1SCVA

Nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein, structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 13
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scvA00
2LCPA 1IG5A 1JUOA 2HF5A 1CDNA 1H8BA 4HRGA 1B7TZ 3GK2A 2BECA 3BQ3A 4MVFA 5JJGA 1FI6A 1C07A 2LP2A 5KU1A 2I7AA 1D1OA 3EK8A 1Y1XA 2LMUA 3KHEA 2NZ0A 1F4OA 1CMFA 5DKRA 1MHOA 2JC2A 3O6BA 1KK7Z 1DJXA 1BR4B 2WORA 3D0YB 1KK8B 4QJ4B 1DGVA 4GAOA 2VRGA 3VROA 1J7QA 4I5LB 1CLLA 1K8UA 2M1KB 2ZNEA 2JXLA 4JPZB 1QTXA 4P5OE 2JPTA 1AP4A 1QLSA 1J7RA 1OOJA 2LAPA 1KQMB 1BMOA 1IRJA 2CNPA 2M0RA 3NSKA 1XFXO 5CSNA 1IQ3A 2JZIA 4QJ3B 1VRKA 1XFWO 2KOTA 3QRXA 2NLNA 3AAKA 1X02A 1K95A 2KFGA 4JWQA 2WCBA 1TNWA 2JT0A 2LLUA 1YUSA 2JWWA 4DS7A 1DJGA 1CLBA 2HETA 3A8RA 1B4CA 2F2PA 1DMOA 2K7OA 1CKKA 2KI6D 2F8PA 2BBMA 3I5HB 3PM8A 4NDCA 3LCPC 4YI9A 1F71A 1YURA 2JRFA 1M31A 1B47A 4CLNA 4AQJA 1CFFA 2LANA 5AANA 1HQVA 2LVJA 1EL4A 5TNCA 1NCYA 3OX5A 1A75B 4M2OA 5CSIA 5ER4X 5G08A 5HLVA 3OB1B 1QV1A 3CGAA 1YR5A 1R6PA 2ZRSA 1WY9A 3A4UB 5CSFA 4YRUA 4CFQA 2LUCA 2BL0B 3FIAA 4YGBB 2LUXA 4MSPA 4YI8A 2KQYA 4CIDA 4ORAB 2KDHA 1SR6C 1AVSA 4DUQA 4WQ3A 2SASA 5AERA 2P6BB 1MXLC 1CMGA 4TNCA 1AJ4A 5KTYA 2AMIA 5D7FA 2KBIA 3LK0A 1A29A 1OMDA 3CLNA 1NIWA 1NP8A 1NYAA 1K90D 1TNXA 4GGNA 1YRTB 1AHRA 2JULA 1YVHA 3SIBA 1W7IB 2KNEA 1K94A 2KAXA 1A4PA 3BUOB 1SCMB 2KHNA 1ODBA 4MBEA 3WHTB 1PVAA 1QIVA 1JWDA 1QX5B 2GGMA 1WRKA 2LC5A 1RJVA 3PATA 2EC6B 2L0PA 4R1EA 2I18A 4USLA 2ISDA 2BBNA 2K7BA 1UHKA 1KFXS 4ORBB 3I5FC 2IS9A 4AOMA 1KK7Y 2Q4UA 1SY9A 3BOWA 2CBLA 1J1DA 5I2LA 3TDZA 2JT3A 4C0JA 1U5IB 3GK4X 3IQOA 2PMYA 4ICBA 5I2QA 1XYDA 1XK4A 5PALA 1JFJA 2LVIA 3EVVA 1NSHA 1XFVO 1YTZC 2EHBA 1NX0A 1SL9A 3OP0A 2B1UA 2BKHB 1MXEA 1K9UA 1Y1AA 1JFKA 2COLB 1TN4A 3PN7C 5HYDA 2OPOA 1ALWA 2OS8B 3D10A 3MSEB 3PFVA 3GOFA 2FJUB 1S26D 1WDCB 1N65A 1GGZA 1TNPA 2KAYA 3SG2A 1PSBA 5ER5A 2MA2A 1GJYA 3TZ1A 5HKWA 1QATA 2K0JA 