3HX4A 3I5FC 1DJZA 1U5IA 3BUXB 1CNPA 1CM4A 3BUNB 1G4YR 1NX2A 2F2PA 3H4SE 3PN7B 4OKHA 1AUIB 3O6BA 1TCOB 1XFVO 1J7QA 4FQOA 1SL8A 4PHMA 1KK8C 3D10A 1JSAA 1S6IA 1YX7A 1X02A 1UP5A 1B4CA 2Y1NA 1DGUA 3CWGA 4Q04A 5CSIA 1TCFA 2L2EA 1YTZC 3DVKA 4NDBA 2K8MB 1EJ3A 1RECA 3CGAA 4CIDA 1MXLC 2CXJA 1CFPA 2MAZA 2O5GA 2KI4B 2KQYA 1IG5A 3DVEA 2L4HA 2NZ0A 4PHKA 3I5IC 3RLZA 3VRPA 1FF1A 1KSOA 1CDPA 4N1GA 2LANA 4ORBB 1IJ6A 3MSEB 1BODA 4XYNA 2M7NA 4MZKA 4ZCVA 5JOLA 1QTXA 4YGCB 4TNCA 1NUBA 4C0LA 1SMGA 4YI8A 2VRGA 1XO5A 4AQIA 2KFGA 3CR2A 3EK8A 1UURA 2K7BA 3AKAA 2LUCA 3FIAA 1C7WA 4PCWA 4AQJA 4F0ZB 2EHBA 4MVFA 5AFPA 2JNXA 2M97A 1DJYA 2HPSA 1J1DA 2Y4QA 1YUTA 1NX3A 3JTDC 4GFTA 2QACA 1OZSA 1IGVA 1Y1XA 2SCPA 1HQVA 2IS9A 2KYFA 1LVCD 1FPWA 3CR4X 1PSBA 1QJTA 3LL8B 1A2XA 4A4BA 1NCXA 1ZOTB 1YVLA 1CDNA 5AERA 1F71A 4NDCA 2LVKA 3BUWB 3AKBA 2MLFC 4XJKB 1BG1A 1B9AA 1KFXS 2E6WA 5JJGA 2PMYA 2OS8C 1SW8A 3PFVA 1KK8B 1SR6C 3GK4X 4HSZA 3CZTX 1BMOA 1B8CA 4ORAB 4ICBA 3I5GC 4PHJA 1A4PA 1A75B 1K9UA 2BKIB 1XFXO 1XFUO 2K2AA 4P2YB 1CB1A 2F8PA 5I2LA 3I5GB 4I5NB 2BE4A 2K7DA 3SG4A 2D8NA 2F3YA 1KSMA 4MRYA 1LKJA 5TNCA 1J1EA 2JULA 4DCKA 1DJHA 3PM8A 1BOCA 3BYAA 2ZFDA 1AJ4A 3LK0A 4CLNA 1B7TY 1KK7Z 4HRGA 2LMTA 1KQVA 1JF2A 1TOPA 2LC5A 1UHIA 2WCBA 3C1VA 3EVUA 4JWQA 1PALA 1SR6B 2JOJA 3E3RA 4PE1A 3WHUB 1A03A 2OS8B 1YR5A 2I2RE 1J7OA 3FWCA 3IF7A 2WOSA 2AUCA 2F2OA 1CTRA 1DF0B 4MLWA 1Y1UA 3EKJA 1QVIY 2K7CA 3JVTB 2HETA 4PE4A 4JQ0D 2M1KB 2K0JA 1MUXA 4CFQA 2JXLA 4JPZB 1SYMA 5AANA 1EH2A 1TRFA 3D0YA 1LA0A 2ZRSA 3JTDB 1TNWA 4OR9B 1NP8A 1PK0D 1DJWA 1QV1A 1IRJA 1DVIA 2L0PA 2PSRA 1QX2A 4GNKB 1BR4B 4UPGA 2BCBA 2TN4A 2NLNA 1M39A 2KSPA 4DUQA 2JC2A 1NWDA 1SCMB 3GK1A 2PRUA 4ZCUA 4HREE 2M29A 1DJIA 1U5IB 3PN7C 1NCYA 2LVIA 2FCDA 2OTGB 3O2PA 3A8RA 4P5OE 5KSZA 3CR5X 3BOWB 2M7LA 2BBNA 2G2BA 3IQOA 3D0YB 1K95A 4CPVA 4NQGA 2WC8A 4MSPA 2M49B 1B47A 3BXKA 2M8UA 2ZRTA 4OV2A 4M2QA 4FTGA 1JBAA 4MEWA 5F6TA 3DVJA 2NCOA 5I2OA 3NXAA 4IL1A 5I8NA 4YBHB 4PHNA 1GQMA 1DJXA 1TTXA 2LAPA 1LXFC 2G9BA
chains in the Genus database with same CATH superfamily
1B8RA 1SSEB 1IIOA 1F4QA 1ODBA 1ALWA 1E8AA 1QX7A 1RK9A 1SKTA 1ZUZA 3D75A 5FYXA 3ZNIA 4PE7A 1XVJA 1OOJA 3O78A 5CSFA 1IQ3A 1M63B 3BUMB 1ZACA 4PE0A 1SRAA 1T14A 2JWWA 1TNQA 3KEVA 2I94A 3EK4A 2WCMA 5DKQA 4QJ4B 2K61A 2QEHA 2OTGC 2QEVA 3OX5A 3NSIA 2WCKA 1KQMC 1LA3A 4BY5A 1GGWA 2ZN8A 3PALA 2L50A 1C7VA 2WCEA 5DKNA 3CABA 1OQPA 1SCVA 3QMEA 1C3ZA 1RROA 2JZIA 3SIBA 1QIVA 1CLBA 3PATA 2MJWB 3PJIA 3SG7A 1NPQA 2GV5A 1QXPA 2AMIA 2ERBA 2KBIA 2ZNEA 3SG3A 1UHKA 4YRUA 3KO0A 2WCLA 3B87A 2WORA 4R1EA 3OB2B 5B8IB 1DGVA 2PALA 3KF9A 4GBAA 1XFWO 1CLMA 1XK4C 3VB1A 1YUSA 1WRLA 3GK2A 4KYNA 3O4XA 4YGEB 1YVHA 2JXCA 1BLQA 1HT9A 4E68A 1EG3A 1RWYA 1KK7Y 3R1OA 2QPTA 3SS4A 1AP4A 1IH0A 2KGBC 4QJ3B 2OPOA 1F8HA 2Q4UA 1PSRA 2L5XB 2BNXA 2I18A 3AAJA 2KAXA 2EGDA 3FWBA 3WNXB 3FE8A 3AAKA 1XA5A 5KU1A 1D1OA 2KNEA 1JWDA 1C07A 3A4UB 3S0AA 1RFJA 1NCZA 3R72A 1A29A 1DF0A 5D69A 4C0KA 2ZN9A 5EL2A 3TDZA 5AEQA 3NSOA 3UNWA 2GTEA 3OX6A 3HCMA 1TUZA 2E30A 2F3ZA 2WC6A 3CS1A 3TZ1A 1BF5A 5FI6A 2LVVA 1OOGA 2KYCA 1YUUA 1LINA 1IKUA 5K89A 1SBJA 1L2OC 4U8DA 1TUJA 3I5FB 4DRWA 1BJFA 3D74A 3F45A 1AVSA 3O4YA 2KHNA 1WY9A 2LMUA 5HKWA 4F7FA 1VRKA 2F33A 3EVVA 2O60A 3DYEA 2M9GA 1QATA 1XK4A 1MQ1A 2Y5IA 2LV7A 3DF0A 1MF8B 5CPVA 1B8LA 2LHIA 1SL9A 2NCPA 3I5IB 1K9KA 1AJ5A 1OMRA 2JPTA 3K21A 1WLMA 1R2UA 2EC6B 2KI6D 2MHHA 2AAOA 2KOTA 2LNKA 1H4BA 4XJKA 3NSKA 2JU0A 4DIRA 4GGNA 1CLLA 4ETOA 4WQ2A 3I5HC 2LP3A 1S5GZ 3FE6A 5I2QA 1UWOA 1FBVA 1G33A 1S5GY 3QRXA 1KFXL 1CFFA 2EC6C 5BPJA 1EXRA 1K94A 2L5YA 1MHOA 1F4OA 1IWQA 1WRKA 1SPYA 3TDIA 1RTP1 1Y0VH 2BCXA 1M46A 5CSNA 3VRQA 4MZLA 2R2IA 2LM5A 3DD4A 1H8BA 2JT8A 1UUSA 3I5HB 4IJ7A 1N65A 3TS5B 3FS7A 2SASA 2JNFA 3RM1A 1DELA 3SG6A 1W7IB 2CBLA 2MRDA 1N2DA 3DXLA 4N1FA 4WRIA 5ER5A 1UHJA 2PYQA 1YURA 2GGZA 4N5XA 2BKHB 4C0JA 5KTYA 3RZSA 5PALA 2P71A 2JQ6A 1WDCB 3ZWHA 1K8UA 2BL0C 3IQQA 2K2FA 1IQ5A 4WQ3A 2JTTA 1OMVA 3NSLA 4L9MA 2KGRA 5GQQC 2M3WA 4YGBB 3ICBA 2P6BB 2L51A 1ALVA 5HL1A 1KWOC 1KCYA 1WDCC 2LLUA 4YGAA 1DTLA 3NHIA 4YGDB 2PASA 4MRXA 1WRZA 1DEKA 2KAVA 4JKTA 1GJYA 4GPLB 1QV0A 1JC2A 1UHHA 4INWA 1CDLA 2QEBA 4BY4A 1NIWA 1S6CA 2FOTA 2BBMA 2KFHA 3SJSA 3CZ0A 1JUOA 2B1UA 4PALA 1M45A 2KFFA 4I5LB 3SG2A 2LLTA 2LVJA 1MR8A 3TDUA 1DMOA 2BAPA 4MBEA 5J3XA 1XFZO 1IJ5A 1FI5A 5HKZA 2JT3A 1RJVA 1ORGA 3DVMA 1JFJA 2MA2A 1YRUB 1OMDA 2Y1MA 3SS5A 3PLFB 2LHLA 3JVTC 2HF5A 2JRFA 1L2OB 3CDNA 1QLKA 2FJUB 2MLEC 1KWOB 1TNXA 4CFRA 2BL0B 1CFCA 1CKKA 2KAYA 2KBMA 1NSHA 3D77A 1SL7A 1EL4A 2M1UA 1YRTB 5IBWA 2PQLA 1Y6WA 1G8IA 1TN4A 4M2OA 2KI4C 2V53A 1K2HA 2BECA 2DOQA 3PSRA 3OB1B 2MBXA 3D78A 3TUYC 5ER4X 1TIZA 1ZMZA 3VGOA 2KI6C 2CCMA 2QDIA 3EG5B 1SCMC 1JF0A 3CYZA 3EKHA 3S0DA 2KLEA 3GOFA 1J55A 4I5JA 3NHTA 2COLB 5HYDA 3BQ3A 3L47A 3LCPC 1GGZA 2GGMA 4D1EA 2KQ6A 1ZFSA 2A4JA 2BCAA 1V1FA 1DT7B 2ZNDA 5HLOA 1KQMB 1DJGA 3SG5A 5G08A 3CTNA 1PRWA 2WCFA 3N7HA 1TNPA 