2P71A

Bombyx mori pheromone binding protein bound to iodohexadecane
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
132
structure length
132
Chain Sequence
b'SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pheromone-binding protein
publication title Bombyx mori pheromone-binding protein binding nonpheromone ligands: implications for pheromone recognition.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Attractant
total genus 43
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2p71A00
4F7FA 3B86A 2P71A 3CZ0A 3K1EA 1DQEA 1XFRA 3FE9A 3D74A 3FE6A 1ORGA 3D73A 3CABA 2QEVA 3R1OA 2L2CA 3DZTA 4JD9A 3B88A 3D77A 3S0EA 3QMEA 1T14A 2JPOA 2WCLA 3BJHA 1TUJA 1GM0A 1C3ZA 3B87A 3CZ1A 1QWVA 2FJYA 3NHIA 3L4LA 3D75A 2PQLA 2WC6A 1TWOA 2ERBA 3CYZA 2WC5A 1OOFA 3PJIA 3R1PA 1OW4A 3S0GA 5DICA 3S0DA 3DY9A 3N7HA 3OGNA 3S0FA 3BFAA 2QDIA 3CZ2A 3BFBA 2WCKA 2WCHA 3R72A 2WCJA 3Q8IA 1OOGA 4INXA 1C3YA 2WCMA 3DYEA 3R1VA 1OOIX 3DXLA 3D76A 3V2LA 3S0AA 3NGVA 3L4AA 3BFHA 2GTEA 2QEBA 3RZSA 3CDNA 4FQTA 1LS8A 3FE8A 4PT1A 2P70A 3D78A 1P28A 2QEOA 1OOHA 3B7AA 2QEHA 2H8VA 5EL2A 2KPHA 3L47A 4OZDA 3NHTA 3B6XA 3VB1A 4INWA 3S0BA
chains in the Genus database with same CATH superfamily
2MAZA 3VRQA 3DVMA 2HQ8A 3GK4X 1K9UA 1DTLA 2P71A 3CR4X 2Q4UA 2WC8A 2CT9A 3CZ0A 3PLFB 1JF0A 2F3YA 1XFRA 2LLSA 2JRFA 1DJHA 1KFUS 1XFUO 2K7BA 1J1DA 1RK9A 1S5GY 2JXCA 3PSRA 4IL1A 4R1EA 4MBEA 2LM5A 1NCZA 1YVHA 3EKJA 3F45A 2BCBA 4AOMA 4PE1A 4YBHB 2LUCA 3OBVA 4WQ2A 4D1EA 1BLQA 2LUXA 3B88A 1CDNA 4GGNA 4C0JA 1WDCB 3M0WA 4N1FA 4ZCUA 1NP8A 1ZACA 1ZUZA 2CBLA 2I7AA 3QMEA 1BODA 3PM2A 4TNCA 4QJ5B 1T14A 2JPOA 1PK0D 1H4BA 1F4QA 1G4YR 1L2OB 2VRGA 1WLMA 3BXKA 4MRYA 4NDDA 4CLNA 2PASA 3BJHA 1F4OA 1X02A 2LV7A 1FI6A 2KFHA 2LVVA 1C07A 4YI9A 3E3RA 1CDMA 3B87A 1SRAA 3VROA 1WLZA 1TCFA 5AERA 2EC6B 1H8BA 3DVEA 2JNXA 1RJVA 3IF7A 2CNPA 4ICBA 3L4LA 1UHJA 2YGUA 3O4XA 1TWOA 4PALA 4PE4A 3K21A 2F3ZA 2MBXA 3KF9A 2LVJA 5HLOA 1EXRA 1RTP1 5DKRA 3PJIA 1TOPA 4FQOA 1GGWA 2M29A 3TUYC 4OR9B 4M2OA 2PALA 3PM8A 1IWQA 1N65A 2BKIB 3N7HA 5I2OA 1KK7Y 1MF8B 3FIAA 4DIRA 3I5GC 2M49B 5ER5A 2ZKMX 1C7WA 4DCKA 2CTNA 2WCHA 1DGVA 1OE9B 1CDPA 2ZRTA 2LP2A 5ER4X 2EHBA 2KLEA 2MHHA 1W9ZA 1CDLA 3MSEB 1DJWA 2L5YA 3D10A 1TRFA 4CFRA 4E68A 2WORA 2BNXA 3CTNA 1B7TY 2ZN8A 3EVRA 4INXA 4HREE 1CLLA 3BYAA 4P5OE 2Y1MA 1UHKA 1B8LA 2WCEA 3VRNA 3ICBA 3LL8B 3OX5A 1OOIX 1CLMA 4P2YB 1BJFA 1ALVA 1RECA 3DF0B 1OMVA 3ZNIA 4M2QA 