2PASA 1AJ5A 4NDDA 4U8DA 3K21A 4GUKA 2M9GA 1NWDA 1KFUS 2L51A 1BOCA 1JF2A 5K89A 1QXPA 2MLFC 1J7PA 1GQMA 3SG3A 2FCEA 4Q04A 1JSAA 3CS1A 2MBXA 4L9MA 2KYFA 3RM1A 4CPVA 1DVIA 2HPSA 2SCPA 4PHKA 1OSAA 1ZOTB 3DF0A 4MEWA 1CB1A 1WRZA 1FF1A 3I5IB 4WRIA 1RFJA 2M3WA 3DVKA 1B1GA 3AAJA 2LMVA 2M1UA 3VRPA 5DKQA 1K93D 3O2PA 3C1VA 3CZTX 1V1FA 3LK1A 4PALA 1DGUA 2KI4B 4BY4A 1CDPA 1WLZA 4PHJA 4MZLA 3SJSA 2OTGB 2JQ6A 1M45A 1NX2A 1SMGA 1IQ5A 2LNKA 5I8NA 3CR5X 1YVLA 2AAOA 3I5GC 2OS8C 1AUIB 3TS5C 1NX3A 1AK8A 1TIZA 5B8IB 2E30A 1S1EA 4ORCB 1K96A 1CTRA 1B8CA 1BJFA 2M49B 1WLMA 3SG7A 2LVVA 1OMVA 2JU0A 4HRHA 2KAVA 1QX2A 1KWOC 2M8UA 2AUCA 2O60A 3VGOA 3SG4A 1F8HA 2L4HA 1S36A 1IJ6A 1W7JB 1A75A 2M7LA 2HQ8A 1U5IA 4M2PA 1UWOA 2QACA 1YUUA 2ZFDA 3BOWB 1KCYA 1SPYA 4GPLB 1M46A 1MF8B 2JXCA 2JTTA 2LMTA 1ZACA 2NCPA 4OV2A 3OX6A 1SL8A 3TDIA 1N0YA 1LVCD 3AKBA 3BUNB 2F2OA 4P2YB 2KGRA 1S6IA 2QPTA 4D1EA 1H4BA 1C7WA 1SCVA 4C0LA 1HT9A 1B7TY 1DJYA 3AKAA 5AFPA 5D69A 3EVRA 1CDMA 2EC6C 1K9KA 1QLKA 1G33A 2PSRA 2PVBA 1LKJA 3BYAA 4A4CA 2K2AA 2GGZA 1TNQA 2CCMA 2Y1MA 4OR9B 2Q91A 1UURA 1RWYA 1YX7A 1TTXA 1KWOB 1PSRA 2KSPA 4OCIA 4QJ5B 2JNFA 4PDZA 5CSJA 4YGAA 1XA5A 3HX4A 1IH0A 2A4JA 1EJ3A 2Y1NA 2JOJA 3LLEA 3JTDC 4OVNF 4PCWA 4FQOA 3HCMA 3EVUA 1ZMZA 2G9BA 3LL8B 2LM5A 2G2BA 1DJHA 3FWCA 1EH2A 5AXIA 1UP5A 2L50A 1KFXL 3BUXB 3CR2A 3H4SE 4I5KA 4XJKB 1QVIZ 1CFCA 4DCKA 4GBAA 3TDUA 1XFZO 1TCFA 1TOPA 1WRLA 2BCBA 1PK0D 2BE4A 3PSRA 1TCOB 1XFYO 3DF0B 1FI5A 1MQ1A 1Y0VH 2HQWA 1SL7A 4PHMA 2MLEC 1BF5A 3WHUB 5AEQA 4GGFC 1WDCC 3NXAA 1B8RA 2LHLA 1MR8A 1J1EA 2M29A 2MJWB 1IJ5A 2H2KA 1K2HA 3O78A 1JBAA 2ZN9A 4PE4A 3O4YA 1CFDA 3SIAA 3PN7B 1SW8A 1IKUA 3EK7A 1L2OB 5DKNA 4NQGA 1UUSA 1Y6WA 1EG3A 3ZWHA 2BKIB 2O5GA 1SR6B 1QS7A 2KFFA 1F55A 1SRAA 4PE0A 1JC2A 1UHIA 5HKZA 3JVTB 4YGEB 2MRDA 4PE1A 2PALA 3NSIA 1J7OA 2BL0C 5F6TA 1NCZA 1NCXA 1DF0A 2NXQA 1A03A 2K7CA 5JOLA 1YRUB 4PE7A 1PALA 1C7VA 