4GAOA 3DY9A 3VRNA 1QIWA 4GUKA 1AK8A 1N0YA 5HLVA 1OZOA 1NX0A 3BUOB 1CMFA 4HRHA 3KPXA 1NYAA 1S1EA 4MZJA 2L98A 3M0WA 1CMGA 1QVIZ 2LCPA 2WCJA 4YI9A 1FI6A 1XYDA 2NXQA 4AOMA 4M2PA 4QJ5B 3OP0A 5DKRA 2HQ8A 1XFYO 3KHEA 3LLEA 4JD9A 1J7PA 1A75A 1P28A 2QEOA 2WNDA 1S3PA 5HKYA 1KFUS 1MXEA 3CLNA 1OE9B 1CFDA 4NDDA 3SIAA 4PDZA 2K7OA 1OOHA 2M0RA 2WCHA 1DC1A 1BU3A 3DF0B 1KFUL 1K9PA 3IVTA 2KLDA 1W7JB 4FQTA 2CTNA 4A4CA 1WLZA 2I7AA 1AHRA 1OSAA 2JTZA 1QLSA 1NX1A 1S6JA 1SY9A 4USLA 2FCEA 2RGIA 5AXIA 5FI2A 1SNLA 1QX5B 2PVBA 1QS7A 3EVRA 3R1PA 3S0FA 2H2KA 2L4IA 2LUXA 1K93D 1L7ZA 2H61C 2BE6A 3WXAA 3WHTB 4GGFA 1B1GA 2P70A 1FW4A 1S26D 5CSJA 1S36A 3LK1A 4ORCB 1UHNA 4OCIA 2ZKMX 2LE9B 3BOWA 1PVAA 1SK6D 1EG4A 1BT6A 3TUYB 1PULA 1K96A 1PVBA 2LMVA 4MN0A 1CM1A 1Y1AA 4OVNF 1Z4HA 1V1GA 1R6PA 3OBVA 1YX8A 3OHMB 1JFKA 3TS5C 2LP2A 2WC5A 1F70A 2JT0A 1J7RA 5D7FA 1QASA 4GGFC 2LLSA 1F55A 1M31A 2H61A 3NGVA 3VROA 1F54A 1Q80A 1W9ZA 2CNPA 2Q91A 3VRRA 4I5KA 1MWNA 3EK7A 1B7TZ 1OOFA 2HQWA 1K90D 1BR1B 2CT9A 4DS7A 2ISDA 3K1EA 2KDHA 1CDMA 3HX4A 3I5FC 1DJZA 1U5IA 3BUXB 1CNPA 1CM4A 3BUNB 1G4YR 1NX2A 2F2PA 3H4SE 3PN7B 4OKHA 1AUIB 3BFBA 3O6BA 1TCOB 1XFVO 1J7QA 4FQOA 1SL8A 4PHMA 1KK8C 3D10A 1JSAA 1S6IA 1YX7A 1X02A 1UP5A 1B4CA 2Y1NA 1DGUA 1TWOA 3CWGA 4Q04A 5DICA 5CSIA 2H8VA 1TCFA 2L2EA 1YTZC 3DVKA 4NDBA 2K8MB 4INXA 1EJ3A 1RECA 3CGAA 4CIDA 3BJHA 1MXLC 2CXJA 1OW4A 1CFPA 2MAZA 2O5GA 3DZTA 3L4AA 2KI4B 2KQYA 1IG5A 3DVEA 2L4HA 2NZ0A 4PHKA 3I5IC 4OZDA 3RLZA 3VRPA 1FF1A 1KSOA 1CDPA 1GM0A 4N1GA 2LANA 4ORBB 1IJ6A 1LS8A 3MSEB 3S0EA 1Z2CB 4XYNA 1BODA 2M7NA 4MZKA 1DQEA 4ZCVA 5JOLA 1QTXA 4YGCB 4TNCA 1NUBA 4C0LA 1SMGA 4YI8A 2VRGA 1XO5A 4AQIA 2KFGA 3CR2A 3EK8A 1UURA 2K7BA 3AKAA 2LUCA 3FIAA 3FE9A 3S0GA 1C7WA 4PCWA 4AQJA 4F0ZB 2EHBA 3D76A 3OGNA 4MVFA 5AFPA 2JNXA 2M97A 1DJYA 2HPSA 3BFAA 1J1DA 3BFHA 2Y4QA 1YUTA 1NX3A 3JTDC 3S0BA 4GFTA 2QACA 1OZSA 1IGVA 1Y1XA 2SCPA 1HQVA 3SS3A 2IS9A 2KYFA 1LVCD 1FPWA 3CR4X 1PSBA 1QJTA 3LL8B 1A2XA 4A4BA 1NCXA 2FJYA 1ZOTB 1YVLA 3PM2A 5I94A 1C3YA 1CDNA 3R1VA 5AERA 1F71A 4NDCA 2LVKA 3BUWB 3AKBA 4PT1A 2MLFC 2YGUA 4XJKB 1BG1A 1B9AA 1KFXS 2E6WA 5JJGA 2PMYA 2OS8C 1SW8A 3PFVA 1QWVA 1KK8B 1SR6C 3GK4X 4HSZA 3CZTX 1BMOA 1B8CA 4ORAB 4ICBA 3I5GC 4PHJA 1A4PA 1A75B 1K9UA 2BKIB 1XFXO 3B7AA 1XFUO 2K2AA 4P2YB 1CB1A 2F8PA 5I2LA 3I5GB 4I5NB 2BE4A 2K7DA 3SG4A 2D8NA 2F3YA 1KSMA 4MRYA 1LKJA 5TNCA 1J1EA 2JULA 4DCKA 1DJHA 3PM8A 1BOCA 3BYAA 2ZFDA 1AJ4A 3CZ2A 3LK0A 4CLNA 1B7TY 1KK7Z 4HRGA 2LMTA 3B88A 1KQVA 1JF2A 1TOPA 2LC5A 1UHIA 2WCBA 1OOIX 3C1VA 3EVUA 4JWQA 1PALA 3L4LA 1SR6B 2JOJA 3E3RA 4PE1A 3WHUB 1XFRA 1A03A 2OS8B 1YR5A 2I2RE 1J7OA 3FWCA 3IF7A 3UO9A 2WOSA 2AUCA 2F2OA 1CTRA 1DF0B 4MLWA 1Y1UA 3EKJA 1QVIY 3B6XA 2K7CA 3JVTB 2HETA 4PE4A 4JQ0D 2M1KB 2K0JA 1MUXA 4CFQA 2JXLA 4JPZB 1SYMA 5AANA 1EH2A 1TRFA 3D0YA 1LA0A 2ZRSA 3JTDB 1TNWA 4OR9B 1NP8A 1PK0D 1DJWA 1QV1A 1IRJA 2L2CA 1DVIA 2L0PA 2PSRA 1QX2A 4GNKB 1BR4B 4UPGA 2BCBA 2TN4A 3V2LA 2NLNA 1M39A 2KSPA 4DUQA 2JC2A 1NWDA 1SCMB 3D73A 2PRUA 3B86A 3GK1A 4ZCUA 4HREE 2M29A 1DJIA 1U5IB 3PN7C 5D3OA 1NCYA 2LVIA 2FCDA 2OTGB 3O2PA 3A8RA 4P5OE 5KSZA 3CR5X 3BOWB 2M7LA 2BBNA 2G2BA 3IQOA 3D0YB 1K95A 4CPVA 2JPOA 4NQGA 2WC8A 2K60A 4MSPA 2M49B 1B47A 3BXKA 2M8UA 2ZRTA 4OV2A 4M2QA 5FI7A 4FTGA 3Q8IA 1JBAA 4MEWA 5F6TA 3DVJA 2NCOA 3CZ1A 2KPHA 5I2OA 3NXAA 4IL1A 5I8NA 4YBHB 4PHNA 1GQMA 1DJXA 1TTXA 2LAPA 1LXFC 2G9BA
chains in the Genus database with same CATH topology
1B8RA 1F4QA 1ODBA 1ALWA 1E8AA 1QX7A 1RK9A 1SKTA 1ZUZA 5FYXA 3ZNIA 4PE7A 1XVJA 1OOJA 3O78A 5CSFA 1IQ3A 1M63B 3BUMB 1ZACA 4PE0A 1SRAA 2JWWA 1TNQA 3KEVA 2I94A 3EK4A 5DKQA 4QJ4B 2K61A 2OTGC 3OX5A 3NSIA 1KQMC 1LA3A 4BY5A 1GGWA 2ZN8A 3PALA 2L50A 1C7VA 2WCEA 5DKNA 1OQPA 1SCVA 1RROA 2JZIA 3SIBA 1QIVA 1CLBA 3PATA 2MJWB 3SG7A 1NPQA 2GV5A 1QXPA 2AMIA 2KBIA 2ZNEA 3SG3A 1UHKA 4YRUA 3KO0A 4R1EA 2WORA 3OB2B 5B8IB 1DGVA 2PALA 3KF9A 4GBAA 1XFWO 1CLMA 1XK4C 1YUSA 1WRLA 3GK2A 4YGEB 1YVHA 2JXCA 1BLQA 1HT9A 4E68A 1EG3A 1RWYA 1KK7Y 1AP4A 2QPTA 1IH0A 2KGBC 4QJ3B 2OPOA 1F8HA 2Q4UA 1PSRA 2L5XB 2I18A 3AAJA 2KAXA 2EGDA 3FWBA 3WNXB 3AAKA 1XA5A 5KU1A 1D1OA 2KNEA 1JWDA 1C07A 3A4UB 1RFJA 1NCZA 1A29A 1DF0A 5D69A 4C0KA 2ZN9A 3TDZA 5AEQA 3NSOA 3OX6A 3HCMA 3CS1A 2E30A 2F3ZA 3TZ1A 1BF5A 2LVVA 2KYCA 1YUUA 1LINA 1IKUA 5K89A 1SBJA 1L2OC 4U8DA 3I5FB 4DRWA 1BJFA 3F45A 1AVSA 3O4YA 2KHNA 1WY9A 2LMUA 5HKWA 1VRKA 2F33A 3EVVA 2O60A 2M9GA 1QATA 1XK4A 1MQ1A 2Y5IA 2LV7A 3DF0A 1MF8B 5CPVA 1B8LA 2LHIA 1SL9A 2NCPA 3I5IB 1K9KA 1AJ5A 1OMRA 2JPTA 3K21A 1WLMA 1R2UA 2EC6B 2KI6D 2MHHA 2AAOA 2KOTA 2LNKA 1H4BA 4XJKA 3NSKA 2JU0A 4DIRA 4GGNA 1CLLA 4ETOA 4WQ2A 3I5HC 2LP3A 1S5GZ 5I2QA 1UWOA 1FBVA 1G33A 1S5GY 3QRXA 1KFXL 1CFFA 2EC6C 5BPJA 1EXRA 1K94A 3TDIA 1MHOA 1F4OA 1IWQA 1WRKA 1SPYA 3VRQA 1RTP1 1Y0VH 2BCXA 1M46A 5CSNA 4MZLA 2R2IA 2LM5A 3DD4A 1H8BA 2JT8A 1UUSA 3I5HB 1N65A 3TS5B 3FS7A 2SASA 2JNFA 3RM1A 3SG6A 1W7IB 2CBLA 2MRDA 1N2DA 4N1FA 4WRIA 