2P71A

Bombyx mori pheromone binding protein bound to iodohexadecane
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
132
structure length
132
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pheromone-binding protein
publication title Bombyx mori pheromone-binding protein binding nonpheromone ligands: implications for pheromone recognition.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Attractant
total genus 43
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2p71A00
2FJYA 2WC5A 3BFBA 3CYZA 2WCJA 1C3ZA 3DY9A 2QEOA 3S0DA 3R1VA 4FQTA 1DQEA 1OW4A 2KPHA 3B87A 5EL2A 1XFRA 1LS8A 1TWOA 1GM0A 2P71A 3L4AA 3D73A 3L4LA 2WCHA 3FE6A 3S0EA 3V2LA 3Q8IA 2WCMA 3RZSA 3R1OA 4F7FA 3DXLA 1ORGA 3OGNA 4INWA 3S0GA 3B88A 2P70A 2WCLA 3B7AA 3DYEA 3CDNA 1T14A 3NGVA 3S0FA 3CZ1A 2WC6A 2ERBA 3VB1A 3D78A 3D74A 3R1PA 1C3YA 3BJHA 1P28A 2QEVA 1OOGA 3FE8A 3S0AA 2WCKA 3QMEA 3N7HA 3K1EA 3B6XA 3R72A 3CZ0A 3CZ2A 2H8VA 3BFAA 3D76A 1OOIX 3DZTA 3D77A 1OOHA 2GTEA 2PQLA 4OZDA 3B86A 1OOFA 3NHIA 4PT1A 3PJIA 4JD9A 2L2CA 3L47A 3CABA 2QDIA 3FE9A 2QEHA 3NHTA 3D75A 3S0BA 1QWVA 2JPOA 2QEBA 4INXA 1TUJA 3BFHA 5DICA
chains in the Genus database with same CATH superfamily
2IS9A 2QACA 5CPVA 1DJZA 1FPWA 1SMGA 4CFQA 1TNXA 1U5IA 1SCVA 4PHJA 3BFBA 3CYZA 1S5GZ 1Y1XA 1IJ6A 4JPZB 2LVJA 1KK8C 3EKJA 2AMIA 3GOFA 3I5HB 2G9BA 3BOWA 4GGFA 1Q80A 1NUBA 3TDUA 1B8RA 3A8RA 4C0KA 3AAJA 1K9UA 4MVFA 4I5KA 4PE4A 1BJFA 3TZ1A 1XFRA 3LCPC 1B7TZ 3NSKA 4I5NB 3VRPA 1TWOA 4MEWA 1ALWA 2DOQA 2WCHA 4YI9A 1XFYO 1KQVA 3V2LA 1Y0VH 3TUYC 2JT8A 1YVHA 2PMYA 4GNKB 2A4JA 2M7LA 5I2OA 1NX0A 1AHRA 3EK7A 3MSEB 5FI6A 5JOLA 3EVRA 1RFJA 3SG3A 4BY5A 2JNFA 3ICBA 4OV2A 1XO5A 2CBLA 1SR6C 2JNXA 2KI6C 1DVIA 2JPTA 2KQYA 1C7WA 2L51A 3IF7A 2SCPA 5KU1A 1C7VA 1PALA 1A4PA 3S0GA 3OB1B 3NSOA 2EGDA 4YBHB 3VRQA 4YGEB 1SBJA 3OP0A 3O2PA 4BY4A 1VRKA 1XVJA 4ORAB 3UO9A 2F2PA 4MLWA 2GV5A 1PSRA 2WC8A 3EVVA 1S6CA 2BNXA 3NGVA 4XYNA 2WC6A 2KFFA 4C0JA 1KK7Z 3D78A 2F8PA 3EKHA 3R1PA 1RTP1 4PHKA 2Y5IA 3BUWB 1P28A 3KHEA 4MZJA 2KNEA 3I5HC 1H4BA 3VGOA 1XK4C 3CZTX 4NDBA 2LV7A 3M0WA 2JTTA 4NQGA 5J3XA 1DF0A 1K90D 1QX7A 1UHIA 2JRFA 2WCKA 1JF2A 3KPXA 4PHMA 2P6BB 3FWCA 4A4BA 3C1VA 4ETOA 4MBEA 1QLSA 3PLFB 4HREE 1CLLA 1B4CA 4A4CA 5AEQA 4OCIA 2LP3A 1RROA 1HQVA 2FJUB 2M97A 3R72A 1OMDA 2KAYA 1IQ5A 1LA0A 1BR4B 1XYDA 2M9GA 2K0JA 1S36A 1OOIX 2F3ZA 3WXAA 3D77A 4PDZA 1CM4A 1OOHA 2GTEA 1IJ5A 1DJHA 1DJXA 1IWQA 1TNQA 5DKQA 