2P71A

Bombyx mori pheromone binding protein bound to iodohexadecane
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
132
structure length
132
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Attractant
molecule keywords pheromone-binding protein
publication title Bombyx mori pheromone-binding protein binding nonpheromone ligands: implications for pheromone recognition.
pubmed doi rcsb
source organism Bombyx mori
total genus 43
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2p71A00
1LS8A 3OGNA 3R1VA 2GTEA 3QMEA 3D76A 3CYZA 4OZDA 3S0EA 3BFBA 3VB1A 1QWVA 4JD9A 2QEVA 2QDIA 3NHIA 3RZSA 4INXA 3L4AA 3CZ2A 1C3YA 2WCJA 5DICA 3B6XA 3DYEA 3Q8IA 3FE9A 3BFAA 2WCLA 5EL2A 3D77A 1GM0A 3R1OA 2P71A 1T14A 3D75A 1ORGA 3D74A 2L2CA 3D73A 2WCMA 3L4LA 3DY9A 3CABA 3NGVA 1OOFA 3B86A 2WC6A 3R72A 1TWOA 2JPOA 3S0AA 3B87A 3B7AA 3L47A 4FQTA 3S0BA 3N7HA 3FE8A 3CDNA 2H8VA 3D78A 3DXLA 3B88A 1OOHA 1OOIX 2WC5A 2P70A 1OW4A 3S0GA 2KPHA 1TUJA 3CZ0A 3CZ1A 2PQLA 1DQEA 4F7FA 1OOGA 2QEOA 3K1EA 3PJIA 2QEBA 3S0DA 4PT1A 3NHTA 2WCKA 3BJHA 1XFRA 2QEHA 1P28A 1C3ZA 2ERBA 3R1PA 3S0FA 3DZTA 2WCHA 3FE6A 3V2LA 3BFHA 4INWA 2FJYA
chains in the Genus database with same CATH superfamily
2BCAA 3HX4A 3PATA 1NX3A 2M1UA 2KAVA 2ZRSA 3O2PA 2COLB 3EVUA 1WRZA 4OV2A 3OB1B 5FYXA 3TUYB 1J1DA 3CWGA 1N0YA 3DD4A 1TRFA 1F71A 3CYZA 4OZDA 2LAPA 1CFDA 3S0EA 3OHMB 2HQWA 1QWVA 2PRUA 3DF0A 4GGNA 2EC6B 3SJSA 4NDCA 4CPVA 1K2HA 1QLKA 3D10A 1JFKA 1NSHA 1ODBA 1NP8A 1PVAA 2WCBA 1IGVA 1TUZA 4DUQA 1A4PA 1NCXA 1MUXA 4INXA 3TS5C 2Q4UA 3VGOA 2MRDA 2F8PA 3OX5A 3FIAA 3VRPA 1R6PA 2SASA 1DF0A 1AP4A 3AKBA 2BBNA 1KK8B 1SW8A 2FOTA 2JC2A 2PVBA 2F2PA 1KCYA 4YBHB 1A29A 1YX8A 1SYMA 5DICA 2M0RA 2CXJA 3E3RA 3Q8IA 4MVFA 1WRKA 1DJGA 1XK4A 2K0JA 2KLDA 1QX5B 5AXIA 1BODA 2WCFA 2BCBA 2BAPA 2MJWB 1DJXA 2P71A 1T14A 2KGBC 3D74A 3TUYC 1CB1A 1WLMA 1KQVA 2WCMA 3BUXB 3L4LA 1IWQA 1FBVA 3CABA 2WORA 2H2KA 2KYFA 5F6TA 1AJ4A 1QV0A 5TNCA 1DC1A 2EC6C 1L7ZA 2K61A 3R72A 5ER5A 4BY4A 1K96A 1KWOC 1DVIA 1QXPA 1OZOA 4ETOA 2JPOA 3PLFB 1NX1A 3B7AA 4XJKA 3L47A 1KFUL 1YVLA 3JVTB 4PHJA 4PHNA 3KO0A 5CSJA 3SG2A 1ZOTB 1XK4C 3CDNA 2L5XB 5D69A 3O4XA 5AEQA 1MHOA 1XA5A 1OE9B 1PSBA 1K95A 1GQMA 1G33A 1CLBA 1OOHA 1WDCB 1OOIX 3EVVA 2Y5IA 1V1FA 2MLEC 2MBXA 1DJYA 2BL0B 1XFZO 3S0GA 4CLNA 1QTXA 1TUJA 1LA3A 1XYDA 2Y4QA 3F45A 3RM1A 3AKAA 4CFRA 1UHHA 2L2EA 1CM4A 2NCPA 2KBMA 5I2OA 1DQEA 4ZCVA 1DT7B 1YX7A 3MSEB 4GBAA 1K93D 