2KFGA 4DRWA 2F33A 4ORAB 2ZNDA 2K7DA 5HYDA 4DS7A 2WCBA 1F55A 3AAKA 2BBNA 4HRHA 5AANA 2Y1NA 1G8IA 2KDHA 3FE8A 4WRIA 4GPLB 4PT1A 4YGBB 2KAYA 4ETOA 1CNPA 1KCYA 2NLNA 1QX2A 3NSLA 2P70A 1TNWA 2GGZA 1GGZA 1P28A 2L50A 2V53A 4YGEB 2B1UA 2JT8A 3L47A 4OZDA 1BR1B 1M31A 3EK7A 2M9GA 4INWA 1M45A 3S0BA 3VB1A 3I5HB 4F7FA 2HETA 1KWOC 1WY9A 1F54A 2LVKA 1K9KA 2BCAA 2AAOA 4ZCVA 2K2AA 1J7QA 2CCMA 4XJKA 1DQEA 2BL0B 3FS7A 1F71A 1BT6A 2KBIA 3DVJA 2JXLA 2KLDA 1A75A 3OB1B 1HT9A 4Q04A 1CTRA 4MEWA 2I18A 1BMOA 1K90D 3HX4A 3D73A 4C0LA 3WHUB 4GNKB 1M46A 2OS8C 1KQMB 2QEVA 1DEKA 2JU0A 1DVIA 1FPWA 1QS7A 3GOFA 1IJ5A 1KFXS 3TS5C 3I5IB 1TUZA 3D0YB 1TNPA 4F0ZB 4YGDB 5HKWA 2KFFA 2Q91A 2L51A 4PHMA 3O4YA 1KK8C 1XYDA 1OMDA 2AUCA 1Y6WA 4HSZA 5HKYA 1Q80A 1NWDA 3UO9A 1CFFA 1CMFA 1NCYA 3SG2A 4M2PA 1BR4B 1K95A 4OV2A 5CSJA 1EH2A 2L2EA 2PYQA 1QVIY 3BUWB 1KFXL 4JQ0D 1YX8A 1ODBA 2GGMA 2AMIA 2FOTA 1IKUA 2BE6A 1QWVA 1S1EA 2F8PA 2FJYA 1S26D 3D75A 1YVLA 2PQLA 3O78A 3RM1A 2ERBA 1UURA 2KHNA 1J7OA 2MA2A 1QLSA 1MWNA 1IQ5A 1SL8A 1E8AA 1OZSA 5FI6A 5J3XA 2WC5A 1OOFA 3SS4A 1BOCA 1JBAA 2M7NA 2D8NA 3S0GA 4PHNA 4MSPA 1KFUL 3S0DA 1R6PA 1EG3A 1WRLA 1DJIA 4C0KA 1NPQA 5DKNA 4AQJA 2K2FA 3SJSA 1NSHA 5AXIA 3SIBA 3KO0A 4JPZB 4CIDA 3S0FA 2CXJA 3I5FC 2JTZA 2KBMA 3CZTX 1OZOA 3CZ2A 2OTGC 1TIZA 4MZKA 1S6JA 1D1OA 3IQOA 1IH0A 2KAXA 4HRGA 1AHRA 4YGCB 2ZFDA 2BKHB 4N5XA 3CLNA 1AP4A 2BECA 2PSRA 1QTXA 1SR6B 1LKJA 3A8RA 5TNCA 3JTDC 2F2OA 1SSEB 1DF0A 1SL9A 1SNLA 2BCXA 1Y1XA 1SCMB 3AAJA 3HCMA 1QX7A 3DYEA 2JULA 3TDIA 1MXEA 3JVTC 3OB2B 3R1VA 1K8UA 1YUTA 1SCVA 3SG4A 3S0AA 1N2DA 3L4AA 5G08A 1IGVA 1PSRA 2R2IA 3BFHA 3TDZA 4DUQA 3BOWB 1MR8A 3NSIA 1QXPA 4FQTA 1LS8A 3RZSA 2H2KA 2I94A 1B9AA 3OHMB 1YX7A 2KYFA 1TNQA 3IVTA 2K8MB 2WCFA 5JJGA 1N0YA 1NX3A 3CR5X 4AQIA 5I2QA 2MLEC 5HL1A 1RFJA 1U5IB 1YRUB 2LHLA 1SYMA 1OOHA 1CFDA 1CFCA 3BUXB 1NX0A 2K7OA 2H8VA 5D69A 4A4BA 1W7JB 1K96A 1Y1UA 3GK1A 3B6XA 3I5IC 3PN7C 1IRJA 2K0JA 4PE0A 4YGAA 3KHEA 1UHHA 3O2PA 3K1EA 5KTYA 2ZNEA 2IS9A 2PVBA 2FJUB 1CM1A 1LXFC 3IQQA 4MRXA 1AUIB 1OQPA 3D74A 5KU1A 1TCOB 1K2HA 2WNDA 2LLTA 3FE6A 2F2PA 5DKQA 1ORGA 5BPJA 3CABA 2SASA 2Y4QA 4I5NB 2JNFA 2K60A 3R1OA 1J1EA 2L2CA 3DZTA 5K89A 3SG6A 1C7VA 1AVSA 3CGAA 3EK4A 5I8NA 3LK1A 4MZLA 2M1UA 3D77A 3SS3A 2JT3A 1F8HA 4FTGA 1RWYA 2KAVA 2LMUA 1WDCC 4GFTA 1TTXA 2HPSA 1DT7B 1JF2A 2NCPA 4ORCB 4PE7A 2OPOA 1NX2A 3FWBA 2BBMA 2WCLA 2NXQA 1B8CA 1QX5B 1TUJA 2G9BA 1L2OC 1GM0A 1C3ZA 3PATA 2K7CA 2TN4A 