5HKZA 3I5IB 5F6TA 3B86A 3NSLA 4AOMA 1OOFA 1CM1A 2M1UA 2LVVA 5AFPA 2NZ0A 1A2XA 4GGNA 2LUXA 2BECA 4OVNF 1KCYA 2L2CA 3O78A 2PVBA 1RJVA 4UPGA 1BF5A 2HETA 3WHTB 2K2AA 3SG6A 1W7IB 2MLFC 1ODBA 1CLBA 2WOSA 3AAKA 1DJIA 1AVSA 2EC6B 2QEHA 3FWBA 1AP4A 1QV0A 4MRYA 2L4IA 1K8UA 2LUCA 1CFDA 1F70A 2KI6D 5DICA 5DKRA 3DF0B 4GBAA 2NCPA 4HSZA 4PE1A 1CKKA 1DTLA 1KFXS 1BMOA 2FJYA 2KI4B 2K61A 2PSRA 1JWDA 1S26D 1YRUB 1JSAA 2WC5A 4QJ4B 2M29A 3EK4A 1QXPA 1BLQA 1WRLA 3EK8A 4MZKA 3IQOA 5DKNA 3GK1A 4P5OE 1F71A 2D8NA 3PATA 2Y1MA 3LK1A 3R1VA 4WQ3A 1SK6D 5HLOA 1DQEA 2I94A 3I5GB 1G33A 1WRZA 3D0YB 1B8CA 2MRDA 1EJ3A 3I5IC 3PFVA 4GAOA 4N1GA 4YGDB 2E30A 1CNPA 4R1EA 3CR2A 4DRWA 1DC1A 1TRFA 1M45A 3DVEA 4MSPA 2KQ6A 2I18A 1M63B 1ZMZA 3CLNA 3CWGA 5K89A 2KYFA 4L9MA 1DMOA 4MN0A 4F7FA 4Q04A 1TNPA 2CNPA 2EC6C 1ORGA 2LLTA 4I5JA 3OGNA 2V53A 1JFJA 4INWA 1IQ3A 1LINA 3SIBA 2ZNEA 3I5FB 5PALA 3AKAA 4JWQA 2P70A 5ER4X 2L50A 3BQ3A 3SIAA 1M39A 1SYMA 1K96A 2PRUA 1IH0A 2KI4C 4QJ5B 5D3OA 1UHJA 1ZUZA 4CFRA 3CZ1A 5D69A 2H61A 2ERBA 3VB1A 2BBNA 1J55A 2HF5A 3D74A 4D1EA 4OKHA 1RK9A 1QVIY 1OZOA 1SSEB 2YGUA 2LMTA 1YUTA 4M2QA 2FCDA 3AKBA 3BUMB 1RWYA 1SY9A 3NXAA 1DJGA 1OSAA 1K9KA 2O5GA 1MXEA 1TIZA 3I5GC 4JKTA 3RLZA 1ZACA 2BE4A 1XFUO 3K1EA 1XA5A 3UNWA 2L5YA 2I2RE 1LKJA 3GK4X 4FTGA 1WLZA 1WY9A 1A75B 3GK2A 1NIWA 2H2KA 2CXJA 3CZ0A 1V1GA 2LMUA 3BFAA 2WCBA 2QPTA 3DVKA 1CDNA 1V1FA 4U8DA 1QATA 1TNWA 2KAXA 3LL8B 4KYNA 5IBWA 2MJWB 2K7DA 1K95A 5TNCA 3CS1A 2LANA 1UHHA 2E6WA 2JXCA 3TDZA 1UURA 2CT9A 3I5FC 3IQQA 3LLEA 4USLA 1JBAA 3OX5A 2JT0A 1X02A 1AK8A 1B7TY 1GJYA 1L2OB 4GUKA 4HRGA 1CB1A 2PASA 3O4XA 2LHIA 1Z2CB 1N65A 2LE9B 2ZN9A 3O4YA 2KGBC 2Q4UA 4FQOA 1MHOA 3CGAA 3D75A 3S0BA 1GGZA 1N2DA 3LK0A 1QWVA 4INXA 2ZRSA 1OQPA 3BUOB 2KOTA 1TUJA 2ZRTA 2BE6A 3BFHA 3SS3A 1LVCD 1BR1B 2B1UA 5FI7A 2BL0B 2LLSA 2PALA 2NCOA 3NSIA 1U5IB 4CIDA 5JJGA 4ZCVA 1J7OA 1K94A 2PYQA 1PULA 2WCJA 1MF8B 2K7CA 2LVIA 5FYXA 2LP2A 4YRUA 1QX5B 1R2UA 1D1OA 1FF1A 1C3ZA 2Y4QA 4QJ3B 2MAZA 1PSBA 1XFXO 3OB2B 4P2YB 3BOWB 2SASA 2EHBA 3S0DA 1SL9A 1XK4A 4FQTA 5GQQC 3K21A 3ZNIA 1KFUL 1OW4A 2KLEA 4TNCA 5EL2A 1NSHA 1S1EA 1NP8A 3DVJA 1BODA 1GM0A 2WCEA 1LXFC 1UWOA 2BKHB 3FE6A 3L4AA 1BT6A 3L4LA 3S0EA 5B8IB 2GGZA 1L7ZA 4IL1A 3SJSA 1BG1A 2CCMA 1EG4A 4XJKB 1PVAA 1QX2A 2OS8B 2LM5A 1PK0D 2LVKA 4M2PA 1L2OC 1S6JA 1Y1AA 3RZSA 3CR5X 1UUSA 2KAVA 2GGMA 3R1OA 2KFGA 4AQIA 3DXLA 1J7RA 2VRGA 3ZWHA 2ISDA 3VRNA 1YR5A 2R2IA 1MUXA 3PM2A 3SG5A 