1SCVA

Nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein, structural protein
total genus 13
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scvA00
1KQMC 3BOWA 2G9BA 1OMRA 1E8AA 2JZIA 1NX2A 3FWBA 1IQ3A 1OQPA 2R2IA 1TNWA 3PN7B 3O78A 2I2RE 3H4SE 2KNEA 1YVHA 3NXAA 1KK7Y 1NSHA 4WQ3A 5TNCA 4PHNA 4D1EA 1ZACA 2TN4A 1IQ5A 2BCBA 4JQ0D 1G8IA 3LLEA 1AK8A 1UHKA 2LE9B 4I5LB 1M45A 2NCPA 3IQOA 5F6TA 3O4YA 2B1UA 1AUIB 1NCXA 4GFTA 1H8BA 1IJ5A 2P6BB 1MWNA 2LVJA 2WCFA 4GUKA 1Q80A 3CWGA 1B1GA 1B8CA 5HKZA 1S6CA 3CR5X 1GQMA 4WQ2A 2I7AA 1CLMA 1SCMC 2LHIA 3EVUA 4YI9A 1NX1A 3FS7A 2O5GA 2PSRA 4M2OA 3AAJA 1H4BA 4C0JA 4C0KA 3JVTC 1D1OA 1BODA 2F8PA 1K9UA 4QJ4B 1GGWA 1S3PA 1S5GZ 1G33A 5HLVA 2F2PA 1CLLA 1MR8A 1OZOA 2K7BA 3SJSA 4CIDA 1IGVA 1KK8C 4E68A 1DJGA 2LVIA 1A4PA 3ZWHA 2KBIA 2QACA 2QPTA 2ZNEA 3LCPC 4PE1A 2ZN9A 1NYAA 2NLNA 1SRAA 3RLZA 2M7NA 1M31A 2AMIA 3I5GC 1A29A 5CSFA 1IH0A 1N0YA 4HREE 1F4OA 3CLNA 4GPLB 4PHJA 4IL1A 1YUUA 1QV0A 1SL8A 5AEQA 1JWDA 1NWDA 1QVIZ 4N1FA 1CTRA 1XA5A 4DCKA 2I18A 2KQ6A 1XYDA 1DJHA 2K0JA 2KGBC 5ER5A 1NCYA 2L0PA 5KSZA 2LC5A 4ZCUA 2KGRA 3BUOB 1N65A 4HRHA 5D69A 1CFFA 3PATA 2ZFDA 2WNDA 3PM8A 3K21A 2LP2A 3CS1A 2ZKMX 1KK7Z 1UHJA 1B8LA 4YGBB 1A75B 1V1FA 2LUXA 2VRGA 1Y6WA 1V1GA 2E30A 1MXLC 4DIRA 1J7PA 3NSIA 1SY9A 1K8UA 1CFCA 1SW8A 3NSLA 2BE6A 4YI8A 3TUYB 1C7VA 3BQ3A 4XYNA 2EHBA 1K9PA 1J1EA 1SMGA 3VRRA 3VRQA 4CLNA 3SG2A 1WRKA 1M63B 3CZTX 3GOFA 4PHKA 2LNKA 4DRWA 1SPYA 1WLZA 3I5HB 2F33A 1KCYA 3BUMB 4MRXA 1EH2A 3CR2A 5CPVA 5G08A 2JWWA 2JTZA 1UHHA 1K95A 3O2PA 1DMOA 3NSKA 4A4CA 2MRDA 4M2QA 4OKHA 2OTGC 4P5OE 5KTYA 2LMUA 1KSOA 3CR4X 4M2PA 1WDCB 4AQIA 1K93D 1TNXA 1BMOA 2Y1MA 1IRJA 2PALA 3DVMA 2HQWA 1KWOB 1CNPA 1U5IA 4NDDA 1ZMZA 2K7DA 1EJ3A 2KAYA 1B7TY 3GK4X 1DGVA 3OX6A 2ZRSA 4P2YB 2KQYA 3JTDB 4PE7A 1G4YR 3FIAA 2LHLA 1QIVA 1KFXS 1AVSA 3TS5C 2M9GA 5CSIA 1SR6C 1RJVA 1TNPA 2KDHA 2KBMA 3PN7C 2MAZA 1N2DA 1KQMB 2K7OA 3EK8A 1CDNA 1EG3A 4OV2A 1CFPA 3OHMB 1XFUO 3M0WA 1WRLA 1YX8A 1FF1A 2JQ6A 2CBLA 2KAVA 4ICBA 2H61A 1S36A 1FPWA 1OOJA 1QIWA 1XFWO 2FJUB 2LMTA 2O60A 3OB1B 4AQJA 1M46A 2PASA 3D0YB 4BY5A 4PE0A 1YTZC 4WRIA 2GV5A 2FCEA 3BYAA 4YRUA 2PRUA 1CMFA 1YUSA 2ZN8A 2EC6B 3DD4A 1JC2A 1KFXL 4MSPA 3WXAA 1UWOA 1PK0D 4MVFA 1PSBA 2JXLA 1SCMB 2JTTA 2JT8A 4C0LA 5IBWA 1F8HA 2OS8B 2Q4UA 2BBMA 3I5IB 3CGAA 3C1VA 3TDZA 4N1GA 1LA0A 2JRFA 2HETA 1UHNA 2L2EA 1UUSA 2MLFC 2NXQA 1PVBA 3LK0A 4CPVA 3PLFB 1F54A 1DTLA 1SK6D 2KFGA 2LMVA 4GAOA 1OZSA 2KFHA 2MBXA 1MUXA 2LV7A 2EGDA 3D0YA 3LL8B 1J7QA 3LK1A 1UP5A 3DVKA 5I2LA 1KQVA 3KHEA 2ZNDA 1PSRA 4BY4A 2Y1NA 1LVCD 1OE9B 4GNKB 1F70A 3OP0A 2LLTA 2NCOA 2LUCA 1Y1UA 1TTXA 1B7TZ 1L2OB 2KAXA 4QJ5B 3SG4A 1BG1A 2JT3A 1L7ZA 1RROA 2A4JA 2M0RA 5AERA 1J55A 2SASA 3OX5A 5HKWA 5KU1A 1KSMA 1ALWA 3DF0B 1HT9A 1KFUS 1EXRA 2MHHA 1R2UA 2PVBA 2LANA 1YR5A 2KFFA 2H2KA 3SG6A 2HQ8A 3HCMA 3TDIA 1CDPA 3KEVA 1QX5B 2BKHB 1K90D 1JF2A 1FI5A 1J1DA 1MF8B 4Q04A 1IWQA 3BUXB 1JFJA 2LCPA 1NCZA 3F45A 1F4QA 1YUTA 4YGCB 1IJ6A 1XFVO 1YX7A 1IG5A 2M49B 2HF5A 3O6BA 3PSRA 4YGAA 4YGDB 5DKNA 2BCAA 4I5KA 1LXFC 1LINA 2K61A 4FQOA 4ORBB 1F71A 2GGMA 3GK2A 5JJGA 2LLSA 1PRWA 1XFXO 3ZNIA 3TUYC 1YRUB 1XK4A 1TCOB 1ZOTB 1QTXA 2F3YA 1ODBA 5HLOA 1BF5A 1DJXA 3DVJA 2HPSA 1QATA 1M39A 1NPQA 1XFYO 2KYCA 3EVVA 4UPGA 1AP4A 1CDMA 2CTNA 5DKRA 5I2QA 4A4BA 4MZJA 2JNFA 3BOWB 2IS9A 2KI6C 2WORA 2WCBA 1A2XA 1PALA 2CXJA 1B8RA 1SL9A 5CSNA 1SNLA 1DF0B 3DF0A 2MJWB 1TN4A 2BL0C 2LLUA 1RWYA 1CDLA 1DJYA 3I5FC 1A75A 2BCXA 2D8NA 4MEWA 1C07A 1QLKA 1DJWA 1K96A 1QV1A 2L5XB 2H61C 3IQQA 5HYDA 2BECA 4I5NB 4N5XA 2ISDA 3GK1A 1UHIA 1NUBA 2I94A 1KWOC 1W7IB 3TZ1A 3WHUB 4MZLA 1W7JB 3VGOA 1A03A 1CKKA 1QJTA 2KI4B 2M97A 3FWCA 4NQGA 2BKIB 5B8IB 1RECA 3D10A 3WNXB 1CLBA 2KSPA 3JTDC 2JNXA 1SBJA 4GBAA 1B9AA 2WCEA 4MLWA 1HQVA 3AKBA 1QXPA 1Y1XA 3IF7A 1SYMA 4OR9B 3MSEB 5JOLA 1BT6A 3SIAA 1TNQA 2COLB 2L98A 3TS5B 1SR6B 3NSOA 1DF0A 1JF0A 1BR4B 1TCFA 2K2FA 2Y5IA 3CTNA 1J7OA 1B47A 1XFZO 4HSZA 1LKJA 4MBEA 2LP3A 1QS7A 4GGFA 2JT0A 3SG3A 2GGZA 2G2BA 2JPTA 1OMVA 2AUCA 3EKJA 2E6WA 3ICBA 3SG7A 1GJYA 4L9MA 5J3XA 2KHNA 1EL4A 1QX2A 1TIZA 1J7RA 1CM1A 1NP8A 1WLMA 2M1UA 4QJ3B 5D7FA 2JXCA 2EC6C 2LAPA 1EG4A 4ORAB 2K8MB 1AHRA 2BBNA 4XJKB 1R6PA 2FCDA 2ZRTA 1K2HA 3JVTB 1AJ4A 1S26D 1NX0A 3KPXA 4USLA 3QRXA 3EK7A 4NDCA 2OS8C 1K94A 3EVRA 3I5IC 3KO0A 3WHTB 4CFRA 2M8UA 2BE4A 2F2OA 1DGUA 1ZFSA 3AKAA 4MRYA 3VRNA 1XO5A 5ER4X 2MA2A 1KK8B 4F0ZB 2L4HA 4I5JA 1BLQA 4ORCB 3EKHA 1JUOA 4TNCA 4PALA 3VRPA 2LVVA 2DOQA 5DKQA 3HX4A 2M1KB 1FBVA 3BUNB 1JFKA 5BPJA 3E3RA 4PDZA 1XK4C 2PMYA 1PVAA 1BJFA 2LM5A 3I5GB 4OCIA 3AAKA 4CFQA 2F3ZA 4DS7A 4YBHB 3RM1A 3VROA 1IKUA 1SKTA 1DJZA 1MHOA 2K7CA 4XJKA 2JU0A 1GGZA 1L2OC 5CSJA 3BUWB 2RGIA 5GQQC 1CFDA 3SG5A 2Y4QA 1SL7A 2KYFA 4PHMA 4GGNA 2JULA 1X02A 1OMDA 5PALA 1QASA 1CB1A 2MLEC 2FOTA 1F55A 1XVJA 1VRKA 1BU3A 4ETOA 1UURA 4R1EA 1NX3A 4PE4A 2Q91A 1TOPA 1BR1B 4MZKA 1DVIA 3TDUA 2AAOA 4YGEB 1QLSA 2JOJA 2LVKA 3EK4A 1CMGA 1FW4A 5I8NA 5AXIA 1LA3A 3A4UB 5FYXA 2K2AA 4JPZB 5AFPA 1S1EA 1NIWA 2WOSA 1U5IB 3I5HC 1KFUL 3DVEA 1SCVA 1S5GY 2L51A 5HKYA 5I2OA 1CM4A 2CNPA 4AOMA 1Y0VH 1MQ1A 1YVLA 2L4IA 5AANA 2WC8A 2CCMA 1WRZA 2NZ0A 2KI6D 2M3WA 1WDCC 1WY9A 5K89A 2L50A 4NDBA 1FI6A 4MN0A 2SCPA 2OTGB 1RK9A 4PCWA 1C7WA 4FTGA 2M29A 4DUQA 3PALA 4GGFC 1S6JA 1JBAA 4JWQA 1B4CA 3A8RA 2BL0B 2JC2A 1MXEA 1RFJA 3I5FB 1JSAA 1YURA 1PULA 1ZUZA 2OPOA 3SIBA 1S6IA 4U8DA 1YRTB 2KOTA 3OB2B 3PFVA 1K9KA 1TRFA 1AJ5A 1DJIA 4OVNF 4ZCVA 2M7LA 2KI4C 1DT7B 1QVIY 3BXKA 1OSAA 1Y1AA 1BOCA 2CT9A 1ALVA 1RTP1 1QX7A 3KF9A 2V53A 4HRGA