2K61A 2KI4C 1KQVA 4GGFA 4E68A 2E6WA 1KK8C 4ZCVA 1F4QA 1DJIA 1ALVA 1NX1A 1MUXA 1XVJA 3I5IC 1S3PA 4PHNA 4ZCUA 2BE6A 3VRRA 1S6JA 4MRXA 2LVKA 1SKTA 1XO5A 1SNLA 3EKJA 1CM1A 2DOQA 1R2UA 2JT8A 1CLMA 1LXFC 2KYCA 1QJTA 4IL1A 1M39A 2WOSA 2OTGC 1CFPA 3E3RA 1IWQA 1OZSA 1MWNA 1E8AA 1L2OC 2KQ6A 2L98A 1B8LA 1YX8A 3DVEA 1BR1B 1LA0A 3NSLA 1F70A 4FTGA 2CT9A 2MHHA 1DTLA 5HKYA 1G8IA 2I94A 1Q80A 2M97A 3FS7A 4XJKA 4I5JA 2GV5A 1XFUO 2FOTA 4YBHB 1KQMC 4MZJA 2JNXA 1UHJA 3VRNA 3EK4A 4MRYA 4JQ0D 2F3ZA 1QIWA 3DVMA 1S5GY 3KO0A 1QASA 1N2DA 3PLFB 2LLSA 1SYMA 4XYNA 1BU3A 1RTP1 4N1GA 4C0KA 3ICBA 1RK9A 4A4BA 1S5GZ 3OHMB 3CTNA 1LINA 2ZN8A 1OMRA 4M2QA 3IF7A 1QX7A 1FBVA 2F33A 2KFHA 4NDBA 1F54A 3M0WA 4DIRA 4OKHA 3I5HC 2D8NA 2LHIA 4HREE 3EKHA 2TN4A 2MAZA 1G4YR 3WXAA 5BPJA 2BCAA 3TUYB 3PALA 2ZRTA 4F0ZB 1DJZA 1KFUL 2Y4QA 4YGDB 1EXRA 1OE9B 1V1GA 2JTZA 3BUWB 3SG5A 5KSZA 1SK6D 2KGBC 2RGIA 2EGDA 1L7ZA 4AQIA 1GGWA 1PULA 2L2EA 1BT6A 1ZUZA 2LE9B 3JTDB 1TRFA 1DT7B 2PRUA 1Y1UA 2K2FA 2ZNDA 3GK1A 2K8MB 1LA3A 1PRWA 2WCEA 2WC8A 2R2IA 2ZKMX 2LP3A 3KEVA 4ETOA 1BODA 4BY5A 2WNDA 4YGCB 3DVJA 4N1FA 1CM4A 2F3YA 1A2XA 2V53A 5IBWA 1B9AA 1CDLA 2H61C 5FYXA 1NPQA 1SBJA 5J3XA 1QV0A 1M63B 1YUTA 3I5FB 4UPGA 3BXKA 4WQ2A 4GNKB 1FW4A 3ZNIA 4I5NB 1PVBA 1DF0B 1SCMC 1UHHA 3CR4X 3KPXA 1DJWA 2BCXA 2L5XB 1RROA 3F45A 1J55A 1BLQA 2WCFA 1JF0A 1BG1A 1RECA 4DRWA 3FWBA 3WNXB 2LLTA 3I5GB 4MZKA 5CPVA 3TS5B 2H61A 4N5XA 3RLZA 2KBMA 2M7NA 4GFTA 3TUYC 3SG6A 2KI6C 3D0YA 4MN0A 1FPWA 4MLWA 4HSZA 5HLOA 2CXJA 3OB2B 3DD4A 2K7DA 3JVTC 1K9PA 1UHNA 1KSMA 1ZFSA 2L4IA 3KF9A 5I2OA 1EG4A 2I2RE 3CWGA 1XK4C 2Y5IA 2CTNA 1KSOA 3NSOA 3IQQA 3BUMB 5GQQC 1IGVA 1CNPA 2FCDA 2LV7A 1NUBA 1OQPA 1QVIY 1OZOA 2NCOA 4CFRA 3VRQA 1S6CA
chains in the Genus database with same CATH superfamily