1A03A 1N0YA 2JU0A 1CLMA 1GQMA 1QIWA 2KDHA 1DELA 1SL8A 3B88A 1M46A 1C07A 1IG5A 4CPVA 3BUXB 1F8HA 3BUNB 1A75A 2WCLA 2KSPA 4MRXA 1J1DA 2ZNDA 3B7AA 3DVMA 2BL0C 3HCMA 1F54A 3DYEA 1J7QA 2RGIA 1NCZA 5I2QA 4MZLA 1UHKA 1XFVO 2KLDA 1CTRA 1DJWA 1MXLC 1T14A 1CDLA 1KSOA 2HQWA 2L2EA 4AQJA 1DT7B 3WNXB 1PVBA 2NXQA 3OBVA 4GGFC 1J1EA 3FE8A 4NDCA 1LA3A 1DF0B 2M0RA 5HL1A 1NYAA 1QLKA 4DIRA 3VROA 2BBMA 3S0AA 2LCPA 1QVIZ 1IKUA 5I8NA 3N7HA 3DD4A 1SW8A 2L0PA 3QRXA 2K2FA 4YGCB 5I2LA 1H8BA 1NWDA 3B6XA 5HKWA 2MLEC 1WDCB 1FW4A 3FIAA 1IGVA 1Y6WA 1DJYA 2OS8C 1EXRA 2L98A 2H8VA 4PCWA 3RM1A 3KEVA 3D76A 3TDIA 2AAOA 1YURA 2G2BA 2HPSA 1F4QA 3JTDB 5CSIA 2M3WA 4C0LA 2PQLA 2KBIA 2F33A 2O60A 2KYCA 3PJIA 3OX6A 1NPQA 1NCYA 3KO0A 4WQ2A 1SRAA 2COLB 1K93D 1EG3A 1TTXA 5AXIA 3L47A 1TCOB 1TCFA 3IVTA 3CTNA 3VRRA 4DCKA 2LNKA 4IJ7A 2JT3A 1CDMA 4ORBB 3EVUA 4YGBB 2QDIA 3FE9A 1OZSA 2KGRA 4E68A 1AJ5A 1QASA 1YRTB 2FCEA 3WHUB 3NHTA 2MA2A 3SG4A 1ZFSA 3CR4X 1NCXA 4PALA 2QEBA 2WCFA 3SS4A 1NX2A 1CFPA 1OMVA 1S5GY 2K7BA 4XJKA 1F4OA 1F55A 3DF0A 2LMVA 3JVTB 1YUSA 3PALA 5HLVA 3FS7A 1RECA 1SPYA 1DGVA 3PN7B 1JFKA 1WDCC 1QS7A 2JZIA 3DY9A 2QEOA 1YUUA 1NX1A 4DUQA 3SS5A 2L5XB 4PE0A 2KHNA 1CFFA 3JTDC 1BU3A 1QIVA 1YX8A 5FI2A 4ZCUA 1SL7A 2KFHA 2KPHA 3B87A 2BCAA 3D0YA 1HT9A 1CMGA 1LS8A 1NX3A 1XFZO 2M8UA 2P71A 1KQMB 2CTNA 1Z4HA 2M1KB 3D73A 4GPLB 2Q91A 4CLNA 1UP5A 1KFXL 2OPOA 5CSFA 2JULA 3Q8IA 4HRHA 4JQ0D 3OHMB 1W7JB 3O6BA 2JXLA 2HQ8A 2LHLA 1DGUA 2F2OA 2JTZA 2OTGB 2WCMA 3H4SE 3TS5B 2K8MB 1SKTA 2ZN8A 4N1FA 4I5LB 2LAPA 3SG7A 3E3RA 1QJTA 5AERA 1G4YR 1MWNA 1OMRA 2LC5A 4OR9B 2K7OA 5HKYA 4PHNA 3PM8A 1CMFA 4ICBA 2BCBA 1YX7A 1J7PA 1JUOA 1KWOB 1ZOTB 2JWWA 2TN4A 1B1GA 1TUZA 1KK7Y 3JVTC 2ZKMX 3CDNA 1E8AA 2WNDA 1CFCA 2K60A 3S0FA 3EG5B 3PN7C 2L4HA 1CDPA 1M31A 1S3PA 1OE9B 5I94A 3HX4A 1XFWO 3BJHA 2ZFDA 4M2OA 1C3YA 1IIOA 2QEVA 1WRKA 2NLNA 1OOGA 2BKIB 5HYDA 1UHNA 2BAPA 1OOJA 1SCMB 1QTXA 1TOPA 1B47A 3QMEA 5D7FA 1KQMC 1EH2A 4DS7A 3D10A 4PE7A 1PRWA 1KSMA 1YTZC 1WLMA 1EL4A 1S6IA 1GGWA 1KK8B 3SG2A 2OTGC 3TS5C 2MHHA 3CZ2A 3F45A 3KF9A 3DZTA 1G8IA 1K9PA 2JQ6A 2JC2A 1DEKA 1QV1A 4GFTA 2M49B 4OZDA 4YI8A 1AJ4A 5CSNA 1K2HA 5KTYA 4N5XA 3NHIA 4PT1A 2AUCA 5AANA 3BXKA 1JF0A 1MQ1A 2F3YA 3A4UB 3TUYB 1TN4A 1ALVA 4JD9A 1B9AA 1KWOC 2FOTA 2MBXA 1IRJA 1FBVA 2Y1NA 5ER5A 4YGAA 1AUIB 3CABA 2WORA 3BYAA 1R6PA 1SNLA 1W9ZA 2H61C 4WRIA 5BPJA 3PSRA 1YVLA 1BOCA 1SR6B 5CSJA 1B8LA 5KSZA 1FI5A 1JC2A 5G08A 4F0ZB 2LLUA 1MR8A 2I7AA 2M7NA 1FI6A 2JPOA 1KFUS 2KBMA 4ORCB 1A29A 2JOJA 4NDDA 1Y1UA 1SCMC 2BCXA