chains in the Genus database with same CATH superfamily
1KQMC 3BOWA 2G9BA 1OMRA 1E8AA 2GTEA 2JZIA 1NX2A 3FWBA 1IQ3A 1OQPA 2R2IA 1TNWA 4INXA 3PN7B 3B86A 3O78A 2I2RE 2KLEA 3H4SE 2KNEA 1YVHA 3NXAA 1KK7Y 1NSHA 4WQ3A 5TNCA 4PHNA 4D1EA 1ZACA 2TN4A 1IQ5A 2BCBA 4JQ0D 2QEBA 1G8IA 3LLEA 1AK8A 1UHKA 1GM0A 2LE9B 4I5LB 1M45A 2NCPA 3IQOA 5F6TA 3O4YA 2B1UA 3BFHA 1AUIB 1NCXA 4GFTA 1H8BA 1IJ5A 2P6BB 1MWNA 2LVJA 2WCFA 4GUKA 1Q80A 2H8VA 3CWGA 1B1GA 1B8CA 5HKZA 1S6CA 3CR5X 1GQMA 4KYNA 3L4LA 4WQ2A 2I7AA 1CLMA 1SCMC 2ERBA 2LHIA 3EVUA 4YI9A 1DC1A 1NX1A 2YGUA 2PYQA 2O5GA 3FS7A 2PSRA 4M2OA 3AAJA 1H4BA 4C0JA 4C0KA 3JVTC 1D1OA 1BODA 1DEKA 1K9UA 2F8PA 4QJ4B 1GGWA 1S3PA 1S5GZ 1G33A 5HLVA 2F2PA 1CLLA 1MR8A 1OZOA 2K7BA 3SJSA 4CIDA 5DKNA 3S0FA 1IGVA 1KK8C 4E68A 1DJGA 2LVIA 1A4PA 3CABA 3ZWHA 2KBIA 1IIOA 2QACA 2QPTA 2ZNEA 3LCPC 4PE1A 3SS5A 2ZN9A 1NYAA 2NLNA 1SRAA 3RLZA 2M7NA 1M31A 2AMIA 3I5GC 1A29A 2K60A 3FE8A 5CSFA 1N0YA 1IH0A 4HREE 1F4OA 3CLNA 4GPLB 4PHJA 5D3OA 4IL1A 1YUUA 1QV0A 1SL8A 5AEQA 1JWDA 1NWDA 1QVIZ 4N1FA 1CTRA 1XA5A 2L2CA 4DCKA 2I18A 2KQ6A 1XYDA 3NGVA 1DJHA 2K0JA 2KGBC 5ER5A 1NCYA 2L0PA 5KSZA 2LC5A 3OBVA 4ZCUA 2KGRA 1OW4A 3BUOB 1N65A 4HRHA 5D69A 1CFFA 3PATA 2ZFDA 2WNDA 3PM8A 3K21A 2LP2A 3CS1A 2ZKMX 1KK7Z 1UHJA 1B8LA 3L47A 4YGBB 1A75B 1V1FA 2LUXA 2VRGA 1Y6WA 3D77A 1V1GA 2E30A 3PJIA 1MXLC 4DIRA 3CDNA 1J7PA 3NSIA 1SY9A 1K8UA 1CFCA 1SW8A 3NSLA 2BE6A 3OGNA 4YI8A 3TUYB 1C7VA 2QDIA 3BQ3A 4XYNA 2EHBA 1K9PA 1J1EA 1SMGA 3VRRA 3VRQA 4CLNA 3SG2A 1WRKA 1M63B 3CZTX 3GOFA 4PHKA 2LNKA 4DRWA 1SPYA 1WLZA 3I5HB 2F33A 1KCYA 3BUMB 4MRXA 1EH2A 1DQEA 3CR2A 5CPVA 2QEVA 5G08A 2JWWA 2JTZA 1UHHA 1K95A 3O2PA 3D78A 5I94A 1DMOA 3NSKA 2P70A 4A4CA 2MRDA 4M2QA 4OKHA 2OTGC 4P5OE 5KTYA 2LMUA 1KSOA 3CR4X 4M2PA 1W9ZA 1WDCB 4AQIA 1K93D 1TNXA 1BMOA 2Y1MA 1IRJA 1XFRA 2PALA 3DVMA 3DY9A 3S0GA 2HQWA 1KWOB 1CNPA 1U5IA 4NDDA 1ZMZA 2K7DA 1EJ3A 2KAYA 3DZTA 1B7TY 1TUZA 3GK4X 4PT1A 1DGVA 3OX6A 2ZRSA 4P2YB 2KQYA 3FE6A 3JTDB 4PE7A 1G4YR 1SSEB 2WCMA 3FIAA 2LHLA 1QIVA 1KFXS 1AVSA 3TS5C 2M9GA 4JD9A 5CSIA 1SR6C 1RJVA 1TNPA 2KDHA 2KBMA 3PN7C 2MAZA 1N2DA 1KQMB 2K7OA 3EK8A 1CDNA 2BAPA 1EG3A 4OV2A 1CFPA 3OHMB 1XFUO 3M0WA 1WRLA 1YX8A 1FF1A 2JQ6A 5FI2A 2CBLA 2KAVA 3BFAA 5HL1A 2QEOA 4ICBA 2H61A 1S36A 1FPWA 1OOJA 1QIWA 1XFWO 2FJUB 2LMTA 2O60A 3OB1B 4AQJA 1M46A 2PASA 3D0YB 4BY5A 4PE0A 1YTZC 2WC6A 3BJHA 2GV5A 2FCEA 4WRIA 3BYAA 4YRUA 2PRUA 1CMFA 1YUSA 2ZN8A 2EC6B 3DD4A 1JC2A 1KFXL 4MSPA 2WC5A 2WCLA 3WXAA 1UWOA 1PK0D 4MVFA 1PSBA 2JXLA 1SCMB 2JTTA 2JT8A 4C0LA 5IBWA 1TUJA 1F8HA 2JPOA 2OS8B 2Q4UA 3SS3A 2BBMA 3I5IB 3CGAA 3NHIA 1OOFA 3C1VA 3TDZA 4IJ7A 4N1GA 1LA0A 2JRFA 2HETA 1UHNA 2L2EA 1UUSA 2MLFC 1P28A 2NXQA 1PVBA 3LK0A 4CPVA 3PLFB 1F54A 3CYZA 1DTLA 1SK6D 2KFGA 2LMVA 4GAOA 1OZSA 2KFHA 2MBXA 1MUXA 2LV7A 3DYEA 4F7FA 2EGDA 3B7AA 3D0YA 3LL8B 3B6XA 1J7QA 3LK1A 1UP5A 3DVKA 5I2LA 1KQVA 3KHEA 2ZNDA 1PSRA 4BY4A 2Y1NA 1LVCD 1OE9B 4GNKB 1F70A 3CZ2A 3OP0A 2LLTA 2NCOA 2LUCA 1Y1UA 1TTXA 1B7TZ 1L2OB 2KAXA 4QJ5B 3SG4A 1BG1A 2JT3A 3Q8IA 1L7ZA 1RROA 2A4JA 2M0RA 5AERA 1J55A 2SASA 3OX5A 5HKWA 5KU1A 1KSMA 1ALWA 3SS4A 3DF0B 1HT9A 1KFUS 1EXRA 2MHHA 1R2UA 2PVBA 2LANA 1YR5A 2KFFA 2H2KA 3SG6A 2HQ8A 3HCMA 4OZDA 1CDPA 3KEVA 3TDIA 1QX5B 3V2LA 2BKHB 1K90D 1JF2A 1FI5A 1J1DA 1MF8B 4Q04A 1IWQA 3BUXB 1JFJA 2LCPA 1NCZA 3F45A 1F4QA 1YUTA 4YGCB 1IJ6A 1XFVO 1YX7A 1IG5A 2M49B 2HF5A 3O6BA 3PSRA 3R1OA 4YGDB 4YGAA 2BCAA 4I5KA 3DXLA 1LXFC 1LINA 2K61A 3D74A 4FQOA 4ORBB 1F71A 3VB1A 2GGMA 3GK2A 5JJGA 2LLSA 1PRWA 1XFXO 2FJYA 3NHTA 3ZNIA 3TUYC 1YRUB 1XK4A 1TCOB 1ZOTB 1QTXA 2F3YA 1ODBA 5HLOA 3S0EA 1DJXA 1BF5A 3DVJA 3S0DA 2HPSA 1QATA 1M39A 1NPQA 1XFYO 2KYCA 2P71A 3EVVA 4UPGA 1AP4A 3RZSA 1CDMA 2CTNA 5DKRA 5I2QA 4A4BA 4MZJA 2JNFA 3BOWB 2IS9A 2KI6C 2WORA 2WCBA 1A2XA 1PALA 2CXJA 1B8RA 1SL9A 5CSNA 1SNLA 1DF0B 3DF0A 1Z2CB 2MJWB 3IVTA 4INWA 1TN4A 2BL0C 2LLUA 1RWYA 3FE9A 1CDLA 1DJYA 3I5FC 1A75A 2BCXA 2D8NA 4MEWA 1C07A 1QLKA 1DJWA 1K96A 1QV1A 2L5XB 2H61C 3D76A 3IQQA 5HYDA 2BECA 4I5NB 4N5XA 2ISDA 3R1PA 3GK1A 2WCHA 1UHIA 1NUBA 2I94A 1KWOC 1W7IB 3TZ1A 3WHUB 4MZLA 1W7JB 3VGOA 1A03A 1CKKA 1QJTA 2KI4B 2M97A 2WCKA 3FWCA 4NQGA 1ORGA 2BKIB 5B8IB 1RECA 3D10A 3WNXB 1CLBA 2KSPA 3JTDC 2BNXA 1SBJA 2JNXA 4GBAA 1B9AA 2WCEA 3O4XA 5EL2A 4MLWA 1HQVA 3AKBA 1QXPA 1Y1XA 3IF7A 1SYMA 4OR9B 3MSEB 5JOLA 1BT6A 3SIAA 1TNQA 3S0BA 1LS8A 2COLB 2L98A 3TS5B 1SR6B 3NSOA 1DF0A 1JF0A 1BR4B 1TCFA 2K2FA 2Y5IA 3CTNA 1J7OA 1B47A 1XFZO 4HSZA 1LKJA 4MBEA 2LP3A 1QS7A 3CZ0A 4GGFA 2JT0A 3SG3A 2GGZA 2G2BA 2JPTA 1OMVA 2AUCA 3EKJA 2E6WA 3ICBA 3SG7A 1GJYA 1QWVA 3UNWA 1OOGA 1DELA 4L9MA 5FI6A 5J3XA 2KHNA 1EL4A 1QX2A 1TIZA 1J7RA 1CM1A 1NP8A 1WLMA 2L5YA 2M1UA 4QJ3B 2JXCA 5D7FA 3UO9A 1T14A 2EC6C 2LAPA 1EG4A 4ORAB 2K8MB 1AHRA 2BBNA 1OOHA 4XJKB 1R6PA 2FCDA 2ZRTA 4FQTA 1K2HA 3JVTB 1AJ4A 1S26D 3PM2A 1NX0A 3KPXA 4USLA 3QRXA 3EK7A 4NDCA 2OS8C 1K94A 3EG5B 3EVRA 3I5IC 3KO0A 3WHTB 4CFRA 2M8UA 2BE4A 2F2OA 1DGUA 1ZFSA 3AKAA 4MRYA 3VRNA 1Z4HA 1XO5A 5ER4X 2MA2A 1C3YA 1KK8B 4F0ZB 2L4HA 4I5JA 1BLQA 2PQLA 3EKHA 4ORCB 1JUOA 4TNCA 4PALA 3VRPA 2LVVA 2DOQA 1TWOA 5DKQA 3HX4A 2M1KB 1FBVA 3BUNB 1JFKA 5BPJA 3E3RA 4PDZA 1XK4C 2PMYA 1PVAA 1BJFA 2LM5A 3I5GB 4OCIA 