5ER5A 1UHJA 1YURA 2GGZA 4N5XA 2BKHB 4C0JA 5KTYA 5PALA 2JQ6A 1WDCB 3ZWHA 1K8UA 2BL0C 3IQQA 2K2FA 1IQ5A 4WQ3A 2JTTA 1OMVA 3NSLA 4L9MA 2KGRA 5GQQC 2M3WA 4YGBB 3ICBA 2P6BB 2L51A 1ALVA 1KWOC 1KCYA 1WDCC 2LLUA 4YGAA 1DTLA 4YGDB 2PASA 4MRXA 1WRZA 2KAVA 1GJYA 4GPLB 1QV0A 1JC2A 1UHHA 1CDLA 4BY4A 1NIWA 1S6CA 2FOTA 2BBMA 2KFHA 3SJSA 1JUOA 2B1UA 4PALA 1M45A 2KFFA 4I5LB 3SG2A 2LLTA 2LVJA 1MR8A 3TDUA 1DMOA 4MBEA 5J3XA 1XFZO 1IJ5A 1FI5A 5HKZA 2JT3A 1RJVA 3DVMA 1JFJA 2MA2A 1YRUB 1OMDA 2Y1MA 3PLFB 2LHLA 3JVTC 2HF5A 2JRFA 1L2OB 1QLKA 2FJUB 2MLEC 1KWOB 1TNXA 4CFRA 2BL0B 1CFCA 1CKKA 2KAYA 2KBMA 1NSHA 1SL7A 1EL4A 2M1UA 1YRTB 5IBWA 1Y6WA 1G8IA 1TN4A 4M2OA 2KI4C 2V53A 1K2HA 2BECA 2DOQA 3PSRA 3OB1B 2MBXA 3TUYC 5ER4X 1TIZA 1ZMZA 3VGOA 2KI6C 2CCMA 1SCMC 1JF0A 3EKHA 3GOFA 1J55A 4I5JA 2COLB 5HYDA 3BQ3A 3LCPC 1GGZA 2GGMA 4D1EA 2KQ6A 1ZFSA 2A4JA 2BCAA 1V1FA 1DT7B 2ZNDA 5HLOA 1KQMB 1DJGA 3SG5A 5G08A 3CTNA 1PRWA 2WCFA 4GAOA 1TNPA 3VRNA 1QIWA 4GUKA 1AK8A 1N0YA 5HLVA 1OZOA 1NX0A 3BUOB 1CMFA 4HRHA 3KPXA 1NYAA 1S1EA 4MZJA 2L98A 3M0WA 1CMGA 1QVIZ 2LCPA 4YI9A 1FI6A 1XYDA 2NXQA 4AOMA 4M2PA 4QJ5B 3OP0A 5DKRA 2HQ8A 1XFYO 3KHEA 3LLEA 1J7PA 1A75A 2WNDA 1S3PA 5HKYA 1KFUS 1MXEA 3CLNA 1OE9B 1CFDA 4NDDA 3SIAA 4PDZA 2K7OA 2M0RA 1BU3A 3DF0B 1KFUL 1K9PA 1W7JB 4A4CA 2CTNA 1WLZA 2I7AA 1AHRA 1OSAA 2JTZA 1QLSA 1NX1A 1S6JA 1SY9A 4USLA 2FCEA 2RGIA 5AXIA 1SNLA 1QX5B 2PVBA 1QS7A 3EVRA 2H2KA 2L4IA 2LUXA 1K93D 1L7ZA 2H61C 2BE6A 3WXAA 3WHTB 4GGFA 1B1GA 1FW4A 1S26D 5CSJA 1S36A 3LK1A 4ORCB 1UHNA 4OCIA 2ZKMX 2LE9B 3BOWA 1PVAA 1SK6D 1EG4A 1BT6A 3TUYB 1PULA 1K96A 1PVBA 2LMVA 4MN0A 1CM1A 1Y1AA 4OVNF 1V1GA 1R6PA 1YX8A 3OHMB 1JFKA 3TS5C 2LP2A 1F70A 2JT0A 1J7RA 5D7FA 1QASA 4GGFC 2LLSA 1F55A 1M31A 2H61A 3VROA 1F54A 1Q80A 2CNPA 2Q91A 3VRRA 4I5KA 1MWNA 3EK7A 1B7TZ 2HQWA 1K90D 1BR1B 2CT9A 4DS7A 2ISDA 2KDHA 1CDMA 3HX4A 3I5FC 1DJZA 1U5IA 3BUXB 1CNPA 1CM4A 3BUNB 1G4YR 1NX2A 2F2PA 3H4SE 3PN7B 4OKHA 1AUIB 3O6BA 1TCOB 1XFVO 1J7QA 4FQOA 1SL8A 4PHMA 1KK8C 3D10A 1JSAA 1S6IA 1YX7A 1X02A 1UP5A 1B4CA 2Y1NA 1DGUA 3CWGA 4Q04A 5CSIA 1TCFA 2L2EA 1YTZC 3DVKA 4NDBA 2K8MB 1EJ3A 1RECA 3CGAA 4CIDA 1MXLC 2CXJA 1CFPA 2MAZA 2O5GA 2KI4B 2KQYA 1IG5A 3DVEA 2L4HA 2NZ0A 4PHKA 3I5IC 3RLZA 3VRPA 1FF1A 1KSOA 1CDPA 4N1GA 2LANA 4ORBB 1IJ6A 3MSEB 1BODA 4XYNA 2M7NA 4MZKA 4ZCVA 5JOLA 1QTXA 4YGCB 4TNCA 1NUBA 4C0LA 1SMGA 4YI8A 2VRGA 1XO5A 4AQIA 2KFGA 3CR2A 3EK8A 1UURA 2K7BA 3AKAA 2LUCA 3FIAA 1C7WA 4PCWA 4AQJA 4F0ZB 2EHBA 4MVFA 5AFPA 2JNXA 2M97A 1DJYA 2HPSA 1J1DA 2Y4QA 1YUTA 1NX3A 3JTDC 4GFTA 2QACA 1OZSA 1IGVA 1Y1XA 2SCPA 1HQVA 2IS9A 2KYFA 1LVCD 1FPWA 3CR4X 1PSBA 1QJTA 3LL8B 1A2XA 4A4BA 1NCXA 1ZOTB 1YVLA 1CDNA 5AERA 1F71A 4NDCA 2LVKA 3BUWB 3AKBA 2MLFC 4XJKB 1BG1A 1B9AA 1KFXS 2E6WA 5JJGA 2PMYA 2OS8C 1SW8A 3PFVA 1KK8B 1SR6C 3GK4X 4HSZA 3CZTX 1BMOA 1B8CA 4ORAB 4ICBA 3I5GC 4PHJA 1A4PA 1A75B 1K9UA 2BKIB 1XFXO 1XFUO 2K2AA 4P2YB 1CB1A 2F8PA 5I2LA 3I5GB 4I5NB 2BE4A 2K7DA 3SG4A 2D8NA 2F3YA 1KSMA 4MRYA 1LKJA 5TNCA 1J1EA 2JULA 4DCKA 1DJHA 3PM8A 1BOCA 3BYAA 2ZFDA 1AJ4A 3LK0A 4CLNA 1B7TY 1KK7Z 4HRGA 2LMTA 1KQVA 1JF2A 1TOPA 2LC5A 1UHIA 2WCBA 3C1VA 3EVUA 4JWQA 1PALA 1SR6B 2JOJA 3E3RA 4PE1A 3WHUB 1A03A 2OS8B 1YR5A 2I2RE 1J7OA 3FWCA 3IF7A 2WOSA 2AUCA 2F2OA 1CTRA 1DF0B 4MLWA 1Y1UA 3EKJA 1QVIY 2K7CA 3JVTB 2HETA 4PE4A 4JQ0D 2M1KB 2K0JA 1MUXA 4CFQA 2JXLA 4JPZB 1SYMA 5AANA 1EH2A 1TRFA 3D0YA 1LA0A 2ZRSA 3JTDB 1TNWA 4OR9B 1NP8A 1PK0D 1DJWA 1QV1A 1IRJA 1DVIA 2L0PA 2PSRA 1QX2A 4GNKB 1BR4B 4UPGA 2BCBA 2TN4A 2NLNA 1M39A 2KSPA 4DUQA 2JC2A 1NWDA 1SCMB 3GK1A 2PRUA 4ZCUA 4HREE 2M29A 1DJIA 1U5IB 3PN7C 1NCYA 2LVIA 2FCDA 2OTGB 3O2PA 3A8RA 4P5OE 5KSZA 3CR5X 3BOWB 2M7LA 2BBNA 2G2BA 3IQOA 3D0YB 1K95A 4CPVA 4NQGA 2WC8A 4MSPA 2M49B 1B47A 3BXKA 2M8UA 2ZRTA 4OV2A 4M2QA 4FTGA 1JBAA 4MEWA 5F6TA 3DVJA 2NCOA 5I2OA 3NXAA 4IL1A 5I8NA 4YBHB 4PHNA 1GQMA 1DJXA 1TTXA 2LAPA 1LXFC 2G9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8R A;  1F4Q A;  1ODB A;  1ALW A;  1E8A A;  1QX7 A;  1RK9 A;  1SKT A;  1ZUZ A;  5FYX A;  3ZNI A;  4PE7 A;  1XVJ A;  1OOJ A;  3O78 A;  5CSF A;  1IQ3 A;  1M63 B;  3BUM B;  1ZAC A;  4PE0 A;  1SRA A;  2JWW A;  1TNQ A;  3KEV A;  2I94 A;  3EK4 A;  5DKQ A;  4QJ4 B;  2K61 A;  2OTG C;  3OX5 A;  3NSI A;  1KQM C;  1LA3 A;  4BY5 A;  1GGW A;  2ZN8 A;  3PAL A;  2L50 A;  1C7V A;  2WCE A;  5DKN A;  1OQP A;  1SCV A;  1RRO A;  2JZI A;  3SIB A;  1QIV A;  1CLB A;  3PAT A;  2MJW B;  3SG7 A;  1NPQ A;  2GV5 A;  1QXP A;  2AMI A;  2KBI A;  2ZNE A;  3SG3 A;  1UHK A;  4YRU A;  3KO0 A;  4R1E A;  2WOR A;  3OB2 B;  5B8I B;  1DGV A;  2PAL A;  3KF9 A;  4GBA A;  1XFW O;  1CLM A;  1XK4 C;  1YUS A;  1WRL A;  3GK2 A;  4YGE B;  1YVH A;  2JXC A;  1BLQ A;  1HT9 A;  4E68 A;  1EG3 A;  1RWY A;  1KK7 Y;  1AP4 A;  2QPT A;  1IH0 A;  2KGB C;  4QJ3 B;  2OPO A;  1F8H A;  2Q4U A;  1PSR A;  2L5X B;  2I18 A;  3AAJ A;  2KAX A;  2EGD A;  3FWB A;  3WNX B;  3AAK A;  1XA5 A;  5KU1 