chains in the Genus database with same CATH topology
2FJYA 2WC5A 3BFBA 3CYZA 2WCJA 1C3ZA 3DY9A 2QEOA 3S0DA 3R1VA 4FQTA 1DQEA 1OW4A 2KPHA 3B87A 5EL2A 1XFRA 1LS8A 1TWOA 1GM0A 2P71A 3L4AA 3D73A 3L4LA 2WCHA 3FE6A 3S0EA 3V2LA 3Q8IA 2WCMA 3RZSA 3R1OA 4F7FA 3DXLA 1ORGA 3OGNA 4INWA 3S0GA 3B88A 2P70A 2WCLA 3B7AA 3DYEA 3CDNA 1T14A 3NGVA 3S0FA 3CZ1A 2WC6A 2ERBA 3VB1A 3D78A 3D74A 3R1PA 1C3YA 3BJHA 1P28A 2QEVA 1OOGA 3FE8A 3S0AA 2WCKA 3QMEA 3N7HA 3K1EA 3B6XA 3R72A 3CZ0A 3CZ2A 2H8VA 3BFAA 3D76A 1OOIX 3DZTA 3D77A 1OOHA 2GTEA 2PQLA 4OZDA 3B86A 1OOFA 3NHIA 4PT1A 3PJIA 4JD9A 2L2CA 3L47A 3CABA 2QDIA 3FE9A 2QEHA 3NHTA 3D75A 3S0BA 1QWVA 2JPOA 2QEBA 4INXA 1TUJA 3BFHA 5DICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJY A;  2WC5 A;  3BFB A;  3CYZ A;  2WCJ A;  1C3Z A;  3DY9 A;  2QEO A;  3S0D A;  3R1V A;  4FQT A;  1DQE A;  1OW4 A;  2KPH A;  3B87 A;  5EL2 A;  1XFR A;  1LS8 A;  1TWO A;  1GM0 A;  2P71 A;  3L4A A;  3D73 A;  3L4L A;  2WCH A;  3FE6 A;  3S0E A;  3V2L A;  3Q8I A;  2WCM A;  3RZS A;  3R1O A;  4F7F A;  3DXL A;  1ORG A;  3OGN A;  4INW A;  3S0G A;  3B88 A;  2P70 A;  2WCL A;  3B7A A;  3DYE A;  3CDN A;  1T14 A;  3NGV A;  3S0F A;  3CZ1 A;  2WC6 A;  2ERB A;  3VB1 A;  3D78 A;  3D74 A;  3R1P A;  1C3Y A;  3BJH A;  1P28 A;  2QEV A;  1OOG A;  3FE8 A;  3S0A A;  2WCK A;  3QME A;  3N7H A;  3K1E A;  3B6X A;  3R72 A;  3CZ0 A;  3CZ2 A;  2H8V A;  3BFA A;  3D76 A;  1OOI X;  3DZT A;  3D77 A;  1OOH A;  2GTE A;  2PQL A;  4OZD A;  3B86 A;  1OOF A;  3NHI A;  4PT1 A;  3PJI A;  4JD9 A;  2L2C A;  3L47 A;  3CAB A;  2QDI A;  3FE9 A;  2QEH A;  3NHT A;  3D75 A;  3S0B A;  1QWV A;  2JPO A;  2QEB A;  4INX A;  1TUJ A;  3BFH A;  5DIC A; 
#chains in the Genus database with same CATH topology
 2IS9 A;  2QAC A;  5CPV A;  1DJZ A;  1FPW A;  1SMG A;  4CFQ A;  1TNX A;  1U5I A;  1SCV A;  4PHJ A;  3BFB A;  3CYZ A;  1S5G Z;  1Y1X A;  1IJ6 A;  4JPZ B;  2LVJ A;  1KK8 C;  3EKJ A;  2AMI A;  3GOF A;  3I5H B;  2G9B A;  3BOW A;  4GGF A;  1Q80 A;  1NUB A;  3TDU A;  1B8R A;  3A8R A;  4C0K A;  3AAJ A;  1K9U A;  4MVF A;  4I5K A;  4PE4 A;  1BJF A;  3TZ1 A;  1XFR A;  3LCP C;  1B7T Z;  3NSK A;  4I5N B;  3VRP A;  1TWO A;  4MEW A;  1ALW A;  2DOQ A;  2WCH A;  4YI9 A;  1XFY O;  1KQV A;  3V2L A;  1Y0V H;  3TUY C;  2JT8 A;  1YVH A;  2PMY A;  4GNK B;  2A4J A;  2M7L A;  5I2O A;  1NX0 