2LCPA 1IG5A 1JUOA 3S0BA 2HF5A 1CDNA 1H8BA 4HRGA 1B7TZ 3GK2A 2BECA 3BQ3A 4MVFA 5JJGA 1FI6A 1C07A 2LP2A 5KU1A 2I7AA 2WCLA 1D1OA 3EK8A 1Y1XA 2LMUA 3KHEA 2NZ0A 1F4OA 1CMFA 5DKRA 1MHOA 2JC2A 3O6BA 1KK7Z 1DJXA 1BR4B 2WORA 3CZ2A 3D0YB 1KK8B 4QJ4B 1DGVA 4GAOA 2VRGA 3VROA 3D77A 1J7QA 4I5LB 1CLLA 1K8UA 2M1KB 2GTEA 2ZNEA 2JXLA 4JPZB 1QTXA 4P5OE 2JPTA 1AP4A 1QLSA 1J7RA 3CZ0A 1OOJA 2LAPA 1KQMB 1BMOA 1IRJA 2CNPA 2M0RA 3NSKA 1XFXO 5CSNA 1IQ3A 2JZIA 4QJ3B 1VRKA 1XFWO 2KOTA 3QRXA 2NLNA 3AAKA 5FI6A 1X02A 1K95A 2KFGA 4JWQA 4INWA 2WCBA 1TNWA 2JT0A 2LLUA 1YUSA 2JWWA 4DS7A 1DJGA 1CLBA 2HETA 3A8RA 3FE8A 1Z4HA 1B4CA 2F2PA 1DMOA 5DICA 1OOFA 2K7OA 2L2CA 1CKKA 2KI6D 3OGNA 4FQTA 2F8PA 2BBMA 3I5HB 3PM8A 4NDCA 3LCPC 4OZDA 4YI9A 1F71A 5D3OA 1Z2CB 1YURA 1OW4A 3DZTA 2JRFA 1M31A 1B47A 4CLNA 4AQJA 3S0GA 1CFFA 1OOIX 2LANA 5AANA 2WC6A 1HQVA 2LVJA 1EL4A 5TNCA 1NCYA 3OX5A 1A75B 4M2OA 5CSIA 5ER4X 5G08A 1P28A 5HLVA 3OB1B 1QV1A 3CGAA 3K1EA 1YR5A 1R6PA 2ZRSA 1WY9A 2QEVA 3A4UB 3L4AA 5CSFA 4YRUA 4CFQA 2LUCA 2BL0B 3FIAA 4YGBB 2LUXA 4MSPA 3DY9A 1GM0A 4YI8A 2KQYA 4CIDA 4ORAB 2KDHA 1SR6C 1AVSA 3N7HA 4DUQA 4WQ3A 3V2LA 2SASA 5AERA 2P6BB 3S0EA 1MXLC 1CMGA 4TNCA 1AJ4A 5KTYA 2AMIA 3D76A 2H8VA 2KBIA 3LK0A 5D7FA 1A29A 1OMDA 3CLNA 1NIWA 1NP8A 1NYAA 1K90D 1TNXA 2KPHA 1YRTB 4GGNA 1AHRA 2JULA 1YVHA 3SIBA 1W7IB 2KNEA 1K94A 2KAXA 1A4PA 2P71A 3BUOB 1SCMB 2WCHA 2KHNA 1ODBA 4MBEA 3WHTB 1PVAA 1QIVA 1JWDA 1QX5B 1DC1A 2GGMA 1WRKA 2LC5A 1RJVA 3PATA 2EC6B 2L0PA 4R1EA 2I18A 2QEBA 4USLA 2ISDA 2BBNA 2K7BA 1UHKA 1KFXS 4ORBB 3NHIA 3I5FC 2IS9A 5FI7A 4AOMA 1KK7Y 3DYEA 2Q4UA 1SY9A 3FE6A 3BOWA 2CBLA 1J1DA 5I2LA 3TDZA 2JT3A 4C0JA 2L5YA 1U5IB 3GK4X 1T14A 3IQOA 2PMYA 1XFRA 4ICBA 5I2QA 1XYDA 1XK4A 5PALA 1JFJA 2LVIA 3EVVA 1NSHA 1XFVO 2PYQA 1YTZC 2EHBA 2KLDA 3PM2A 1NX0A 1SL9A 1C3ZA 3OP0A 2B1UA 2BKHB 1MXEA 1K9UA 1Y1AA 1JFKA 2COLB 1TN4A 3PN7C 5HYDA 2OPOA 1ALWA 2OS8B 3D10A 3MSEB 3PFVA 3GOFA 2FJUB 1S26D 1WDCB 1N65A 1GGZA 1TNPA 2KAYA 3SG2A 1PSBA 5ER5A 3RZSA 2MA2A 1GJYA 3TZ1A 5HKWA 1QATA 