3AAKA 4CFQA 2F3ZA 4DS7A 4YBHB 3RM1A 3K1EA 3VROA 1SKTA 1IKUA 1C3ZA 1DJZA 1MHOA 2K7CA 4XJKA 2JU0A 1GGZA 1L2OC 5CSJA 3BUWB 2RGIA 5GQQC 1CFDA 3SG5A 3B88A 2Y4QA 1SL7A 2KYFA 4PHMA 4GGNA 2JULA 1X02A 1OMDA 5PALA 1QASA 1CB1A 2MLEC 2FOTA 1F55A 5DICA 1XVJA 1VRKA 1BU3A 4ETOA 1UURA 3L4AA 4R1EA 1NX3A 4PE4A 2KLDA 1TOPA 2Q91A 3D75A 1BR1B 4MZKA 1DVIA 3TDUA 2AAOA 4YGEB 1QLSA 2JOJA 2LVKA 3EK4A 1CMGA 1FW4A 5I8NA 5AXIA 1LA3A 3A4UB 5FYXA 2K2AA 4JPZB 5AFPA 1S1EA 1NIWA 2WOSA 1U5IB 3I5HC 1KFUL 3DVEA 1SCVA 1S5GY 3D73A 4JKTA 2L51A 5HKYA 5I2OA 1CM4A 2CNPA 3CZ1A 4AOMA 3R72A 1Y0VH 1MQ1A 1YVLA 2L4IA 5AANA 2WC8A 2CCMA 1WRZA 2NZ0A 2KI6D 2M3WA 1WDCC 1WY9A 5K89A 2L50A 4NDBA 1FI6A 4MN0A 5FI7A 2SCPA 2OTGB 1RK9A 4PCWA 1C7WA 4FTGA 2M29A 3BFBA 3PALA 4DUQA 4GGFC 1S6JA 2QEHA 1JBAA 4JWQA 1B4CA 3A8RA 2WCJA 2BL0B 2JC2A 1MXEA 1RFJA 3I5FB 1JSAA 3QMEA 1YURA 1PULA 1ZUZA 2KPHA 2OPOA 3SIBA 3S0AA 1S6IA 3B87A 4U8DA 1YRTB 2KOTA 3OB2B 3PFVA 1K9KA 1TRFA 1AJ5A 1DJIA 1OOIX 4OVNF 4ZCVA 2KI4C 2M7LA 1DT7B 1QVIY 3BXKA 3R1VA 1OSAA 1Y1AA 1BOCA 2CT9A 1ALVA 1RTP1 1QX7A 3N7HA 3KF9A 2V53A 4HRGA
chains in the Genus database with same CATH topology
1KQMC 3BOWA 2G9BA 1OMRA 1E8AA 2JZIA 1NX2A 3FWBA 1IQ3A 1OQPA 2R2IA 1TNWA 3PN7B 3O78A 2I2RE 3H4SE 2KNEA 1YVHA 3NXAA 1KK7Y 1NSHA 4WQ3A 5TNCA 4PHNA 4D1EA 1ZACA 2TN4A 1IQ5A 2BCBA 4JQ0D 1G8IA 3LLEA 1AK8A 1UHKA 2LE9B 4I5LB 1M45A 2NCPA 3IQOA 5F6TA 3O4YA 2B1UA 1AUIB 1NCXA 4GFTA 1H8BA 1IJ5A 2P6BB 1MWNA 2LVJA 2WCFA 4GUKA 1Q80A 3CWGA 1B1GA 1B8CA 5HKZA 1S6CA 3CR5X 1GQMA 4WQ2A 2I7AA 1CLMA 1SCMC 2LHIA 3EVUA 4YI9A 1NX1A 3FS7A 2O5GA 2PSRA 4M2OA 3AAJA 1H4BA 4C0JA 4C0KA 3JVTC 1D1OA 1BODA 2F8PA 1K9UA 4QJ4B 1GGWA 1S3PA 1S5GZ 1G33A 5HLVA 2F2PA 1CLLA 1MR8A 1OZOA 2K7BA 3SJSA 4CIDA 1IGVA 1KK8C 4E68A 1DJGA 2LVIA 1A4PA 3ZWHA 2KBIA 2QACA 2QPTA 2ZNEA 3LCPC 4PE1A 2ZN9A 1NYAA 2NLNA 1SRAA 3RLZA 2M7NA 1M31A 2AMIA 3I5GC 1A29A 5CSFA 1IH0A 1N0YA 4HREE 1F4OA 3CLNA 4GPLB 4PHJA 4IL1A 1YUUA 1QV0A 1SL8A 5AEQA 1JWDA 1NWDA 1QVIZ 4N1FA 1CTRA 1XA5A 4DCKA 2I18A 2KQ6A 1XYDA 1DJHA 2K0JA 2KGBC 5ER5A 1NCYA 2L0PA 5KSZA 2LC5A 4ZCUA 2KGRA 3BUOB 1N65A 4HRHA 5D69A 1CFFA 3PATA 2ZFDA 2WNDA 3PM8A 3K21A 2LP2A 3CS1A 2ZKMX 1KK7Z 1UHJA 1B8LA 4YGBB 1A75B 1V1FA 2LUXA 2VRGA 1Y6WA 1V1GA 2E30A 1MXLC 4DIRA 1J7PA 3NSIA 1SY9A 1K8UA 1CFCA 1SW8A 3NSLA 2BE6A 4YI8A 3TUYB 1C7VA 3BQ3A 4XYNA 2EHBA 1K9PA 1J1EA 1SMGA 3VRRA 3VRQA 4CLNA 3SG2A 1WRKA 1M63B 3CZTX 3GOFA 4PHKA 2LNKA 4DRWA 1SPYA 1WLZA 3I5HB 2F33A 1KCYA 3BUMB 4MRXA 1EH2A 3CR2A 5CPVA 5G08A 2JWWA 2JTZA 1UHHA 1K95A 3O2PA 1DMOA 3NSKA 4A4CA 2MRDA 4M2QA 4OKHA 2OTGC 4P5OE 5KTYA 2LMUA 1KSOA 3CR4X 4M2PA 1WDCB 4AQIA 1K93D 1TNXA 1BMOA 2Y1MA 1IRJA 2PALA 3DVMA 2HQWA 1KWOB 1CNPA 1U5IA 4NDDA 1ZMZA 2K7DA 1EJ3A 2KAYA 1B7TY 3GK4X 1DGVA 3OX6A 2ZRSA 4P2YB 2KQYA 3JTDB 4PE7A 1G4YR 3FIAA 2LHLA 1QIVA 1KFXS 1AVSA 3TS5C 2M9GA 5CSIA 1SR6C 1RJVA 1TNPA 2KDHA 2KBMA 3PN7C 2MAZA 1N2DA 1KQMB 2K7OA 3EK8A 1CDNA 1EG3A 4OV2A 1CFPA 3OHMB 1XFUO 3M0WA 1WRLA 1YX8A 1FF1A 2JQ6A 2CBLA 2KAVA 4ICBA 2H61A 1S36A 1FPWA 1OOJA 1QIWA 1XFWO 2FJUB 2LMTA 2O60A 3OB1B 4AQJA 1M46A 2PASA 3D0YB 4BY5A 4PE0A 1YTZC 4WRIA 2GV5A 2FCEA 3BYAA 4YRUA 2PRUA 1CMFA 1YUSA 2ZN8A 2EC6B 3DD4A 1JC2A 1KFXL 4MSPA 3WXAA 1UWOA 1PK0D 4MVFA 1PSBA 2JXLA 1SCMB 2JTTA 2JT8A 4C0LA 5IBWA 1F8HA 2OS8B 2Q4UA 2BBMA 3I5IB 3CGAA 3C1VA 3TDZA 4N1GA 1LA0A 2JRFA 2HETA 1UHNA 2L2EA 1UUSA 2MLFC 2NXQA 1PVBA 3LK0A 4CPVA 3PLFB 1F54A 1DTLA 1SK6D 2KFGA 2LMVA 4GAOA 1OZSA 2KFHA 2MBXA 1MUXA 2LV7A 2EGDA 3D0YA 3LL8B 1J7QA 3LK1A 1UP5A 3DVKA 5I2LA 1KQVA 3KHEA 2ZNDA 1PSRA 4BY4A 2Y1NA 1LVCD 1OE9B 4GNKB 1F70A 3OP0A 2LLTA 2NCOA 2LUCA 1Y1UA 1TTXA 1B7TZ 1L2OB 2KAXA 4QJ5B 3SG4A 1BG1A 2JT3A 1L7ZA 1RROA 2A4JA 2M0RA 5AERA 1J55A 2SASA 3OX5A 5HKWA 5KU1A 1KSMA 1ALWA 3DF0B 1HT9A 1KFUS 1EXRA 2MHHA 1R2UA 2PVBA 2LANA 1YR5A 2KFFA 2H2KA 3SG6A 2HQ8A 3HCMA 3TDIA 1CDPA 3KEVA 1QX5B 2BKHB 1K90D 1JF2A 1FI5A 1J1DA 1MF8B 4Q04A 1IWQA 3BUXB 1JFJA 2LCPA 1NCZA 3F45A 1F4QA 1YUTA 4YGCB 1IJ6A 1XFVO 1YX7A 1IG5A 2M49B 2HF5A 3O6BA 3PSRA 4YGAA 4YGDB 5DKNA 2BCAA 4I5KA 1LXFC 1LINA 2K61A 4FQOA 4ORBB 1F71A 2GGMA 3GK2A 5JJGA 2LLSA 1PRWA 1XFXO 3ZNIA 3TUYC 1YRUB 1XK4A 1TCOB 1ZOTB 1QTXA 2F3YA 1ODBA 5HLOA 1BF5A 1DJXA 3DVJA 2HPSA 1QATA 1M39A 1NPQA 1XFYO 2KYCA 3EVVA 4UPGA 1AP4A 1CDMA 2CTNA 5DKRA 5I2QA 4A4BA 4MZJA 2JNFA 3BOWB 2IS9A 2KI6C 2WORA 2WCBA 1A2XA 1PALA 2CXJA 1B8RA 1SL9A 5CSNA 1SNLA 1DF0B 3DF0A 2MJWB 1TN4A 2BL0C 2LLUA 1RWYA 1CDLA 1DJYA 3I5FC 1A75A 2BCXA 2D8NA 4MEWA 1C07A 1QLKA 1DJWA 1K96A 1QV1A 2L5XB 2H61C 3IQQA 5HYDA 2BECA 4I5NB 4N5XA 2ISDA 3GK1A 1UHIA 1NUBA 2I94A 1KWOC 1W7IB 3TZ1A 3WHUB 4MZLA 1W7JB 3VGOA 1A03A 1CKKA 1QJTA 2KI4B 2M97A 3FWCA 4NQGA 2BKIB 5B8IB 1RECA 3D10A 3WNXB 1CLBA 2KSPA 3JTDC 2JNXA 1SBJA 4GBAA 1B9AA 2WCEA 4MLWA 1HQVA 3AKBA 1QXPA 1Y1XA 3IF7A 1SYMA 4OR9B 3MSEB 5JOLA 1BT6A 3SIAA 1TNQA 2COLB 2L98A 3TS5B 1SR6B 3NSOA 1DF0A 1JF0A 1BR4B 1TCFA 2K2FA 2Y5IA 3CTNA 1J7OA 1B47A 1XFZO 4HSZA 1LKJA 4MBEA 2LP3A 1QS7A 4GGFA 2JT0A 3SG3A 2GGZA 2G2BA 2JPTA 1OMVA 2AUCA 3EKJA 2E6WA 3ICBA 3SG7A 1GJYA 4L9MA 5J3XA 2KHNA 1EL4A 1QX2A 1TIZA 1J7RA 1CM1A 1NP8A 1WLMA 2M1UA 4QJ3B 5D7FA 2JXCA 2EC6C 2LAPA 1EG4A 4ORAB 2K8MB 1AHRA 2BBNA 4XJKB 1R6PA 2FCDA 2ZRTA 1K2HA 3JVTB 1AJ4A 1S26D 1NX0A 3KPXA 4USLA 3QRXA 3EK7A 4NDCA 2OS8C 1K94A 3EVRA 3I5IC 3KO0A 3WHTB 4CFRA 2M8UA 2BE4A 2F2OA 1DGUA 1ZFSA 3AKAA 4MRYA 3VRNA 1XO5A 