A;  1AHR A;  3EK7 A;  3MSE B;  5FI6 A;  5JOL A;  3EVR A;  1RFJ A;  3SG3 A;  4BY5 A;  2JNF A;  3ICB A;  4OV2 A;  1XO5 A;  2CBL A;  1SR6 C;  2JNX A;  2KI6 C;  1DVI A;  2JPT A;  2KQY A;  1C7W A;  2L51 A;  3IF7 A;  2SCP A;  5KU1 A;  1C7V A;  1PAL A;  1A4P A;  3S0G A;  3OB1 B;  3NSO A;  2EGD A;  4YBH B;  3VRQ A;  4YGE B;  1SBJ A;  3OP0 A;  3O2P A;  4BY4 A;  1VRK A;  1XVJ A;  4ORA B;  3UO9 A;  2F2P A;  4MLW A;  2GV5 A;  1PSR A;  2WC8 A;  3EVV A;  1S6C A;  2BNX A;  3NGV A;  4XYN A;  2WC6 A;  2KFF A;  4C0J A;  1KK7 Z;  3D78 A;  2F8P A;  3EKH A;  3R1P A;  1RTP 1;  4PHK A;  2Y5I A;  3BUW B;  1P28 A;  3KHE A;  4MZJ A;  2KNE A;  3I5H C;  1H4B A;  3VGO A;  1XK4 C;  3CZT X;  4NDB A;  2LV7 A;  3M0W A;  2JTT A;  4NQG A;  5J3X A;  1DF0 A;  1K90 D;  1QX7 A;  1UHI A;  2JRF A;  2WCK A;  1JF2 A;  3KPX A;  4PHM A;  2P6B B;  3FWC A;  4A4B A;  3C1V A;  4ETO A;  4MBE A;  1QLS A;  3PLF B;  4HRE E;  1CLL A;  1B4C A;  4A4C A;  5AEQ A;  4OCI A;  2LP3 A;  1RRO A;  1HQV A;  2FJU B;  2M97 A;  3R72 A;  1OMD A;  2KAY A;  1IQ5 A;  1LA0 A;  1BR4 B;  1XYD A;  2M9G A;  2K0J A;  1S36 A;  1OOI X;  2F3Z A;  3WXA A;  3D77 A;  4PDZ A;  1CM4 A;  1OOH A;  2GTE A;  1IJ5 A;  1DJH A;  1DJX A;  1IWQ A;  1TNQ A;  5DKQ A;  5HKZ A;  3I5I B;  5F6T A;  3B86 A;  3NSL A;  4AOM A;  1OOF A;  1CM1 A;  2M1U A;  2LVV A;  5AFP A;  2NZ0 A;  1A2X A;  4GGN A;  2LUX A;  2BEC A;  4OVN F;  1KCY A;  2L2C A;  3O78 A;  2PVB A;  1RJV A;  4UPG A;  1BF5 A;  2HET A;  3WHT B;  2K2A A;  3SG6 A;  1W7I B;  2MLF C;  1ODB A;  1CLB A;  2WOS A;  3AAK A;  1DJI A;  1AVS A;  2EC6 B;  2QEH A;  3FWB A;  1AP4 A;  1QV0 A;  4MRY A;  2L4I A;  1K8U A;  2LUC A;  1CFD A;  1F70 A;  2KI6 D;  5DIC A;  5DKR A;  3DF0 B;  4GBA A;  2NCP A;  4HSZ A;  4PE1 A;  1CKK A;  1DTL A;  1KFX S;  1BMO A;  2FJY A;  2KI4 B;  2K61 A;  2PSR A;  1JWD A;  1S26 D;  1YRU B;  1JSA A;  2WC5 A;  4QJ4 B;  2M29 A;  3EK4 A;  1QXP A;  1BLQ A;  1WRL A;  3EK8 A;  4MZK A;  3IQO A;  5DKN A;  3GK1 A;  4P5O E;  1F71 A;  2D8N A;  3PAT A;  2Y1M A;  3LK1 A;  3R1V A;  4WQ3 A;  1SK6 D;  5HLO A;  1DQE A;  2I94 A;  3I5G B;  1G33 A;  1WRZ A;  3D0Y B;  1B8C A;  2MRD A;  1EJ3 A;  3I5I C;  3PFV A;  4GAO A;  4N1G A;  4YGD B;  2E30 A;  1CNP A;  4R1E A;  3CR2 A;  4DRW A;  1DC1 A;  1TRF A;  1M45 A;  3DVE A;  4MSP A;  2KQ6 A;  2I18 A;  1M63 B;  1ZMZ A;  3CLN A;  3CWG A;  5K89 A;  2KYF A;  4L9M A;  1DMO A;  4MN0 A;  4F7F A;  4Q04 A;  1TNP