A;  1D1O A;  2KNE A;  1JWD A;  1C07 A;  3A4U B;  1RFJ A;  1NCZ A;  1A29 A;  1DF0 A;  5D69 A;  4C0K A;  2ZN9 A;  3TDZ A;  5AEQ A;  3NSO A;  3OX6 A;  3HCM A;  3CS1 A;  2E30 A;  2F3Z A;  3TZ1 A;  1BF5 A;  2LVV A;  2KYC A;  1YUU A;  1LIN A;  1IKU A;  5K89 A;  1SBJ A;  1L2O C;  4U8D A;  3I5F B;  4DRW A;  1BJF A;  3F45 A;  1AVS A;  3O4Y A;  2KHN A;  1WY9 A;  2LMU A;  5HKW A;  1VRK A;  2F33 A;  3EVV A;  2O60 A;  2M9G A;  1QAT A;  1XK4 A;  1MQ1 A;  2Y5I A;  2LV7 A;  3DF0 A;  1MF8 B;  5CPV A;  1B8L A;  2LHI A;  1SL9 A;  2NCP A;  3I5I B;  1K9K A;  1AJ5 A;  1OMR A;  2JPT A;  3K21 A;  1WLM A;  1R2U A;  2EC6 B;  2KI6 D;  2MHH A;  2AAO A;  2KOT A;  2LNK A;  1H4B A;  4XJK A;  3NSK A;  2JU0 A;  4DIR A;  4GGN A;  1CLL A;  4ETO A;  4WQ2 A;  3I5H C;  2LP3 A;  1S5G Z;  5I2Q A;  1UWO A;  1FBV A;  1G33 A;  1S5G Y;  3QRX A;  1KFX L;  1CFF A;  2EC6 C;  5BPJ A;  1EXR A;  1K94 A;  3TDI A;  1MHO A;  1F4O A;  1IWQ A;  1WRK A;  1SPY A;  3VRQ A;  1RTP 1;  1Y0V H;  2BCX A;  1M46 A;  5CSN A;  4MZL A;  2R2I A;  2LM5 A;  3DD4 A;  1H8B A;  2JT8 A;  1UUS A;  3I5H B;  1N65 A;  3TS5 B;  3FS7 A;  2SAS A;  2JNF A;  3RM1 A;  3SG6 A;  1W7I B;  2CBL A;  2MRD A;  1N2D A;  4N1F A;  4WRI A;  5ER5 A;  1UHJ A;  1YUR A;  2GGZ A;  4N5X A;  2BKH B;  4C0J A;  5KTY A;  5PAL A;  2JQ6 A;  1WDC B;  3ZWH A;  1K8U A;  2BL0 C;  3IQQ A;  2K2F A;  1IQ5 A;  4WQ3 A;  2JTT A;  1OMV A;  3NSL A;  4L9M A;  2KGR A;  5GQQ C;  2M3W A;  4YGB B;  3ICB A;  2P6B B;  2L51 A;  1ALV A;  1KWO C;  1KCY A;  1WDC C;  2LLU A;  4YGA A;  1DTL A;  4YGD B;  2PAS A;  4MRX A;  1WRZ A;  2KAV A;  1GJY A;  4GPL B;  1QV0 A;  1JC2 A;  1UHH A;  1CDL A;  4BY4 A;  1NIW A;  1S6C A;  2FOT A;  2BBM A;  2KFH A;  3SJS A;  1JUO A;  2B1U A;  4PAL A;  1M45 A;  2KFF A;  4I5L B;  3SG2 A;  2LLT A;  2LVJ A;  1MR8 A;  3TDU A;  1DMO A;  4MBE A;  5J3X A;  1XFZ O;  1IJ5 A;  1FI5 A;  5HKZ A;  2JT3 A;  1RJV A;  3DVM A;  1JFJ A;  2MA2 A;  1YRU B;  1OMD A;  2Y1M A;  3PLF B;  2LHL A;  3JVT C;  2HF5 A;  2JRF A;  1L2O B;  1QLK A;  2FJU B;  2MLE C;  1KWO B;  1TNX A;  4CFR A;  2BL0 B;  1CFC A;  1CKK A;  2KAY A;  2KBM A;  1NSH A;  1SL7 A;  1EL4 A;  2M1U A;  1YRT B;  5IBW A;  1Y6W A;  1G8I A;  1TN4 A;  4M2O A;  2KI4 C;  2V53 A;  1K2H A;  2BEC A;  2DOQ A;  3PSR A;  3OB1 B;  2MBX A;  3TUY C;  5ER4 X;  1TIZ A;  1ZMZ A;  3VGO A;  2KI6 C;  2CCM A;  1SCM C;  1JF0 A;  3EKH A;  3GOF A;  1J55 A;  4I5J A;  2COL B;  5HYD A;  3BQ3 A;  3LCP C;  1GGZ A;  2GGM A;  4D1E A;  2KQ6 A;  1ZFS A;  2A4J A;  2BCA A;  1V1F A;  1DT7 B;  2ZND A;  5HLO A;  1KQM B;  1DJG A;  3SG5 A;  5G08 A;  3CTN A;  1PRW A;  2WCF A;  4GAO A;  1TNP A;  3VRN A;  1QIW A;  4GUK A;  1AK8 A;  1N0Y A;  5HLV A;  1OZO A;  1NX0 A;  3BUO B;  1CMF A;  4HRH A;  3KPX A;  1NYA A;  1S1E A;  4MZJ A;  2L98 A;  3M0W A;  1CMG A;  1QVI Z;  2LCP A;  4YI9 A;  1FI6 A;  1XYD A;  2NXQ A;  4AOM A;  4M2P A;  4QJ5 B;  3OP0 A;  5DKR A;  2HQ8 A;  1XFY O;  3KHE A;  3LLE A;  1J7P A;  1A75 A;  2WND A;  1S3P A;  5HKY A;  1KFU S;  1MXE A;  3CLN A;  1OE9 B;  1CFD A;  4NDD A;  3SIA A;  4PDZ A;  2K7O A;  2M0R A;  1BU3 A;  3DF0 B;  1KFU L;  1K9P A;  1W7J B;  4A4C A;  2CTN A;  1WLZ A;  2I7A A;  1AHR A;  1OSA A;  2JTZ A;  1QLS A;  1NX1 A;  1S6J A;  1SY9 A;  4USL A;  2FCE A;  2RGI A;  5AXI A;  1SNL A;  1QX5 B;  2PVB A;  1QS7 A;  3EVR A;  2H2K A;  2L4I A;  2LUX A;  1K93 D;  1L7Z A;  2H61 C;  2BE6 A;  3WXA A;  3WHT B;  4GGF A;  1B1G A;  1FW4 A;  1S26 D;  5CSJ A;  1S36 A;  3LK1 A;  4ORC B;  1UHN A;  4OCI A;  2ZKM X;  2LE9 B;  3BOW A;  1PVA A;  1SK6 D;  1EG4 A;  1BT6 A;  3TUY B;  1PUL A;  1K96 A;  1PVB A;  2LMV A;  4MN0 A;  1CM1 A;  1Y1A A;  4OVN F;  1V1G A;  1R6P A;  1YX8 A;  3OHM B;  1JFK A;  3TS5 C;  2LP2 A;  1F70 A;  2JT0 A;  1J7R A;  5D7F A;  1QAS A;  4GGF C;  2LLS A;  1F55 A;  1M31 A;  2H61 A;  3VRO A;  1F54 A;  1Q80 A;  2CNP A;  2Q91 A;  3VRR A;  4I5K A;  1MWN A;  3EK7 A;  1B7T Z;  2HQW A;  1K90 D;  1BR1 B;  2CT9 A;  4DS7 A;  2ISD A;  2KDH A;  1CDM A;  3HX4 A;  3I5F C;  1DJZ A;  1U5I A;  3BUX B;  1CNP A;  1CM4 A;  3BUN B;  1G4Y R;  1NX2 A;  2F2P A;  3H4S E;  3PN7 B;  4OKH A;  1AUI B;  3O6B A;  1TCO B;  1XFV O;  1J7Q A;  4FQO A;  1SL8 A;  4PHM A;  1KK8 C;  3D10 A;  1JSA A;  1S6I A;  1YX7 A;  1X02 A;  1UP5 A;  1B4C A;  2Y1N A;  1DGU A;  3CWG A;  4Q04 A;  5CSI A;  1TCF A;  2L2E A;  1YTZ C;  3DVK A;  4NDB A;  2K8M B;  1EJ3 A;  1REC A;  3CGA A;  4CID A;  1MXL C;  2CXJ A;  1CFP A;  2MAZ A;  2O5G A;  2KI4 B;  2KQY A;  1IG5 A;  3DVE A;  2L4H A;  2NZ0 A;  4PHK A;  3I5I C;  3RLZ A;  3VRP A;  1FF1 A;  1KSO A;  1CDP A;  4N1G A;  2LAN A;  4ORB B;  1IJ6 A;  3MSE B;  1BOD A;  4XYN A;  2M7N A;  4MZK A;  4ZCV A;  5JOL A;  1QTX A;  4YGC B;  4TNC A;  1NUB A;  4C0L A;  1SMG A;  4YI8 A;  2VRG A;  1XO5 A;  4AQI A;  2KFG A;  3CR2 A;  3EK8 A;  1UUR A;  2K7B A;  3AKA A;  2LUC A;  3FIA A;  1C7W A;  4PCW A;  4AQJ A;  