3TS5B

Crystal structure of a light chain domain of scallop smooth muscle myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
ARLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Myosin heavy chain
total genus 45
structure length 142
sequence length 142
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ts5B01
4M2OA 1X02A 1IQ5A 5KU1A 3O78A 1IQ3A 3SG5A 1BR4B 1K96A 1TCFA 1IJ6A 3NXAA 1XFYO 1RROA 1WRLA 1JWDA 1DJXA 1JFKA 2LLSA 5PALA 1FPWA 5BPJA 1EL4A 1NWDA 2EGDA 3CGAA 3PALA 3PLFB 2LUXA 2L51A 3F45A 4I5JA 3LK1A 1N65A 4CIDA 2EHBA 3FS7A 1DF0B 1A75A 2FJUB 2KOTA 1K9UA 1B1GA 2WCBA 3O4YA 2K8MB 3OB2B 1CNPA 2TN4A 1PSBA 5KSZA 3RM1A 2JU0A 1K93D 3VROA 2BL0B 1A2XA 2OTGC 3BOWB 1DF0A 1QS7A 2F33A 1KFXL 2LVKA 3GK4X 3PSRA 4BY5A 5D69A 2ZN9A 3JVTB 1W7JB 3WNXB 1KSOA 1MXEA 2K7BA 1SBJA 2LCPA 2Y4QA 4I5LB 4QJ4B 3BXKA 3KO0A 1PVAA 1SR6B 4YRUA 1DT7B 4ORCB 4I5KA 1Y0VH 2L4HA 4D1EA 2NCOA 4ORAB 2KAXA 1K9PA 1DJGA 1IRJA 3ICBA 5AANA 2OPOA 2PSRA 3MSEB 3I5GC 5HKZA 2Y1NA 2LMTA 3NSLA 4GPLB 3VRNA 3ZWHA 1EXRA 1IGVA 2KQYA 1VRKA 2LP3A 4I5NB 1J7PA 2IS9A 1YUTA 2GGZA 1RK9A 4YBHB 5DKQA 1DJYA 2M3WA 1OZSA 2K7DA 1AVSA 1TTXA 1A29A 1QIWA 1ODBA 4DIRA 2M7LA 1S26D 2KYCA 2M0RA 1F55A 1MHOA 4DUQA 1XO5A 3E3RA 4FQOA 2L98A 4P2YB 4GAOA 4ZCVA 1YRTB 3TDUA 3NSOA 1TRFA 2LC5A 1KWOB 1EJ3A 1NYAA 3C1VA 2LANA 1XA5A 2L4IA 5I8NA 2K0JA 3AAJA 4A4CA 5DKNA 1EH2A 3SG4A 2NLNA 3CR5X 3TUYB 3FWBA 1TCOB 2COLB 2P6BB 1WDCC 4YGAA 4F0ZB 4GGFA 4PCWA 4JPZB 1AHRA 1SKTA 3I5FC 4QJ5B 2O60A 1CM4A 3I5HC 5HLVA 2ZN8A 1CTRA 3PN7C 2JT0A 2LAPA 2JT8A 3D0YB 4C0LA 5HKYA 1FI5A 1JF0A 3JVTC 2LVVA 4IL1A 1WLMA 2JZIA 4CFRA 2MHHA 2ZKMX 2SCPA 4WQ3A 2E6WA 1CM1A 2F3YA 4HRGA 2LHLA 1QLKA 2KBIA 2QACA 3OB1B 1TNQA 3BUWB 3H4SE 2M1KB 4OVNF 1F54A 2NCPA 1AJ5A 1ZACA 3WHTB 2KAYA 1K2HA 2FOTA 3K21A 1KQVA 1B7TY 3CTNA 3KF9A 1CMFA 2BKIB 1LKJA 1XK4A 3CR4X 1S6JA 4USLA 1QTXA 1K94A 1QVIY 5JOLA 4YGCB 1MR8A 1ALWA 1BU3A 1DJIA 2JNXA 2KHNA 5D7FA 4A4BA 1JBAA 2Q4UA 5AXIA 1TNXA 1YTZC 4GFTA 3I5IB 4FTGA 1QXPA 2KGRA 2E30A 1NX1A 5G08A 3SG2A 1KQMC 1J55A 1OMDA 2KI6D 2Q91A 4QJ3B 1L2OB 1BLQA 2JWWA 1CLMA 2F3ZA 1TNWA 2I94A 1XK4C 1A4PA 4N1FA 4CPVA 2DOQA 2PMYA 3CWGA 4PE7A 4C0JA 1M45A 1CMGA 1XYDA 1BJFA 4XJKB 1M39A 2BE6A 2L50A 2JXLA 1G8IA 1Q80A 1MUXA 4MZLA 1RECA 1SCVA 3OX5A 3BUOB 4MBEA 3GOFA 5CSNA 1SNLA 1GQMA 1U5IA 4MVFA 1M31A 2JULA 3AAKA 5DKRA 4L9MA 1L7ZA 5AFPA 1SCMB 4YGBB 2CTNA 2M29A 3JTDC 4AQJA 4GNKB 1JUOA 4PE4A 2GV5A 2CCMA 4ORBB 4OR9B 1A03A 4DCKA 3CR2A 5AERA 4PE0A 2LMVA 2Y5IA 1KK7Y 3BUXB 3DVMA 5I2QA 3IQQA 3HCMA 1FW4A 4MRXA 4ICBA 1H8BA 2LLUA 3RLZA 1WRZA 4U8DA 2PALA 2B1UA 1XFVO 1IWQA 1ZUZA 2G9BA 1YVLA 2BL0C 2JNFA 2KDHA 2OTGB 3EK8A 3TDIA 3D10A 3BUNB 1YX7A 4YGEB 3TS5B 1IJ5A 2LVIA 1PVBA 3LL8B 1WDCB 3GK1A 3EK7A 5KTYA 2MA2A 2BBMA 1MXLC 1OOJA 1FBVA 1LXFC 1SY9A 1TNPA 2L2EA 2JXCA 1QATA 4ZCUA 1OQPA 1V1FA 5ER5A 1J7QA 1CDPA 1RFJA 1K95A 2O5GA 1QIVA 4UPGA 2EC6C 4M2QA 3I5FB 1DJHA 1S6CA 2KBMA 1RTP1 4GBAA 1SPYA 1SW8A 1CFCA 1QV0A 1B7TZ 1PSRA 1SMGA 1UHHA 3VGOA 4MEWA 1SR6C 4NQGA 1NPQA 1YRUB 2KFHA 3QRXA 1F4OA 1V1GA 1SRAA 1YURA 1XFUO 2CXJA 2KFGA 2LM5A 1XFWO 2WC8A 4AOMA 1B4CA 1Y1AA 2JT3A 4YI8A 2JTZA 1BG1A 2JRFA 3EK4A 1EG3A 1N0YA 4BY4A 4WRIA 3BQ3A 1E8AA 1UWOA 1XFXO 1YUSA 1S1EA 3DVEA 3IF7A 1LA0A 4OCIA 5CSFA 3VRPA 1KFUS 1AK8A 1MWNA 2KQ6A 2JPTA 1DTLA 1KFXS 1Y1XA 2WOSA 3EKJA 1D1OA 2HF5A 3LCPC 2L5XB 4PDZA 1N2DA 1BOCA 4MRYA 2K61A 3SG7A 3OHMB 2G2BA 1BR1B 3ZNIA 2I2RE 2M1UA 4XYNA 1AP4A 3SG6A 1S5GY 3CLNA 3EVVA 1UHNA 1WLZA 1NX2A 4HSZA 1OMVA 2NZ0A 2EC6B 4C0KA 3D0YA 3NSKA 5I2OA 1JF2A 1QVIZ 1HT9A 1C07A 4DRWA 4HRHA 4MN0A 4WQ2A 5I2LA 3GK2A 4E68A 2VRGA 1PK0D 5HYDA 1QV1A 2CT9A 1JC2A 1F70A 2QPTA 4NDBA 1J1DA 1CFPA 3TZ1A 2F8PA 2HPSA 1CDMA 3OX6A 3I5GB 4N1GA 2HETA 4MLWA 1NIWA 2A4JA 2KAVA 3NSIA 2I7AA 2PRUA 2Y1MA 1DVIA 2MLEC 5HKWA 4GGFC 1TIZA 2GGMA 1WRKA 1S36A 1ALVA 2NXQA 2KI4B 2F2PA 1QLSA 5CPVA 4GUKA 1ZFSA 3BUMB 2CNPA 2FCEA 1GJYA 1QJTA 2BCXA 2KI4C 2LV7A 2MJWB 2PASA 1CKKA 1CB1A 2M8UA 2ZNDA 2R2IA 2MAZA 2LLTA 1YUUA 4CLNA 4JWQA 1NCZA 4NDCA 4NDDA 4N5XA 1DGUA 1UHJA 1Y1UA 3FIAA 2PVBA 1S5GZ 1XFZO 1BT6A 1CDLA 1UURA 4P5OE 1H4BA 1QX2A 3TUYC 1KWOC 1LINA 1CFDA 2K7CA 4YI9A 1DGVA 2LVJA 1F71A 1KK7Z 4MZJA 5AEQA 3SG3A 4DS7A 3HX4A 2AUCA 2ZRTA 1DJZA 1B47A 4AQIA 1CLBA 2LUCA 3DD4A 2WCFA 1QASA 1UP5A 5F6TA 2KNEA 1B8CA 1IG5A 1DMOA 1S3PA 1NCXA 1UHIA 1OMRA 4MZKA 1WY9A 1TOPA 3PN7B 5J3XA 1G33A 3VRRA 2OS8B 3AKAA 3CS1A 1JFJA 1NCYA 3JTDB 2JQ6A 4YGDB 1PRWA 1RJVA 2LNKA 1NSHA 3PATA 1G4YR 4PHJA 5B8IB 2RGIA 1AJ4A 5TNCA 1OE9B 1HQVA 2H2KA 3WXAA 1C7VA 2LP2A 3DVKA 1PALA 1J7RA 2BECA 5K89A 3EVUA 2WORA 3BYAA 2CBLA 4OKHA 1QX5B 2BKHB 1TN4A 1NX3A 5CSIA 1B8LA 5CSJA 2BCAA 1PULA 1RWYA 3WHUB 2JOJA 4PE1A 1YX8A 1B8RA 5IBWA 1S6IA 2K2FA 5JJGA 1QX7A 3A4UB 1NP8A 1SL8A 4XJKA 5GQQC 4TNCA 1W7IB 1K9KA 1L2OC 3KPXA 1BODA 2D8NA 1MF8B 4HREE 2HQWA 3I5IC 2KGBC 4PHMA 4PHNA 3IQOA 2V53A 1KSMA 2I18A 3PFVA 2MRDA 3TS5C 3TDZA 2ISDA 1GGWA 2M9GA 2BCBA 3BOWA 2FCDA 1U5IB 5ER4X 3LK0A 1KK8C 3DF0A 1M63B 1LVCD 3O6BA 2L0PA 1R2UA 1KK8B 1UHKA 3SIBA 4ETOA 3I5HB 1FI6A 3SJSA 1SCMC 3DF0B 3PM8A 1K90D 2JC2A 1MQ1A 3CZTX 1IH0A 3KHEA 1CFFA 1ZMZA 2ZRSA 2AAOA 2K2AA 3SIAA 1BMOA 2WNDA 1SL9A 1SYMA 2H61C 4OV2A 1B9AA 1FF1A 3DVJA 1AUIB 1M46A 1K8UA 1CDNA 1EG4A 1SK6D 1OSAA 4PHKA 2JTTA 1NX0A 3M0WA 4JQ0D 2LE9B 4CFQA 3AKBA 3FWCA 2H61A 1ZOTB 2ZNEA 2KFFA 2KI6C 3LLEA 3O2PA 4PALA 1A75B 3KEVA 2AMIA 1BF5A 2HQ8A 1F4QA 2BBNA 4R1EA 1OZOA 2BE4A 4MSPA 4GGNA 1J7OA 2LHIA 1LA3A 1KQMB 5FYXA 2KYFA 1R6PA 2ZFDA 1NUBA 2M7NA 2F2OA 3A8RA 3EKHA 1YVHA 1IKUA 1GGZA 2KSPA 3EVRA 3OP0A 1XVJA 1DJWA 1SL7A 2WCEA 5HLOA 1UUSA 1C7WA 2LMUA 2MBXA 2K7OA 2M97A 1KCYA 1J1EA 2MLFC 2M49B 1KFUL 3VRQA 1Y6WA 1YR5A 4M2PA 2OS8C 2SASA 1JSAA 4Q04A 1F8HA 1CLLA