2ISDA 1YUSA 3PJIA 1CMFA 1V1GA 1QS7A 1QX2A 4YGDB 2RGIA 3OB2B 2LHLA 2M3WA 3SIAA 4ORAB 2AAOA 1NIWA 1AJ5A 1VRKA 2QPTA 2WCKA 1MQ1A 3VRNA 3ZNIA 1MXEA 1XFRA 2QEHA 3D0YB 2GGMA 2F3ZA 2R2IA 3I5GB 4GGFA 3NSOA 2OS8C 1MR8A 1F70A 3BXKA 1SSEB 3LK0A 1CFFA 1H4BA 1B8RA 2KGRA 2HF5A 4M2QA 1M45A 1IH0A 4GAOA 2ERBA 1QVIZ 3H4SE 1FPWA 5GQQC 2L4HA 3DZTA 4C0KA 1LA0A 2G9BA 1SRAA 2VRGA 3SS5A 4GFTA 3KHEA 1ZUZA 2BL0C 3D0YA 3EK7A 2KQYA 5JJGA 4GNKB 3FS7A 1LKJA 2WC8A 1OOJA 1BG1A 2I7AA 1TNWA 2KI4B 2D8NA 1HT9A 1CMGA 1SK6D 3CR2A 1DTLA 2M1KB 4ZCUA 1IJ6A 1QVIY 4JD9A 1Y1AA 1DJIA 4ORCB 1IG5A 4GGFC 3VRQA 2CNPA 1QJTA 1NCYA 2JRFA 3PALA 1WRLA 2ZFDA 1XFUO 3ICBA 1RFJA 2K2FA 4I5LB 1A03A 4GPLB 4HRHA 1S3PA 4MRXA 3FWCA 1BR4B 2TN4A 1K8UA 3CZ2A 1OMRA 2I94A 4M2OA 1C3YA 1NUBA 2BE4A 1K90D 2LVKA 1MWNA 4PDZA 2K7CA 5IBWA 1K9KA 2K7DA 3O4YA 3I5FC 3B6XA 1E8AA 3BUOB 4C0LA 3DYEA 5HL1A 2QACA 4P2YB 4Q04A 4WQ3A 5FI7A 4MEWA 2WCLA 5EL2A 1F55A 4KYNA 4ORBB 2G2BA 1JUOA 1SPYA 2JULA 3I5IC 1L2OB 1ZFSA 3KF9A 2L2CA 4AQIA 4GUKA 1SCMC 1CDNA 5KTYA 1BU3A 2KI4C 2OTGC 2EGDA 1TNXA 2BKHB 1UUSA 2KLEA 1QIVA 2Q91A 3LCPC 2B1UA 3NSIA 3CR5X 3OP0A 1CNPA 3OBVA 1GJYA 3B86A 2E30A 1EXRA 1YUUA 1DGVA 2FJUB 2WC6A 5FI2A 2M7LA 1SR6B 2JT0A 2KAXA 3PN7B 1QIWA 1D1OA 2IS9A 1XVJA 2M97A 2MA2A 3B87A 2GV5A 1RJVA 1NWDA 1UHJA 2CBLA 2JWWA 4PE4A 2LMTA 2KSPA 1DJWA 2AUCA 2Y1MA 3AAKA 5HKZA 1BJFA 1C07A 4MN0A 4FQOA 2OPOA 2M7NA 3BYAA 3B88A 1F4OA 4JKTA 3CZTX 1LVCD 1SL9A 3CGAA 2WC5A 2O60A 2H61A 1K9PA 1SL8A 1Y1XA 2BE6A 1TNQA 4I5NB 2L0PA 3BOWB 2K60A 2KPHA 4MZJA 1J7QA 1G4YR 1QV1A 1ZMZA 2O5GA 5CSIA 4PE0A 4QJ3B 2PQLA 3AAJA 5I2LA 2PSRA 2HPSA 2KFHA 3KEVA 1S36A 2WCEA 4DS7A 1OOGA 3FWBA 3BOWA 1CFPA 1WY9A 1UHIA 2M49B 1YRUB 3GK4X 2BECA 3K1EA 1SL7A 4AQJA 1SY9A 3S0DA 2LVJA 1SR6C 4R1EA 3PN7C 4JWQA 2JZIA 4QJ4B 4YI9A 2ZKMX 1PRWA 5HYDA 1EG4A 2H61C 3BJHA 1DGUA 1KK8C 2Y1NA 3WHTB 4AOMA 1TCFA 1OQPA 3A8RA 1BR1B 1U5IB 1JF0A 1YURA 4YI8A 4PHMA 1CDPA 1CFCA 5HLOA 1A2XA 2KFGA 1JSAA 3CLNA 4YGBB 1IJ5A 1UHKA 1AK8A 2LLSA 3I5HB 2FJYA 1EG3A 2JNFA 4F0ZB 4QJ5B 2P6BB 2CCMA 1N2DA 2FCDA 2JQ6A 3M0WA 1BLQA 1PVBA 2V53A 3R1VA 2GTEA 3QMEA 4YGCB 3TDUA 1M46A 3D76A 3PM2A 1SMGA 3IQOA 5G08A 3BFBA 1IIOA 2AMIA 3DVKA 3SG4A 3IVTA 1KQMB 1ZACA 3BUMB 2QDIA 1AVSA 1JBAA 3JVTC 2LANA 3JTDB 2F3YA 1QX7A 1UP5A 3RZSA 4A4CA 1NX0A 1WDCC 2KAYA 3L4AA 1F4QA 1BOCA 5DKRA 1Y0VH 1UURA 1JF2A 1BT6A 4JQ0D 4U8DA 4ICBA 1KFXL 4YGAA 2HETA 4N1GA 2JT8A 2ZN9A 1FW4A 3C1VA 4NDBA 1DJZA 5I94A 1XFXO 