4KYNA 3UNWA 1UUSA 5KSZA 1UHIA 3DVKA 1UWOA 4U8DA 5AFPA 1SPYA 3EKHA 3CZ1A 1L7ZA 4ORBB 1A2XA 1YTZC 3KPXA 3NHIA 1S6IA 2LLUA 2EC6C 1JFJA 2LE9B 2JT0A 1OSAA 2JPTA 1SKTA 3CYZA 4UPGA 4PHKA 3TUYB 1TN4A 2G2BA 2SCPA 1OW4A 3LK0A 1V1GA 3DF0A 3NXAA 3I5GB 1LA3A 3DY9A 3EVUA 1SBJA 2M7LA 2KOTA 5CSIA 3BFAA 1SW8A 4GGFA 3EG5B 2H61A 3EK8A 4GAOA 4MLWA 4CFQA 2QDIA 3LLEA 2COLB 1LA0A 1DGUA 1QASA 2KI4B 2WCKA 4NDCA 1A03A 4MN0A 3R72A 3WNXB 1PVAA 1K94A 1KSOA 2PRUA 1QATA 1SK6D 1XK4A 1OOGA 2LCPA 2KI6D 3C1VA 2M8UA 4CPVA 1CKKA 1MHOA 1YUSA 3EVVA 2ISDA 2K61A 4BY4A 1AJ5A 1PALA 1J7RA 3D76A 3NGVA 1CB1A 5I94A 2GTEA 2KNEA 2QEBA 3BUNB 2JC2A 2M0RA 4YI8A 1EL4A 5CSFA 3CDNA 3RLZA 1XA5A 3ZWHA 2NZ0A 1XFYO 1XO5A 3WHTB 1W7IB 1FW4A 3OX6A 2L4IA 1FI5A 5I2LA 2Y5IA 4NDBA 5HKZA 2KGBC 1A4PA 1DJZA 1MQ1A 2A4JA 4GGFC 2JOJA 2H61C 3SG3A 1QJTA 1K9PA 3CR2A 1S3PA 2LHIA 1B1GA 1CFPA 1KSMA 3PFVA 5AEQA 4N1GA 1ALWA 2BAPA 2KQYA 1B8RA 4PCWA 1YRTB 2NCOA 1V1FA 1XK4C 1KK7Z 2KPHA 2LAPA 1KWOB 2BE4A 4GUKA 3D0YA 1BF5A 3LCPC 4I5JA 1OMRA 1IQ3A 2LP3A 4I5KA 3B86A 1KQVA 1RROA 3DD4A 2O5GA 1TNXA 3I5HC 3BUMB 1B7TZ 1FBVA 1NYAA 3TDUA 1GJYA 1VRKA 3FE9A 1DJXA 2BL0C 3NSOA 3BQ3A 2OS8B 2LC5A 1MXLC 1UP5A 2HF5A 1AJ4A 3AKAA 3TS5B 3TZ1A 3SS5A 3CWGA 2M3WA 1AK8A 1MUXA 5HLVA 4PHJA 3H4SE 4BY5A 1JUOA 4JD9A 1JSAA 1KK8B 2M97A 2P6BB 1KQMC 1SL7A 1SY9A 1XFVO 3S0EA 1M39A 2DOQA 2MRDA 4WQ3A 2KQ6A 2E6WA 1YURA 4XJKB 1LVCD 1PVBA 2I2RE 1DJYA 1QIWA 1NX1A 3FWCA 1OOJA 1YR5A 4OKHA 1A75B 2MLFC 4MZJA 4QJ3B 3SG7A 4XYNA 2EGDA 2QACA 1Y0VH 1B47A 2KI4C 1S36A 2LNKA 2L4HA 2QPTA 2WC6A 2HQWA 1DMOA 2JWWA 2GV5A 2LANA 2L0PA 1HQVA 3NSKA 2KYCA 1ZFSA 1XFWO 4NQGA 1JC2A 4OVNF 1WRZA 3SIAA 1K93D 3R1PA 1B4CA 5DICA 2WOSA 1IG5A 2L98A 4USLA 3I5FB 3VRRA 3KEVA 3O6BA 5PALA 4YRUA 1Z2CB 2FCEA 3BOWA 3OGNA 4MVFA 2M1KB 2OTGB 1DC1A 1PULA 1S6CA 1M63B 2E30A 5IBWA 2LVIA 1NUBA 4QJ4B 1LINA 3BFBA 5FI7A 3GK2A 1QLKA 2O60A 4GBAA 2JTTA 3JTDB 1PRWA 2WCJA 1F70A 2PMYA 3Q8IA 5FI2A 3AKBA 3QRXA 5D3OA 1U5IA 3JVTB 3WXAA 1BU3A 3SG5A 4L9MA 1IJ6A 1YUUA 1C3YA 3BUOB 2WCMA 1SR6C 1DELA 3A4UB 1EG4A 1QVIZ 1QV1A 1UHNA 2FCDA 1S5GZ 2KGRA 1ZMZA 1SCMC 3DXLA 5JOLA 3V2LA 1J7PA 5D7FA 5GQQC 5B8IB 2JQ6A 1IIOA 2KSPA 3CS1A 1ZOTB 1FF1A 4PDZA 4OCIA 5CPVA 2RGIA 3PALA 1GQMA 2L5XB 1BG1A 5FYXA 2ZN9A 1CLBA 1XVJA 5F6TA 1QIVA 1SMGA 5CSNA 1PSBA 1Y1AA 1QV0A 1J55A 4JWQA 1DJGA 1XFZO 2LMTA 1A29A 2MJWB 3VGOA 1WRKA 1R2UA 2ZRSA 3D78A 1NCXA 1Z4HA 4I5LB 4JKTA 3VRPA 1JWDA 1DF0B 2KI6C 2QEOA 3OP0A 1G33A 3B7AA 2QEHA 3PN7B 2JZIA 1CM4A 5EL2A 4A4CA 1EJ3A 4IJ7A 3NHTA 1NIWA 2LMVA 1JFKA 1XFXO 1CMGA