chains in the Genus database with same CATH superfamily
4M2OA 1X02A 1IQ5A 5KU1A 3O78A 1IQ3A 3SG5A 3NGVA 1BR4B 1K96A 1TCFA 1IJ6A 3NXAA 1XFYO 1RROA 1WRLA 1JWDA 1DJXA 1JFKA 2LLSA 5PALA 1FPWA 5BPJA 1EL4A 1NWDA 2EGDA 3CGAA 3PALA 3PLFB 2LUXA 2KLDA 2L51A 3F45A 4I5JA 3RZSA 3LK1A 1N65A 3B7AA 2EHBA 3FS7A 1DELA 1DF0B 1W9ZA 4CIDA 1A75A 2FJUB 2KOTA 1K9UA 1B1GA 2WCBA 3O4YA 2K8MB 3OB2B 1CNPA 2TN4A 1PSBA 3CZ0A 5KSZA 2KLEA 2QEBA 3S0AA 4JD9A 2WCMA 2QEOA 3RM1A 2P70A 2JU0A 1K93D 3VROA 2BL0B 1A2XA 2OTGC 3BOWB 5DICA 1DF0A 1QS7A 2F33A 1KFXL 2LVKA 3GK4X 3PSRA 4BY5A 5D69A 2ZN9A 3D78A 1W7JB 3JVTB 1KSOA 1MXEA 2K7BA 1SBJA 2LCPA 2Y4QA 3NHIA 4I5LB 3WNXB 4QJ4B 3BXKA 3KO0A 1P28A 1PVAA 1SR6B 3VB1A 4YRUA 4ORCB 4I5KA 2WC5A 1DT7B 1Y0VH 2L4HA 3D73A 3UNWA 4D1EA 2NCOA 4ORAB 2KAXA 1K9PA 2JPOA 2BNXA 1DJGA 1IRJA 3ICBA 5AANA 2OPOA 2PSRA 3SS3A 3MSEB 1OOFA 3I5GC 5HKZA 2Y1NA 2LMTA 3NSLA 4GPLB 3VRNA 3ZWHA 1EXRA 1IGVA 2KQYA 1VRKA 2LP3A 4I5NB 5I94A 2IS9A 1YUTA 2GGZA 1RK9A 4YBHB 5DKQA 3S0DA 1DJYA 2M3WA 1OZSA 2K7DA 1AVSA 1TTXA 1A29A 1QIWA 1ODBA 4DIRA 2M7LA 3L47A 1S26D 3DXLA 2KYCA 2M0RA 1F55A 1MHOA 4DUQA 1XO5A 3E3RA 4FQOA 2L98A 4P2YB 4GAOA 2KPHA 3B6XA 1YRTB 4ZCVA 3TDUA 3UO9A 3NSOA 1TRFA 2LC5A 1KWOB 1EJ3A 1NYAA 3C1VA 2LANA 1XA5A 2L4IA 5I8NA 1J7PA 2K0JA 3AAJA 4A4CA 5DKNA 1EH2A 3SG4A 2NLNA 3CR5X 3TUYB 3FWBA 1TCOB 2COLB 2P6BB 1WDCC 4YGAA 4F0ZB 4GGFA 4PCWA 2WCKA 4JPZB 1AHRA 1SKTA 3I5FC 4QJ5B 2O60A 1CM4A 3I5HC 5HLVA 2ZN8A 1CTRA 3PN7C 2JT0A 2LAPA 2JT8A 3D0YB 4C0LA 5HKYA 1DC1A 1FI5A 1JF0A 3JVTC 2LVVA 3S0BA 4IL1A 1WLMA 2JZIA 4CFRA 2MHHA 2ZKMX 2SCPA 4WQ3A 2E6WA 1CM1A 2F3YA 4KYNA 4HRGA 2LHLA 1QLKA 2KBIA 2QACA 3OB1B 1TNQA 3BUWB 3H4SE 4FQTA 2M1KB 4OVNF 1F54A 2NCPA 1AJ5A 1XFRA 1ZACA 2WC6A 3WHTB 2KAYA 1K2HA 2FOTA 3K21A 1KQVA 1B7TY 3CTNA 3KF9A 1CMFA 2BKIB 3PM2A 1LKJA 1XK4A 3CR4X 3BFAA 1S6JA 4USLA 1QTXA 1K94A 1QVIY 5JOLA 4YGCB 1MR8A 3BFBA 2K60A 3CDNA 1ALWA 1BU3A 1DJIA 2JNXA 2KHNA 2WCHA 3BJHA 5D7FA 4A4BA 1JBAA 2Q4UA 1IIOA 5AXIA 1TNXA 1YTZC 3EG5B 4GFTA 3I5IB 4FTGA 1SSEB 1QXPA 2KGRA 2E30A 1NX1A 5G08A 3SG2A 1KQMC 1J55A 1OMDA 2KI6D 2Q91A 4QJ3B 1L2OB 1BLQA 1DQEA 2JWWA 1CLMA 4OZDA 2F3ZA 1TNWA 2I94A 3SS4A 1XK4C 1A4PA 4N1FA 4CPVA 2DOQA 2PMYA 3CWGA 4PE7A 4C0JA 1M45A 1CMGA 1XYDA 1BJFA 4XJKB 1M39A 2BE6A 2L50A 2JXLA 5EL2A 1G8IA 3V2LA 3PJIA 1Q80A 1MUXA 3CZ1A 4MZLA 1RECA 1SCVA 3R1VA 3OX5A 3BUOB 4MBEA 3L4LA 3GOFA 5CSNA 1SNLA 1GQMA 1U5IA 1C3ZA 4MVFA 1M31A 2JULA 3AAKA 5DKRA 4L9MA 1L7ZA 5AFPA 3D77A 1SCMB 4YGBB 2CTNA 2M29A 3JTDC 4AQJA 4GNKB 1JUOA 4PE4A 2GV5A 2CCMA 4ORBB 4OR9B 1A03A 4DCKA 3CR2A 5AERA 4PE0A 2LMVA 2Y5IA 1KK7Y 3BUXB 3DVMA 5I2QA 3IQQA 3NHTA 3HCMA 1FW4A 4MRXA 4ICBA 1H8BA 2LLUA 3RLZA 1WRZA 4U8DA 2PALA 2B1UA 1XFVO 1IWQA 1ZUZA 2G9BA 1YVLA 2BL0C 2JNFA 2KDHA 2OTGB 3EK8A 3TDIA 3D10A 3BUNB 2BAPA 1YX7A 4YGEB 3TS5B 1IJ5A 2LVIA 1PVBA 1TWOA 3LL8B 1WDCB 3GK1A 3EK7A 5KTYA 2MA2A 2BBMA 1MXLC 1OOJA 1T14A 1FBVA 1LXFC 1SY9A 1TNPA 2L2EA 2JXCA 1QATA 4ZCUA 1OQPA 1V1FA 5ER5A 1J7QA 1CDPA 1RFJA 1K95A 1Z2CB 2O5GA 1QIVA 4UPGA 2EC6C 3QMEA 4M2QA 3I5FB 3OGNA 1DJHA 1S6CA 2KBMA 1RTP1 4GBAA 1SPYA 1SW8A 1CFCA 1QV0A 1B7TZ 1PSRA 1SMGA 1UHHA 3VGOA 4MEWA 1SR6C 4NQGA 1NPQA 1YRUB 2KFHA 3QRXA 1F4OA 1V1GA 1SRAA 1YURA 1XFUO 2CXJA 2KFGA 2LM5A 1XFWO 2WC8A 4AOMA 1C3YA 1Y1AA 1B4CA 2JT3A 4YI8A 2JTZA 3O4XA 1BG1A 2JRFA 3EK4A 1EG3A 1N0YA 4BY4A 4WRIA 3BQ3A 1E8AA 3S0EA 1UWOA 1XFXO 1YUSA 1S1EA 3DVEA 3IF7A 1LA0A 4OCIA 3R72A 5CSFA 1KFUS 3VRPA 1AK8A 1MWNA 2KQ6A 2JPTA 1DTLA 1KFXS 1Y1XA 2WOSA 3EKJA 1D1OA 2HF5A 3D75A 3LCPC 3N7HA 2L5XB 4PDZA 1N2DA 1BOCA 4MRYA 2K61A 3SG7A 3OHMB 2G2BA 1BR1B 4F7FA 3ZNIA 2I2RE 2M1UA 4INWA 4XYNA 1AP4A 3SG6A 1S5GY 3CLNA 3EVVA 1UHNA 1WLZA 1NX2A 4HSZA 1OMVA 2NZ0A 2EC6B 4C0KA 3D0YA 3NSKA 5I2OA 1JF2A 1QVIZ 1HT9A 1C07A 4DRWA 4HRHA 4MN0A 4WQ2A 5I2LA 2YGUA 3GK2A 2VRGA 3DYEA 1PK0D 4IJ7A 5HYDA 4E68A 1QV1A 2WCJA 2CT9A 1JC2A 1F70A 2QPTA 4NDBA 1J1DA 1CFPA 3TZ1A 2F8PA 2HPSA 1CDMA 3OX6A 3I5GB 4N1GA 2HETA 4MLWA 1NIWA 2A4JA 2KAVA 3NSIA 2I7AA 2PRUA 2Y1MA 1DVIA 2MLEC 5HKWA 4GGFC 1TIZA 2GGMA 2L5YA 3DZTA 1WRKA 1S36A 1ALVA 2NXQA 2KI4B 2F2PA 1QLSA 5CPVA 4GUKA 1ZFSA 3BUMB 2CNPA 2FCEA 1GJYA 1QJTA 2BCXA 2KI4C 2LV7A 2MJWB 2PASA 3D74A 1CKKA 2M8UA 2ZNDA 1CB1A 2R2IA 3DY9A 2MAZA 2LLTA 1YUUA 1TUZA 4CLNA 4JWQA 1NCZA 4NDCA 4NDDA 4N5XA 1DGUA 1OOGA 1UHJA 1Y1UA 3FIAA 1OW4A 2PVBA 5FI6A 1S5GZ 1XFZO 1BT6A 1CDLA 1UURA 4P5OE 1H4BA 2QDIA 1QX2A 3TUYC 1KWOC 1LINA 1CFDA 2FJYA 2K7CA 4YI9A 1DGVA 2LVJA 1F71A 1Z4HA 1KK7Z 3L4AA 4MZJA 5AEQA 3SG3A 1TUJA 4DS7A 3HX4A 2AUCA 2ZRTA 1DJZA 1B47A 3R1PA 4AQIA 1CLBA 2LUCA 3DD4A 2WCFA 3D76A 1QASA 1UP5A 3CYZA 5F6TA 2KNEA 1B8CA 1IG5A 1DMOA 1S3PA 2PYQA 1NCXA 1UHIA 1OMRA 4MZKA 1WY9A 1TOPA 3PN7B 5J3XA 1G33A 3VRRA 2OS8B 1LS8A 3SS5A 3AKAA 3CS1A 3Q8IA 5FI7A 1NCYA 2L2CA 2JQ6A 3JTDB 4YGDB 1JFJA 1PRWA 1RJVA 2LNKA 1NSHA 2QEHA 1G4YR 3PATA 4PHJA 2RGIA 5B8IB 1AJ4A 5TNCA 1OE9B 1HQVA 2H2KA 3WXAA 1C7VA 2LP2A 3DVKA 1PALA 1J7RA 2BECA 5K89A 3EVUA 2WORA 1ORGA 3BYAA 2CBLA 4OKHA 5FI2A 1QX5B 2BKHB 1TN4A 1NX3A 5CSIA 1B8LA 5CSJA 2BCAA 1PULA 1RWYA 3WHUB 2JOJA 4PE1A 