4F0Z B;  2EHB A;  4MVF A;  5AFP A;  2JNX A;  2M97 A;  1DJY A;  2HPS A;  1J1D A;  2Y4Q A;  1YUT A;  1NX3 A;  3JTD C;  4GFT A;  2QAC A;  1OZS A;  1IGV A;  1Y1X A;  2SCP A;  1HQV A;  2IS9 A;  2KYF A;  1LVC D;  1FPW A;  3CR4 X;  1PSB A;  1QJT A;  3LL8 B;  1A2X A;  4A4B A;  1NCX A;  1ZOT B;  1YVL A;  1CDN A;  5AER A;  1F71 A;  4NDC A;  2LVK A;  3BUW B;  3AKB A;  2MLF C;  4XJK B;  1BG1 A;  1B9A A;  1KFX S;  2E6W A;  5JJG A;  2PMY A;  2OS8 C;  1SW8 A;  3PFV A;  1KK8 B;  1SR6 C;  3GK4 X;  4HSZ A;  3CZT X;  1BMO A;  1B8C A;  4ORA B;  4ICB A;  3I5G C;  4PHJ A;  1A4P A;  1A75 B;  1K9U A;  2BKI B;  1XFX O;  1XFU O;  2K2A A;  4P2Y B;  1CB1 A;  2F8P A;  5I2L A;  3I5G B;  4I5N B;  2BE4 A;  2K7D A;  3SG4 A;  2D8N A;  2F3Y A;  1KSM A;  4MRY A;  1LKJ A;  5TNC A;  1J1E A;  2JUL A;  4DCK A;  1DJH A;  3PM8 A;  1BOC A;  3BYA A;  2ZFD A;  1AJ4 A;  3LK0 A;  4CLN A;  1B7T Y;  1KK7 Z;  4HRG A;  2LMT A;  1KQV A;  1JF2 A;  1TOP A;  2LC5 A;  1UHI A;  2WCB A;  3C1V A;  3EVU A;  4JWQ A;  1PAL A;  1SR6 B;  2JOJ A;  3E3R A;  4PE1 A;  3WHU B;  1A03 A;  2OS8 B;  1YR5 A;  2I2R E;  1J7O A;  3FWC A;  3IF7 A;  2WOS A;  2AUC A;  2F2O A;  1CTR A;  1DF0 B;  4MLW A;  1Y1U A;  3EKJ A;  1QVI Y;  2K7C A;  3JVT B;  2HET A;  4PE4 A;  4JQ0 D;  2M1K B;  2K0J A;  1MUX A;  4CFQ A;  2JXL A;  4JPZ B;  1SYM A;  5AAN A;  1EH2 A;  1TRF A;  3D0Y A;  1LA0 A;  2ZRS A;  3JTD B;  1TNW A;  4OR9 B;  1NP8 A;  1PK0 D;  1DJW A;  1QV1 A;  1IRJ A;  1DVI A;  2L0P A;  2PSR A;  1QX2 A;  4GNK B;  1BR4 B;  4UPG A;  2BCB A;  2TN4 A;  2NLN A;  1M39 A;  2KSP A;  4DUQ A;  2JC2 A;  1NWD A;  1SCM B;  3GK1 A;  2PRU A;  4ZCU A;  4HRE E;  2M29 A;  1DJI A;  1U5I B;  3PN7 C;  1NCY A;  2LVI A;  2FCD A;  2OTG B;  3O2P A;  3A8R A;  4P5O E;  5KSZ A;  3CR5 X;  3BOW B;  2M7L A;  2BBN A;  2G2B A;  3IQO A;  3D0Y B;  1K95 A;  4CPV A;  4NQG A;  2WC8 A;  4MSP A;  2M49 B;  1B47 A;  3BXK A;  2M8U A;  2ZRT A;  4OV2 A;  4M2Q A;  4FTG A;  1JBA A;  4MEW A;  5F6T A;  3DVJ A;  2NCO A;  5I2O A;  3NXA A;  4IL1 A;  5I8N A;  4YBH B;  4PHN A;  1GQM A;  1DJX A;  1TTX A;  2LAP A;  1LXF C;  2G9B A; 
#chains in the Genus database with same CATH topology
 1B8R A;  1SSE B;  1IIO A;  1F4Q A;  1ODB A;  1ALW A;  1E8A A;  1QX7 A;  1RK9 A;  1SKT A;  1ZUZ A;  3D75 A;  5FYX A;  3ZNI A;  4PE7 A;  1XVJ A;  1OOJ A;  3O78 A;  5CSF A;  1IQ3 A;  1M63 B;  3BUM B;  1ZAC A;  4PE0 A;  1SRA A;  1T14 A;  2JWW A;  1TNQ A;  3KEV A;  2I94 A;  3EK4 A;  2WCM A;  5DKQ A;  4QJ4 B;  2K61 A;  2QEH A;  2OTG C;  2QEV A;  3OX5 A;  3NSI A;  2WCK A;  1KQM C;  1LA3 A;  4BY5 A;  1GGW A;  2ZN8 A;  3PAL A;  2L50 A;  1C7V A;  2WCE A;  5DKN A;  3CAB A;  1OQP A;  1SCV A;  3QME A;  1C3Z A;  1RRO A;  2JZI A;  3SIB A;  1QIV A;  1CLB A;  3PAT A;  2MJW B;  3PJI A;  3SG7 A;  1NPQ A;  2GV5 A;  1QXP A;  2AMI A;  2ERB A;  2KBI A;  2ZNE A;  3SG3 A;  1UHK A;  4YRU A;  3KO0 A;  2WCL A;  3B87 A;  2WOR A;  4R1E A;  3OB2 B;  5B8I B;  1DGV A;  2PAL A;  3KF9 A;  4GBA A;  1XFW O;  1CLM A;  1XK4 C;  3VB1 A;  1YUS A;  1WRL A;  3GK2 A;  4KYN A;  3O4X A;  4YGE B;  1YVH A;  2JXC A;  1BLQ A;  1HT9 A;  4E68 A;  1EG3 A;  1RWY A;  1KK7 Y;  3R1O A;  2QPT A;  3SS4 A;  1AP4 A;  1IH0 A;  2KGB C;  4QJ3 B;  2OPO A;  1F8H A;  2Q4U A;  1PSR A;  2L5X B;  2BNX A;  2I18 A;  3AAJ A;  2KAX A;  2EGD A;  3FWB A;  3WNX B;  3FE8 A;  3AAK A;  1XA5 A;  5KU1 A;  1D1O A;  2KNE A;  1JWD A;  1C07 A;  3A4U B;  3S0A A;  1RFJ A;  1NCZ A;  3R72 A;  1A29 A;  1DF0 A;  5D69 A;  4C0K A;  2ZN9 A;  5EL2 A;  3TDZ A;  5AEQ A;  3NSO A;  3UNW A;  2GTE A;  3OX6 A;  3HCM A;  1TUZ A;  2E30 A;  2F3Z A;  2WC6 A;  3CS1 A;  3TZ1 A;  1BF5 A;  5FI6 A;  2LVV A;  1OOG A;  2KYC A;  1YUU A;  1LIN A;  1IKU A;  5K89 A;  1SBJ A;  1L2O C;  4U8D A;  1TUJ A;  3I5F B;  4DRW A;  1BJF A;  3D74 A;  3F45 A;  1AVS A;  3O4Y A;  2KHN A;  1WY9 A;  2LMU A;  5HKW A;  4F7F A;  1VRK A;  2F33 A;  3EVV A;  2O60 A;  3DYE A;  2M9G A;  1QAT A;  1XK4 A;  1MQ1 A;  2Y5I A;  2LV7 A;  3DF0 A;  1MF8 B;  5CPV A;  1B8L A;  2LHI A;  1SL9 A;  2NCP A;  3I5I B;  1K9K A;  1AJ5 A;  1OMR A;  2JPT A;  3K21 A;  1WLM A;  1R2U A;  2EC6 B;  2KI6 D;  2MHH A;  2AAO A;  2KOT A;  2LNK A;  1H4B A;  4XJK A;  3NSK A;  2JU0 A;  4DIR A;  4GGN A;  1CLL A;  4ETO A;  4WQ2 A;  3I5H C;  2LP3 A;  1S5G Z;  3FE6 A;  5I2Q A;  1UWO A;  1FBV A;  1G33 A;  1S5G Y;  3QRX A;  1KFX L;  1CFF A;  2EC6 C;  5BPJ A;  1EXR A;  1K94 A;  2L5Y A;  1MHO A;  1F4O A;  1IWQ A;  1WRK A;  1SPY A;  3TDI A;  1RTP 1;  1Y0V H;  2BCX A;  1M46 A;  5CSN A;  3VRQ A;  4MZL A;  2R2I A;  2LM5 A;  3DD4 A;  1H8B A;  2JT8 A;  1UUS A;  3I5H B;  4IJ7 A;  1N65 A;  3TS5 B;  3FS7 A;  2SAS A;  2JNF A;  3RM1 A;  1DEL A;  3SG6 A;  1W7I B;  2CBL A;  2MRD A;  1N2D A;  3DXL A;  4N1F A;  4WRI A;  5ER5 A;  1UHJ A;  2PYQ A;  1YUR A;  2GGZ A;  4N5X A;  2BKH B;  4C0J A;  5KTY A;  3RZS A;  5PAL A;  2P71 A;  2JQ6 A;  1WDC B;  