3I5HC 2F33A 4HSZA 1IQ3A 1Z4HA 3EK8A 5DKQA 4OVNF 4PHKA 4C0JA 1KSOA 3R1OA 1W7JB 1W7IB 3D75A 1K94A 1ORGA 4MLWA 5HKWA 1X02A 1TTXA 1GGZA 4DRWA 3NGVA 2JTZA 2WOSA 1OOFA 2PYQA 2LP3A 1QLSA 4OKHA 1B9AA 1KQMC 2WNDA 1B4CA 1M31A 5KSZA 1YRTB 4CIDA 1LXFC 3O6BA 5B8IB 1IQ5A 3I5GC 1TOPA 2LV7A 4OCIA 2BNXA 1RTP1 2LUCA 4PE1A 3WXAA 1OMVA 2ZRTA 3SG7A 1EH2A 3ZWHA 1S26D 2ZN8A 4JPZB 1DEKA 4IJ7A 1EL4A 1B1GA 1FI6A 1Q80A 1J7OA 1OMDA 1KFXS 1HQVA 2JT3A 3DVJA 5AANA 1A75B 5AERA 1JFJA 2LM5A 1SBJA 3DVEA 2LP2A 4MSPA 4USLA 5I2QA 4M2PA 2BBMA 3PFVA 1NCZA 2KFFA 1CM1A 3PM8A 1KK7Z 2LC5A 1S1EA 2K7OA 1C7WA 2ZNEA 5CPVA 5D3OA 1RECA 2LLTA 2PASA 4FTGA 3WHUB 2I18A 1A75A 3DF0B 1G8IA 2LNKA 4D1EA 4F7FA 2YGUA 3VRRA 3BQ3A 2JPTA 1S6IA 2QEOA 4MZLA 1W9ZA 1LINA 5J3XA 5BPJA 1YUTA 1XFYO 1J7PA 2JTTA 5HLVA 1F8HA 1PULA 2ZNDA 2JXLA 4PT1A 2PALA 5KU1A 1M39A 3RLZA 1KK7Y 2I2RE 1DF0B 2MAZA 1KWOB 1AUIB 3QRXA 5HKYA 2KI6C 2LMUA 1NX2A 1P28A 2F2OA 1C3ZA 2K8MB 3S0FA 5DKNA 2WCHA 1OZSA 2KDHA 3GOFA 3SS3A 2LLUA 3V2LA 4INWA 1L2OC 2LMVA 2KNEA 1ALWA 2MHHA 1DJHA 1MF8B 1LS8A 3LK1A 1YR5A 4PCWA 3OGNA 3SS4A 2LHIA 2CTNA 4DIRA 3EK4A 4YGEB 3VROA 2KYCA 2JU0A 3VB1A 1CLLA 2QEVA 1PALA 1R2UA 2M8UA 3GK2A 2M29A 3EKHA 3NHIA 1B47A 1XO5A 4OR9B 4XJKB 1GGWA 2L51A 1B8LA 2KQ6A 1XFWO 4WQ2A 2NCOA 2NZ0A 2KBIA 1IKUA 1DMOA 4HRGA 3LL8B 1YTZC 1N65A 4TNCA 1UHNA 2LCPA 3UO9A 3NXAA 2LVIA 5I8NA 1QATA 1FF1A 3HCMA 4E68A 1UWOA 2GGZA 3WNXB 1U5IA 4P5OE 1KSMA 3GK1A 2KI6D 2M9GA 3KPXA 2L4IA 4NQGA 1TIZA 1J1EA 2WCJA 4A4BA 4UPGA 2NLNA 2OS8B 3PSRA 1BF5A 1K9UA 1SKTA 3SG3A 1IRJA 3BFAA 3FE9A 2A4JA 1S5GZ 3CR4X 3D77A 1CKKA 5FI6A 1GM0A 1Z2CB 2CT9A 1SNLA 3A4UB 3D73A 1CLMA 4PE7A 2L98A 3DY9A 5PALA 2L50A 2JXCA 4DCKA 5D7FA 4I5JA 4MZKA 4HREE 2KOTA 2BKIB 1TWOA 3EG5B 1S5GY 4NDDA 1B7TZ 5CSNA 3S0AA 4I5KA 2EHBA 4FQTA 5JOLA 3N7HA 3S0BA 1JWDA 3FE8A 1TN4A 4WRIA 1M63B 1NPQA 1EJ3A 1QASA 3CTNA 2H8VA 1ALVA 2LVVA 1BMOA 1WLZA 2MLFC 4IL1A 3K21A 3D78A 1RK9A 4XYNA 2NXQA 3DXLA 3EVRA 4BY5A 2SCPA 2P70A 3SG6A 4YRUA 1TCOB 1SCVA 1YVHA 4N5XA 5ER4X 1KFUS 2BCXA 1OW4A 2K2AA 1B7TY 2KHNA 1JC2A 3LLEA 2PMYA 2LE9B 3EKJA 3I5FB 1S6JA 3TDZA 3CZ0A 3CZ1A 5AFPA 1J7RA 1TNPA 1CDLA 1Y1UA 2JOJA 1PK0D 2L5YA 3UNWA 3TDIA 3IF7A 1DELA 1MXLC 3I5IB 3IQQA 3JTDC 1F54A 1SCMB 2LUXA 2OTGB 1OSAA 4PALA 3TZ1A 1C7VA 1RWYA 3O78A 2QEBA 2DOQA 1B8CA 3SIBA 3CS1A 3NHTA 2K7BA 3NSLA 4N1FA 3TS5B 4L9MA 1AHRA 1S6CA 3SG5A 2E6WA 3BUNB 1CTRA 5CSFA 1H8BA 3DVMA 5K89A 1CDMA 2FCEA 1RROA 2HQ8A 4CFQA 3NSKA 1NYAA 1PSRA 3R1PA 1XFVO 1FI5A 3BUWB 3FE6A 3OX6A 4MRYA 1J55A 3BFHA 2JNXA 4MBEA 1Y6WA