A;  2CNP A;  2EC6 C;  1ORG A;  2LLT A;  4I5J A;  3OGN A;  2V53 A;  1JFJ A;  4INW A;  1IQ3 A;  1LIN A;  3SIB A;  2ZNE A;  3I5F B;  5PAL A;  3AKA A;  4JWQ A;  2P70 A;  5ER4 X;  2L50 A;  3BQ3 A;  3SIA A;  1M39 A;  1SYM A;  1K96 A;  2PRU A;  1IH0 A;  2KI4 C;  4QJ5 B;  5D3O A;  1UHJ A;  1ZUZ A;  4CFR A;  3CZ1 A;  5D69 A;  2H61 A;  2ERB A;  3VB1 A;  2BBN A;  1J55 A;  2HF5 A;  3D74 A;  4D1E A;  4OKH A;  1RK9 A;  1QVI Y;  1OZO A;  1SSE B;  2YGU A;  2LMT A;  1YUT A;  4M2Q A;  2FCD A;  3AKB A;  3BUM B;  1RWY A;  1SY9 A;  3NXA A;  1DJG A;  1OSA A;  1K9K A;  2O5G A;  1MXE A;  1TIZ A;  3I5G C;  4JKT A;  3RLZ A;  1ZAC A;  2BE4 A;  1XFU O;  3K1E A;  1XA5 A;  3UNW A;  2L5Y A;  2I2R E;  1LKJ A;  3GK4 X;  4FTG A;  1WLZ A;  1WY9 A;  1A75 B;  3GK2 A;  1NIW A;  2H2K A;  2CXJ A;  3CZ0 A;  1V1G A;  2LMU A;  3BFA A;  2WCB A;  2QPT A;  3DVK A;  1CDN A;  1V1F A;  4U8D A;  1QAT A;  1TNW A;  2KAX A;  3LL8 B;  4KYN A;  5IBW A;  2MJW B;  2K7D A;  1K95 A;  5TNC A;  3CS1 A;  2LAN A;  1UHH A;  2E6W A;  2JXC A;  3TDZ A;  1UUR A;  2CT9 A;  3I5F C;  3IQQ A;  3LLE A;  4USL A;  1JBA A;  3OX5 A;  2JT0 A;  1X02 A;  1AK8 A;  1B7T Y;  1GJY A;  1L2O B;  4GUK A;  4HRG A;  1CB1 A;  2PAS A;  3O4X A;  2LHI A;  1Z2C B;  1N65 A;  2LE9 B;  2ZN9 A;  3O4Y A;  2KGB C;  2Q4U A;  4FQO A;  1MHO A;  3CGA A;  3D75 A;  3S0B A;  1GGZ A;  1N2D A;  3LK0 A;  1QWV A;  4INX A;  2ZRS A;  1OQP A;  3BUO B;  2KOT A;  1TUJ A;  2ZRT A;  2BE6 A;  3BFH A;  3SS3 A;  1LVC D;  1BR1 B;  2B1U A;  5FI7 A;  2BL0 B;  2LLS A;  2PAL A;  2NCO A;  3NSI A;  1U5I B;  4CID A;  5JJG A;  4ZCV A;  1J7O A;  1K94 A;  2PYQ A;  1PUL A;  2WCJ A;  1MF8 B;  2K7C A;  2LVI A;  5FYX A;  2LP2 A;  4YRU A;  1QX5 B;  1R2U A;  1D1O A;  1FF1 A;  1C3Z A;  2Y4Q A;  4QJ3 B;  2MAZ A;  1PSB A;  1XFX O;  3OB2 B;  4P2Y B;  3BOW B;  2SAS A;  2EHB A;  3S0D A;  1SL9 A;  1XK4 A;  4FQT A;  5GQQ C;  3K21 A;  3ZNI A;  1KFU L;  1OW4 A;  2KLE A;  4TNC A;  5EL2 A;  1NSH A;  1S1E A;  1NP8 A;  3DVJ A;  1BOD A;  1GM0 A;  2WCE A;  1LXF C;  1UWO A;  2BKH B;  3FE6 A;  3L4A A;  1BT6 A;  3L4L A;  3S0E A;  5B8I B;  2GGZ A;  1L7Z A;  4IL1 A;  3SJS A;  1BG1 A;  2CCM A;  1EG4 A;  4XJK B;  1PVA A;  1QX2 A;  2OS8 B;  2LM5 A;  1PK0 D;  2LVK A;  4M2P A;  1L2O C;  1S6J A;  1Y1A A;  3RZS A;  3CR5 X;  1UUS A;  2KAV A;  2GGM A;  3R1O A;  2KFG A;  4AQI A;  3DXL A;  1J7R A;  2VRG A;  3ZWH A;  2ISD A;  3VRN A;  1YR5 A;  2R2I A;  