5ER4X 2MA2A 1KK8B 4F0ZB 2L4HA 4I5JA 1BLQA 4ORCB 3EKHA 1JUOA 4TNCA 4PALA 3VRPA 2LVVA 2DOQA 5DKQA 3HX4A 2M1KB 1FBVA 3BUNB 1JFKA 5BPJA 3E3RA 4PDZA 1XK4C 2PMYA 1PVAA 1BJFA 2LM5A 3I5GB 4OCIA 3AAKA 4CFQA 2F3ZA 4DS7A 4YBHB 3RM1A 3VROA 1IKUA 1SKTA 1DJZA 1MHOA 2K7CA 4XJKA 2JU0A 1GGZA 1L2OC 5CSJA 3BUWB 2RGIA 5GQQC 1CFDA 3SG5A 2Y4QA 1SL7A 2KYFA 4PHMA 4GGNA 2JULA 1X02A 1OMDA 5PALA 1QASA 1CB1A 2MLEC 2FOTA 1F55A 1XVJA 1VRKA 1BU3A 4ETOA 1UURA 4R1EA 1NX3A 4PE4A 2Q91A 1TOPA 1BR1B 4MZKA 1DVIA 3TDUA 2AAOA 4YGEB 1QLSA 2JOJA 2LVKA 3EK4A 1CMGA 1FW4A 5I8NA 5AXIA 1LA3A 3A4UB 5FYXA 2K2AA 4JPZB 5AFPA 1S1EA 1NIWA 2WOSA 1U5IB 3I5HC 1KFUL 3DVEA 1SCVA 1S5GY 2L51A 5HKYA 5I2OA 1CM4A 2CNPA 4AOMA 1Y0VH 1MQ1A 1YVLA 2L4IA 5AANA 2WC8A 2CCMA 1WRZA 2NZ0A 2KI6D 2M3WA 1WDCC 1WY9A 5K89A 2L50A 4NDBA 1FI6A 4MN0A 2SCPA 2OTGB 1RK9A 4PCWA 1C7WA 4FTGA 2M29A 4DUQA 3PALA 4GGFC 1S6JA 1JBAA 4JWQA 1B4CA 3A8RA 2BL0B 2JC2A 1MXEA 1RFJA 3I5FB 1JSAA 1YURA 1PULA 1ZUZA 2OPOA 3SIBA 1S6IA 4U8DA 1YRTB 2KOTA 3OB2B 3PFVA 1K9KA 1TRFA 1AJ5A 1DJIA 4OVNF 4ZCVA 2M7LA 2KI4C 1DT7B 1QVIY 3BXKA 1OSAA 1Y1AA 1BOCA 2CT9A 1ALVA 1RTP1 1QX7A 3KF9A 2V53A 4HRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQM C;  3BOW A;  2G9B A;  1OMR A;  1E8A A;  2JZI A;  1NX2 A;  3FWB A;  1IQ3 A;  1OQP A;  2R2I A;  1TNW A;  3PN7 B;  3O78 A;  2I2R E;  3H4S E;  2KNE A;  1YVH A;  3NXA A;  1KK7 Y;  1NSH A;  4WQ3 A;  5TNC A;  4PHN A;  4D1E A;  1ZAC A;  2TN4 A;  1IQ5 A;  2BCB A;  4JQ0 D;  1G8I A;  3LLE A;  1AK8 A;  1UHK A;  2LE9 B;  4I5L B;  1M45 A;  2NCP A;  3IQO A;  5F6T A;  3O4Y A;  2B1U A;  1AUI B;  1NCX A;  4GFT A;  1H8B A;  1IJ5 A;  2P6B B;  1MWN A;  2LVJ A;  2WCF A;  4GUK A;  1Q80 A;  3CWG A;  1B1G A;  1B8C A;  5HKZ A;  1S6C A;  3CR5 X;  1GQM A;  4WQ2 A;  2I7A A;  1CLM A;  1SCM C;  2LHI A;  3EVU A;  4YI9 A;  1NX1 A;  3FS7 A;  2O5G A;  2PSR A;  4M2O A;  3AAJ A;  1H4B A;  4C0J A;  4C0K A;  3JVT C;  1D1O A;  1BOD A;  2F8P A;  1K9U A;  4QJ4 B;  1GGW A;  1S3P A;  1S5G Z;  1G33 A;  5HLV A;  2F2P A;  1CLL A;  1MR8 A;  1OZO A;  2K7B A;  3SJS A;  4CID A;  1IGV A;  1KK8 C;  4E68 A;  1DJG A;  2LVI A;  1A4P A;  3ZWH A;  2KBI A;  2QAC A;  2QPT A;  2ZNE A;  3LCP C;  4PE1 A;  2ZN9 A;  1NYA A;  2NLN A;  1SRA A;  3RLZ A;  2M7N A;  1M31 A;  2AMI A;  3I5G C;  1A29 A;  5CSF A;  1IH0 A;  1N0Y A;  4HRE E;  1F4O A;  3CLN A;  4GPL B;  4PHJ A;  4IL1 A;  1YUU A;  1QV0 A;  1SL8 A;  5AEQ A;  1JWD A;  1NWD A;  1QVI Z;  4N1F A;  1CTR A;  1XA5 A;  4DCK A;  2I18 A;  2KQ6 A;  1XYD A;  1DJH A;  2K0J A;  2KGB C;  5ER5 A;  1NCY A;  2L0P A;  5KSZ A;  2LC5 A;  4ZCU A;  2KGR A;  3BUO B;  1N65 A;  4HRH A;  5D69 A;  1CFF A;  3PAT A;  2ZFD A;  2WND A;  3PM8 A;  3K21 A;  2LP2 A;  3CS1 A;  2ZKM X;  1KK7 Z;  1UHJ A;  1B8L A;  4YGB B;  1A75 B;  1V1F A;  2LUX A;  2VRG A;  1Y6W A;  1V1G A;  2E30 A;  1MXL C;  4DIR A;  1J7P A;  3NSI A;  1SY9 A;  1K8U A;  1CFC A;  1SW8 A;  3NSL A;  2BE6 A;  4YI8 A;  3TUY B;  1C7V A;  3BQ3 A;  4XYN A;  2EHB A;  1K9P A;  1J1E A;  1SMG A;  3VRR A;  3VRQ A;  4CLN A;  3SG2 A;  1WRK A;  1M63 B;  3CZT X;  3GOF A;  4PHK A;  2LNK A;  4DRW A;  1SPY A;  1WLZ A;  3I5H B;  2F33 A;  1KCY A;  3BUM B;  4MRX A;  1EH2 A;  3CR2 A;  5CPV A;  5G08 A;  2JWW A;  2JTZ A;  1UHH A;  1K95 A;  3O2P A;  1DMO A;  3NSK A;  4A4C A;  2MRD A;  4M2Q A;  4OKH A;  2OTG C;  4P5O E;  5KTY A;  2LMU A;  1KSO A;  3CR4 X;  4M2P A;  1WDC B;  4AQI A;  1K93 D;  1TNX A;  1BMO A;  2Y1M A;  1IRJ A;  2PAL A;  3DVM A;  2HQW A;  1KWO B;  1CNP A;  1U5I A;  4NDD A;  1ZMZ A;  2K7D A;  1EJ3 A;  2KAY A;  1B7T Y;  3GK4 X;  1DGV A;  3OX6 A;  2ZRS A;  4P2Y B;  2KQY A;  3JTD B;  4PE7 A;  1G4Y R;  3FIA A;  2LHL A;  1QIV A;  1KFX S;  1AVS A;  3TS5 C;  2M9G A;  5CSI A;  1SR6 C;  1RJV A;  1TNP A;  2KDH A;  2KBM A;  3PN7 C;  2MAZ A;  1N2D A;  1KQM B;  2K7O A;  3EK8 A;  1CDN A;  1EG3 A;  4OV2 A;  1CFP A;  3OHM B;  1XFU O;  3M0W A;  1WRL A;  1YX8 A;  1FF1 A;  2JQ6 A;  2CBL A;  2KAV A;  4ICB A;  2H61 A;  1S36 A;  1FPW A;  1OOJ A;  1QIW A;  1XFW O;  2FJU B;  2LMT A;  2O60 A;  3OB1 B;  4AQJ A;  1M46 A;  2PAS A;  3D0Y B;  4BY5 A;  4PE0 A;  1YTZ C;  4WRI A;  2GV5 A;  2FCE A;  3BYA A;  4YRU A;  2PRU A;  1CMF A;  1YUS A;  2ZN8 A;  2EC6 B;  3DD4 A;  1JC2 A;  1KFX L;  4MSP A;  3WXA A;  1UWO A;  1PK0 D;  4MVF A;  1PSB A;  2JXL A;  1SCM B;  2JTT A;  2JT8 A;  4C0L A;  5IBW A;  1F8H A;  2OS8 B;  2Q4U A;  2BBM A;  3I5I B;  3CGA A;  3C1V A;  3TDZ A;  4N1G A;  1LA0 A;  2JRF A;  2HET A;  1UHN A;  2L2E A;  1UUS A;  2MLF C;  2NXQ A;  1PVB A;  3LK0 A;  4CPV A;  3PLF B;  1F54 A;  1DTL A;  1SK6 D;  2KFG A;  2LMV A;  4GAO A;  1OZS A;  2KFH A;  2MBX A;  1MUX A;  2LV7 A;  2EGD A;  3D0Y A;  3LL8 B;  1J7Q A;  3LK1 A;  1UP5 A;  3DVK A;  5I2L A;  1KQV A;  3KHE A;  2ZND A;  1PSR A;  4BY4 A;  2Y1N A;  1LVC D;  1OE9 B;  4GNK B;  1F70 A;  3OP0 A;  2LLT A;  2NCO A;  2LUC A;  1Y1U A;  1TTX A;  1B7T Z;  1L2O B;  2KAX A;  4QJ5 B;  3SG4 A;  1BG1 A;  2JT3 A;  1L7Z A;  1RRO A;  2A4J A;  2M0R A;  5AER A;  1J55 A;  2SAS A;  3OX5 A;  5HKW A;  5KU1 A;  1KSM A;  1ALW A;  3DF0 B;  1HT9 A;  1KFU S;  1EXR A;  2MHH A;  1R2U A;  2PVB A;  2LAN A;  1YR5 A;  2KFF A;  2H2K A;  3SG6 A;  2HQ8 A;  3HCM A;  3TDI A;  1CDP A;  3KEV A;  1QX5 B;  2BKH B;  1K90 D;  1JF2 A;  1FI5 A;  1J1D A;  1MF8 B;  4Q04 A;  1IWQ A;  3BUX B;  1JFJ A;  2LCP A;  1NCZ A;  3F45 A;  1F4Q A;  1YUT A;  4YGC B;  1IJ6 A;  1XFV O;  1YX7 A;  1IG5 A;  2M49 B;  2HF5 A;  3O6B A;  3PSR A;  4YGA A;  4YGD B;  5DKN A;  2BCA A;  4I5K A;  1LXF C;  1LIN A;  2K61 A;  4FQO A;  4ORB B;  1F71 A;  2GGM A;  3GK2 A;  5JJG A;  2LLS A;  1PRW A;  1XFX O;  3ZNI A;  3TUY C;  1YRU B;  1XK4 A;  1TCO B;  1ZOT B;  1QTX A;  2F3Y A;  1ODB A;  5HLO A;  1BF5 A;  1DJX A;  3DVJ A;  2HPS A;  1QAT A;  1M39 A;  1NPQ A;  1XFY O;  2KYC A;  3EVV A;  4UPG A;  1AP4 A;  1CDM A;  2CTN A;  5DKR A;  5I2Q A;  4A4B A;  4MZJ A;  2JNF A;  3BOW B;  2IS9 A;  2KI6 C;  2WOR A;  2WCB A;  1A2X A;  1PAL A;  2CXJ A;  1B8R A;  1SL9 A;  5CSN A;  1SNL A;  1DF0 B;  3DF0 A;  2MJW B;  1TN4 A;  2BL0 C;  2LLU A;  1RWY A;  1CDL A;  1DJY A;  3I5F C;  1A75 A;  2BCX A;  2D8N A;  4MEW A;  1C07 A;  1QLK A;  1DJW A;  1K96 A;  1QV1 A;  2L5X B;  2H61 C;  3IQQ A;  5HYD A;  2BEC A;  4I5N B;  4N5X A;  2ISD A;  3GK1 A;  1UHI A;  1NUB A;  2I94 A;  1KWO C;  1W7I B;  3TZ1 A;  3WHU B;  4MZL A;  1W7J B;  3VGO A;  1A03 A;  1CKK A;  1QJT A;  2KI4 B;  2M97 A;  3FWC A;  4NQG A;  2BKI B;  5B8I B;  1REC A;  3D10 A;  3WNX B;  1CLB A;  2KSP A;  3JTD C;  2JNX A;  1SBJ A;  4GBA A;  1B9A A;  2WCE A;  4MLW A;  1HQV A;  3AKB A;  1QXP A;  1Y1X A;  3IF7 A;  1SYM A;  4OR9 B;  3MSE B;  5JOL A;  1BT6 A;  3SIA A;  1TNQ A;  2COL B;  2L98 A;  3TS5 B;  1SR6 B;  3NSO A;  1DF0 A;  1JF0 A;  1BR4 B;  1TCF A;  2K2F A;  2Y5I A;  3CTN A;  1J7O A;  1B47 A;  1XFZ O;  4HSZ A;  1LKJ A;  4MBE A;  2LP3 A;  1QS7 A;  4GGF A;  2JT0 A;  3SG3 A;  2GGZ A;  2G2B A;  2JPT A;  1OMV A;  2AUC A;  3EKJ A;  2E6W A;  3ICB A;  3SG7 A;  1GJY A;  4L9M A;  5J3X A;  2KHN A;  1EL4 A;  1QX2 A;  1TIZ A;  1J7R A;  1CM1 A;  1NP8 A;  1WLM A;  2M1U A;  4QJ3 B;  5D7F A;  2JXC A;  2EC6 C;  2LAP A;  1EG4 A;  4ORA B;  2K8M B;  1AHR A;  2BBN A;  4XJK B;  1R6P A;  2FCD A;  2ZRT A;  1K2H A;  3JVT B;  1AJ4 A;  1S26 D;  1NX0 A;  3KPX A;  4USL A;  3QRX A;  3EK7 A;  4NDC A;  2OS8 C;  1K94 A;  3EVR A;  3I5I C;  3KO0 A;  3WHT B;  4CFR A;  2M8U A;  2BE4 A;  2F2O A;  1DGU A;  1ZFS A;  3AKA A;  4MRY A;  3VRN A;  1XO5 A;  5ER4 X;  2MA2 A;  1KK8 B;  4F0Z B;  2L4H A;  4I5J A;  1BLQ A;  4ORC B;  3EKH A;  1JUO A;  4TNC A;  4PAL A;  3VRP A;  2LVV A;  2DOQ A;  5DKQ A;  3HX4 A;  2M1K B;  1FBV A;  3BUN B;  1JFK A;  5BPJ A;  3E3R A;  4PDZ A;  1XK4 C;  2PMY A;  1PVA A;  1BJF A;  2LM5 A;  3I5G B;  4OCI A;  3AAK A;  4CFQ A;  2F3Z A;  4DS7 A;  4YBH B;  3RM1 A;  3VRO A;  1IKU A;  1SKT A;  1DJZ A;  1MHO A;  2K7C A;  4XJK A;  2JU0 A;  1GGZ A;  1L2O C;  5CSJ A;  3BUW B;  2RGI A;  5GQQ C;  1CFD A;  3SG5 A;  2Y4Q A;  1SL7 A;  2KYF A;  4PHM A;  4GGN A;  2JUL A;  1X02 A;  1OMD A;  5PAL A;  1QAS A;  1CB1 A;  2MLE C;  2FOT A;  1F55 A;  1XVJ A;  1VRK A;  1BU3 A;  4ETO A;  1UUR A;  4R1E A;  1NX3 A;  4PE4 A;  2Q91 A;  1TOP A;  1BR1 B;  4MZK A;  1DVI A;  3TDU A;  2AAO A;  4YGE B;  1QLS A;  2JOJ A;  2LVK A;  3EK4 A;  1CMG A;  1FW4 A;  5I8N A;  5AXI A;  1LA3 A;  3A4U B;  5FYX A;  2K2A A;  4JPZ B;  5AFP A;  1S1E A;  1NIW A;  2WOS A;  1U5I B;  3I5H C;  1KFU L;  3DVE A;  1SCV A;  1S5G Y;  2L51 A;  5HKY A;  5I2O A;  1CM4 A;  2CNP A;  4AOM A;  1Y0V H;  1MQ1 A;  1YVL A;  2L4I A;  5AAN A;  2WC8 A;  2CCM A;  1WRZ A;  2NZ0 A;  2KI6 D;  2M3W A;  1WDC C;  1WY9 A;  5K89 A;  2L50 A;  4NDB A;  1FI6 A;  4MN0 A;  2SCP A;  2OTG B;  1RK9 A;  4PCW A;  1C7W A;  4FTG A;  2M29 A;  4DUQ A;  3PAL A;  4GGF C;  1S6J A;  1JBA A;  4JWQ A;  1B4C A;  3A8R A;  2BL0 B;  2JC2 A;  1MXE A;  1RFJ A;  3I5F B;  1JSA A;  1YUR A;  1PUL A;  1ZUZ A;  2OPO A;  3SIB A;  1S6I A;  4U8D A;  1YRT B;  2KOT A;  3OB2 B;  3PFV A;  1K9K A;  1TRF A;  1AJ5 A;  1DJI A;  4OVN F;  4ZCV A;  2M7L A;  2KI4 C;  1DT7 B;  1QVI Y;  3BXK A;  1OSA A;  1Y1A A;  1BOC A;  2CT9 A;  1ALV A;  1RTP 1;  1QX7 A;  3KF9 A;  2V53 A;  4HRG A; 
#chains in the Genus database with same CATH topology
 1KQM C;  3BOW A;  2G9B A;  1OMR A;  1E8A A;  2GTE A;  2JZI A;  1NX2 A;  3FWB A;  1IQ3 A;  1OQP A;  2R2I A;  1TNW A;  4INX A;  3PN7 B;  3B86 A;  3O78 A;  2I2R E;  2KLE A;  3H4S E;  2KNE A;  1YVH A;  3NXA A;  1KK7 Y;  1NSH A;  4WQ3 A;  5TNC A;  4PHN A;  4D1E A;  1ZAC A;  2TN4 A;  1IQ5 A;  2BCB A;  4JQ0 D;  2QEB A;  1G8I A;  3LLE A;  1AK8 A;  1UHK A;  1GM0 A;  2LE9 B;  4I5L B;  1M45 A;  2NCP A;  3IQO A;  5F6T A;  3O4Y A;  2B1U A;  3BFH A;  1AUI B;  1NCX A;  4GFT A;  1H8B A;  1IJ5 A;  2P6B B;  1MWN A;  2LVJ A;  2WCF A;  4GUK A;  1Q80 A;  2H8V A;  3CWG A;  1B1G A;  1B8C A;  5HKZ A;  1S6C A;  3CR5 X;  1GQM A;  4KYN A;  3L4L A;  4WQ2 A;  2I7A A;  1CLM A;  1SCM C;  2ERB A;  2LHI A;  3EVU A;  4YI9 A;  1DC1 A;  1NX1 A;  2YGU A;  2PYQ A;  2O5G A;  3FS7 A;  2PSR A;  4M2O A;  3AAJ A;  1H4B A;  4C0J A;  4C0K A;  3JVT C;  1D1O A;  1BOD A;  1DEK A;  1K9U A;  2F8P A;  4QJ4 B;  1GGW A;  1S3P A;  1S5G Z;  1G33 A;  5HLV A;  2F2P A;  1CLL A;  1MR8 A;  1OZO A;  2K7B A;  3SJS A;  4CID A;  5DKN A;  3S0F A;  1IGV A;  1KK8 C;  4E68 A;  1DJG A;  2LVI A;  1A4P A;  3CAB A;  3ZWH A;  2KBI A;  1IIO A;  2QAC A;  2QPT A;  2ZNE A;  3LCP C;  4PE1 A;  3SS5 A;  2ZN9 A;  1NYA A;  2NLN A;  1SRA A;  3RLZ A;  2M7N A;  1M31 A;  2AMI A;  3I5G C;  1A29 A;  2K60 A;  3FE8 A;  5CSF A;  1N0Y A;  1IH0 A;  4HRE E;  1F4O A;  3CLN A;  4GPL B;  4PHJ A;  5D3O A;  4IL1 A;  1YUU