chains in the Genus database with same CATH topology
1LS8A 3OGNA 3R1VA 2GTEA 3QMEA 3D76A 3CYZA 4OZDA 3S0EA 3BFBA 3VB1A 1QWVA 4JD9A 2QEVA 2QDIA 3NHIA 3RZSA 4INXA 3L4AA 3CZ2A 1C3YA 2WCJA 5DICA 3B6XA 3DYEA 3Q8IA 3FE9A 3BFAA 2WCLA 5EL2A 3D77A 1GM0A 3R1OA 2P71A 1T14A 3D75A 1ORGA 3D74A 2L2CA 3D73A 2WCMA 3L4LA 3DY9A 3CABA 3NGVA 1OOFA 3B86A 2WC6A 3R72A 1TWOA 2JPOA 3S0AA 3B87A 3B7AA 3L47A 4FQTA 3S0BA 3N7HA 3FE8A 3CDNA 2H8VA 3D78A 3DXLA 3B88A 1OOHA 1OOIX 2WC5A 2P70A 1OW4A 3S0GA 2KPHA 1TUJA 3CZ0A 3CZ1A 2PQLA 1DQEA 4F7FA 1OOGA 2QEOA 3K1EA 3PJIA 2QEBA 3S0DA 4PT1A 3NHTA 2WCKA 3BJHA 1XFRA 2QEHA 1P28A 1C3ZA 2ERBA 3R1PA 3S0FA 3DZTA 2WCHA 3FE6A 3V2LA 3BFHA 4INWA 2FJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LS8 A;  3OGN A;  3R1V A;  2GTE A;  3QME A;  3D76 A;  3CYZ A;  4OZD A;  3S0E A;  3BFB A;  3VB1 A;  1QWV A;  4JD9 A;  2QEV A;  2QDI A;  3NHI A;  3RZS A;  4INX A;  3L4A A;  3CZ2 A;  1C3Y A;  2WCJ A;  5DIC A;  3B6X A;  3DYE A;  3Q8I A;  3FE9 A;  3BFA A;  2WCL A;  5EL2 A;  3D77 A;  1GM0 A;  3R1O A;  2P71 A;  1T14 A;  3D75 A;  1ORG A;  3D74 A;  2L2C A;  3D73 A;  2WCM A;  3L4L A;  3DY9 A;  3CAB A;  3NGV A;  1OOF A;  3B86 A;  2WC6 A;  3R72 A;  1TWO A;  2JPO A;  3S0A A;  3B87 A;  3B7A A;  3L47 A;  4FQT A;  3S0B A;  3N7H A;  3FE8 A;  3CDN A;  2H8V A;  3D78 A;  3DXL A;  3B88 A;  1OOH A;  1OOI X;  2WC5 A;  2P70 A;  1OW4 A;  3S0G A;  2KPH A;  1TUJ A;  3CZ0 A;  3CZ1 A;  2PQL A;  1DQE A;  4F7F A;  1OOG A;  2QEO A;  3K1E A;  3PJI A;  2QEB A;  3S0D A;  4PT1 A;  3NHT A;  2WCK A;  3BJH A;  1XFR A;  2QEH A;  1P28 A;  1C3Z A;  2ERB A;  3R1P A;  3S0F A;  3DZT A;  2WCH A;  3FE6 A;  3V2L A;  3BFH A;  4INW A;  2FJY A; 
#chains in the Genus database with same CATH topology
 2BCA A;  3HX4 A;  3PAT A;  1NX3 A;  2M1U A;  2KAV A;  2ZRS A;  3O2P A;  2COL B;  3EVU A;  1WRZ A;  4OV2 A;  3OB1 B;  5FYX A;  3TUY B;  1J1D A;  3CWG A;  1N0Y A;  3DD4 A;  1TRF A;  1F71 A;  3CYZ A;  4OZD A;  2LAP A;  1CFD A;  3S0E A;  3OHM B;  2HQW A;  1QWV A;  2PRU A;  3DF0 A;  4GGN A;  2EC6 B;  3SJS A;  4NDC A;  4CPV A;  1K2H A;  1QLK A;  3D10 A;  1JFK A;  1NSH A;  1ODB A;  1NP8 A;  1PVA A;  2WCB A;  1IGV A;  1TUZ A;  4DUQ A;  1A4P A;  1NCX A;  1MUX A;  4INX A;  3TS5 C;  2Q4U A;  3VGO A;  2MRD A;  2F8P A;  3OX5 A;  3FIA A;  3VRP A;  1R6P A;  2SAS A;  1DF0 A;  