chains in the Genus database with same CATH topology
4F7FA 3B86A 2P71A 3CZ0A 3K1EA 1DQEA 1XFRA 3FE9A 3D74A 3FE6A 1ORGA 3D73A 3CABA 2QEVA 3R1OA 2L2CA 3DZTA 4JD9A 3B88A 3D77A 3S0EA 3QMEA 1T14A 2JPOA 2WCLA 3BJHA 1TUJA 1GM0A 1C3ZA 3B87A 3CZ1A 1QWVA 2FJYA 3NHIA 3L4LA 3D75A 2PQLA 2WC6A 1TWOA 2ERBA 3CYZA 2WC5A 1OOFA 3PJIA 3R1PA 1OW4A 3S0GA 5DICA 3S0DA 3DY9A 3N7HA 3OGNA 3S0FA 3BFAA 2QDIA 3CZ2A 3BFBA 2WCKA 2WCHA 3R72A 2WCJA 3Q8IA 1OOGA 4INXA 1C3YA 2WCMA 3DYEA 3R1VA 1OOIX 3DXLA 3D76A 3V2LA 3S0AA 3NGVA 3L4AA 3BFHA 2GTEA 2QEBA 3RZSA 3CDNA 4FQTA 1LS8A 3FE8A 4PT1A 2P70A 3D78A 1P28A 2QEOA 1OOHA 3B7AA 2QEHA 2H8VA 5EL2A 2KPHA 3L47A 4OZDA 3NHTA 3B6XA 3VB1A 4INWA 3S0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7F A;  3B86 A;  2P71 A;  3CZ0 A;  3K1E A;  1DQE A;  1XFR A;  3FE9 A;  3D74 A;  3FE6 A;  1ORG A;  3D73 A;  3CAB A;  2QEV A;  3R1O A;  2L2C A;  3DZT A;  4JD9 A;  3B88 A;  3D77 A;  3S0E A;  3QME A;  1T14 A;  2JPO A;  2WCL A;  3BJH A;  1TUJ A;  1GM0 A;  1C3Z A;  3B87 A;  3CZ1 A;  1QWV A;  2FJY A;  3NHI A;  3L4L A;  3D75 A;  2PQL A;  2WC6 A;  1TWO A;  2ERB A;  3CYZ A;  2WC5 A;  1OOF A;  3PJI A;  3R1P A;  1OW4 A;  3S0G A;  5DIC A;  3S0D A;  3DY9 A;  3N7H A;  3OGN A;  3S0F A;  3BFA A;  2QDI A;  3CZ2 A;  3BFB A;  2WCK A;  2WCH A;  3R72 A;  2WCJ A;  3Q8I A;  1OOG A;  4INX A;  1C3Y A;  2WCM A;  3DYE A;  3R1V A;  1OOI X;  3DXL A;  3D76 A;  3V2L A;  3S0A A;  3NGV A;  3L4A A;  3BFH A;  2GTE A;  2QEB A;  3RZS A;  3CDN A;  4FQT A;  1LS8 A;  3FE8 A;  4PT1 A;  2P70 A;  3D78 A;  1P28 A;  2QEO A;  1OOH A;  3B7A A;  2QEH A;  2H8V A;  5EL2 A;  2KPH A;  3L47 A;  4OZD A;  3NHT A;  3B6X A;  3VB1 A;  4INW A;  3S0B A; 
#chains in the Genus database with same CATH topology
 2MAZ A;  3VRQ A;  3DVM A;  2HQ8 A;  3GK4 X;  1K9U A;  1DTL A;  2P71 A;  3CR4 X;  2Q4U A;  2WC8 A;  2CT9 A;  3CZ0 A;  3PLF B;  1JF0 A;  2F3Y A;  1XFR A;  2LLS A;  2JRF A;  1DJH A;  1KFU S;  1XFU O;  2K7B A;  1J1D A;  1RK9 A;  1S5G Y;  2JXC A;  3PSR A;  4IL1 A;  4R1E A;  4MBE A;  2LM5 A;  1NCZ A;  1YVH A;  3EKJ A;  3F45 A;  2BCB A;  4AOM A;  4PE1 A;  4YBH B;  2LUC A;  3OBV A;  4WQ2 A;  4D1E A;  1BLQ A;  2LUX A;  3B88 A;  1CDN A;  4GGN A;  4C0J A;  1WDC B;  3M0W A;  4N1F A;  4ZCU A;  1NP8 A;  1ZAC A;  1ZUZ A;  2CBL A;  2I7A A;  3QME A;  1BOD A;  3PM2 A;  4TNC