3ZWH A;  1K8U A;  2BL0 C;  3IQQ A;  2K2F A;  1IQ5 A;  4WQ3 A;  2JTT A;  1OMV A;  3NSL A;  4L9M A;  2KGR A;  5GQQ C;  2M3W A;  4YGB B;  3ICB A;  2P6B B;  2L51 A;  1ALV A;  5HL1 A;  1KWO C;  1KCY A;  1WDC C;  2LLU A;  4YGA A;  1DTL A;  3NHI A;  4YGD B;  2PAS A;  4MRX A;  1WRZ A;  1DEK A;  2KAV A;  4JKT A;  1GJY A;  4GPL B;  1QV0 A;  1JC2 A;  1UHH A;  4INW A;  1CDL A;  2QEB A;  4BY4 A;  1NIW A;  1S6C A;  2FOT A;  2BBM A;  2KFH A;  3SJS A;  3CZ0 A;  1JUO A;  2B1U A;  4PAL A;  1M45 A;  2KFF A;  4I5L B;  3SG2 A;  2LLT A;  2LVJ A;  1MR8 A;  3TDU A;  1DMO A;  2BAP A;  4MBE A;  5J3X A;  1XFZ O;  1IJ5 A;  1FI5 A;  5HKZ A;  2JT3 A;  1RJV A;  1ORG A;  3DVM A;  1JFJ A;  2MA2 A;  1YRU B;  1OMD A;  2Y1M A;  3SS5 A;  3PLF B;  2LHL A;  3JVT C;  2HF5 A;  2JRF A;  1L2O B;  3CDN A;  1QLK A;  2FJU B;  2MLE C;  1KWO B;  1TNX A;  4CFR A;  2BL0 B;  1CFC A;  1CKK A;  2KAY A;  2KBM A;  1NSH A;  3D77 A;  1SL7 A;  1EL4 A;  2M1U A;  1YRT B;  5IBW A;  2PQL A;  1Y6W A;  1G8I A;  1TN4 A;  4M2O A;  2KI4 C;  2V53 A;  1K2H A;  2BEC A;  2DOQ A;  3PSR A;  3OB1 B;  2MBX A;  3D78 A;  3TUY C;  5ER4 X;  1TIZ A;  1ZMZ A;  3VGO A;  2KI6 C;  2CCM A;  2QDI A;  3EG5 B;  1SCM C;  1JF0 A;  3CYZ A;  3EKH A;  3S0D A;  2KLE A;  3GOF A;  1J55 A;  4I5J A;  3NHT A;  2COL B;  5HYD A;  3BQ3 A;  3L47 A;  3LCP C;  1GGZ A;  2GGM A;  4D1E A;  2KQ6 A;  1ZFS A;  2A4J A;  2BCA A;  1V1F A;  1DT7 B;  2ZND A;  5HLO A;  1KQM B;  1DJG A;  3SG5 A;  5G08 A;  3CTN A;  1PRW A;  2WCF A;  3N7H A;  1TNP A;  4GAO A;  3DY9 A;  3VRN A;  1QIW A;  4GUK A;  1AK8 A;  1N0Y A;  5HLV A;  1OZO A;  1NX0 A;  3BUO B;  1CMF A;  4HRH A;  3KPX A;  1NYA A;  1S1E A;  4MZJ A;  2L98 A;  3M0W A;  1CMG A;  1QVI Z;  2LCP A;  2WCJ A;  4YI9 A;  1FI6 A;  1XYD A;  2NXQ A;  4AOM A;  4M2P A;  4QJ5 B;  3OP0 A;  5DKR A;  2HQ8 A;  1XFY O;  3KHE A;  3LLE A;  4JD9 A;  1J7P A;  1A75 A;  1P28 A;  2QEO A;  2WND A;  1S3P A;  5HKY A;  1KFU S;  1MXE A;  3CLN A;  1OE9 B;  1CFD A;  4NDD A;  3SIA A;  4PDZ A;  2K7O A;  1OOH A;  2M0R A;  2WCH A;  1DC1 A;  1BU3 A;  3DF0 B;  1KFU L;  1K9P A;  3IVT A;  2KLD A;  1W7J B;  4FQT A;  2CTN A;  4A4C A;  1WLZ A;  2I7A A;  1AHR A;  1OSA A;  2JTZ A;  1QLS A;  1NX1 A;  1S6J A;  1SY9 A;  4USL A;  2FCE A;  2RGI A;  5AXI A;  5FI2 A;  1SNL A;  1QX5 B;  2PVB A;  1QS7 A;  3EVR A;  3R1P A;  3S0F A;  2H2K A;  2L4I A;  2LUX A;  1K93 D;  1L7Z A;  2H61 C;  2BE6 A;  3WXA A;  3WHT B;  4GGF A;  1B1G A;  2P70 A;  1FW4 A;  1S26 D;  5CSJ A;  1S36 A;  3LK1 A;  4ORC B;  1UHN A;  4OCI A;  2ZKM X;  2LE9 B;  3BOW A;  1PVA A;  1SK6 D;  1EG4 A;  1BT6 A;  3TUY B;  1PUL A;  1K96 A;  1PVB A;  2LMV A;  4MN0 A;  1CM1 A;  1Y1A A;  4OVN F;  1Z4H A;  1V1G A;  1R6P A;  3OBV A;  1YX8 A;  3OHM B;  1JFK A;  3TS5 C;  2LP2 A;  2WC5 A;  1F70 A;  2JT0 A;  1J7R A;  5D7F A;  1QAS A;  4GGF C;  2LLS A;  1F55 A;  1M31 A;  2H61 A;  3NGV A;  3VRO A;  1F54 A;  1Q80 A;  1W9Z A;  2CNP A;  2Q91 A;  3VRR A;  4I5K A;  1MWN A;  3EK7 A;  1B7T Z;  1OOF A;  2HQW A;  1K90 D;  1BR1 B;  2CT9 A;  4DS7 A;  2ISD A;  3K1E A;  2KDH A;  1CDM A;  3HX4 A;  3I5F C;  1DJZ A;  1U5I A;  3BUX B;  1CNP A;  1CM4 A;  3BUN B;  1G4Y R;  1NX2 A;  2F2P A;  3H4S E;  3PN7 B;  4OKH A;  1AUI B;  3BFB A;  3O6B A;  1TCO B;  1XFV O;  1J7Q A;  4FQO A;  1SL8 A;  4PHM A;  1KK8 C;  3D10 A;  1JSA A;  1S6I A;  1YX7 A;  1X02 A;  1UP5 A;  1B4C A;  2Y1N A;  1DGU A;  1TWO A;  3CWG A;  4Q04 A;  5DIC A;  5CSI A;  2H8V A;  1TCF A;  2L2E A;  1YTZ C;  3DVK A;  4NDB A;  2K8M B;  4INX A;  1EJ3 A;  1REC A;  3CGA A;  4CID A;  3BJH A;  1MXL C;  2CXJ A;  1OW4 A;  1CFP A;  2MAZ A;  2O5G A;  3DZT A;  3L4A A;  2KI4 B;  2KQY A;  1IG5 A;  3DVE A;  2L4H A;  2NZ0 A;  4PHK A;  3I5I C;  4OZD A;  3RLZ A;  3VRP A;  1FF1 A;  1KSO A;  1CDP A;  1GM0 A;  4N1G A;  2LAN A;  4ORB B;  1IJ6 A;  1LS8 A;  3MSE B;  3S0E A;  1Z2C B;  4XYN A;  1BOD A;  2M7N A;  4MZK A;  1DQE A;  4ZCV A;  5JOL A;  1QTX A;  4YGC B;  4TNC A;  1NUB A;  4C0L A;  1SMG A;  4YI8 A;  2VRG A;  1XO5 A;  4AQI A;  2KFG A;  3CR2 A;  3EK8 A;  1UUR A;  2K7B A;  3AKA A;  2LUC A;  3FIA A;  3FE9 A;  3S0G A;  1C7W A;  4PCW A;  4AQJ A;  4F0Z B;  2EHB A;  3D76 A;  3OGN A;  4MVF A;  5AFP A;  2JNX A;  2M97 A;  1DJY A;  2HPS A;  3BFA A;  1J1D A;  3BFH A;  2Y4Q A;  1YUT A;  1NX3 A;  3JTD C;  3S0B A;  4GFT A;  2QAC A;  1OZS A;  1IGV A;  1Y1X A;  2SCP A;  1HQV A;  3SS3 A;  2IS9 A;  2KYF A;  1LVC D;  1FPW A;  3CR4 X;  1PSB A;  1QJT A;  3LL8 B;  1A2X A;  4A4B A;  1NCX A;  2FJY A;  1ZOT B;  1YVL A;  3PM2 A;  5I94 A;  1C3Y A;  1CDN A;  3R1V A;  5AER A;  1F71 A;  4NDC A;  2LVK A;  3BUW B;  3AKB A;  4PT1 A;  2MLF C;  2YGU A;  4XJK B;  1BG1 A;  1B9A A;  1KFX S;  2E6W A;  5JJG A;  2PMY A;  2OS8 C;  1SW8 A;  3PFV A;  1QWV A;  1KK8 B;  1SR6 C;  3GK4 X;  4HSZ A;  3CZT X;  1BMO A;  1B8C A;  4ORA B;  4ICB A;  3I5G C;  4PHJ A;  1A4P A;  1A75 B;  1K9U A;  2BKI