1AP4 A;  3AKB A;  2BBN A;  1KK8 B;  1SW8 A;  2FOT A;  2JC2 A;  2PVB A;  2F2P A;  1KCY A;  4YBH B;  1A29 A;  1YX8 A;  1SYM A;  5DIC A;  2M0R A;  2CXJ A;  3E3R A;  3Q8I A;  4MVF A;  1WRK A;  1DJG A;  1XK4 A;  2K0J A;  2KLD A;  1QX5 B;  5AXI A;  1BOD A;  2WCF A;  2BCB A;  2BAP A;  2MJW B;  1DJX A;  2P71 A;  1T14 A;  2KGB C;  3D74 A;  3TUY C;  1CB1 A;  1WLM A;  1KQV A;  2WCM A;  3BUX B;  3L4L A;  1IWQ A;  1FBV A;  3CAB A;  2WOR A;  2H2K A;  2KYF A;  5F6T A;  1AJ4 A;  1QV0 A;  5TNC A;  1DC1 A;  2EC6 C;  1L7Z A;  2K61 A;  3R72 A;  5ER5 A;  4BY4 A;  1K96 A;  1KWO C;  1DVI A;  1QXP A;  1OZO A;  4ETO A;  2JPO A;  3PLF B;  1NX1 A;  3B7A A;  4XJK A;  3L47 A;  1KFU L;  1YVL A;  3JVT B;  4PHJ A;  4PHN A;  3KO0 A;  5CSJ A;  3SG2 A;  1ZOT B;  1XK4 C;  3CDN A;  2L5X B;  5D69 A;  3O4X A;  5AEQ A;  1MHO A;  1XA5 A;  1OE9 B;  1PSB A;  1K95 A;  1GQM A;  1G33 A;  1CLB A;  1OOH A;  1WDC B;  1OOI X;  3EVV A;  2Y5I A;  1V1F A;  2MLE C;  2MBX A;  1DJY A;  2BL0 B;  1XFZ O;  3S0G A;  4CLN A;  1QTX A;  1TUJ A;  1LA3 A;  1XYD A;  2Y4Q A;  3F45 A;  3RM1 A;  3AKA A;  4CFR A;  1UHH A;  2L2E A;  1CM4 A;  2NCP A;  2KBM A;  5I2O A;  1DQE A;  4ZCV A;  1DT7 B;  1YX7 A;  3MSE B;  4GBA A;  1K93 D;  2ISD A;  1YUS A;  3PJI A;  1CMF A;  1V1G A;  1QS7 A;  1QX2 A;  4YGD B;  2RGI A;  3OB2 B;  2LHL A;  2M3W A;  3SIA A;  4ORA B;  2AAO A;  1NIW A;  1AJ5 A;  1VRK A;  2QPT A;  2WCK A;  1MQ1 A;  3VRN A;  3ZNI A;  1MXE A;  1XFR A;  2QEH A;  3D0Y B;  2GGM A;  2F3Z A;  2R2I A;  3I5G B;  4GGF A;  3NSO A;  2OS8 C;  1MR8 A;  1F70 A;  3BXK A;  1SSE B;  3LK0 A;  1CFF A;  1H4B A;  1B8R A;  2KGR A;  2HF5 A;  4M2Q A;  1M45 A;  1IH0 A;  4GAO A;  2ERB A;  1QVI Z;  3H4S E;  1FPW A;  5GQQ C;  2L4H A;  3DZT A;  4C0K A;  1LA0 A;  2G9B A;  1SRA A;  2VRG A;  3SS5 A;  4GFT A;  3KHE A;  1ZUZ A;  2BL0 C;  3D0Y A;  3EK7 A;  2KQY A;  5JJG A;  4GNK B;  3FS7 A;  1LKJ A;  2WC8 A;  1OOJ A;  1BG1 A;  2I7A A;  1TNW A;  2KI4 B;  2D8N A;  1HT9 A;  1CMG A;  1SK6 D;  3CR2 A;  1DTL A;  2M1K B;  4ZCU A;  1IJ6 A;  1QVI Y;  4JD9 A;  1Y1A A;  1DJI A;  4ORC B;  1IG5 A;  4GGF C;  3VRQ A;  2CNP A;  1QJT A;  1NCY A;  2JRF A;  3PAL A;  1WRL A;  2ZFD A;  1XFU O;  3ICB A;  1RFJ A;  2K2F A;  4I5L B;  1A03 A;  4GPL B;  4HRH A;  1S3P A;  4MRX A;  3FWC A;  1BR4 B;  2TN4 A;  1K8U A;  3CZ2 A;  1OMR A;  2I94 A;  4M2O A;  1C3Y A;  1NUB A;  2BE4 A;  1K90 D;  2LVK A;  1MWN A;  4PDZ A;  2K7C A;  