1OOHA 1YX8A 1B8RA 3CABA 5IBWA 3B88A 1S6IA 2K2FA 5JJGA 1QX7A 3A4UB 1NP8A 1SL8A 4XJKA 3S0FA 5GQQC 4TNCA 1W7IB 1K9KA 1L2OC 3K1EA 3KPXA 4JKTA 1BODA 2D8NA 1MF8B 4HREE 2HQWA 3OBVA 3I5IC 2KGBC 4PHMA 3BFHA 4PHNA 3IQOA 1OOIX 3CZ2A 2V53A 1KSMA 2I18A 3PFVA 2MRDA 3TS5C 3TDZA 2ISDA 1GGWA 2M9GA 2BCBA 3FE6A 1QWVA 3BOWA 2FCDA 1U5IB 3R1OA 5ER4X 3LK0A 1KK8C 3DF0A 1M63B 1LVCD 3O6BA 2L0PA 1R2UA 1KK8B 1UHKA 3SIBA 4ETOA 5D3OA 3I5HB 1FI6A 3SJSA 1SCMC 3DF0B 3PM8A 1K90D 2JC2A 1MQ1A 3CZTX 1IH0A 3KHEA 1CFFA 1ZMZA 2ZRSA 2GTEA 2AAOA 2K2AA 3SIAA 1BMOA 2WNDA 1SL9A 1SYMA 2H61C 4OV2A 1B9AA 1FF1A 3DVJA 1AUIB 1GM0A 1M46A 1K8UA 1CDNA 1EG4A 1SK6D 1OSAA 4PHKA 3FE8A 2JTTA 1NX0A 3M0WA 4JQ0D 3IVTA 2LE9B 4CFQA 3AKBA 3FWCA 2QEVA 2H61A 3B87A 1ZOTB 2ZNEA 2KFFA 2KI6C 3LLEA 3O2PA 4PALA 1A75B 3KEVA 2AMIA 4PT1A 1BF5A 2HQ8A 1F4QA 2BBNA 4R1EA 1OZOA 2BE4A 2PQLA 4MSPA 4GGNA 2WCLA 1J7OA 2LHIA 1LA3A 1KQMB 5FYXA 2KYFA 1R6PA 2ZFDA 1NUBA 2M7NA 2F2OA 3A8RA 3EKHA 5HL1A 1YVHA 1IKUA 1GGZA 2KSPA 3EVRA 4INXA 3OP0A 1XVJA 1DJWA 1DEKA 1SL7A 2WCEA 1UUSA 5HLOA 1C7WA 2LMUA 2MBXA 3B86A 2K7OA 2H8VA 2M97A 2ERBA 1KCYA 1J1EA 2MLFC 2M49B 1KFUL 3VRQA 1Y6WA 1YR5A 4M2PA 2OS8C 2SASA 1JSAA 3FE9A 4Q04A 3S0GA 1F8HA 1CLLA 2P71A
chains in the Genus database with same CATH topology
4M2OA 1X02A 1IQ5A 5KU1A 3O78A 1IQ3A 3SG5A 1BR4B 1K96A 1TCFA 1IJ6A 3NXAA 1XFYO 1RROA 1WRLA 1JWDA 1DJXA 1JFKA 2LLSA 5PALA 1FPWA 5BPJA 1EL4A 1NWDA 2EGDA 3CGAA 3PALA 3PLFB 2LUXA 2L51A 3F45A 4I5JA 3LK1A 1N65A 4CIDA 2EHBA 3FS7A 1DF0B 1A75A 2FJUB 2KOTA 1K9UA 1B1GA 2WCBA 3O4YA 2K8MB 3OB2B 1CNPA 2TN4A 1PSBA 5KSZA 3RM1A 2JU0A 1K93D 3VROA 2BL0B 1A2XA 2OTGC 3BOWB 1DF0A 1QS7A 2F33A 1KFXL 2LVKA 3GK4X 3PSRA 4BY5A 5D69A 2ZN9A 3JVTB 1W7JB 3WNXB 1KSOA 1MXEA 2K7BA 1SBJA 2LCPA 2Y4QA 4I5LB 4QJ4B 3BXKA 3KO0A 1PVAA 1SR6B 4YRUA 1DT7B 4ORCB 4I5KA 1Y0VH 2L4HA 4D1EA 2NCOA 4ORAB 2KAXA 1K9PA 1DJGA 1IRJA 3ICBA 5AANA 2OPOA 2PSRA 3MSEB 3I5GC 5HKZA 2Y1NA 2LMTA 3NSLA 4GPLB 3VRNA 3ZWHA 1EXRA 1IGVA 2KQYA 1VRKA 2LP3A 4I5NB 1J7PA 2IS9A 1YUTA 2GGZA 1RK9A 4YBHB 5DKQA 1DJYA 2M3WA 1OZSA 2K7DA 1AVSA 1TTXA 1A29A 1QIWA 1ODBA 4DIRA 2M7LA 1S26D 2KYCA 2M0RA 1F55A 1MHOA 4DUQA 1XO5A 3E3RA 4FQOA 2L98A 4P2YB 4GAOA 4ZCVA 1YRTB 3TDUA 3NSOA 1TRFA 2LC5A 1KWOB 1EJ3A 1NYAA 3C1VA 2LANA 1XA5A 2L4IA 5I8NA 2K0JA 3AAJA 4A4CA 5DKNA 1EH2A 3SG4A 2NLNA 3CR5X 3TUYB 3FWBA 1TCOB 2COLB 2P6BB 1WDCC 4YGAA 4F0ZB 4GGFA 4PCWA 4JPZB 1AHRA 1SKTA 3I5FC 4QJ5B 2O60A 1CM4A 3I5HC 5HLVA 2ZN8A 1CTRA 3PN7C 2JT0A 2LAPA 2JT8A 3D0YB 4C0LA 5HKYA 1FI5A 1JF0A 3JVTC 2LVVA 4IL1A 1WLMA 2JZIA 4CFRA 2MHHA 2ZKMX 2SCPA 4WQ3A 2E6WA 1CM1A 2F3YA 4HRGA 2LHLA 1QLKA 2KBIA 2QACA 3OB1B 1TNQA 3BUWB 3H4SE 2M1KB 4OVNF 1F54A 2NCPA 1AJ5A 1ZACA 3WHTB 2KAYA 1K2HA 2FOTA 3K21A 1KQVA 1B7TY 3CTNA 3KF9A 1CMFA 2BKIB 1LKJA 1XK4A 3CR4X 1S6JA 4USLA 1QTXA 1K94A 1QVIY 5JOLA 4YGCB 1MR8A 1ALWA 1BU3A 1DJIA 2JNXA 2KHNA 5D7FA 4A4BA 1JBAA 2Q4UA 5AXIA 1TNXA 1YTZC 4GFTA 3I5IB 4FTGA 1QXPA 2KGRA 2E30A 1NX1A 5G08A 3SG2A 1KQMC 1J55A 1OMDA 2KI6D 2Q91A 4QJ3B 1L2OB 1BLQA 2JWWA 1CLMA 2F3ZA 1TNWA 2I94A 1XK4C 1A4PA 4N1FA 4CPVA 2DOQA 2PMYA 3CWGA 4PE7A 4C0JA 1M45A 1CMGA 1XYDA 1BJFA 4XJKB 1M39A 2BE6A 2L50A 2JXLA 1G8IA 1Q80A 1MUXA 4MZLA 1RECA 1SCVA 3OX5A 3BUOB 4MBEA 3GOFA 5CSNA 1SNLA 1GQMA 1U5IA 4MVFA 1M31A 2JULA 3AAKA 5DKRA 4L9MA 1L7ZA 5AFPA 1SCMB 4YGBB 2CTNA 2M29A 3JTDC 4AQJA 4GNKB 1JUOA 4PE4A 2GV5A 2CCMA 4ORBB 4OR9B 1A03A 4DCKA 3CR2A 5AERA 4PE0A 2LMVA 2Y5IA 1KK7Y 3BUXB 3DVMA 5I2QA 3IQQA 3HCMA 1FW4A 4MRXA 4ICBA 1H8BA 2LLUA 3RLZA 1WRZA 4U8DA 2PALA 2B1UA 1XFVO 1IWQA 1ZUZA 2G9BA 1YVLA 2BL0C 2JNFA 2KDHA 2OTGB 3EK8A 3TDIA 3D10A 3BUNB 1YX7A 4YGEB 3TS5B 1IJ5A 2LVIA 1PVBA 3LL8B 1WDCB 3GK1A 3EK7A 5KTYA 2MA2A 2BBMA 1MXLC 1OOJA 1FBVA 1LXFC 1SY9A 1TNPA 2L2EA 2JXCA 1QATA 4ZCUA 1OQPA 1V1FA 5ER5A 1J7QA 1CDPA 1RFJA 1K95A 2O5GA 1QIVA 4UPGA 2EC6C 4M2QA 3I5FB 1DJHA 1S6CA 2KBMA 1RTP1 4GBAA 1SPYA 1SW8A 1CFCA 1QV0A 1B7TZ 1PSRA 1SMGA 1UHHA 3VGOA 4MEWA 1SR6C 4NQGA 1NPQA 1YRUB 2KFHA 3QRXA 1F4OA 1V1GA 1SRAA 1YURA 1XFUO 2CXJA 2KFGA 2LM5A 1XFWO 2WC8A 4AOMA 1B4CA 1Y1AA 2JT3A 4YI8A 2JTZA 1BG1A 2JRFA 3EK4A 1EG3A 1N0YA 4BY4A 4WRIA 3BQ3A 1E8AA 1UWOA 1XFXO 1YUSA 1S1EA 3DVEA 3IF7A 1LA0A 4OCIA 5CSFA 3VRPA 1KFUS 1AK8A 1MWNA 2KQ6A 2JPTA 1DTLA 1KFXS 1Y1XA 2WOSA 3EKJA 1D1OA 2HF5A 3LCPC 2L5XB 4PDZA 1N2DA 1BOCA 4MRYA 2K61A 3SG7A 3OHMB 2G2BA 1BR1B 3ZNIA 2I2RE 2M1UA 4XYNA 1AP4A 3SG6A 1S5GY 3CLNA 3EVVA 1UHNA 1WLZA 1NX2A 4HSZA 1OMVA 2NZ0A 2EC6B 4C0KA 3D0YA 3NSKA 5I2OA 1JF2A 1QVIZ 1HT9A 1C07A 4DRWA 4HRHA 4MN0A 4WQ2A 5I2LA 3GK2A 4E68A 2VRGA 1PK0D 5HYDA 1QV1A 2CT9A 1JC2A 1F70A 2QPTA 4NDBA 1J1DA 1CFPA 3TZ1A 2F8PA 2HPSA 1CDMA 3OX6A 3I5GB 4N1GA 2HETA 4MLWA 1NIWA 2A4JA 2KAVA 3NSIA 2I7AA 2PRUA 2Y1MA 1DVIA 2MLEC 5HKWA 4GGFC 1TIZA 2GGMA 1WRKA 1S36A 1ALVA 2NXQA 2KI4B 2F2PA 1QLSA 5CPVA 4GUKA 1ZFSA 3BUMB 2CNPA 2FCEA 1GJYA 1QJTA 2BCXA 2KI4C 2LV7A 2MJWB 2PASA 1CKKA 1CB1A 2M8UA 2ZNDA 2R2IA 2MAZA 2LLTA 1YUUA 4CLNA 4JWQA 1NCZA 4NDCA 4NDDA 4N5XA 1DGUA 1UHJA 1Y1UA 3FIAA 2PVBA 1S5GZ 1XFZO 1BT6A 1CDLA 1UURA 4P5OE 1H4BA 1QX2A 3TUYC 1KWOC 1LINA 1CFDA 2K7CA 4YI9A 1DGVA 2LVJA 1F71A 1KK7Z 4MZJA 5AEQA 3SG3A 4DS7A 3HX4A 2AUCA 2ZRTA 1DJZA 1B47A 4AQIA 1CLBA 2LUCA 3DD4A 2WCFA 1QASA 1UP5A 5F6TA 2KNEA 1B8CA 1IG5A 1DMOA 1S3PA 1NCXA 1UHIA 1OMRA 4MZKA 1WY9A 1TOPA 3PN7B 5J3XA 1G33A 3VRRA 2OS8B 3AKAA 3CS1A 1JFJA 1NCYA 3JTDB 2JQ6A 4YGDB 1PRWA 1RJVA 2LNKA 1NSHA 3PATA 1G4YR 4PHJA 5B8IB 2RGIA 1AJ4A 5TNCA 1OE9B 1HQVA 2H2KA 3WXAA 1C7VA 2LP2A 3DVKA 1PALA 1J7RA 2BECA 5K89A 3EVUA 2WORA 3BYAA 2CBLA 4OKHA 1QX5B 2BKHB 1TN4A 1NX3A 5CSIA 1B8LA 5CSJA 2BCAA 1PULA 1RWYA 3WHUB 2JOJA 4PE1A 1YX8A 1B8RA 5IBWA 1S6IA 2K2FA 5JJGA 1QX7A 3A4UB 1NP8A 1SL8A 4XJKA 5GQQC 4TNCA 1W7IB 1K9KA 1L2OC 3KPXA 1BODA 2D8NA 1MF8B 4HREE 2HQWA 3I5IC 2KGBC 4PHMA 4PHNA 3IQOA 2V53A 1KSMA 2I18A 3PFVA 2MRDA 3TS5C 3TDZA 2ISDA 1GGWA 2M9GA 2BCBA 3BOWA 2FCDA 1U5IB 5ER4X 3LK0A 1KK8C 3DF0A 1M63B 1LVCD 3O6BA 2L0PA 1R2UA 1KK8B 1UHKA 3SIBA 4ETOA 3I5HB 1FI6A 3SJSA 1SCMC 3DF0B 3PM8A 1K90D 2JC2A 1MQ1A 3CZTX 1IH0A 3KHEA 1CFFA 1ZMZA 2ZRSA 2AAOA 2K2AA 3SIAA 1BMOA 2WNDA 1SL9A 1SYMA 2H61C 4OV2A 1B9AA 1FF1A 3DVJA 1AUIB 1M46A 1K8UA 1CDNA 1EG4A 1SK6D 1OSAA 4PHKA 2JTTA 1NX0A 3M0WA 4JQ0D 2LE9B 4CFQA 3AKBA 3FWCA 2H61A 1ZOTB 2ZNEA 2KFFA 2KI6C 3LLEA 3O2PA 4PALA 1A75B 3KEVA 2AMIA 1BF5A 2HQ8A 1F4QA 2BBNA 4R1EA 1OZOA 2BE4A 4MSPA 4GGNA 1J7OA 2LHIA 1LA3A 1KQMB 5FYXA 2KYFA 1R6PA 2ZFDA 1NUBA 2M7NA 2F2OA 3A8RA 3EKHA 1YVHA 1IKUA 1GGZA 2KSPA 3EVRA 3OP0A 1XVJA 1DJWA 1SL7A 2WCEA 5HLOA 1UUSA 1C7WA 2LMUA 2MBXA 2K7OA 2M97A 1KCYA 1J1EA 2MLFC 2M49B 1KFUL 3VRQA 1Y6WA 1YR5A 4M2PA 2OS8C 2SASA 1JSAA 4Q04A 1F8HA 1CLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2O A;  1X02 A;  1IQ5 A;  5KU1 A;  3O78 A;  1IQ3 A;  3SG5 A;  1BR4 B;  1K96 A;  1TCF A;  1IJ6 A;  3NXA A;  1XFY O;  1RRO A;  1WRL A;  1JWD A;  1DJX A;  1JFK A;  2LLS A;  5PAL A;  1FPW A;  5BPJ A;  1EL4 A;  1NWD A;  2EGD A;  3CGA A;  3PAL A;  3PLF B;  2LUX A;  2L51 A;  3F45 A;  4I5J A;  3LK1 A;  1N65 A;  4CID A;  2EHB A;  3FS7 A;  1DF0 B;  1A75 A;  2FJU B;  2KOT A;  1K9U A;  1B1G A;  2WCB A;  3O4Y A;  2K8M B;  3OB2 B;  1CNP A;  2TN4 A;  1PSB A;  5KSZ A;  3RM1 A;  2JU0 A;  1K93 D;  3VRO A;  2BL0 B;  1A2X A;  2OTG C;  3BOW B;  1DF0 A;  1QS7 A;  2F33 A;  1KFX L;  2LVK A;  3GK4 X;  3PSR A;  4BY5 A;  5D69 A;  2ZN9 A;  3JVT B;  1W7J B;  3WNX B;  1KSO A;  1MXE A;  2K7B A;  1SBJ A;  2LCP A;  2Y4Q A;  4I5L B;  4QJ4 B;  3BXK A;  3KO0 A;  1PVA A;  1SR6 B;  4YRU A;  1DT7 B;  4ORC B;  4I5K A;  1Y0V H;  2L4H A;  4D1E A;  2NCO A;  4ORA B;  2KAX A;  1K9P A;  1DJG A;  1IRJ A;  3ICB A;  5AAN A;  2OPO A;  2PSR A;  3MSE B;  3I5G C;  5HKZ A;  2Y1N A;  2LMT A;  3NSL A;  4GPL B;  3VRN A;  3ZWH A;  1EXR A;  1IGV A;  2KQY A;  1VRK A;  2LP3 A;  4I5N B;  1J7P A;  2IS9 A;  1YUT A;  2GGZ A;  1RK9 A;  4YBH B;  5DKQ A;  1DJY A;  2M3W A;  1OZS A;  2K7D A;  1AVS A;  1TTX A;  1A29 A;  1QIW A;  1ODB A;  4DIR A;  2M7L A;  1S26 D;  2KYC A;  2M0R A;  1F55 A;  1MHO A;  4DUQ A;  1XO5 A;  3E3R A;  4FQO A;  2L98 A;  4P2Y B;  4GAO A;  4ZCV A;  1YRT B;  3TDU A;  3NSO A;  1TRF A;  2LC5 A;  1KWO B;  1EJ3 A;  1NYA A;  3C1V A;  2LAN A;  1XA5 A;  2L4I A;  5I8N A;  2K0J A;  3AAJ A;  4A4C A;  5DKN A;  1EH2 A;  3SG4 A;  2NLN A;  3CR5 X;  3TUY B;  3FWB A;  1TCO B;  2COL B;  2P6B B;  1WDC C;  4YGA A;  4F0Z B;  4GGF A;  4PCW A;  4JPZ B;  1AHR A;  1SKT A;  3I5F C;  4QJ5 B;  2O60 A;  1CM4 A;  3I5H C;  5HLV A;  2ZN8 A;  1CTR A;  3PN7 C;  2JT0 A;  2LAP A;  2JT8 A;  3D0Y B;  4C0L A;  5HKY A;  1FI5 A;  1JF0 A;  3JVT C;  2LVV A;  4IL1 A;  1WLM A;  2JZI A;  4CFR A;  2MHH A;  2ZKM X;  2SCP A;  4WQ3 A;  2E6W A;  1CM1 A;  2F3Y A;  4HRG A;  2LHL A;  1QLK A;  2KBI A;  2QAC A;  3OB1 B;  1TNQ A;  3BUW B;  3H4S E;  2M1K B;  4OVN F;  1F54 A;  2NCP A;  1AJ5 A;  1ZAC A;  3WHT B;  2KAY A;  1K2H A;  2FOT A;  3K21 A;  1KQV A;  1B7T Y;  3CTN A;  3KF9 A;  1CMF A;  2BKI B;  1LKJ A;  1XK4 A;  3CR4 X;  1S6J A;  4USL A;  1QTX A;  1K94 A;  1QVI Y;  5JOL A;  4YGC B;  1MR8 A;  1ALW A;  1BU3 A;  1DJI A;  2JNX A;  2KHN A;  5D7F A;  4A4B A;  1JBA A;  2Q4U A;  5AXI A;  1TNX A;  1YTZ C;  4GFT A;  3I5I B;  4FTG A;  1QXP A;  2KGR A;  2E30 A;  1NX1 A;  5G08 A;  3SG2 A;  1KQM C;  1J55 A;  1OMD A;  2KI6 D;  2Q91 A;  4QJ3 B;  1L2O B;  1BLQ A;  2JWW A;  1CLM A;  2F3Z A;  1TNW A;  2I94 A;  1XK4 C;  1A4P A;  4N1F A;  4CPV A;  2DOQ A;  2PMY A;  3CWG A;  4PE7 A;  4C0J A;  1M45 A;  1CMG A;  1XYD A;  1BJF A;  4XJK B;  1M39 A;  2BE6 A;  2L50 A;  2JXL A;  1G8I A;  1Q80 A;  1MUX A;  4MZL A;  1REC A;  1SCV A;  3OX5 A;  3BUO B;  4MBE A;  3GOF A;  5CSN A;  1SNL A;  1GQM A;  1U5I A;  4MVF A;  1M31 A;  2JUL A;  3AAK A;  5DKR A;  4L9M A;  1L7Z A;  5AFP A;  1SCM B;  4YGB B;  2CTN A;  2M29 A;  3JTD C;  4AQJ A;  4GNK B;  1JUO A;  4PE4 A;  2GV5 A;  2CCM A;  4ORB B;  4OR9 B;  1A03 A;  4DCK A;  3CR2 A;  5AER A;  4PE0 A;  2LMV A;  2Y5I A;  1KK7 Y;  3BUX B;  3DVM A;  5I2Q A;  3IQQ A;  3HCM A;  1FW4 A;  4MRX A;  4ICB A;  1H8B A;  2LLU A;  3RLZ A;  1WRZ A;  4U8D A;  2PAL A;  2B1U A;  1XFV O;  1IWQ A;  1ZUZ A;  2G9B A;  1YVL A;  2BL0 C;  2JNF A;  2KDH A;  2OTG B;  3EK8 A;  3TDI A;  3D10 A;  3BUN B;  1YX7 A;  4YGE B;  3TS5 B;  1IJ5 A;  2LVI A;  1PVB A;  3LL8 B;  1WDC B;  3GK1 A;  3EK7 A;  5KTY A;  2MA2 A;  2BBM A;  1MXL C;  1OOJ A;  1FBV A;  1LXF C;  1SY9 A;  1TNP A;  2L2E A;  2JXC A;  1QAT A;  4ZCU A;  1OQP A;  1V1F A;  5ER5 A;  1J7Q A;  1CDP A;  1RFJ A;  1K95 A;  2O5G A;  1QIV A;  4UPG A;  2EC6 C;  4M2Q A;  3I5F B;  1DJH A;  1S6C A;  2KBM A;  1RTP 1;  4GBA A;  1SPY A;  1SW8 A;  1CFC A;  1QV0 A;  1B7T Z;  1PSR A;  1SMG A;  1UHH A;  3VGO A;  4MEW A;  1SR6 C;  4NQG A;  1NPQ A;  1YRU B;  2KFH A;  3QRX A;  1F4O A;  1V1G