1MUX A;  3PM2 A;  3SG5 A;  1A03 A;  1N0Y A;  2JU0 A;  1CLM A;  1GQM A;  1QIW A;  2KDH A;  1DEL A;  1SL8 A;  3B88 A;  1M46 A;  1C07 A;  1IG5 A;  4CPV A;  3BUX B;  1F8H A;  3BUN B;  1A75 A;  2WCL A;  2KSP A;  4MRX A;  1J1D A;  2ZND A;  3B7A A;  3DVM A;  2BL0 C;  3HCM A;  1F54 A;  3DYE A;  1J7Q A;  2RGI A;  1NCZ A;  5I2Q A;  4MZL A;  1UHK A;  1XFV O;  2KLD A;  1CTR A;  1DJW A;  1MXL C;  1T14 A;  1CDL A;  1KSO A;  2HQW A;  2L2E A;  4AQJ A;  1DT7 B;  3WNX B;  1PVB A;  2NXQ A;  3OBV A;  4GGF C;  1J1E A;  3FE8 A;  4NDC A;  1LA3 A;  1DF0 B;  2M0R A;  5HL1 A;  1NYA A;  1QLK A;  4DIR A;  3VRO A;  2BBM A;  3S0A A;  2LCP A;  1QVI Z;  1IKU A;  5I8N A;  3N7H A;  3DD4 A;  1SW8 A;  2L0P A;  3QRX A;  2K2F A;  4YGC B;  5I2L A;  1H8B A;  1NWD A;  3B6X A;  5HKW A;  2MLE C;  1WDC B;  1FW4 A;  3FIA A;  1IGV A;  1Y6W A;  1DJY A;  2OS8 C;  1EXR A;  2L98 A;  2H8V A;  4PCW A;  3RM1 A;  3KEV A;  3D76 A;  3TDI A;  2AAO A;  1YUR A;  2G2B A;  2HPS A;  1F4Q A;  3JTD B;  5CSI A;  2M3W A;  4C0L A;  2PQL A;  2KBI A;  2F33 A;  2O60 A;  2KYC A;  3PJI A;  3OX6 A;  1NPQ A;  1NCY A;  3KO0 A;  4WQ2 A;  1SRA A;  2COL B;  1K93 D;  1EG3 A;  1TTX A;  5AXI A;  3L47 A;  1TCO B;  1TCF A;  3IVT A;  3CTN A;  3VRR A;  4DCK A;  2LNK A;  4IJ7 A;  2JT3 A;  1CDM A;  4ORB B;  3EVU A;  4YGB B;  2QDI A;  3FE9 A;  1OZS A;  2KGR A;  4E68 A;  1AJ5 A;  1QAS A;  1YRT B;  2FCE A;  3WHU B;  3NHT A;  2MA2 A;  3SG4 A;  1ZFS A;  3CR4 X;  1NCX A;  4PAL A;  2QEB A;  2WCF A;  3SS4 A;  1NX2 A;  1CFP A;  1OMV A;  1S5G Y;  2K7B A;  4XJK A;  1F4O A;  1F55 A;  3DF0 A;  2LMV A;  3JVT B;  1YUS A;  3PAL A;  5HLV A;  3FS7 A;  1REC A;  1SPY A;  1DGV A;  3PN7 B;  1JFK A;  1WDC C;  1QS7 A;  2JZI A;  3DY9 A;  2QEO A;  1YUU A;  1NX1 A;  4DUQ A;  3SS5 A;  2L5X B;  4PE0 A;  2KHN A;  1CFF A;  3JTD C;  1BU3 A;  1QIV A;  1YX8 A;  5FI2 A;  4ZCU A;  1SL7 A;  2KFH A;  2KPH A;  3B87 A;  2BCA A;  3D0Y A;  1HT9 A;  1CMG A;  1LS8 A;  1NX3 A;  1XFZ O;  2M8U A;  2P71 A;  1KQM B;  2CTN A;  1Z4H A;  2M1K B;  3D73 A;  4GPL B;  2Q91 A;  4CLN A;  1UP5 A;  1KFX L;  2OPO A;  5CSF A;  2JUL A;  3Q8I A;  4HRH A;  4JQ0 D;  3OHM B;  1W7J B;  3O6B A;  2JXL A;  2HQ8 A;  2LHL A;  1DGU A;  2F2O A;  2JTZ A;  2OTG B;  2WCM A;  3H4S E;  3TS5 B;  2K8M B;  1SKT A;  2ZN8 A;  4N1F A;  4I5L B;  2LAP A;  3SG7 A;  3E3R A;  1QJT A;  5AER A;  1G4Y R;  1MWN A;  1OMR A;  2LC5 A;  4OR9 B;  2K7O A;  5HKY A;  4PHN A;  