A;  4QJ5 B;  1T14 A;  2JPO A;  1PK0 D;  1H4B A;  1F4Q A;  1G4Y R;  1L2O B;  2VRG A;  1WLM A;  3BXK A;  4MRY A;  4NDD A;  4CLN A;  2PAS A;  3BJH A;  1F4O A;  1X02 A;  2LV7 A;  1FI6 A;  2KFH A;  2LVV A;  1C07 A;  4YI9 A;  3E3R A;  1CDM A;  3B87 A;  1SRA A;  3VRO A;  1WLZ A;  1TCF A;  5AER A;  2EC6 B;  1H8B A;  3DVE A;  2JNX A;  1RJV A;  3IF7 A;  2CNP A;  4ICB A;  3L4L A;  1UHJ A;  2YGU A;  3O4X A;  1TWO A;  4PAL A;  4PE4 A;  3K21 A;  2F3Z A;  2MBX A;  3KF9 A;  2LVJ A;  5HLO A;  1EXR A;  1RTP 1;  5DKR A;  3PJI A;  1TOP A;  4FQO A;  1GGW A;  2M29 A;  3TUY C;  4OR9 B;  4M2O A;  2PAL A;  3PM8 A;  1IWQ A;  1N65 A;  2BKI B;  3N7H A;  5I2O A;  1KK7 Y;  1MF8 B;  3FIA A;  4DIR A;  3I5G C;  2M49 B;  5ER5 A;  2ZKM X;  1C7W A;  4DCK A;  2CTN A;  2WCH A;  1DGV A;  1OE9 B;  1CDP A;  2ZRT A;  2LP2 A;  5ER4 X;  2EHB A;  2KLE A;  2MHH A;  1W9Z A;  1CDL A;  3MSE B;  1DJW A;  2L5Y A;  3D10 A;  1TRF A;  4CFR A;  4E68 A;  2WOR A;  2BNX A;  3CTN A;  1B7T Y;  2ZN8 A;  3EVR A;  4INX A;  4HRE E;  1CLL A;  3BYA A;  4P5O E;  2Y1M A;  1UHK A;  1B8L A;  2WCE A;  3VRN A;  3ICB A;  3LL8 B;  3OX5 A;  1OOI X;  1CLM A;  4P2Y B;  1BJF A;  1ALV A;  1REC A;  3DF0 B;  1OMV A;  3ZNI A;  4M2Q A;  2KFG A;  4DRW A;  2F33 A;  4ORA B;  2ZND A;  2K7D A;  5HYD A;  4DS7 A;  2WCB A;  1F55 A;  3AAK A;  2BBN A;  4HRH A;  5AAN A;  2Y1N A;  1G8I A;  2KDH A;  3FE8 A;  4WRI A;  4GPL B;  4PT1 A;  4YGB B;  2KAY A;  4ETO A;  1CNP A;  1KCY A;  2NLN A;  1QX2 A;  3NSL A;  2P70 A;  1TNW A;  2GGZ A;  1GGZ A;  1P28 A;  2L50 A;  2V53 A;  4YGE B;  2B1U A;  2JT8 A;  3L47 A;  4OZD A;  1BR1 B;  1M31 A;  3EK7 A;  2M9G A;  4INW A;  1M45 A;  3S0B A;  3VB1 A;  3I5H B;  4F7F A;  2HET A;  1KWO C;  1WY9 A;  1F54 A;  2LVK A;  1K9K A;  2BCA A;  2AAO A;  4ZCV A;  2K2A A;  1J7Q A;  2CCM A;  4XJK A;  1DQE A;  2BL0 B;  3FS7 A;  1F71 A;  1BT6 A;  2KBI A;  3DVJ A;  2JXL A;  2KLD A;  1A75 A;  3OB1 B;  1HT9 A;  4Q04 A;  1CTR A;  4MEW A;  2I18 A;  1BMO A;  1K90 D;  3HX4 A;  3D73 A;  4C0L A;  3WHU B;  4GNK B;  1M46 A;  2OS8 C;  1KQM B;  2QEV A;  1DEK A;  2JU0 A;  1DVI A;  1FPW A;  1QS7 A;  3GOF A;  1IJ5 A;  1KFX S;  3TS5 C;  3I5I B;  1TUZ A;  3D0Y B;  1TNP A;  4F0Z B;  4YGD B;  5HKW A;  2KFF A;  2Q91 A;  2L51 A;  4PHM A;  3O4Y A;  1KK8 C;  1XYD A;  1OMD A;  2AUC A;  1Y6W A;  4HSZ A;  5HKY A;  1Q80 A;  1NWD A;  3UO9 A;  1CFF A;  1CMF A;  1NCY A;  3SG2 A;  4M2P A;  1BR4 B;  1K95 A;  4OV2 A;  5CSJ A;  1EH2 A;  2L2E A;  2PYQ A;  1QVI Y;  3BUW B;  1KFX L;  4JQ0 D;  1YX8 A;  1ODB A;  2GGM A;  2AMI A;  2FOT A;  1IKU A;  2BE6 A;  1QWV A;  1S1E A;  2F8P A;  2FJY A;  1S26 D;  3D75 A;  1YVL A;  2PQL A;  3O78 A;  3RM1 A;  2ERB A;  1UUR A;  2KHN A;  1J7O A;  2MA2 A;  1QLS A;  1MWN A;  1IQ5 A;  1SL8 A;  1E8A A;  1OZS A;  5FI6 A;  5J3X A;  2WC5 A;  1OOF A;  3SS4 A;  1BOC A;  1JBA A;  2M7N A;  2D8N A;  3S0G A;  4PHN A;  4MSP A;  1KFU L;  3S0D A;  1R6P A;  1EG3 A;  1WRL A;  1DJI A;  4C0K A;  1NPQ A;  5DKN A;  4AQJ A;  2K2F A;  3SJS A;  1NSH A;  5AXI A;  3SIB A;  3KO0 A;  4JPZ B;  4CID A;  3S0F A;  2CXJ A;  3I5F C;  2JTZ A;  2KBM A;  3CZT X;  1OZO A;  3CZ2 A;  2OTG C;  1TIZ A;  4MZK A;  1S6J A;  1D1O A;  3IQO A;  1IH0 A;  2KAX A;  4HRG A;  1AHR A;  4YGC B;  2ZFD A;  2BKH B;  4N5X A;  3CLN A;  1AP4 A;  2BEC A;  2PSR A;  1QTX A;  1SR6 B;  1LKJ A;  3A8R A;  5TNC A;  3JTD C;  2F2O A;  1SSE B;  1DF0 A;  1SL9 A;  1SNL A;  2BCX A;  1Y1X A;  1SCM B;  3AAJ A;  3HCM A;  1QX7 A;  3DYE A;  2JUL A;  3TDI A;  1MXE A;  3JVT C;  3OB2 B;  3R1V A;  1K8U A;  1YUT A;  1SCV A;  3SG4 A;  3S0A A;  1N2D A;  3L4A A;  5G08 A;  1IGV A;  1PSR A;  2R2I A;  3BFH A;  3TDZ A;  4DUQ A;  3BOW B;  1MR8 A;  3NSI A;  1QXP A;  4FQT A;  1LS8 A;  3RZS A;  2H2K A;  2I94 A;  1B9A A;  3OHM B;  1YX7 A;  2KYF A;  1TNQ A;  3IVT A;  2K8M B;  2WCF A;  5JJG A;  1N0Y A;  1NX3 A;  3CR5 X;  4AQI A;  5I2Q A;  2MLE C;  5HL1 A;  1RFJ A;  1U5I B;  1YRU B;  2LHL A;  1SYM A;  1OOH A;  1CFD A;  1CFC A;  3BUX B;  1NX0 A;  2K7O A;  2H8V A;  5D69 A;  4A4B A;  1W7J B;  1K96 A;  1Y1U A;  3GK1 A;  3B6X A;  3I5I C;  3PN7 C;  1IRJ A;  2K0J A;  4PE0 A;  4YGA A;  3KHE A;  1UHH A;  3O2P A;  3K1E A;  5KTY A;  2ZNE A;  2IS9 A;  2PVB A;  2FJU B;  1CM1 A;  1LXF C;  3IQQ A;  4MRX A;  1AUI B;  1OQP A;  3D74 A;  5KU1 A;  1TCO B;  1K2H A;  2WND A;  2LLT A;  3FE6 A;  2F2P A;  5DKQ A;  1ORG A;  5BPJ A;  3CAB A;  2SAS A;  2Y4Q A;  4I5N B;  2JNF A;  2K60 A;  3R1O A;  1J1E A;  2L2C A;  3DZT A;  5K89 A;  3SG6 A;  1C7V A;  1AVS A;  3CGA A;  3EK4 A;  5I8N A;  3LK1 A;  4MZL A;  2M1U A;  3D77 A;  3SS3 A;  2JT3 A;  1F8H A;  4FTG A;  1RWY A;  2KAV A;  2LMU A;  1WDC C;  4GFT A;  1TTX A;  2HPS A;  1DT7 B;  1JF2 A;  2NCP A;  4ORC B;  4PE7 A;  2OPO A;  1NX2 A;  3FWB A;  2BBM A;  2WCL A;  2NXQ A;  1B8C A;  1QX5 B;  1TUJ A;  2G9B A;  1L2O C;  1GM0 A;  1C3Z A;  3PAT A;  2K7C