A;  1SRA A;  1YUR A;  1XFU O;  2CXJ A;  2KFG A;  2LM5 A;  1XFW O;  2WC8 A;  4AOM A;  1B4C A;  1Y1A A;  2JT3 A;  4YI8 A;  2JTZ A;  1BG1 A;  2JRF A;  3EK4 A;  1EG3 A;  1N0Y A;  4BY4 A;  4WRI A;  3BQ3 A;  1E8A A;  1UWO A;  1XFX O;  1YUS A;  1S1E A;  3DVE A;  3IF7 A;  1LA0 A;  4OCI A;  5CSF A;  3VRP A;  1KFU S;  1AK8 A;  1MWN A;  2KQ6 A;  2JPT A;  1DTL A;  1KFX S;  1Y1X A;  2WOS A;  3EKJ A;  1D1O A;  2HF5 A;  3LCP C;  2L5X B;  4PDZ A;  1N2D A;  1BOC A;  4MRY A;  2K61 A;  3SG7 A;  3OHM B;  2G2B A;  1BR1 B;  3ZNI A;  2I2R E;  2M1U A;  4XYN A;  1AP4 A;  3SG6 A;  1S5G Y;  3CLN A;  3EVV A;  1UHN A;  1WLZ A;  1NX2 A;  4HSZ A;  1OMV A;  2NZ0 A;  2EC6 B;  4C0K A;  3D0Y A;  3NSK A;  5I2O A;  1JF2 A;  1QVI Z;  1HT9 A;  1C07 A;  4DRW A;  4HRH A;  4MN0 A;  4WQ2 A;  5I2L A;  3GK2 A;  4E68 A;  2VRG A;  1PK0 D;  5HYD A;  1QV1 A;  2CT9 A;  1JC2 A;  1F70 A;  2QPT A;  4NDB A;  1J1D A;  1CFP A;  3TZ1 A;  2F8P A;  2HPS A;  1CDM A;  3OX6 A;  3I5G B;  4N1G A;  2HET A;  4MLW A;  1NIW A;  2A4J A;  2KAV A;  3NSI A;  2I7A A;  2PRU A;  2Y1M A;  1DVI A;  2MLE C;  5HKW A;  4GGF C;  1TIZ A;  2GGM A;  1WRK A;  1S36 A;  1ALV A;  2NXQ A;  2KI4 B;  2F2P A;  1QLS A;  5CPV A;  4GUK A;  1ZFS A;  3BUM B;  2CNP A;  2FCE A;  1GJY A;  1QJT A;  2BCX A;  2KI4 C;  2LV7 A;  2MJW B;  2PAS A;  1CKK A;  1CB1 A;  2M8U A;  2ZND A;  2R2I A;  2MAZ A;  2LLT A;  1YUU A;  4CLN A;  4JWQ A;  1NCZ A;  4NDC A;  4NDD A;  4N5X A;  1DGU A;  1UHJ A;  1Y1U A;  3FIA A;  2PVB A;  1S5G Z;  1XFZ O;  1BT6 A;  1CDL A;  1UUR A;  4P5O E;  1H4B A;  1QX2 A;  3TUY C;  1KWO C;  1LIN A;  1CFD A;  2K7C A;  4YI9 A;  1DGV A;  2LVJ A;  1F71 A;  1KK7 Z;  4MZJ A;  5AEQ A;  3SG3 A;  4DS7 A;  3HX4 A;  2AUC A;  2ZRT A;  1DJZ A;  1B47 A;  4AQI A;  1CLB A;  2LUC A;  3DD4 A;  2WCF A;  1QAS A;  1UP5 A;  5F6T A;  2KNE A;  1B8C A;  1IG5 A;  1DMO A;  1S3P A;  1NCX A;  1UHI A;  1OMR A;  4MZK A;  1WY9 A;  1TOP A;  3PN7 B;  5J3X A;  1G33 A;  3VRR A;  2OS8 B;  3AKA A;  3CS1 A;  1JFJ A;  1NCY A;  3JTD B;  2JQ6 A;  4YGD B;  1PRW A;  1RJV A;  2LNK A;  1NSH A;  3PAT A;  1G4Y R;  4PHJ A;  5B8I B;  2RGI A;  1AJ4 A;  5TNC A;  1OE9 B;  1HQV A;  2H2K A;  3WXA A;  1C7V A;  2LP2 A;  3DVK A;  1PAL A;  1J7R A;  2BEC A;  5K89 A;  3EVU A;  2WOR A;  3BYA A;  2CBL A;  4OKH A;  1QX5 B;  2BKH B;  1TN4 A;  1NX3 A;  5CSI A;  1B8L A;  5CSJ A;  2BCA A;  1PUL A;  1RWY A;  3WHU B;  2JOJ A;  4PE1 A;  1YX8 A;  1B8R A;  5IBW A;  1S6I A;  2K2F A;  5JJG A;  1QX7 A;  3A4U B;  1NP8 A;  1SL8 A;  4XJK A;  5GQQ C;  4TNC A;  1W7I B;  1K9K A;  1L2O C;  3KPX A;  1BOD A;  2D8N A;  1MF8 B;  4HRE E;  2HQW A;  3I5I C;  2KGB C;  4PHM A;  4PHN A;  3IQO A;  2V53 A;  1KSM A;  2I18 A;  3PFV A;  2MRD A;  3TS5 C;  3TDZ A;  2ISD A;  1GGW A;  2M9G A;  2BCB A;  3BOW A;  2FCD A;  1U5I B;  5ER4 X;  3LK0 A;  1KK8 C;  3DF0 A;  1M63 B;  1LVC D;  3O6B A;  2L0P A;  1R2U A;  1KK8 B;  1UHK A;  3SIB A;  4ETO A;  3I5H B;  1FI6 A;  3SJS A;  1SCM C;  3DF0 B;  3PM8 A;  1K90 D;  2JC2 A;  1MQ1 A;  3CZT X;  1IH0 A;  3KHE A;  1CFF A;  1ZMZ A;  2ZRS A;  2AAO A;  2K2A A;  3SIA A;  1BMO A;  2WND A;  1SL9 A;  1SYM A;  2H61 C;  4OV2 A;  1B9A A;  1FF1 A;  3DVJ A;  1AUI B;  1M46 A;  1K8U A;  1CDN A;  1EG4 A;  1SK6 D;  1OSA A;  4PHK A;  2JTT A;  1NX0 A;  3M0W A;  4JQ0 D;  2LE9 B;  4CFQ A;  3AKB A;  3FWC A;  2H61 A;  1ZOT B;  2ZNE A;  2KFF A;  2KI6 C;  3LLE A;  3O2P A;  4PAL A;  1A75 B;  3KEV A;  2AMI A;  1BF5 A;  2HQ8 A;  1F4Q A;  2BBN A;  4R1E A;  1OZO A;  2BE4 A;  4MSP A;  4GGN A;  1J7O A;  2LHI A;  1LA3 A;  1KQM B;  5FYX A;  2KYF A;  1R6P A;  2ZFD A;  1NUB A;  2M7N A;  2F2O A;  3A8R A;  3EKH A;  1YVH A;  1IKU A;  1GGZ A;  2KSP A;  3EVR A;  3OP0 A;  1XVJ A;  1DJW A;  1SL7 A;  2WCE A;  5HLO A;  1UUS A;  1C7W A;  2LMU A;  2MBX A;  2K7O A;  2M97 A;  1KCY A;  1J1E A;  2MLF C;  2M49 B;  1KFU L;  3VRQ A;  1Y6W A;  1YR5 A;  4M2P A;  2OS8 C;  2SAS A;  1JSA A;  4Q04 A;  1F8H A;  1CLL A; 
#chains in the Genus database with same CATH topology
 4M2O A;  1X02 A;  1IQ5 A;  5KU1 A;  3O78 A;  1IQ3 A;  3SG5 A;  3NGV A;  1BR4 B;  1K96 A;  1TCF A;  1IJ6 A;  3NXA A;  1XFY O;  1RRO A;  1WRL A;  1JWD A;  1DJX A;  1JFK A;  2LLS A;  5PAL A;  1FPW A;  5BPJ A;  1EL4 A;  1NWD A;  2EGD A;  3CGA A;  3PAL A;  3PLF B;  2LUX A;  2KLD A;  2L51 A;  3F45 A;  4I5J A;  3RZS A;  3LK1 A;  1N65 A;  3B7A A;  2EHB A;  3FS7 A;  1DEL A;  1DF0 B;  1W9Z A;  4CID A;  1A75 A;  2FJU B;  2KOT A;  1K9U A;  1B1G A;  2WCB A;  3O4Y A;  2K8M B;  3OB2 B;  1CNP A;  2TN4 A;  1PSB A;  3CZ0 A;  5KSZ A;  2KLE A;  2QEB A;  3S0A A;  4JD9 A;  2WCM A;  2QEO A;  3RM1 A;  2P70 A;  2JU0 A;  1K93 D;  3VRO A;  2BL0 B;  1A2X A;  2OTG C;  3BOW B;  5DIC A;  1DF0 A;  1QS7 A;  2F33 A;  1KFX L;  2LVK A;  3GK4 X;  3PSR A;  4BY5 A;  5D69 A;  2ZN9 A;  3D78 A;  1W7J B;  3JVT B;  1KSO A;  1MXE A;  2K7B A;  1SBJ A;  2LCP A;  2Y4Q A;  3NHI A;  4I5L B;  3WNX B;  4QJ4 B;  3BXK A;  3KO0 A;  1P28 A;  1PVA A;  1SR6 B;  3VB1 A;  4YRU A;  4ORC B;  4I5K A;  2WC5 A;  1DT7 B;  1Y0V H;  2L4H A;  3D73 A;  3UNW A;  4D1E A;  2NCO A;  4ORA B;  2KAX A;  1K9P A;  2JPO A;  2BNX A;  1DJG A;  1IRJ A;  3ICB A;  5AAN A;  2OPO A;  2PSR A;  3SS3 A;  3MSE B;  1OOF A;  3I5G C;  5HKZ A;  2Y1N A;  2LMT A;  3NSL A;  4GPL B;  3VRN A;  3ZWH A;  1EXR A;  1IGV A;  2KQY A;  1VRK A;  2LP3 A;  4I5N B;  5I94 