B;  1XFX O;  3B7A A;  1XFU O;  2K2A A;  4P2Y B;  1CB1 A;  2F8P A;  5I2L A;  3I5G B;  4I5N B;  2BE4 A;  2K7D A;  3SG4 A;  2D8N A;  2F3Y A;  1KSM A;  4MRY A;  1LKJ A;  5TNC A;  1J1E A;  2JUL A;  4DCK A;  1DJH A;  3PM8 A;  1BOC A;  3BYA A;  2ZFD A;  1AJ4 A;  3CZ2 A;  3LK0 A;  4CLN A;  1B7T Y;  1KK7 Z;  4HRG A;  2LMT A;  3B88 A;  1KQV A;  1JF2 A;  1TOP A;  2LC5 A;  1UHI A;  2WCB A;  1OOI X;  3C1V A;  3EVU A;  4JWQ A;  1PAL A;  3L4L A;  1SR6 B;  2JOJ A;  3E3R A;  4PE1 A;  3WHU B;  1XFR A;  1A03 A;  2OS8 B;  1YR5 A;  2I2R E;  1J7O A;  3FWC A;  3IF7 A;  3UO9 A;  2WOS A;  2AUC A;  2F2O A;  1CTR A;  1DF0 B;  4MLW A;  1Y1U A;  3EKJ A;  1QVI Y;  3B6X A;  2K7C A;  3JVT B;  2HET A;  4PE4 A;  4JQ0 D;  2M1K B;  2K0J A;  1MUX A;  4CFQ A;  2JXL A;  4JPZ B;  1SYM A;  5AAN A;  1EH2 A;  1TRF A;  3D0Y A;  1LA0 A;  2ZRS A;  3JTD B;  1TNW A;  4OR9 B;  1NP8 A;  1PK0 D;  1DJW A;  1QV1 A;  1IRJ A;  2L2C A;  1DVI A;  2L0P A;  2PSR A;  1QX2 A;  4GNK B;  1BR4 B;  4UPG A;  2BCB A;  2TN4 A;  3V2L A;  2NLN A;  1M39 A;  2KSP A;  4DUQ A;  2JC2 A;  1NWD A;  1SCM B;  3D73 A;  2PRU A;  3B86 A;  3GK1 A;  4ZCU A;  4HRE E;  2M29 A;  1DJI A;  1U5I B;  3PN7 C;  5D3O A;  1NCY A;  2LVI A;  2FCD A;  2OTG B;  3O2P A;  3A8R A;  4P5O E;  5KSZ A;  3CR5 X;  3BOW B;  2M7L A;  2BBN A;  2G2B A;  3IQO A;  3D0Y B;  1K95 A;  4CPV A;  2JPO A;  4NQG A;  2WC8 A;  2K60 A;  4MSP A;  2M49 B;  1B47 A;  3BXK A;  2M8U A;  2ZRT A;  4OV2 A;  4M2Q A;  5FI7 A;  4FTG A;  3Q8I A;  1JBA A;  4MEW A;  5F6T A;  3DVJ A;  2NCO A;  3CZ1 A;  2KPH A;  5I2O A;  3NXA A;  4IL1 A;  5I8N A;  4YBH B;  4PHN A;  1GQM A;  1DJX A;  1TTX A;  2LAP A;  1LXF C;  2G9B A; 
#chains in the Genus database with same CATH homology
 1B8R A;  1F4Q A;  1ODB A;  1ALW A;  1E8A A;  1QX7 A;  1RK9 A;  1SKT A;  1ZUZ A;  5FYX A;  3ZNI A;  4PE7 A;  1XVJ A;  1OOJ A;  3O78 A;  5CSF A;  1IQ3 A;  1M63 B;  3BUM B;  1ZAC A;  4PE0 A;  1SRA A;  2JWW A;  1TNQ A;  3KEV A;  2I94 A;  3EK4 A;  5DKQ A;  4QJ4 B;  2K61 A;  2OTG C;  3OX5 A;  3NSI A;  1KQM C;  1LA3 A;  4BY5 A;  1GGW A;  2ZN8 A;  3PAL A;  2L50 A;  1C7V A;  2WCE A;  5DKN A;  1OQP A;  1SCV A;  1RRO A;  2JZI A;  3SIB A;  1QIV A;  1CLB A;  3PAT A;  2MJW B;  3SG7 A;  1NPQ A;  2GV5 A;  1QXP A;  2AMI A;  2KBI A;  2ZNE A;  3SG3 A;  1UHK A;  4YRU A;  3KO0 A;  4R1E A;  2WOR A;  3OB2 B;  5B8I B;  1DGV A;  2PAL A;  3KF9 A;  4GBA A;  1XFW O;  1CLM A;  1XK4 C;  1YUS A;  1WRL A;  3GK2 A;  4YGE B;  1YVH A;  2JXC A;  1BLQ A;  1HT9 A;  4E68 A;  1EG3 A;  1RWY A;  1KK7 Y;  1AP4 A;  2QPT A;  1IH0 A;  2KGB C;  4QJ3 B;  2OPO A;  1F8H A;  2Q4U A;  1PSR A;  2L5X B;  2I18 A;  3AAJ A;  2KAX A;  2EGD A;  3FWB A;  3WNX B;  3AAK A;  1XA5 A;  5KU1 A;  1D1O A;  2KNE A;  1JWD A;  1C07 A;  3A4U B;  1RFJ A;  1NCZ A;  1A29 A;  1DF0 A;  5D69 A;  4C0K A;  2ZN9 A;  3TDZ A;  5AEQ A;  3NSO A;  3OX6 A;  3HCM A;  3CS1 A;  2E30 A;  2F3Z A;  3TZ1 A;  1BF5 A;  2LVV A;  2KYC A;  1YUU A;  1LIN A;  1IKU A;  5K89 A;  1SBJ A;  1L2O C;  4U8D A;  3I5F B;  4DRW A;  1BJF A;  3F45 A;  1AVS A;  3O4Y A;  2KHN A;  1WY9 A;  2LMU A;  5HKW A;  1VRK A;  2F33 A;  3EVV A;  2O60 A;  2M9G A;  1QAT A;  1XK4 A;  1MQ1 A;  2Y5I A;  2LV7 A;  3DF0 A;  1MF8 B;  5CPV A;  1B8L A;  2LHI A;  1SL9 A;  2NCP A;  3I5I B;  1K9K A;  1AJ5 A;  1OMR A;  2JPT A;  3K21 A;  1WLM A;  1R2U A;  2EC6 B;  2KI6 D;  2MHH A;  2AAO A;  2KOT A;  2LNK A;  1H4B A;  4XJK A;  3NSK A;  2JU0 A;  4DIR A;  4GGN A;  1CLL A;  4ETO A;  4WQ2 A;  3I5H C;  2LP3 A;  1S5G Z;  5I2Q A;  1UWO A;  1FBV A;  1G33 A;  1S5G Y;  3QRX A;  1KFX L;  1CFF A;  2EC6 C;  5BPJ A;  1EXR A;  1K94 A;  3TDI A;  1MHO A;  1F4O A;  1IWQ A;  1WRK A;  1SPY A;  3VRQ A;  1RTP 1;  1Y0V H;  2BCX A;  1M46 A;  5CSN A;  4MZL A;  2R2I A;  2LM5 A;  3DD4 A;  1H8B A;  2JT8 A;  1UUS A;  3I5H B;  1N65 A;  3TS5 B;  3FS7 A;  2SAS A;  2JNF A;  3RM1 A;  3SG6 A;  1W7I B;  2CBL A;  2MRD A;  1N2D A;  4N1F A;  4WRI A;  5ER5 A;  1UHJ A;  1YUR A;  2GGZ A;  4N5X A;  2BKH B;  4C0J A;  5KTY A;  5PAL A;  2JQ6 A;  1WDC B;  3ZWH A;  1K8U A;  2BL0 C;  3IQQ A;  2K2F A;  1IQ5 A;  4WQ3 A;  2JTT A;  1OMV A;  3NSL A;  4L9M A;  2KGR A;  5GQQ C;  2M3W A;  4YGB B;  3ICB A;  2P6B B;  2L51 A;  1ALV A;  1KWO C;  1KCY A;  1WDC C;  2LLU A;  4YGA A;  1DTL A;  4YGD B;  2PAS A;  4MRX A;  1WRZ A;  2KAV A;  1GJY A;  4GPL B;  1QV0 A;  1JC2 A;  1UHH A;  1CDL A;  4BY4 A;  1NIW A;  1S6C A;  2FOT A;  2BBM A;  2KFH A;  3SJS A;  1JUO A;  2B1U A;  4PAL A;  1M45 A;  2KFF A;  4I5L B;  3SG2 A;  2LLT A;  2LVJ A;  1MR8 A;  3TDU A;  1DMO A;  4MBE A;  5J3X A;  1XFZ O;  1IJ5 A;  1FI5 A;  5HKZ A;  2JT3 A;  1RJV A;  3DVM A;  1JFJ A;  2MA2 A;  1YRU B;  1OMD A;  2Y1M A;  3PLF B;  2LHL A;  3JVT C;  2HF5 A;  2JRF A;  1L2O B;  1QLK A;  2FJU B;  2MLE C;  1KWO B;  1TNX A;  4CFR A;  2BL0 B;  1CFC A;  1CKK A;  2KAY A;  2KBM A;  1NSH A;  1SL7 A;  1EL4 A;  2M1U A;  