A;  1QV0 A;  1SL8 A;  5AEQ A;  1JWD A;  1NWD A;  1QVI Z;  4N1F A;  1CTR A;  1XA5 A;  2L2C A;  4DCK A;  2I18 A;  2KQ6 A;  1XYD A;  3NGV A;  1DJH A;  2K0J A;  2KGB C;  5ER5 A;  1NCY A;  2L0P A;  5KSZ A;  2LC5 A;  3OBV A;  4ZCU A;  2KGR A;  1OW4 A;  3BUO B;  1N65 A;  4HRH A;  5D69 A;  1CFF A;  3PAT A;  2ZFD A;  2WND A;  3PM8 A;  3K21 A;  2LP2 A;  3CS1 A;  2ZKM X;  1KK7 Z;  1UHJ A;  1B8L A;  3L47 A;  4YGB B;  1A75 B;  1V1F A;  2LUX A;  2VRG A;  1Y6W A;  3D77 A;  1V1G A;  2E30 A;  3PJI A;  1MXL C;  4DIR A;  3CDN A;  1J7P A;  3NSI A;  1SY9 A;  1K8U A;  1CFC A;  1SW8 A;  3NSL A;  2BE6 A;  3OGN A;  4YI8 A;  3TUY B;  1C7V A;  2QDI A;  3BQ3 A;  4XYN A;  2EHB A;  1K9P A;  1J1E A;  1SMG A;  3VRR A;  3VRQ A;  4CLN A;  3SG2 A;  1WRK A;  1M63 B;  3CZT X;  3GOF A;  4PHK A;  2LNK A;  4DRW A;  1SPY A;  1WLZ A;  3I5H B;  2F33 A;  1KCY A;  3BUM B;  4MRX A;  1EH2 A;  1DQE A;  3CR2 A;  5CPV A;  2QEV A;  5G08 A;  2JWW A;  2JTZ A;  1UHH A;  1K95 A;  3O2P A;  3D78 A;  5I94 A;  1DMO A;  3NSK A;  2P70 A;  4A4C A;  2MRD A;  4M2Q A;  4OKH A;  2OTG C;  4P5O E;  5KTY A;  2LMU A;  1KSO A;  3CR4 X;  4M2P A;  1W9Z A;  1WDC B;  4AQI A;  1K93 D;  1TNX A;  1BMO A;  2Y1M A;  1IRJ A;  1XFR A;  2PAL A;  3DVM A;  3DY9 A;  3S0G A;  2HQW A;  1KWO B;  1CNP A;  1U5I A;  4NDD A;  1ZMZ A;  2K7D A;  1EJ3 A;  2KAY A;  3DZT A;  1B7T Y;  1TUZ A;  3GK4 X;  4PT1 A;  1DGV A;  3OX6 A;  2ZRS A;  4P2Y B;  2KQY A;  3FE6 A;  3JTD B;  4PE7 A;  1G4Y R;  1SSE B;  2WCM A;  3FIA A;  2LHL A;  1QIV A;  1KFX S;  1AVS A;  3TS5 C;  2M9G A;  4JD9 A;  5CSI A;  1SR6 C;  1RJV A;  1TNP A;  2KDH A;  2KBM A;  3PN7 C;  2MAZ A;  1N2D A;  1KQM B;  2K7O A;  3EK8 A;  1CDN A;  2BAP A;  1EG3 A;  4OV2 A;  1CFP A;  3OHM B;  1XFU O;  3M0W A;  1WRL A;  1YX8 A;  1FF1 A;  2JQ6 A;  5FI2 A;  2CBL A;  2KAV A;  3BFA A;  5HL1 A;  2QEO A;  4ICB A;  2H61 A;  1S36 A;  1FPW A;  1OOJ A;  1QIW A;  1XFW O;  2FJU B;  2LMT A;  2O60 A;  3OB1 B;  4AQJ A;  1M46 A;  2PAS A;  3D0Y B;  4BY5 A;  4PE0 A;  1YTZ C;  2WC6 A;  3BJH A;  2GV5 A;  2FCE A;  4WRI A;  3BYA A;  4YRU A;  2PRU A;  1CMF A;  1YUS A;  2ZN8 A;  2EC6 B;  3DD4 A;  1JC2 A;  1KFX L;  4MSP A;  2WC5 A;  2WCL A;  3WXA A;  1UWO A;  1PK0 D;  4MVF A;  1PSB A;  2JXL A;  1SCM B;  2JTT A;  2JT8 A;  4C0L A;  5IBW A;  1TUJ A;  1F8H A;  2JPO A;  2OS8 B;  2Q4U A;  3SS3 A;  2BBM A;  3I5I B;  3CGA A;  3NHI A;  1OOF A;  3C1V A;  3TDZ A;  4IJ7 A;  4N1G A;  1LA0 A;  2JRF A;  2HET A;  1UHN A;  2L2E A;  1UUS A;  2MLF C;  1P28 A;  2NXQ A;  1PVB A;  3LK0 A;  4CPV A;  3PLF B;  1F54 A;  3CYZ A;  1DTL A;  1SK6 D;  2KFG A;  2LMV A;  4GAO A;  1OZS A;  2KFH A;  2MBX A;  1MUX A;  2LV7 A;  3DYE A;  4F7F A;  2EGD A;  3B7A A;  3D0Y A;  3LL8 B;  3B6X A;  1J7Q A;  3LK1 A;  1UP5 A;  3DVK A;  5I2L A;  1KQV A;  3KHE A;  2ZND A;  1PSR A;  4BY4 A;  2Y1N A;  1LVC D;  1OE9 B;  4GNK B;  1F70 A;  3CZ2 A;  3OP0 A;  2LLT A;  2NCO A;  2LUC A;  1Y1U A;  1TTX A;  1B7T Z;  1L2O B;  2KAX A;  4QJ5 B;  3SG4 A;  1BG1 A;  2JT3 A;  3Q8I A;  1L7Z A;  1RRO A;  2A4J A;  2M0R A;  5AER A;  1J55 A;  2SAS A;  3OX5 A;  5HKW A;  5KU1 A;  1KSM A;  1ALW A;  3SS4 A;  3DF0 B;  1HT9 A;  1KFU S;  1EXR A;  2MHH A;  1R2U A;  2PVB A;  2LAN A;  1YR5 A;  2KFF A;  2H2K A;  3SG6 A;  2HQ8 A;  3HCM A;  4OZD A;  1CDP A;  3KEV A;  3TDI A;  1QX5 B;  3V2L A;  2BKH B;  1K90 D;  1JF2 A;  1FI5 A;  1J1D A;  1MF8 B;  4Q04 A;  1IWQ A;  3BUX B;  1JFJ A;  2LCP A;  1NCZ A;  3F45 A;  1F4Q A;  1YUT A;  4YGC B;  1IJ6 A;  1XFV O;  1YX7 A;  1IG5 A;  2M49 B;  2HF5 A;  3O6B A;  3PSR A;  3R1O A;  4YGD B;  4YGA A;  2BCA A;  4I5K A;  3DXL A;  1LXF C;  1LIN A;  2K61 A;  3D74 A;  4FQO A;  4ORB B;  1F71 A;  3VB1 A;  2GGM A;  3GK2 A;  5JJG A;  2LLS A;  1PRW A;  1XFX O;  2FJY A;  3NHT A;  3ZNI A;  3TUY C;  1YRU B;  1XK4 A;  1TCO B;  1ZOT B;  1QTX A;  2F3Y A;  1ODB A;  5HLO A;  3S0E A;  1DJX A;  1BF5 A;  3DVJ A;  3S0D A;  2HPS A;  1QAT A;  1M39 A;  1NPQ A;  1XFY O;  2KYC A;  2P71 A;  3EVV A;  4UPG A;  1AP4 A;  3RZS A;  1CDM A;  2CTN A;  5DKR A;  5I2Q A;  4A4B A;  4MZJ A;  2JNF A;  3BOW B;  2IS9 A;  2KI6 C;  2WOR A;  2WCB A;  1A2X A;  1PAL A;  2CXJ A;  1B8R A;  1SL9 A;  5CSN A;  1SNL A;  1DF0 B;  3DF0 A;  1Z2C B;  2MJW B;  3IVT A;  4INW A;  1TN4 A;  2BL0 C;  2LLU A;  1RWY A;  3FE9 A;  1CDL A;  1DJY A;  3I5F C;  1A75 A;  2BCX A;  2D8N A;  4MEW A;  1C07 A;  1QLK A;  1DJW A;  1K96 A;  1QV1 A;  2L5X B;  2H61 C;  3D76 A;  3IQQ A;  5HYD A;  2BEC A;  4I5N B;  4N5X A;  2ISD A;  3R1P A;  3GK1 A;  2WCH A;  1UHI A;  1NUB A;  2I94 A;  1KWO C;  1W7I B;  3TZ1 A;  3WHU B;  4MZL A;  1W7J B;  3VGO A;  1A03 A;  1CKK A;  1QJT A;  2KI4 B;  2M97 A;  2WCK A;  3FWC A;  4NQG A;  1ORG A;  2BKI B;  5B8I B;  1REC A;  3D10 A;  3WNX B;  1CLB A;  2KSP A;  3JTD C;  2BNX A;  1SBJ A;  2JNX A;  4GBA A;  1B9A A;  2WCE A;  3O4X A;  5EL2 A;  4MLW A;  1HQV A;  3AKB A;  1QXP A;  1Y1X A;  3IF7 A;  1SYM A;  4OR9 B;  3MSE B;  5JOL A;  1BT6 A;  3SIA A;  1TNQ A;  3S0B A;  1LS8 A;  2COL B;  2L98 A;  3TS5 B;  1SR6 B;  3NSO A;  1DF0 A;  1JF0 A;  1BR4 B;  1TCF A;  2K2F A;  2Y5I A;  3CTN A;  1J7O A;  1B47 A;  1XFZ O;  4HSZ A;  1LKJ A;  4MBE A;  2LP3 A;  1QS7 A;  3CZ0 A;  4GGF A;  2JT0 A;  3SG3 A;  2GGZ A;  2G2B A;  2JPT A;  1OMV A;  2AUC A;  3EKJ A;  2E6W A;  3ICB A;  3SG7 A;  1GJY A;  1QWV A;  