A;  2IS9 A;  1YUT A;  2GGZ A;  1RK9 A;  4YBH B;  5DKQ A;  3S0D A;  1DJY A;  2M3W A;  1OZS A;  2K7D A;  1AVS A;  1TTX A;  1A29 A;  1QIW A;  1ODB A;  4DIR A;  2M7L A;  3L47 A;  1S26 D;  3DXL A;  2KYC A;  2M0R A;  1F55 A;  1MHO A;  4DUQ A;  1XO5 A;  3E3R A;  4FQO A;  2L98 A;  4P2Y B;  4GAO A;  2KPH A;  3B6X A;  1YRT B;  4ZCV A;  3TDU A;  3UO9 A;  3NSO A;  1TRF A;  2LC5 A;  1KWO B;  1EJ3 A;  1NYA A;  3C1V A;  2LAN A;  1XA5 A;  2L4I A;  5I8N A;  1J7P A;  2K0J A;  3AAJ A;  4A4C A;  5DKN A;  1EH2 A;  3SG4 A;  2NLN A;  3CR5 X;  3TUY B;  3FWB A;  1TCO B;  2COL B;  2P6B B;  1WDC C;  4YGA A;  4F0Z B;  4GGF A;  4PCW A;  2WCK A;  4JPZ B;  1AHR A;  1SKT A;  3I5F C;  4QJ5 B;  2O60 A;  1CM4 A;  3I5H C;  5HLV A;  2ZN8 A;  1CTR A;  3PN7 C;  2JT0 A;  2LAP A;  2JT8 A;  3D0Y B;  4C0L A;  5HKY A;  1DC1 A;  1FI5 A;  1JF0 A;  3JVT C;  2LVV A;  3S0B A;  4IL1 A;  1WLM A;  2JZI A;  4CFR A;  2MHH A;  2ZKM X;  2SCP A;  4WQ3 A;  2E6W A;  1CM1 A;  2F3Y A;  4KYN A;  4HRG A;  2LHL A;  1QLK A;  2KBI A;  2QAC A;  3OB1 B;  1TNQ A;  3BUW B;  3H4S E;  4FQT A;  2M1K B;  4OVN F;  1F54 A;  2NCP A;  1AJ5 A;  1XFR A;  1ZAC A;  2WC6 A;  3WHT B;  2KAY A;  1K2H A;  2FOT A;  3K21 A;  1KQV A;  1B7T Y;  3CTN A;  3KF9 A;  1CMF A;  2BKI B;  3PM2 A;  1LKJ A;  1XK4 A;  3CR4 X;  3BFA A;  1S6J A;  4USL A;  1QTX A;  1K94 A;  1QVI Y;  5JOL A;  4YGC B;  1MR8 A;  3BFB A;  2K60 A;  3CDN A;  1ALW A;  1BU3 A;  1DJI A;  2JNX A;  2KHN A;  2WCH A;  3BJH A;  5D7F A;  4A4B A;  1JBA A;  2Q4U A;  1IIO A;  5AXI A;  1TNX A;  1YTZ C;  3EG5 B;  4GFT A;  3I5I B;  4FTG A;  1SSE B;  1QXP A;  2KGR A;  2E30 A;  1NX1 A;  5G08 A;  3SG2 A;  1KQM C;  1J55 A;  1OMD A;  2KI6 D;  2Q91 A;  4QJ3 B;  1L2O B;  1BLQ A;  1DQE A;  2JWW A;  1CLM A;  4OZD A;  2F3Z A;  1TNW A;  2I94 A;  3SS4 A;  1XK4 C;  1A4P A;  4N1F A;  4CPV A;  2DOQ A;  2PMY A;  3CWG A;  4PE7 A;  4C0J A;  1M45 A;  1CMG A;  1XYD A;  1BJF A;  4XJK B;  1M39 A;  2BE6 A;  2L50 A;  2JXL A;  5EL2 A;  1G8I A;  3V2L A;  3PJI A;  1Q80 A;  1MUX A;  3CZ1 A;  4MZL A;  1REC A;  1SCV A;  3R1V A;  3OX5 A;  3BUO B;  4MBE A;  3L4L A;  3GOF A;  5CSN A;  1SNL A;  1GQM A;  1U5I A;  1C3Z A;  4MVF A;  1M31 A;  2JUL A;  3AAK A;  5DKR A;  4L9M A;  1L7Z A;  5AFP A;  3D77 A;  1SCM B;  4YGB B;  2CTN A;  2M29 A;  3JTD C;  4AQJ A;  4GNK B;  1JUO A;  4PE4 A;  2GV5 A;  2CCM A;  4ORB B;  4OR9 B;  1A03 A;  4DCK A;  3CR2 A;  5AER A;  4PE0 A;  2LMV A;  2Y5I A;  1KK7 Y;  3BUX B;  3DVM A;  5I2Q A;  3IQQ A;  3NHT A;  3HCM A;  1FW4 A;  4MRX A;  4ICB A;  1H8B A;  2LLU A;  3RLZ A;  1WRZ A;  4U8D A;  2PAL A;  2B1U A;  1XFV O;  1IWQ A;  1ZUZ A;  2G9B A;  1YVL A;  2BL0 C;  2JNF A;  2KDH A;  2OTG B;  3EK8 A;  3TDI A;  3D10 A;  3BUN B;  2BAP A;  1YX7 A;  4YGE B;  3TS5 B;  1IJ5 A;  2LVI A;  1PVB A;  1TWO A;  3LL8 B;  1WDC B;  3GK1 A;  3EK7 A;  5KTY A;  2MA2 A;  2BBM A;  1MXL C;  1OOJ A;  1T14 A;  1FBV A;  1LXF C;  1SY9 A;  1TNP A;  2L2E A;  2JXC A;  1QAT A;  4ZCU A;  1OQP A;  1V1F A;  5ER5 A;  1J7Q A;  1CDP A;  1RFJ A;  1K95 A;  1Z2C B;  2O5G A;  1QIV A;  4UPG A;  2EC6 C;  3QME A;  4M2Q A;  3I5F B;  3OGN A;  1DJH A;  1S6C A;  2KBM A;  1RTP 1;  4GBA A;  1SPY A;  1SW8 A;  1CFC A;  1QV0 A;  1B7T Z;  1PSR A;  1SMG A;  1UHH A;  3VGO A;  4MEW A;  1SR6 C;  4NQG A;  1NPQ A;  1YRU B;  2KFH A;  3QRX A;  1F4O A;  1V1G A;  1SRA A;  1YUR A;  1XFU O;  2CXJ A;  2KFG A;  2LM5 A;  1XFW O;  2WC8 A;  4AOM A;  1C3Y A;  1Y1A A;  1B4C A;  2JT3 A;  4YI8 A;  2JTZ A;  3O4X A;  1BG1 A;  2JRF A;  3EK4 A;  1EG3 A;  1N0Y A;  4BY4 A;  4WRI A;  3BQ3 A;  1E8A A;  3S0E A;  1UWO A;  1XFX O;  1YUS A;  1S1E A;  3DVE A;  3IF7 A;  1LA0 A;  4OCI A;  3R72 A;  5CSF A;  1KFU S;  3VRP A;  1AK8 A;  1MWN A;  2KQ6 A;  2JPT A;  1DTL A;  1KFX S;  1Y1X A;  2WOS A;  3EKJ A;  1D1O A;  2HF5 A;  3D75 A;  3LCP C;  3N7H A;  2L5X B;  4PDZ A;  1N2D A;  1BOC A;  4MRY A;  2K61 A;  3SG7 A;  3OHM B;  2G2B A;  1BR1 B;  4F7F A;  3ZNI A;  2I2R E;  2M1U A;  4INW A;  4XYN A;  1AP4 A;  3SG6 A;  1S5G Y;  3CLN A;  3EVV A;  1UHN A;  1WLZ A;  1NX2 A;  4HSZ A;  1OMV A;  2NZ0 A;  2EC6 B;  4C0K A;  3D0Y A;  3NSK A;  5I2O A;  1JF2 A;  1QVI Z;  1HT9 A;  1C07 A;  4DRW A;  4HRH A;  4MN0 A;  4WQ2 A;  5I2L A;  2YGU A;  3GK2 A;  2VRG A;  3DYE A;  1PK0 D;  4IJ7 A;  5HYD A;  4E68 A;  1QV1 A;  2WCJ A;  2CT9 A;  1JC2 A;  1F70 A;  2QPT A;  4NDB A;  1J1D A;  1CFP A;  3TZ1 A;  2F8P A;  2HPS A;  1CDM A;  3OX6 A;  3I5G B;  4N1G A;  2HET A;  4MLW A;  1NIW A;  2A4J A;  2KAV A;  3NSI A;  2I7A A;  2PRU A;  2Y1M A;  1DVI A;  2MLE C;  5HKW A;  4GGF C;  1TIZ A;  2GGM A;  2L5Y A;  3DZT A;  1WRK A;  1S36 A;  1ALV A;  2NXQ A;  2KI4 B;  2F2P A;  1QLS A;  5CPV A;  4GUK A;  1ZFS A;  3BUM B;  2CNP A;  2FCE A;  1GJY A;  1QJT A;  2BCX A;  2KI4 C;  2LV7 A;  2MJW B;  2PAS A;  3D74 A;  1CKK A;  2M8U A;  2ZND A;  1CB1 A;  2R2I A;  3DY9 A;  2MAZ A;  2LLT A;  1YUU A;  1TUZ A;  4CLN A;  4JWQ A;  1NCZ A;  4NDC A;  4NDD A;  4N5X A;  1DGU A;  1OOG A;  1UHJ A;  1Y1U A;  3FIA A;  1OW4 A;  2PVB A;  5FI6 A;  1S5G Z;  1XFZ O;  1BT6 A;  1CDL A;  1UUR A;  4P5O E;  1H4B A;  2QDI A;  1QX2 A;  3TUY C;  1KWO C;  1LIN A;  1CFD A;  2FJY A;  2K7C A;  4YI9 A;  1DGV A;  2LVJ A;  1F71 A;  1Z4H A;  1KK7 Z;  3L4A A;  4MZJ A;  5AEQ A;  3SG3 A;  1TUJ A;  4DS7 A;  3HX4 A;  2AUC A;  2ZRT A;  1DJZ A;  1B47 A;  3R1P A;  4AQI