A;  2TN4 A;  4KYN A;  3UNW A;  1UUS A;  5KSZ A;  1UHI A;  3DVK A;  1UWO A;  4U8D A;  5AFP A;  1SPY A;  3EKH A;  3CZ1 A;  1L7Z A;  4ORB B;  1A2X A;  1YTZ C;  3KPX A;  3NHI A;  1S6I A;  2LLU A;  2EC6 C;  1JFJ A;  2LE9 B;  2JT0 A;  1OSA A;  2JPT A;  1SKT A;  3CYZ A;  4UPG A;  4PHK A;  3TUY B;  1TN4 A;  2G2B A;  2SCP A;  1OW4 A;  3LK0 A;  1V1G A;  3DF0 A;  3NXA A;  3I5G B;  1LA3 A;  3DY9 A;  3EVU A;  1SBJ A;  2M7L A;  2KOT A;  5CSI A;  3BFA A;  1SW8 A;  4GGF A;  3EG5 B;  2H61 A;  3EK8 A;  4GAO A;  4MLW A;  4CFQ A;  2QDI A;  3LLE A;  2COL B;  1LA0 A;  1DGU A;  1QAS A;  2KI4 B;  2WCK A;  4NDC A;  1A03 A;  4MN0 A;  3R72 A;  3WNX B;  1PVA A;  1K94 A;  1KSO A;  2PRU A;  1QAT A;  1SK6 D;  1XK4 A;  1OOG A;  2LCP A;  2KI6 D;  3C1V A;  2M8U A;  4CPV A;  1CKK A;  1MHO A;  1YUS A;  3EVV A;  2ISD A;  2K61 A;  4BY4 A;  1AJ5 A;  1PAL A;  1J7R A;  3D76 A;  3NGV A;  1CB1 A;  5I94 A;  2GTE A;  2KNE A;  2QEB A;  3BUN B;  2JC2 A;  2M0R A;  4YI8 A;  1EL4 A;  5CSF A;  3CDN A;  3RLZ A;  1XA5 A;  3ZWH A;  2NZ0 A;  1XFY O;  1XO5 A;  3WHT B;  1W7I B;  1FW4 A;  3OX6 A;  2L4I A;  1FI5 A;  5I2L A;  2Y5I A;  4NDB A;  5HKZ A;  2KGB C;  1A4P A;  1DJZ A;  1MQ1 A;  2A4J A;  4GGF C;  2JOJ A;  2H61 C;  3SG3 A;  1QJT A;  1K9P A;  3CR2 A;  1S3P A;  2LHI A;  1B1G A;  1CFP A;  1KSM A;  3PFV A;  5AEQ A;  4N1G A;  1ALW A;  2BAP A;  2KQY A;  1B8R A;  4PCW A;  1YRT B;  2NCO A;  1V1F A;  1XK4 C;  1KK7 Z;  2KPH A;  2LAP A;  1KWO B;  2BE4 A;  4GUK A;  3D0Y A;  1BF5 A;  3LCP C;  4I5J A;  1OMR A;  1IQ3 A;  2LP3 A;  4I5K A;  3B86 A;  1KQV A;  1RRO A;  3DD4 A;  2O5G A;  1TNX A;  3I5H C;  3BUM B;  1B7T Z;  1FBV A;  1NYA A;  3TDU A;  1GJY A;  1VRK A;  3FE9 A;  1DJX A;  2BL0 C;  3NSO A;  3BQ3 A;  2OS8 B;  2LC5 A;  1MXL C;  1UP5 A;  2HF5 A;  1AJ4 A;  3AKA A;  3TS5 B;  3TZ1 A;  3SS5 A;  3CWG A;  2M3W A;  1AK8 A;  1MUX A;  5HLV A;  4PHJ A;  3H4S E;  4BY5 A;  1JUO A;  4JD9 A;  1JSA A;  1KK8 B;  2M97 A;  2P6B B;  1KQM C;  1SL7 A;  1SY9 A;  1XFV O;  3S0E A;  1M39 A;  2DOQ A;  2MRD A;  4WQ3 A;  2KQ6 A;  2E6W A;  1YUR A;  4XJK B;  1LVC D;  1PVB A;  2I2R E;  1DJY A;  1QIW A;  1NX1 A;  3FWC A;  1OOJ A;  1YR5 A;  4OKH A;  1A75 B;  2MLF C;  4MZJ A;  4QJ3 B;  3SG7 A;  4XYN A;  2EGD A;  2QAC A;  1Y0V H;  1B47 A;  2KI4 C;  1S36 A;  2LNK A;  2L4H A;  2QPT A;  2WC6 A;  2HQW A;  1DMO A;  2JWW A;  2GV5 A;  2LAN A;  2L0P A;  1HQV A;  3NSK A;  2KYC A;  1ZFS A;  1XFW