3PM8 A;  1CMF A;  4ICB A;  2BCB A;  1YX7 A;  1J7P A;  1JUO A;  1KWO B;  1ZOT B;  2JWW A;  2TN4 A;  1B1G A;  1TUZ A;  1KK7 Y;  3JVT C;  2ZKM X;  3CDN A;  1E8A A;  2WND A;  1CFC A;  2K60 A;  3S0F A;  3EG5 B;  3PN7 C;  2L4H A;  1CDP A;  1M31 A;  1S3P A;  1OE9 B;  5I94 A;  3HX4 A;  1XFW O;  3BJH A;  2ZFD A;  4M2O A;  1C3Y A;  1IIO A;  2QEV A;  1WRK A;  2NLN A;  1OOG A;  2BKI B;  5HYD A;  1UHN A;  2BAP A;  1OOJ A;  1SCM B;  1QTX A;  1TOP A;  1B47 A;  3QME A;  5D7F A;  1KQM C;  1EH2 A;  4DS7 A;  3D10 A;  4PE7 A;  1PRW A;  1KSM A;  1YTZ C;  1WLM A;  1EL4 A;  1S6I A;  1GGW A;  1KK8 B;  3SG2 A;  2OTG C;  3TS5 C;  2MHH A;  3CZ2 A;  3F45 A;  3KF9 A;  3DZT A;  1G8I A;  1K9P A;  2JQ6 A;  2JC2 A;  1DEK A;  1QV1 A;  4GFT A;  2M49 B;  4OZD A;  4YI8 A;  1AJ4 A;  5CSN A;  1K2H A;  5KTY A;  4N5X A;  3NHI A;  4PT1 A;  2AUC A;  5AAN A;  3BXK A;  1JF0 A;  1MQ1 A;  2F3Y A;  3A4U B;  3TUY B;  1TN4 A;  1ALV A;  4JD9 A;  1B9A A;  1KWO C;  2FOT A;  2MBX A;  1IRJ A;  1FBV A;  2Y1N A;  5ER5 A;  4YGA A;  1AUI B;  3CAB A;  2WOR A;  3BYA A;  1R6P A;  1SNL A;  1W9Z A;  2H61 C;  4WRI A;  5BPJ A;  3PSR A;  1YVL A;  1BOC A;  1SR6 B;  5CSJ A;  1B8L A;  5KSZ A;  1FI5 A;  1JC2 A;  5G08 A;  4F0Z B;  2LLU A;  1MR8 A;  2I7A A;  2M7N A;  1FI6 A;  2JPO A;  1KFU S;  2KBM A;  4ORC B;  1A29 A;  2JOJ A;  4NDD A;  1Y1U A;  1SCM C;  2BCX A; 
#chains in the Genus database with same CATH homology
 2FJY A;  2WC5 A;  3BFB A;  3CYZ A;  2WCJ A;  1C3Z A;  3DY9 A;  2QEO A;  3S0D A;  3R1V A;  4FQT A;  1DQE A;  1OW4 A;  2KPH A;  3B87 A;  5EL2 A;  1XFR A;  1LS8 A;  1TWO A;  1GM0 A;  2P71 A;  3L4A A;  3D73 A;  3L4L A;  2WCH A;  3FE6 A;  3S0E A;  3V2L A;  3Q8I A;  2WCM A;  3RZS A;  3R1O A;  4F7F A;  3DXL A;  1ORG A;  3OGN A;  4INW A;  3S0G A;  3B88 A;  2P70 A;  2WCL A;  3B7A A;  3DYE A;  3CDN A;  1T14 A;  3NGV A;  3S0F A;  3CZ1 A;  2WC6 A;  2ERB A;  3VB1 A;  3D78 A;  3D74 A;  3R1P A;  1C3Y A;  3BJH A;  1P28 A;  2QEV A;  1OOG A;  3FE8 A;  3S0A A;  2WCK A;  3QME A;  3N7H A;  3K1E A;  3B6X A;  3R72 A;  3CZ0 A;  3CZ2 A;  2H8V A;  3BFA A;  3D76 A;  1OOI X;  3DZT A;  3D77 A;  1OOH A;  2GTE A;  2PQL A;  4OZD A;  3B86 A;  1OOF A;  3NHI A;  4PT1 A;  3PJI A;  4JD9 A;  2L2C A;  3L47 A;  3CAB A;  2QDI A;  3FE9 A;  2QEH A;  3NHT A;  3D75 A;  3S0B A;  1QWV A;  2JPO A;  2QEB A;  4INX A;  1TUJ A;  3BFH A;  5DIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...