5IBW A;  1K9K A;  2K7D A;  3O4Y A;  3I5F C;  3B6X A;  1E8A A;  3BUO B;  4C0L A;  3DYE A;  5HL1 A;  2QAC A;  4P2Y B;  4Q04 A;  4WQ3 A;  5FI7 A;  4MEW A;  2WCL A;  5EL2 A;  1F55 A;  4KYN A;  4ORB B;  2G2B A;  1JUO A;  1SPY A;  2JUL A;  3I5I C;  1L2O B;  1ZFS A;  3KF9 A;  2L2C A;  4AQI A;  4GUK A;  1SCM C;  1CDN A;  5KTY A;  1BU3 A;  2KI4 C;  2OTG C;  2EGD A;  1TNX A;  2BKH B;  1UUS A;  2KLE A;  1QIV A;  2Q91 A;  3LCP C;  2B1U A;  3NSI A;  3CR5 X;  3OP0 A;  1CNP A;  3OBV A;  1GJY A;  3B86 A;  2E30 A;  1EXR A;  1YUU A;  1DGV A;  2FJU B;  2WC6 A;  5FI2 A;  2M7L A;  1SR6 B;  2JT0 A;  2KAX A;  3PN7 B;  1QIW A;  1D1O A;  2IS9 A;  1XVJ A;  2M97 A;  2MA2 A;  3B87 A;  2GV5 A;  1RJV A;  1NWD A;  1UHJ A;  2CBL A;  2JWW A;  4PE4 A;  2LMT A;  2KSP A;  1DJW A;  2AUC A;  2Y1M A;  3AAK A;  5HKZ A;  1BJF A;  1C07 A;  4MN0 A;  4FQO A;  2OPO A;  2M7N A;  3BYA A;  3B88 A;  1F4O A;  4JKT A;  3CZT X;  1LVC D;  1SL9 A;  3CGA A;  2WC5 A;  2O60 A;  2H61 A;  1K9P A;  1SL8 A;  1Y1X A;  2BE6 A;  1TNQ A;  4I5N B;  2L0P A;  3BOW B;  2K60 A;  2KPH A;  4MZJ A;  1J7Q A;  1G4Y R;  1QV1 A;  1ZMZ A;  2O5G A;  5CSI A;  4PE0 A;  4QJ3 B;  2PQL A;  3AAJ A;  5I2L A;  2PSR A;  2HPS A;  2KFH A;  3KEV A;  1S36 A;  2WCE A;  4DS7 A;  1OOG A;  3FWB A;  3BOW A;  1CFP A;  1WY9 A;  1UHI A;  2M49 B;  1YRU B;  3GK4 X;  2BEC A;  3K1E A;  1SL7 A;  4AQJ A;  1SY9 A;  3S0D A;  2LVJ A;  1SR6 C;  4R1E A;  3PN7 C;  4JWQ A;  2JZI A;  4QJ4 B;  4YI9 A;  2ZKM X;  1PRW A;  5HYD A;  1EG4 A;  2H61 C;  3BJH A;  1DGU A;  1KK8 C;  2Y1N A;  3WHT B;  4AOM A;  1TCF A;  1OQP A;  3A8R A;  1BR1 B;  1U5I B;  1JF0 A;  1YUR A;  4YI8 A;  4PHM A;  1CDP A;  1CFC A;  5HLO A;  1A2X A;  2KFG A;  1JSA A;  3CLN A;  4YGB B;  1IJ5 A;  1UHK A;  1AK8 A;  2LLS A;  3I5H B;  2FJY A;  1EG3 A;  2JNF A;  4F0Z B;  4QJ5 B;  2P6B B;  2CCM A;  1N2D A;  2FCD A;  2JQ6 A;  3M0W A;  1BLQ A;  1PVB A;  2V53 A;  3R1V A;  2GTE A;  3QME A;  4YGC B;  3TDU A;  1M46 A;  3D76 A;  3PM2 A;  1SMG A;  3IQO A;  5G08 A;  3BFB A;  1IIO A;  2AMI A;  3DVK A;  3SG4 A;  3IVT A;  1KQM B;  1ZAC A;  3BUM B;  2QDI A;  1AVS A;  1JBA A;  3JVT C;  2LAN A;  3JTD B;  2F3Y A;  1QX7 A;  1UP5 A;  3RZS A;  4A4C A;  1NX0 A;  1WDC C;  2KAY A;  3L4A A;  1F4Q A;  1BOC A;  5DKR A;  1Y0V H;  1UUR A;  1JF2 A;  1BT6 A;  4JQ0 D;  4U8D A;  4ICB A;  1KFX L;  4YGA A;  2HET A;  4N1G A;  2JT8 A;  2ZN9 A;  1FW4 A;  3C1V A;  4NDB A;  1DJZ A;  