A;  1CLB A;  2LUC A;  3DD4 A;  2WCF A;  3D76 A;  1QAS A;  1UP5 A;  3CYZ A;  5F6T A;  2KNE A;  1B8C A;  1IG5 A;  1DMO A;  1S3P A;  2PYQ A;  1NCX A;  1UHI A;  1OMR A;  4MZK A;  1WY9 A;  1TOP A;  3PN7 B;  5J3X A;  1G33 A;  3VRR A;  2OS8 B;  1LS8 A;  3SS5 A;  3AKA A;  3CS1 A;  3Q8I A;  5FI7 A;  1NCY A;  2L2C A;  2JQ6 A;  3JTD B;  4YGD B;  1JFJ A;  1PRW A;  1RJV A;  2LNK A;  1NSH A;  2QEH A;  1G4Y R;  3PAT A;  4PHJ A;  2RGI A;  5B8I B;  1AJ4 A;  5TNC A;  1OE9 B;  1HQV A;  2H2K A;  3WXA A;  1C7V A;  2LP2 A;  3DVK A;  1PAL A;  1J7R A;  2BEC A;  5K89 A;  3EVU A;  2WOR A;  1ORG A;  3BYA A;  2CBL A;  4OKH A;  5FI2 A;  1QX5 B;  2BKH B;  1TN4 A;  1NX3 A;  5CSI A;  1B8L A;  5CSJ A;  2BCA A;  1PUL A;  1RWY A;  3WHU B;  2JOJ A;  4PE1 A;  1OOH A;  1YX8 A;  1B8R A;  3CAB A;  5IBW A;  3B88 A;  1S6I A;  2K2F A;  5JJG A;  1QX7 A;  3A4U B;  1NP8 A;  1SL8 A;  4XJK A;  3S0F A;  5GQQ C;  4TNC A;  1W7I B;  1K9K A;  1L2O C;  3K1E A;  3KPX A;  4JKT A;  1BOD A;  2D8N A;  1MF8 B;  4HRE E;  2HQW A;  3OBV A;  3I5I C;  2KGB C;  4PHM A;  3BFH A;  4PHN A;  3IQO A;  1OOI X;  3CZ2 A;  2V53 A;  1KSM A;  2I18 A;  3PFV A;  2MRD A;  3TS5 C;  3TDZ A;  2ISD A;  1GGW A;  2M9G A;  2BCB A;  3FE6 A;  1QWV A;  3BOW A;  2FCD A;  1U5I B;  3R1O A;  5ER4 X;  3LK0 A;  1KK8 C;  3DF0 A;  1M63 B;  1LVC D;  3O6B A;  2L0P A;  1R2U A;  1KK8 B;  1UHK A;  3SIB A;  4ETO A;  5D3O A;  3I5H B;  1FI6 A;  3SJS A;  1SCM C;  3DF0 B;  3PM8 A;  1K90 D;  2JC2 A;  1MQ1 A;  3CZT X;  1IH0 A;  3KHE A;  1CFF A;  1ZMZ A;  2ZRS A;  2GTE A;  2AAO A;  2K2A A;  3SIA A;  1BMO A;  2WND A;  1SL9 A;  1SYM A;  2H61 C;  4OV2 A;  1B9A A;  1FF1 A;  3DVJ A;  1AUI B;  1GM0 A;  1M46 A;  1K8U A;  1CDN A;  1EG4 A;  1SK6 D;  1OSA A;  4PHK A;  3FE8 A;  2JTT A;  1NX0 A;  3M0W A;  4JQ0 D;  3IVT A;  2LE9 B;  4CFQ A;  3AKB A;  3FWC A;  2QEV A;  2H61 A;  3B87 A;  1ZOT B;  2ZNE A;  2KFF A;  2KI6 C;  3LLE A;  3O2P A;  4PAL A;  1A75 B;  3KEV A;  2AMI A;  4PT1 A;  1BF5 A;  2HQ8 A;  1F4Q A;  2BBN A;  4R1E A;  1OZO A;  2BE4 A;  2PQL A;  4MSP A;  4GGN A;  2WCL A;  1J7O A;  2LHI A;  1LA3 A;  1KQM B;  5FYX A;  2KYF A;  1R6P A;  2ZFD A;  1NUB A;  2M7N A;  2F2O A;  3A8R A;  3EKH A;  5HL1 A;  1YVH A;  1IKU A;  1GGZ A;  2KSP A;  3EVR A;  4INX A;  3OP0 A;  1XVJ A;  1DJW A;  1DEK A;  1SL7 A;  2WCE A;  1UUS A;  5HLO A;  1C7W A;  2LMU A;  2MBX A;  3B86 A;  2K7O A;  2H8V A;  2M97 A;  2ERB A;  1KCY A;  1J1E A;  2MLF C;  2M49 B;  1KFU L;  3VRQ A;  1Y6W A;  1YR5 A;  4M2P A;  2OS8 C;  2SAS A;  1JSA A;  3FE9 A;  4Q04 A;  3S0G A;  1F8H A;  1CLL A;  2P71 A; 
#chains in the Genus database with same CATH homology
 4M2O A;  1X02 A;  1IQ5 A;  5KU1 A;  3O78 A;  1IQ3 A;  3SG5 A;  1BR4 B;  1K96 A;  1TCF A;  1IJ6 A;  3NXA A;  1XFY O;  1RRO A;  1WRL A;  1JWD A;  1DJX A;  1JFK A;  2LLS A;  5PAL A;  1FPW A;  5BPJ A;  1EL4 A;  1NWD A;  2EGD A;  3CGA A;  3PAL A;  3PLF B;  2LUX A;  2L51 A;  3F45 A;  4I5J A;  3LK1 A;  1N65 A;  4CID A;  2EHB A;  3FS7 A;  1DF0 B;  1A75 A;  2FJU B;  2KOT A;  1K9U A;  1B1G A;  2WCB A;  3O4Y A;  2K8M B;  3OB2 B;  1CNP A;  2TN4 A;  1PSB A;  5KSZ A;  3RM1 A;  2JU0 A;  1K93 D;  3VRO A;  2BL0 B;  1A2X A;  2OTG C;  3BOW B;  1DF0 A;  1QS7 A;  2F33 A;  1KFX L;  2LVK A;  3GK4 X;  3PSR A;  4BY5 A;  5D69 A;  2ZN9 A;  3JVT B;  1W7J B;  3WNX B;  1KSO A;  1MXE A;  2K7B A;  1SBJ A;  2LCP A;  2Y4Q A;  4I5L B;  4QJ4 B;  3BXK A;  3KO0 A;  1PVA A;  1SR6 B;  4YRU A;  1DT7 B;  4ORC B;  4I5K A;  1Y0V H;  2L4H A;  4D1E A;  2NCO A;  4ORA B;  2KAX A;  1K9P A;  1DJG A;  1IRJ A;  3ICB A;  5AAN A;  2OPO A;  2PSR A;  3MSE B;  3I5G C;  5HKZ A;  2Y1N A;  2LMT A;  3NSL A;  4GPL B;  3VRN A;  3ZWH A;  1EXR A;  1IGV A;  2KQY A;  1VRK A;  2LP3 A;  4I5N B;  1J7P A;  2IS9 A;  1YUT A;  2GGZ A;  1RK9 A;  4YBH B;  5DKQ A;  1DJY A;  2M3W A;  1OZS A;  2K7D A;  1AVS A;  1TTX A;  1A29 A;  1QIW A;  1ODB A;  4DIR A;  2M7L A;  1S26 D;  2KYC A;  2M0R A;  1F55 A;  1MHO A;  4DUQ A;  1XO5 A;  3E3R A;  4FQO A;  2L98 A;  4P2Y B;  4GAO A;  4ZCV A;  1YRT B;  3TDU A;  3NSO A;  1TRF A;  2LC5 A;  1KWO B;  1EJ3 A;  1NYA A;  3C1V A;  2LAN A;  1XA5 A;  2L4I A;  5I8N A;  2K0J A;  3AAJ A;  4A4C A;  5DKN A;  1EH2 A;  3SG4 A;  2NLN A;  3CR5 X;  3TUY B;  3FWB A;  1TCO B;  2COL B;  2P6B B;  1WDC C;  4YGA A;  4F0Z B;  4GGF A;  4PCW A;  4JPZ B;  1AHR A;  1SKT A;  3I5F C;  4QJ5 B;  2O60 A;  1CM4 A;  3I5H C;  5HLV A;  2ZN8 A;  1CTR A;  3PN7 C;  2JT0 A;  2LAP A;  2JT8 A;  3D0Y B;  4C0L A;  5HKY A;  1FI5 A;  1JF0 A;  3JVT C;  2LVV A;  4IL1 A;  1WLM A;  2JZI A;  4CFR A;  2MHH A;  2ZKM X;  2SCP A;  4WQ3 A;  2E6W A;  1CM1 A;  2F3Y A;  4HRG A;  2LHL A;  1QLK A;  2KBI A;  2QAC A;  3OB1 B;  1TNQ A;  3BUW B;  3H4S E;  2M1K B;  4OVN F;  1F54 A;  2NCP A;  1AJ5 A;  1ZAC A;  3WHT B;  2KAY A;  1K2H A;  2FOT A;  3K21 A;  1KQV A;  1B7T Y;  3CTN A;  3KF9 A;  1CMF A;  2BKI B;  1LKJ A;  1XK4 A;  3CR4 X;  1S6J A;  4USL A;  1QTX A;  1K94 A;  1QVI Y;  5JOL A;  4YGC B;  1MR8 A;  1ALW A;  1BU3 A;  1DJI A;  2JNX A;  2KHN A;  5D7F A;  4A4B A;  1JBA A;  2Q4U A;  5AXI A;  1TNX A;  1YTZ C;  4GFT A;  3I5I B;  4FTG A;  1QXP A;  2KGR A;  2E30 A;  1NX1 A;  5G08 A;  3SG2 A;  1KQM C;  1J55 A;  1OMD A;  2KI6 D;  2Q91 A;  4QJ3 B;  1L2O B;  1BLQ A;  2JWW A;  1CLM A;  2F3Z A;  1TNW A;  2I94 A;  1XK4 C;  1A4P A;  4N1F A;  4CPV A;  2DOQ A;  2PMY A;  3CWG A;  4PE7 A;  4C0J A;  1M45 A;  1CMG A;  1XYD A;  1BJF A;  4XJK B;  1M39 A;  2BE6 A;  2L50 A;  2JXL A;  1G8I A;  1Q80 A;  1MUX A;  4MZL A;  1REC A;  1SCV A;  3OX5 A;  3BUO B;  4MBE A;  3GOF A;  5CSN A;  1SNL A;  1GQM A;  1U5I A;  4MVF A;  1M31 A;  2JUL A;  3AAK A;  5DKR A;  4L9M A;  1L7Z A;  5AFP A;  1SCM B;  4YGB B;  2CTN A;  2M29 A;  3JTD C;  4AQJ A;  4GNK B;  1JUO A;  4PE4 A;  2GV5 A;  2CCM A;  4ORB B;  4OR9 B;  1A03 A;  4DCK A;  3CR2 A;  5AER A;  4PE0 A;  2LMV A;  2Y5I A;  1KK7 Y;  3BUX B;  3DVM A;  5I2Q A;  3IQQ A;  3HCM A;  1FW4 A;  4MRX A;  4ICB A;  1H8B A;  2LLU A;  3RLZ A;  1WRZ A;  4U8D A;  2PAL A;  2B1U A;  1XFV O;  1IWQ A;  1ZUZ A;  2G9B A;  1YVL A;  2BL0 C;  2JNF A;  2KDH A;  2OTG B;  3EK8 A;  3TDI A;  3D10 A;  3BUN B;  1YX7 A;  4YGE B;  3TS5 B;  1IJ5 A;  2LVI A;  1PVB A;  3LL8 B;  1WDC B;  3GK1 A;  3EK7 A;  5KTY A;  2MA2 A;  2BBM A;  1MXL C;  1OOJ A;  1FBV A;  1LXF C;  1SY9 A;  1TNP A;  2L2E A;  2JXC A;  1QAT A;  4ZCU A;  1OQP A;  1V1F A;  5ER5 A;  1J7Q A;  1CDP A;  1RFJ A;  1K95 A;  2O5G A;  1QIV A;  4UPG A;  2EC6 C;  4M2Q A;  3I5F B;  1DJH A;  1S6C A;  2KBM A;  1RTP 1;  4GBA A;  1SPY A;  1SW8 A;  1CFC A;  1QV0 A;  1B7T Z;  1PSR A;  1SMG A;  1UHH A;  3VGO A;  4MEW A;  1SR6 C;  4NQG A;  1NPQ A;  1YRU B;  2KFH A;  3QRX A;  1F4O A;  1V1G A;  1SRA A;  1YUR A;  1XFU O;  2CXJ A;  2KFG A;  2LM5 A;  1XFW O;  2WC8 A;  4AOM A;  1B4C A;  1Y1A A;  2JT3 A;  4YI8 A;  2JTZ A;  1BG1 A;  2JRF A;  3EK4 A;  1EG3 A;  1N0Y A;  4BY4 A;  4WRI A;  3BQ3 A;  1E8A A;  1UWO A;  1XFX O;  1YUS A;  1S1E A;  3DVE A;  3IF7 A;  1LA0 A;  4OCI A;  5CSF A;  3VRP A;  1KFU S;  1AK8 A;  1MWN A;  2KQ6 A;  2JPT A;  1DTL A;  1KFX S;  1Y1X A;  2WOS A;  3EKJ A;  1D1O A;  2HF5 A;  3LCP C;  2L5X B;  4PDZ A;  1N2D A;  1BOC A;  4MRY A;  2K61 A;  3SG7 A;  3OHM B;  2G2B A;  1BR1 B;  3ZNI A;  2I2R E;  2M1U A;  4XYN A;  1AP4 A;  3SG6 A;  1S5G Y;  3CLN A;  3EVV A;  1UHN A;  1WLZ A;  1NX2 A;  4HSZ A;  1OMV A;  2NZ0 A;  2EC6 B;  4C0K A;  3D0Y A;  3NSK A;  5I2O A;  1JF2 A;  1QVI Z;  1HT9 A;  1C07 A;  4DRW A;  4HRH A;  4MN0 A;  4WQ2 A;  5I2L A;  3GK2 A;  4E68 A;  2VRG A;  1PK0 D;  5HYD A;  1QV1 A;  2CT9 A;  1JC2 A;  1F70 A;  2QPT A;  4NDB A;  1J1D A;  1CFP A;  3TZ1 A;  2F8P A;  2HPS A;  1CDM A;  3OX6 A;  3I5G B;  4N1G A;  2HET A;  4MLW A;  1NIW A;  2A4J A;  2KAV A;  3NSI A;  2I7A A;  2PRU A;  2Y1M A;  1DVI A;  2MLE C;  5HKW A;  4GGF C;  1TIZ A;  2GGM A;  1WRK A;  1S36 A;  1ALV A;  2NXQ A;  2KI4 B;  2F2P A;  1QLS A;  5CPV A;  4GUK A;  1ZFS A;  3BUM B;  2CNP A;  2FCE A;  1GJY A;  1QJT A;  2BCX A;  2KI4 C;  2LV7 A;  2MJW B;  2PAS A;  1CKK A;  1CB1 A;  2M8U A;  2ZND A;  2R2I A;  2MAZ A;  2LLT A;  1YUU A;  4CLN A;  4JWQ A;  1NCZ A;  4NDC A;  4NDD A;  4N5X A;  1DGU A;  1UHJ A;  1Y1U A;  3FIA A;  2PVB A;  1S5G Z;  1XFZ O;  1BT6 A;  1CDL A;  1UUR A;  4P5O E;  1H4B A;  1QX2 A;  3TUY C;  1KWO C;  1LIN A;  1CFD A;  2K7C A;  4YI9 A;  1DGV A;  2LVJ A;  1F71 A;  1KK7 Z;  4MZJ A;  5AEQ A;  3SG3 A;  4DS7 A;  3HX4 A;  2AUC A;  2ZRT A;  1DJZ A;  1B47 A;  4AQI A;  1CLB A;  2LUC A;  3DD4 A;  2WCF A;  1QAS A;  1UP5 A;  5F6T A;  2KNE A;  1B8C A;  1IG5 A;  1DMO A;  1S3P A;  1NCX A;  1UHI A;  1OMR A;  4MZK A;  1WY9 A;  1TOP A;  3PN7 B;  5J3X A;  1G33 A;  3VRR A;  2OS8 B;  3AKA A;  3CS1 A;  1JFJ A;  1NCY A;  3JTD B;  2JQ6 A;  4YGD B;  1PRW A;  1RJV A;  2LNK A;  1NSH A;  3PAT A;  1G4Y R;  4PHJ A;  5B8I B;  2RGI A;  1AJ4 A;  5TNC A;  1OE9 B;  1HQV A;  2H2K A;  3WXA A;  1C7V A;  2LP2 A;  3DVK A;  1PAL A;  1J7R A;  2BEC A;  5K89 A;  3EVU A;  2WOR A;  3BYA A;  2CBL A;  4OKH A;  1QX5 B;  2BKH B;  1TN4 A;  1NX3 A;  5CSI A;  1B8L A;  5CSJ A;  2BCA A;  1PUL A;  1RWY A;  3WHU B;  2JOJ A;  4PE1 A;  1YX8 A;  1B8R A;  5IBW A;  1S6I A;  2K2F A;  5JJG A;  1QX7 A;  3A4U B;  1NP8 A;  1SL8 A;  4XJK A;  5GQQ C;  4TNC A;  1W7I B;  1K9K A;  1L2O C;  3KPX A;  1BOD A;  2D8N A;  1MF8 B;  4HRE E;  2HQW A;  3I5I C;  2KGB C;  4PHM A;  4PHN A;  3IQO A;  2V53 A;  1KSM A;  2I18 A;  3PFV A;  2MRD A;  3TS5 C;  3TDZ A;  2ISD A;  1GGW A;  2M9G A;  2BCB A;  3BOW A;  2FCD A;  1U5I B;  5ER4 X;  3LK0 A;  1KK8 C;  3DF0 A;  1M63 B;  1LVC D;  3O6B A;  2L0P A;  1R2U A;  1KK8 B;  1UHK A;  3SIB A;  4ETO A;  3I5H B;  1FI6 A;  3SJS A;  1SCM C;  3DF0 B;  3PM8 A;  1K90 D;  2JC2 A;  1MQ1 A;  3CZT X;  1IH0 A;  3KHE A;  1CFF A;  1ZMZ A;  2ZRS A;  2AAO A;  2K2A A;  3SIA A;  1BMO A;  2WND A;  1SL9 A;  1SYM A;  2H61 C;  4OV2 A;  1B9A A;  1FF1 A;  3DVJ A;  1AUI B;  1M46 A;  1K8U A;  1CDN A;  1EG4 A;  1SK6 D;  1OSA A;  4PHK A;  2JTT A;  1NX0 A;  3M0W A;  4JQ0 D;  2LE9 B;  4CFQ A;  3AKB A;  3FWC A;  2H61 A;  1ZOT B;  2ZNE A;  2KFF A;  2KI6 C;  3LLE A;  3O2P A;  4PAL A;  1A75 B;  3KEV A;  2AMI A;  1BF5 A;  2HQ8 A;  1F4Q A;  2BBN A;  4R1E A;  1OZO A;  2BE4 A;  4MSP A;  4GGN A;  1J7O A;  2LHI A;  1LA3 A;  1KQM B;  5FYX A;  2KYF A;  1R6P A;  2ZFD A;  1NUB A;  2M7N A;  2F2O A;  3A8R A;  3EKH A;  1YVH A;  1IKU A;  1GGZ A;  2KSP A;  3EVR A;  3OP0 A;  1XVJ A;  1DJW A;  1SL7 A;  2WCE A;  5HLO A;  1UUS A;  1C7W A;  2LMU A;  2MBX A;  2K7O A;  2M97 A;  1KCY A;  1J1E A;  2MLF C;  2M49 B;  1KFU L;  3VRQ A;  1Y6W A;  1YR5 A;  4M2P A;  2OS8 C;  2SAS A;  1JSA A;  4Q04 A;  1F8H A;  1CLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...