3UNW A;  1OOG A;  1DEL A;  4L9M A;  5FI6 A;  5J3X A;  2KHN A;  1EL4 A;  1QX2 A;  1TIZ A;  1J7R A;  1CM1 A;  1NP8 A;  1WLM A;  2L5Y A;  2M1U A;  4QJ3 B;  2JXC A;  5D7F A;  3UO9 A;  1T14 A;  2EC6 C;  2LAP A;  1EG4 A;  4ORA B;  2K8M B;  1AHR A;  2BBN A;  1OOH A;  4XJK B;  1R6P A;  2FCD A;  2ZRT A;  4FQT A;  1K2H A;  3JVT B;  1AJ4 A;  1S26 D;  3PM2 A;  1NX0 A;  3KPX A;  4USL A;  3QRX A;  3EK7 A;  4NDC A;  2OS8 C;  1K94 A;  3EG5 B;  3EVR A;  3I5I C;  3KO0 A;  3WHT B;  4CFR A;  2M8U A;  2BE4 A;  2F2O A;  1DGU A;  1ZFS A;  3AKA A;  4MRY A;  3VRN A;  1Z4H A;  1XO5 A;  5ER4 X;  2MA2 A;  1C3Y A;  1KK8 B;  4F0Z B;  2L4H A;  4I5J A;  1BLQ A;  2PQL A;  3EKH A;  4ORC B;  1JUO A;  4TNC A;  4PAL A;  3VRP A;  2LVV A;  2DOQ A;  1TWO A;  5DKQ A;  3HX4 A;  2M1K B;  1FBV A;  3BUN B;  1JFK A;  5BPJ A;  3E3R A;  4PDZ A;  1XK4 C;  2PMY A;  1PVA A;  1BJF A;  2LM5 A;  3I5G B;  4OCI A;  3AAK A;  4CFQ A;  2F3Z A;  4DS7 A;  4YBH B;  3RM1 A;  3K1E A;  3VRO A;  1SKT A;  1IKU A;  1C3Z A;  1DJZ A;  1MHO A;  2K7C A;  4XJK A;  2JU0 A;  1GGZ A;  1L2O C;  5CSJ A;  3BUW B;  2RGI A;  5GQQ C;  1CFD A;  3SG5 A;  3B88 A;  2Y4Q A;  1SL7 A;  2KYF A;  4PHM A;  4GGN A;  2JUL A;  1X02 A;  1OMD A;  5PAL A;  1QAS A;  1CB1 A;  2MLE C;  2FOT A;  1F55 A;  5DIC A;  1XVJ A;  1VRK A;  1BU3 A;  4ETO A;  1UUR A;  3L4A A;  4R1E A;  1NX3 A;  4PE4 A;  2KLD A;  1TOP A;  2Q91 A;  3D75 A;  1BR1 B;  4MZK A;  1DVI A;  3TDU A;  2AAO A;  4YGE B;  1QLS A;  2JOJ A;  2LVK A;  3EK4 A;  1CMG A;  1FW4 A;  5I8N A;  5AXI A;  1LA3 A;  3A4U B;  5FYX A;  2K2A A;  4JPZ B;  5AFP A;  1S1E A;  1NIW A;  2WOS A;  1U5I B;  3I5H C;  1KFU L;  3DVE A;  1SCV A;  1S5G Y;  3D73 A;  4JKT A;  2L51 A;  5HKY A;  5I2O A;  1CM4 A;  2CNP A;  3CZ1 A;  4AOM A;  3R72 A;  1Y0V H;  1MQ1 A;  1YVL A;  2L4I A;  5AAN A;  2WC8 A;  2CCM A;  1WRZ A;  2NZ0 A;  2KI6 D;  2M3W A;  1WDC C;  1WY9 A;  5K89 A;  2L50 A;  4NDB A;  1FI6 A;  4MN0 A;  5FI7 A;  2SCP A;  2OTG B;  1RK9 A;  4PCW A;  1C7W A;  4FTG A;  2M29 A;  3BFB A;  3PAL A;  4DUQ A;  4GGF C;  1S6J A;  2QEH A;  1JBA A;  4JWQ A;  1B4C A;  3A8R A;  2WCJ A;  2BL0 B;  2JC2 A;  1MXE A;  1RFJ A;  3I5F B;  1JSA A;  3QME A;  1YUR A;  1PUL A;  1ZUZ A;  2KPH A;  2OPO A;  3SIB A;  3S0A A;  1S6I A;  3B87 A;  4U8D A;  1YRT B;  2KOT A;  3OB2 B;  3PFV A;  1K9K A;  1TRF A;  1AJ5 A;  1DJI A;  1OOI X;  4OVN F;  4ZCV A;  2KI4 C;  2M7L A;  1DT7 B;  1QVI Y;  3BXK A;  3R1V A;  1OSA A;  1Y1A A;  1BOC A;  2CT9 A;  1ALV A;  1RTP 1;  1QX7 A;  3N7H A;  3KF9 A;  2V53 A;  4HRG A; 
#chains in the Genus database with same CATH homology
 1KQM C;  3BOW A;  2G9B A;  1OMR A;  1E8A A;  2JZI A;  1NX2 A;  3FWB A;  1IQ3 A;  1OQP A;  2R2I A;  1TNW A;  3PN7 B;  3O78 A;  2I2R E;  3H4S E;  2KNE A;  1YVH A;  3NXA A;  1KK7 Y;  1NSH A;  4WQ3 A;  5TNC A;  4PHN A;  4D1E A;  1ZAC A;  2TN4 A;  1IQ5 A;  2BCB A;  4JQ0 D;  1G8I A;  3LLE A;  1AK8 A;  1UHK A;  2LE9 B;  4I5L B;  1M45 A;  2NCP A;  3IQO A;  5F6T A;  3O4Y A;  2B1U A;  1AUI B;  1NCX A;  4GFT A;  1H8B A;  1IJ5 A;  2P6B B;  1MWN A;  2LVJ A;  2WCF A;  4GUK A;  1Q80 A;  3CWG A;  1B1G A;  1B8C A;  5HKZ A;  1S6C A;  3CR5 X;  1GQM A;  4WQ2 A;  2I7A A;  1CLM A;  1SCM C;  2LHI A;  3EVU A;  4YI9 A;  1NX1 A;  3FS7 A;  2O5G A;  2PSR A;  4M2O A;  3AAJ A;  1H4B A;  4C0J A;  4C0K A;  3JVT C;  1D1O A;  1BOD A;  2F8P A;  1K9U A;  4QJ4 B;  1GGW A;  1S3P A;  1S5G Z;  1G33 A;  5HLV A;  2F2P A;  1CLL A;  1MR8 A;  1OZO A;  2K7B A;  3SJS A;  4CID A;  1IGV A;  1KK8 C;  4E68 A;  1DJG A;  2LVI A;  1A4P A;  3ZWH A;  2KBI A;  2QAC A;  2QPT A;  2ZNE A;  3LCP C;  4PE1 A;  2ZN9 A;  1NYA A;  2NLN A;  1SRA A;  3RLZ A;  2M7N A;  1M31 A;  2AMI A;  3I5G C;  1A29 A;  5CSF A;  1IH0 A;  1N0Y A;  4HRE E;  1F4O A;  3CLN A;  4GPL B;  4PHJ A;  4IL1 A;  1YUU A;  1QV0 A;  1SL8 A;  5AEQ A;  1JWD A;  1NWD A;  1QVI Z;  4N1F A;  1CTR A;  1XA5 A;  4DCK A;  2I18 A;  2KQ6 A;  1XYD A;  1DJH A;  2K0J A;  2KGB C;  5ER5 A;  1NCY A;  2L0P A;  5KSZ A;  2LC5 A;  4ZCU A;  2KGR A;  3BUO B;  1N65 A;  4HRH A;  5D69 A;  1CFF A;  3PAT A;  2ZFD A;  2WND A;  3PM8 A;  3K21 A;  2LP2 A;  3CS1 A;  2ZKM X;  1KK7 Z;  1UHJ A;  1B8L A;  4YGB B;  1A75 B;  1V1F A;  2LUX A;  2VRG A;  1Y6W A;  1V1G A;  2E30 A;  1MXL C;  4DIR A;  1J7P A;  3NSI A;  1SY9 A;  1K8U A;  1CFC A;  1SW8 A;  3NSL A;  2BE6 A;  4YI8 A;  3TUY B;  1C7V A;  3BQ3 A;  4XYN A;  2EHB A;  1K9P A;  1J1E A;  1SMG A;  3VRR A;  3VRQ A;  4CLN A;  3SG2 A;  1WRK A;  1M63 B;  3CZT X;  3GOF A;  4PHK A;  2LNK A;  4DRW A;  1SPY A;  1WLZ A;  3I5H B;  2F33 A;  1KCY A;  3BUM B;  4MRX A;  1EH2 A;  3CR2 A;  5CPV A;  5G08 A;  2JWW A;  2JTZ A;  1UHH A;  1K95 A;  3O2P A;  1DMO A;  3NSK A;  4A4C A;  2MRD A;  4M2Q A;  4OKH A;  2OTG C;  4P5O E;  5KTY A;  2LMU A;  1KSO A;  3CR4 X;  4M2P A;  1WDC B;  4AQI A;  1K93 D;  1TNX A;  1BMO A;  2Y1M A;  1IRJ A;  2PAL A;  3DVM A;  2HQW A;  1KWO B;  1CNP A;  1U5I A;  4NDD A;  1ZMZ A;  2K7D A;  1EJ3 A;  2KAY A;  1B7T Y;  3GK4 X;  1DGV A;  3OX6 A;  2ZRS A;  4P2Y B;  2KQY A;  3JTD B;  4PE7 A;  1G4Y R;  3FIA A;  2LHL A;  1QIV A;  1KFX S;  1AVS A;  3TS5 C;  2M9G A;  5CSI A;  1SR6 C;  1RJV A;  1TNP A;  2KDH A;  2KBM A;  3PN7 C;  2MAZ A;  1N2D A;  1KQM B;  2K7O A;  3EK8 A;  1CDN A;  1EG3 A;  4OV2 A;  1CFP A;  3OHM B;  1XFU O;  3M0W A;  1WRL A;  1YX8 