5I94 A;  1XFX O;  3I5H C;  2F33 A;  4HSZ A;  1IQ3 A;  1Z4H A;  3EK8 A;  5DKQ A;  4OVN F;  4PHK A;  4C0J A;  1KSO A;  3R1O A;  1W7J B;  1W7I B;  3D75 A;  1K94 A;  1ORG A;  4MLW A;  5HKW A;  1X02 A;  1TTX A;  1GGZ A;  4DRW A;  3NGV A;  2JTZ A;  2WOS A;  1OOF A;  2PYQ A;  2LP3 A;  1QLS A;  4OKH A;  1B9A A;  1KQM C;  2WND A;  1B4C A;  1M31 A;  5KSZ A;  1YRT B;  4CID A;  1LXF C;  3O6B A;  5B8I B;  1IQ5 A;  3I5G C;  1TOP A;  2LV7 A;  4OCI A;  2BNX A;  1RTP 1;  2LUC A;  4PE1 A;  3WXA A;  1OMV A;  2ZRT A;  3SG7 A;  1EH2 A;  3ZWH A;  1S26 D;  2ZN8 A;  4JPZ B;  1DEK A;  4IJ7 A;  1EL4 A;  1B1G A;  1FI6 A;  1Q80 A;  1J7O A;  1OMD A;  1KFX S;  1HQV A;  2JT3 A;  3DVJ A;  5AAN A;  1A75 B;  5AER A;  1JFJ A;  2LM5 A;  1SBJ A;  3DVE A;  2LP2 A;  4MSP A;  4USL A;  5I2Q A;  4M2P A;  2BBM A;  3PFV A;  1NCZ A;  2KFF A;  1CM1 A;  3PM8 A;  1KK7 Z;  2LC5 A;  1S1E A;  2K7O A;  1C7W A;  2ZNE A;  5CPV A;  5D3O A;  1REC A;  2LLT A;  2PAS A;  4FTG A;  3WHU B;  2I18 A;  1A75 A;  3DF0 B;  1G8I A;  2LNK A;  4D1E A;  4F7F A;  2YGU A;  3VRR A;  3BQ3 A;  2JPT A;  1S6I A;  2QEO A;  4MZL A;  1W9Z A;  1LIN A;  5J3X A;  5BPJ A;  1YUT A;  1XFY O;  1J7P A;  2JTT A;  5HLV A;  1F8H A;  1PUL A;  2ZND A;  2JXL A;  4PT1 A;  2PAL A;  5KU1 A;  1M39 A;  3RLZ A;  1KK7 Y;  2I2R E;  1DF0 B;  2MAZ A;  1KWO B;  1AUI B;  3QRX A;  5HKY A;  2KI6 C;  2LMU A;  1NX2 A;  1P28 A;  2F2O A;  1C3Z A;  2K8M B;  3S0F A;  5DKN A;  2WCH A;  1OZS A;  2KDH A;  3GOF A;  3SS3 A;  2LLU A;  3V2L A;  4INW A;  1L2O C;  2LMV A;  2KNE A;  1ALW A;  2MHH A;  1DJH A;  1MF8 B;  1LS8 A;  3LK1 A;  1YR5 A;  4PCW A;  3OGN A;  3SS4 A;  2LHI A;  2CTN A;  4DIR A;  3EK4 A;  4YGE B;  3VRO A;  2KYC A;  2JU0 A;  3VB1 A;  1CLL A;  2QEV A;  1PAL A;  1R2U A;  2M8U A;  3GK2 A;  2M29 A;  3EKH A;  3NHI A;  1B47 A;  1XO5 A;  4OR9 B;  4XJK B;  1GGW A;  2L51 A;  1B8L A;  2KQ6 A;  1XFW O;  4WQ2 A;  2NCO A;  2NZ0 A;  2KBI A;  1IKU A;  1DMO A;  4HRG A;  3LL8 B;  1YTZ C;  1N65 A;  4TNC A;  1UHN A;  2LCP A;  3UO9 A;  3NXA A;  2LVI A;  5I8N A;  1QAT A;  1FF1 A;  3HCM A;  4E68 A;  1UWO A;  2GGZ A;  3WNX B;  1U5I A;  4P5O E;  1KSM A;  3GK1 A;  2KI6 D;  2M9G A;  3KPX A;  2L4I A;  4NQG A;  1TIZ A;  1J1E A;  2WCJ A;  4A4B A;  4UPG A;  2NLN A;  2OS8 B;  3PSR A;  1BF5 A;  1K9U A;  1SKT A;  3SG3 A;  1IRJ A;  3BFA A;  3FE9 A;  2A4J A;  1S5G Z;  3CR4 X;  3D77 A;  1CKK A;  5FI6 A;  1GM0 A;  1Z2C B;  2CT9 