O;  4NQG A;  1JC2 A;  4OVN F;  1WRZ A;  3SIA A;  1K93 D;  3R1P A;  1B4C A;  5DIC A;  2WOS A;  1IG5 A;  2L98 A;  4USL A;  3I5F B;  3VRR A;  3KEV A;  3O6B A;  5PAL A;  4YRU A;  1Z2C B;  2FCE A;  3BOW A;  3OGN A;  4MVF A;  2M1K B;  2OTG B;  1DC1 A;  1PUL A;  1S6C A;  1M63 B;  2E30 A;  5IBW A;  2LVI A;  1NUB A;  4QJ4 B;  1LIN A;  3BFB A;  5FI7 A;  3GK2 A;  1QLK A;  2O60 A;  4GBA A;  2JTT A;  3JTD B;  1PRW A;  2WCJ A;  1F70 A;  2PMY A;  3Q8I A;  5FI2 A;  3AKB A;  3QRX A;  5D3O A;  1U5I A;  3JVT B;  3WXA A;  1BU3 A;  3SG5 A;  4L9M A;  1IJ6 A;  1YUU A;  1C3Y A;  3BUO B;  2WCM A;  1SR6 C;  1DEL A;  3A4U B;  1EG4 A;  1QVI Z;  1QV1 A;  1UHN A;  2FCD A;  1S5G Z;  2KGR A;  1ZMZ A;  1SCM C;  3DXL A;  5JOL A;  3V2L A;  1J7P A;  5D7F A;  5GQQ C;  5B8I B;  2JQ6 A;  1IIO A;  2KSP A;  3CS1 A;  1ZOT B;  1FF1 A;  4PDZ A;  4OCI A;  5CPV A;  2RGI A;  3PAL A;  1GQM A;  2L5X B;  1BG1 A;  5FYX A;  2ZN9 A;  1CLB A;  1XVJ A;  5F6T A;  1QIV A;  1SMG A;  5CSN A;  1PSB A;  1Y1A A;  1QV0 A;  1J55 A;  4JWQ A;  1DJG A;  1XFZ O;  2LMT A;  1A29 A;  2MJW B;  3VGO A;  1WRK A;  1R2U A;  2ZRS A;  3D78 A;  1NCX A;  1Z4H A;  4I5L B;  4JKT A;  3VRP A;  1JWD A;  1DF0 B;  2KI6 C;  2QEO A;  3OP0 A;  1G33 A;  3B7A A;  2QEH A;  3PN7 B;  2JZI A;  1CM4 A;  5EL2 A;  4A4C A;  1EJ3 A;  4IJ7 A;  3NHT A;  1NIW A;  2LMV A;  1JFK A;  1XFX O;  1CMG A; 
#chains in the Genus database with same CATH homology
 4F7F A;  3B86 A;  2P71 A;  3CZ0 A;  3K1E A;  1DQE A;  1XFR A;  3FE9 A;  3D74 A;  3FE6 A;  1ORG A;  3D73 A;  3CAB A;  2QEV A;  3R1O A;  2L2C A;  3DZT A;  4JD9 A;  3B88 A;  3D77 A;  3S0E A;  3QME A;  1T14 A;  2JPO A;  2WCL A;  3BJH A;  1TUJ A;  1GM0 A;  1C3Z A;  3B87 A;  3CZ1 A;  1QWV A;  2FJY A;  3NHI A;  3L4L A;  3D75 A;  2PQL A;  2WC6 A;  1TWO A;  2ERB A;  3CYZ A;  2WC5 A;  1OOF A;  3PJI A;  3R1P A;  1OW4 A;  3S0G A;  5DIC A;  3S0D A;  3DY9 A;  3N7H A;  3OGN A;  3S0F A;  3BFA A;  2QDI A;  3CZ2 A;  3BFB A;  2WCK A;  2WCH A;  3R72 A;  2WCJ A;  3Q8I A;  1OOG A;  4INX A;  1C3Y A;  2WCM A;  3DYE A;  3R1V A;  1OOI X;  3DXL A;  3D76 A;  3V2L A;  3S0A A;  3NGV A;  3L4A A;  3BFH A;  2GTE A;  2QEB A;  3RZS A;  3CDN A;  4FQT A;  1LS8 A;  3FE8 A;  4PT1 A;  2P70 A;  3D78 A;  1P28 A;  2QEO A;  1OOH A;  3B7A A;  2QEH A;  2H8V A;  5EL2 A;  2KPH A;  3L47 A;  4OZD A;  3NHT A;  3B6X A;  3VB1 A;  4INW A;  3S0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...