A;  1FF1 A;  2JQ6 A;  2CBL A;  2KAV A;  4ICB A;  2H61 A;  1S36 A;  1FPW A;  1OOJ A;  1QIW A;  1XFW O;  2FJU B;  2LMT A;  2O60 A;  3OB1 B;  4AQJ A;  1M46 A;  2PAS A;  3D0Y B;  4BY5 A;  4PE0 A;  1YTZ C;  4WRI A;  2GV5 A;  2FCE A;  3BYA A;  4YRU A;  2PRU A;  1CMF A;  1YUS A;  2ZN8 A;  2EC6 B;  3DD4 A;  1JC2 A;  1KFX L;  4MSP A;  3WXA A;  1UWO A;  1PK0 D;  4MVF A;  1PSB A;  2JXL A;  1SCM B;  2JTT A;  2JT8 A;  4C0L A;  5IBW A;  1F8H A;  2OS8 B;  2Q4U A;  2BBM A;  3I5I B;  3CGA A;  3C1V A;  3TDZ A;  4N1G A;  1LA0 A;  2JRF A;  2HET A;  1UHN A;  2L2E A;  1UUS A;  2MLF C;  2NXQ A;  1PVB A;  3LK0 A;  4CPV A;  3PLF B;  1F54 A;  1DTL A;  1SK6 D;  2KFG A;  2LMV A;  4GAO A;  1OZS A;  2KFH A;  2MBX A;  1MUX A;  2LV7 A;  2EGD A;  3D0Y A;  3LL8 B;  1J7Q A;  3LK1 A;  1UP5 A;  3DVK A;  5I2L A;  1KQV A;  3KHE A;  2ZND A;  1PSR A;  4BY4 A;  2Y1N A;  1LVC D;  1OE9 B;  4GNK B;  1F70 A;  3OP0 A;  2LLT A;  2NCO A;  2LUC A;  1Y1U A;  1TTX A;  1B7T Z;  1L2O B;  2KAX A;  4QJ5 B;  3SG4 A;  1BG1 A;  2JT3 A;  1L7Z A;  1RRO A;  2A4J A;  2M0R A;  5AER A;  1J55 A;  2SAS A;  3OX5 A;  5HKW A;  5KU1 A;  1KSM A;  1ALW A;  3DF0 B;  1HT9 A;  1KFU S;  1EXR A;  2MHH A;  1R2U A;  2PVB A;  2LAN A;  1YR5 A;  2KFF A;  2H2K A;  3SG6 A;  2HQ8 A;  3HCM A;  3TDI A;  1CDP A;  3KEV A;  1QX5 B;  2BKH B;  1K90 D;  1JF2 A;  1FI5 A;  1J1D A;  1MF8 B;  4Q04 A;  1IWQ A;  3BUX B;  1JFJ A;  2LCP A;  1NCZ A;  3F45 A;  1F4Q A;  1YUT A;  4YGC B;  1IJ6 A;  1XFV O;  1YX7 A;  1IG5 A;  2M49 B;  2HF5 A;  3O6B A;  3PSR A;  4YGA A;  4YGD B;  5DKN A;  2BCA A;  4I5K A;  1LXF C;  1LIN A;  2K61 A;  4FQO A;  4ORB B;  1F71 A;  2GGM A;  3GK2 A;  5JJG A;  2LLS A;  1PRW A;  1XFX O;  3ZNI A;  3TUY C;  1YRU B;  1XK4 A;  1TCO B;  1ZOT B;  1QTX A;  2F3Y A;  1ODB A;  5HLO A;  1BF5 A;  1DJX A;  3DVJ A;  2HPS A;  1QAT A;  1M39 A;  1NPQ A;  1XFY O;  2KYC A;  3EVV A;  4UPG A;  1AP4 A;  1CDM A;  2CTN A;  5DKR A;  5I2Q A;  4A4B A;  4MZJ A;  2JNF A;  3BOW B;  2IS9 A;  2KI6 C;  2WOR A;  2WCB A;  1A2X A;  1PAL A;  2CXJ A;  1B8R A;  1SL9 A;  5CSN A;  1SNL A;  1DF0 B;  3DF0 A;  2MJW B;  1TN4 A;  2BL0 C;  2LLU A;  1RWY A;  1CDL A;  1DJY A;  3I5F C;  1A75 A;  2BCX A;  2D8N A;  4MEW A;  1C07 A;  1QLK A;  1DJW A;  1K96 A;  1QV1 A;  2L5X B;  2H61 C;  3IQQ A;  5HYD A;  2BEC A;  4I5N B;  4N5X A;  2ISD A;  3GK1 A;  1UHI A;  1NUB A;  2I94 A;  1KWO C;  1W7I B;  3TZ1 A;  3WHU B;  4MZL A;  1W7J B;  3VGO A;  1A03 A;  1CKK A;  1QJT A;  2KI4 B;  2M97 A;  3FWC A;  4NQG A;  2BKI B;  5B8I B;  1REC A;  3D10 A;  3WNX B;  1CLB A;  2KSP A;  3JTD C;  2JNX A;  1SBJ A;  4GBA A;  1B9A A;  2WCE A;  4MLW A;  1HQV A;  3AKB A;  1QXP A;  1Y1X A;  3IF7 A;  1SYM A;  4OR9 B;  3MSE B;  5JOL A;  1BT6 A;  3SIA A;  1TNQ A;  2COL B;  2L98 A;  3TS5 B;  1SR6 B;  3NSO A;  1DF0 A;  1JF0 A;  1BR4 B;  1TCF A;  2K2F A;  2Y5I A;  3CTN A;  1J7O A;  1B47 A;  1XFZ O;  4HSZ A;  1LKJ A;  4MBE A;  2LP3 A;  1QS7 A;  4GGF A;  2JT0 A;  3SG3 A;  2GGZ A;  2G2B A;  2JPT A;  1OMV A;  2AUC A;  3EKJ A;  2E6W A;  3ICB A;  3SG7 A;  1GJY A;  4L9M A;  5J3X A;  2KHN A;  1EL4 A;  1QX2 A;  1TIZ A;  1J7R A;  1CM1 A;  1NP8 A;  1WLM A;  2M1U A;  4QJ3 B;  5D7F A;  2JXC A;  2EC6 C;  2LAP A;  1EG4 A;  4ORA B;  2K8M B;  1AHR A;  2BBN A;  4XJK B;  1R6P A;  2FCD A;  2ZRT A;  1K2H A;  3JVT B;  1AJ4 A;  1S26 D;  1NX0 A;  3KPX A;  4USL A;  3QRX A;  3EK7 A;  4NDC A;  2OS8 C;  1K94 A;  3EVR A;  3I5I C;  3KO0 A;  3WHT B;  4CFR A;  2M8U A;  2BE4 A;  2F2O A;  1DGU A;  1ZFS A;  3AKA A;  4MRY A;  3VRN A;  1XO5 A;  5ER4 X;  2MA2 A;  1KK8 B;  4F0Z B;  2L4H A;  4I5J A;  1BLQ A;  4ORC B;  3EKH A;  1JUO A;  4TNC A;  4PAL A;  3VRP A;  2LVV A;  2DOQ A;  5DKQ A;  3HX4 A;  2M1K B;  1FBV A;  3BUN B;  1JFK A;  5BPJ A;  3E3R A;  4PDZ A;  1XK4 C;  2PMY A;  1PVA A;  1BJF A;  2LM5 A;  3I5G B;  4OCI A;  3AAK A;  4CFQ A;  2F3Z A;  4DS7 A;  4YBH B;  3RM1 A;  3VRO A;  1IKU A;  1SKT A;  1DJZ A;  1MHO A;  2K7C A;  4XJK A;  2JU0 A;  1GGZ A;  1L2O C;  5CSJ A;  3BUW B;  2RGI A;  5GQQ C;  1CFD A;  3SG5 A;  2Y4Q A;  1SL7 A;  2KYF A;  4PHM A;  4GGN A;  2JUL A;  1X02 A;  1OMD A;  5PAL A;  1QAS A;  1CB1 A;  2MLE C;  2FOT A;  1F55 A;  1XVJ A;  1VRK A;  1BU3 A;  4ETO A;  1UUR A;  4R1E A;  1NX3 A;  4PE4 A;  2Q91 A;  1TOP A;  1BR1 B;  4MZK A;  1DVI A;  3TDU A;  2AAO A;  4YGE B;  1QLS A;  2JOJ A;  2LVK A;  3EK4 A;  1CMG A;  1FW4 A;  5I8N A;  5AXI A;  1LA3 A;  3A4U B;  5FYX A;  2K2A A;  4JPZ B;  5AFP A;  1S1E A;  1NIW A;  2WOS A;  1U5I B;  3I5H C;  1KFU L;  3DVE A;  1SCV A;  1S5G Y;  2L51 A;  5HKY A;  5I2O A;  1CM4 A;  2CNP A;  4AOM A;  1Y0V H;  1MQ1 A;  1YVL A;  2L4I A;  5AAN A;  2WC8 A;  2CCM A;  1WRZ A;  2NZ0 A;  2KI6 D;  2M3W A;  1WDC C;  1WY9 A;  5K89 A;  2L50 A;  4NDB A;  1FI6 A;  4MN0 A;  2SCP A;  2OTG B;  1RK9 A;  4PCW A;  1C7W A;  4FTG A;  2M29 A;  4DUQ A;  3PAL A;  4GGF C;  1S6J A;  1JBA A;  4JWQ A;  1B4C A;  3A8R A;  2BL0 B;  2JC2 A;  1MXE A;  1RFJ A;  3I5F B;  1JSA A;  1YUR A;  1PUL A;  1ZUZ A;  2OPO A;  3SIB A;  1S6I A;  4U8D A;  1YRT B;  2KOT A;  3OB2 B;  3PFV A;  1K9K A;  1TRF A;  1AJ5 A;  1DJI A;  4OVN F;  4ZCV A;  2M7L A;  2KI4 C;  1DT7 B;  1QVI Y;  3BXK A;  1OSA A;  1Y1A A;  1BOC A;  2CT9 A;  1ALV A;  1RTP 1;  1QX7 A;  3KF9 A;  2V53 A;  4HRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...