A;  1SNL A;  3A4U B;  3D73 A;  1CLM A;  4PE7 A;  2L98 A;  3DY9 A;  5PAL A;  2L50 A;  2JXC A;  4DCK A;  5D7F A;  4I5J A;  4MZK A;  4HRE E;  2KOT A;  2BKI B;  1TWO A;  3EG5 B;  1S5G Y;  4NDD A;  1B7T Z;  5CSN A;  3S0A A;  4I5K A;  2EHB A;  4FQT A;  5JOL A;  3N7H A;  3S0B A;  1JWD A;  3FE8 A;  1TN4 A;  4WRI A;  1M63 B;  1NPQ A;  1EJ3 A;  1QAS A;  3CTN A;  2H8V A;  1ALV A;  2LVV A;  1BMO A;  1WLZ A;  2MLF C;  4IL1 A;  3K21 A;  3D78 A;  1RK9 A;  4XYN A;  2NXQ A;  3DXL A;  3EVR A;  4BY5 A;  2SCP A;  2P70 A;  3SG6 A;  4YRU A;  1TCO B;  1SCV A;  1YVH A;  4N5X A;  5ER4 X;  1KFU S;  2BCX A;  1OW4 A;  2K2A A;  1B7T Y;  2KHN A;  1JC2 A;  3LLE A;  2PMY A;  2LE9 B;  3EKJ A;  3I5F B;  1S6J A;  3TDZ A;  3CZ0 A;  3CZ1 A;  5AFP A;  1J7R A;  1TNP A;  1CDL A;  1Y1U A;  2JOJ A;  1PK0 D;  2L5Y A;  3UNW A;  3TDI A;  3IF7 A;  1DEL A;  1MXL C;  3I5I B;  3IQQ A;  3JTD C;  1F54 A;  1SCM B;  2LUX A;  2OTG B;  1OSA A;  4PAL A;  3TZ1 A;  1C7V A;  1RWY A;  3O78 A;  2QEB A;  2DOQ A;  1B8C A;  3SIB A;  3CS1 A;  3NHT A;  2K7B A;  3NSL A;  4N1F A;  3TS5 B;  4L9M A;  1AHR A;  1S6C A;  3SG5 A;  2E6W A;  3BUN B;  1CTR A;  5CSF A;  1H8B A;  3DVM A;  5K89 A;  1CDM A;  2FCE A;  1RRO A;  2HQ8 A;  4CFQ A;  3NSK A;  1NYA A;  1PSR A;  3R1P A;  1XFV O;  1FI5 A;  3BUW B;  3FE6 A;  3OX6 A;  4MRY A;  1J55 A;  3BFH A;  2JNX A;  4MBE A;  1Y6W A; 
#chains in the Genus database with same CATH homology
 1LS8 A;  3OGN A;  3R1V A;  2GTE A;  3QME A;  3D76 A;  3CYZ A;  4OZD A;  3S0E A;  3BFB A;  3VB1 A;  1QWV A;  4JD9 A;  2QEV A;  2QDI A;  3NHI A;  3RZS A;  4INX A;  3L4A A;  3CZ2 A;  1C3Y A;  2WCJ A;  5DIC A;  3B6X A;  3DYE A;  3Q8I A;  3FE9 A;  3BFA A;  2WCL A;  5EL2 A;  3D77 A;  1GM0 A;  3R1O A;  2P71 A;  1T14 A;  3D75 A;  1ORG A;  3D74 A;  2L2C A;  3D73 A;  2WCM A;  3L4L A;  3DY9 A;  3CAB A;  3NGV A;  1OOF A;  3B86 A;  2WC6 A;  3R72 A;  1TWO A;  2JPO A;  3S0A A;  3B87 A;  3B7A A;  3L47 A;  4FQT A;  3S0B A;  3N7H A;  3FE8 A;  3CDN A;  2H8V A;  3D78 A;  3DXL A;  3B88 A;  1OOH A;  1OOI X;  2WC5 A;  2P70 A;  1OW4 A;  3S0G A;  2KPH A;  1TUJ A;  3CZ0 A;  3CZ1 A;  2PQL A;  1DQE A;  4F7F A;  1OOG A;  2QEO A;  3K1E A;  3PJI A;  2QEB A;  3S0D A;  4PT1 A;  3NHT A;  2WCK A;  3BJH A;  1XFR A;  2QEH A;  1P28 A;  1C3Z A;  2ERB A;  3R1P A;  3S0F A;  3DZT A;  2WCH A;  3FE6 A;  3V2L A;  3BFH A;  4INW A;  2FJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...