1YRT B;  5IBW A;  1Y6W A;  1G8I A;  1TN4 A;  4M2O A;  2KI4 C;  2V53 A;  1K2H A;  2BEC A;  2DOQ A;  3PSR A;  3OB1 B;  2MBX A;  3TUY C;  5ER4 X;  1TIZ A;  1ZMZ A;  3VGO A;  2KI6 C;  2CCM A;  1SCM C;  1JF0 A;  3EKH A;  3GOF A;  1J55 A;  4I5J A;  2COL B;  5HYD A;  3BQ3 A;  3LCP C;  1GGZ A;  2GGM A;  4D1E A;  2KQ6 A;  1ZFS A;  2A4J A;  2BCA A;  1V1F A;  1DT7 B;  2ZND A;  5HLO A;  1KQM B;  1DJG A;  3SG5 A;  5G08 A;  3CTN A;  1PRW A;  2WCF A;  4GAO A;  1TNP A;  3VRN A;  1QIW A;  4GUK A;  1AK8 A;  1N0Y A;  5HLV A;  1OZO A;  1NX0 A;  3BUO B;  1CMF A;  4HRH A;  3KPX A;  1NYA A;  1S1E A;  4MZJ A;  2L98 A;  3M0W A;  1CMG A;  1QVI Z;  2LCP A;  4YI9 A;  1FI6 A;  1XYD A;  2NXQ A;  4AOM A;  4M2P A;  4QJ5 B;  3OP0 A;  5DKR A;  2HQ8 A;  1XFY O;  3KHE A;  3LLE A;  1J7P A;  1A75 A;  2WND A;  1S3P A;  5HKY A;  1KFU S;  1MXE A;  3CLN A;  1OE9 B;  1CFD A;  4NDD A;  3SIA A;  4PDZ A;  2K7O A;  2M0R A;  1BU3 A;  3DF0 B;  1KFU L;  1K9P A;  1W7J B;  4A4C A;  2CTN A;  1WLZ A;  2I7A A;  1AHR A;  1OSA A;  2JTZ A;  1QLS A;  1NX1 A;  1S6J A;  1SY9 A;  4USL A;  2FCE A;  2RGI A;  5AXI A;  1SNL A;  1QX5 B;  2PVB A;  1QS7 A;  3EVR A;  2H2K A;  2L4I A;  2LUX A;  1K93 D;  1L7Z A;  2H61 C;  2BE6 A;  3WXA A;  3WHT B;  4GGF A;  1B1G A;  1FW4 A;  1S26 D;  5CSJ A;  1S36 A;  3LK1 A;  4ORC B;  1UHN A;  4OCI A;  2ZKM X;  2LE9 B;  3BOW A;  1PVA A;  1SK6 D;  1EG4 A;  1BT6 A;  3TUY B;  1PUL A;  1K96 A;  1PVB A;  2LMV A;  4MN0 A;  1CM1 A;  1Y1A A;  4OVN F;  1V1G A;  1R6P A;  1YX8 A;  3OHM B;  1JFK A;  3TS5 C;  2LP2 A;  1F70 A;  2JT0 A;  1J7R A;  5D7F A;  1QAS A;  4GGF C;  2LLS A;  1F55 A;  1M31 A;  2H61 A;  3VRO A;  1F54 A;  1Q80 A;  2CNP A;  2Q91 A;  3VRR A;  4I5K A;  1MWN A;  3EK7 A;  1B7T Z;  2HQW A;  1K90 D;  1BR1 B;  2CT9 A;  4DS7 A;  2ISD A;  2KDH A;  1CDM A;  3HX4 A;  3I5F C;  1DJZ A;  1U5I A;  3BUX B;  1CNP A;  1CM4 A;  3BUN B;  1G4Y R;  1NX2 A;  2F2P A;  3H4S E;  3PN7 B;  4OKH A;  1AUI B;  3O6B A;  1TCO B;  1XFV O;  1J7Q A;  4FQO A;  1SL8 A;  4PHM A;  1KK8 C;  3D10 A;  1JSA A;  1S6I A;  1YX7 A;  1X02 A;  1UP5 A;  1B4C A;  2Y1N A;  1DGU A;  3CWG A;  4Q04 A;  5CSI A;  1TCF A;  2L2E A;  1YTZ C;  3DVK A;  4NDB A;  2K8M B;  1EJ3 A;  1REC A;  3CGA A;  4CID A;  1MXL C;  2CXJ A;  1CFP A;  2MAZ A;  2O5G A;  2KI4 B;  2KQY A;  1IG5 A;  3DVE A;  2L4H A;  2NZ0 A;  4PHK A;  3I5I C;  3RLZ A;  3VRP A;  1FF1 A;  1KSO A;  1CDP A;  4N1G A;  2LAN A;  4ORB B;  1IJ6 A;  3MSE B;  1BOD A;  4XYN A;  2M7N A;  4MZK A;  4ZCV A;  5JOL A;  1QTX A;  4YGC B;  4TNC A;  1NUB A;  4C0L A;  1SMG A;  4YI8 A;  2VRG A;  1XO5 A;  4AQI A;  2KFG A;  3CR2 A;  3EK8 A;  1UUR A;  2K7B A;  3AKA A;  2LUC A;  3FIA A;  1C7W A;  4PCW A;  4AQJ A;  4F0Z B;  2EHB A;  4MVF A;  5AFP A;  2JNX A;  2M97 A;  1DJY A;  2HPS A;  1J1D A;  2Y4Q A;  1YUT A;  1NX3 A;  3JTD C;  4GFT A;  2QAC A;  1OZS A;  1IGV A;  1Y1X A;  2SCP A;  1HQV A;  2IS9 A;  2KYF A;  1LVC D;  1FPW A;  3CR4 X;  1PSB A;  1QJT A;  3LL8 B;  1A2X A;  4A4B A;  1NCX A;  1ZOT B;  1YVL A;  1CDN A;  5AER A;  1F71 A;  4NDC A;  2LVK A;  3BUW B;  3AKB A;  2MLF C;  4XJK B;  1BG1 A;  1B9A A;  1KFX S;  2E6W A;  5JJG A;  2PMY A;  2OS8 C;  1SW8 A;  3PFV A;  1KK8 B;  1SR6 C;  3GK4 X;  4HSZ A;  3CZT X;  1BMO A;  1B8C A;  4ORA B;  4ICB A;  3I5G C;  4PHJ A;  1A4P A;  1A75 B;  1K9U A;  2BKI B;  1XFX O;  1XFU O;  2K2A A;  4P2Y B;  1CB1 A;  2F8P A;  5I2L A;  3I5G B;  4I5N B;  2BE4 A;  2K7D A;  3SG4 A;  2D8N A;  2F3Y A;  1KSM A;  4MRY A;  1LKJ A;  5TNC A;  1J1E A;  2JUL A;  4DCK A;  1DJH A;  3PM8 A;  1BOC A;  3BYA A;  2ZFD A;  1AJ4 A;  3LK0 A;  4CLN A;  1B7T Y;  1KK7 Z;  4HRG A;  2LMT A;  1KQV A;  1JF2 A;  1TOP A;  2LC5 A;  1UHI A;  2WCB A;  3C1V A;  3EVU A;  4JWQ A;  1PAL A;  1SR6 B;  2JOJ A;  3E3R A;  4PE1 A;  3WHU B;  1A03 A;  2OS8 B;  1YR5 A;  2I2R E;  1J7O A;  3FWC A;  3IF7 A;  2WOS A;  2AUC A;  2F2O A;  1CTR A;  1DF0 B;  4MLW A;  1Y1U A;  3EKJ A;  1QVI Y;  2K7C A;  3JVT B;  2HET A;  4PE4 A;  4JQ0 D;  2M1K B;  2K0J A;  1MUX A;  4CFQ A;  2JXL A;  4JPZ B;  1SYM A;  5AAN A;  1EH2 A;  1TRF A;  3D0Y A;  1LA0 A;  2ZRS A;  3JTD B;  1TNW A;  4OR9 B;  1NP8 A;  1PK0 D;  1DJW A;  1QV1 A;  1IRJ A;  1DVI A;  2L0P A;  2PSR A;  1QX2 A;  4GNK B;  1BR4 B;  4UPG A;  2BCB A;  2TN4 A;  2NLN A;  1M39 A;  2KSP A;  4DUQ A;  2JC2 A;  1NWD A;  1SCM B;  3GK1 A;  2PRU A;  4ZCU A;  4HRE E;  2M29 A;  1DJI A;  1U5I B;  3PN7 C;  1NCY A;  2LVI A;  2FCD A;  2OTG B;  3O2P A;  3A8R A;  4P5O E;  5KSZ A;  3CR5 X;  3BOW B;  2M7L A;  2BBN A;  2G2B A;  3IQO A;  3D0Y B;  1K95 A;  4CPV A;  4NQG A;  2WC8 A;  4MSP A;  2M49 B;  1B47 A;  3BXK A;  2M8U A;  2ZRT A;  4OV2 A;  4M2Q A;  4FTG A;  1JBA A;  4MEW A;  5F6T A;  3DVJ A;  2NCO A;  5I2O A;  3NXA A;  4IL1 A;  5I8N A;  4YBH B;  4PHN A;  1GQM A;  1DJX A;  1TTX A;  2LAP A;  1LXF C;  2G9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...