2K0JA 2PASA 1AJ5A 4NDDA 4U8DA 3K21A 4KYNA 4GUKA 2M9GA 1NWDA 5HL1A 1KFUS 2L51A 1BOCA 1JF2A 5K89A 1QXPA 2MLFC 1J7PA 1GQMA 4IJ7A 3SG3A 2FCEA 4Q04A 1JSAA 3CS1A 2MBXA 4L9MA 2KYFA 3RM1A 4CPVA 1DVIA 2HPSA 2SCPA 4PHKA 1OSAA 1ZOTB 3DF0A 4MEWA 1CB1A 1W9ZA 1WRZA 1FF1A 3I5IB 4WRIA 1RFJA 2M3WA 3DVKA 1B1GA 3AAJA 2LMVA 2M1UA 3VRPA 5DKQA 1K93D 3O2PA 3C1VA 3CZTX 1V1FA 3LK1A 4PALA 3R1VA 1TUZA 3BFBA 1DGUA 2KI4B 4BY4A 1CDPA 3FE9A 1WLZA 4PHJA 4MZLA 3SJSA 3NGVA 2OTGB 2JQ6A 1M45A 3QMEA 1NX2A 1SMGA 1IQ5A 2LNKA 3O4XA 3CR5X 5I8NA 1YVLA 2AAOA 3I5GC 2OS8C 1AUIB 3TS5C 1NX3A 1AK8A 1TIZA 5B8IB 2E30A 3D75A 1S1EA 4ORCB 1K96A 1CTRA 1B8CA 1BJFA 2M49B 1WLMA 3SG7A 2LVVA 1OMVA 4F7FA 2JU0A 4HRHA 2KAVA 1QX2A 3B87A 1KWOC 2M8UA 2AUCA 2O60A 3NHTA 3VGOA 3SG4A 2FJYA 1F8HA 2L4HA 1S36A 1IJ6A 1W7JB 1A75A 2M7LA 2HQ8A 2YGUA 1U5IA 4M2PA 1UWOA 2QACA 1YUUA 2ZFDA 3BOWB 1KCYA 1SPYA 4GPLB 3PJIA 1M46A 1MF8B 2JXCA 2JTTA 2LMTA 2P70A 1ZACA 2NCPA 4OV2A 3OX6A 1SL8A 3TDIA 1N0YA 1LVCD 3AKBA 3BUNB 2F2OA 4P2YB 1LS8A 2PQLA 2BNXA 2KGRA 1S6IA 2QPTA 4D1EA 1H4BA 1C7WA 1SCVA 4C0LA 1HT9A 1B7TY 1DJYA 3AKAA 5AFPA 5D69A 3EVRA 1CDMA 2EC6C 1K9KA 1QLKA 3IVTA 1G33A 2PSRA 2PVBA 1LKJA 3B86A 3BYAA 2K2AA 4A4CA 2GGZA 1TNQA 2CCMA 1TUJA 2Y1MA 4OR9B 2Q91A 1UURA 3SS4A 1RWYA 1YX7A 2QDIA 1TTXA 5FI2A 1KWOB 3VB1A 1PSRA 2KSPA 4OCIA 4QJ5B 2JNFA 4PDZA 5CSJA 3R1PA 4YGAA 1XA5A 3HX4A 1IH0A 2A4JA 1EJ3A 3D78A 1QWVA 2Y1NA 2JOJA 3LLEA 3JTDC 4OVNF 4PCWA 4FQOA 3HCMA 3EVUA 1ZMZA 2G9BA 3LL8B 2LM5A 2G2BA 1DJHA 1SSEB 3BFAA 3FWCA 1EH2A 5AXIA 1UP5A 2L50A 1KFXL 3BUXB 3CR2A 3H4SE 4I5KA 4XJKB 1QVIZ 1CFCA 4DCKA 4GBAA 3TDUA 1XFZO 1TCFA 1TOPA 1WRLA 2BCBA 1PK0D 2BE4A 3PSRA 1TCOB 1XFYO 3DF0B 1FI5A 3SS5A 1MQ1A 1Y0VH 2HQWA 1SL7A 4PHMA 2MLEC 1BF5A 3WHUB 5AEQA 4GGFC 1WDCC 3NXAA 1B8RA 2LHLA 1MR8A 1J1EA 2M29A 2MJWB 1IJ5A 2H2KA 3R72A 1K2HA 3O78A 1JBAA 2ZN9A 4PE4A 3O4YA 1CFDA 3SIAA 3PN7B 1SW8A 1IKUA 3EK7A 1L2OB 2WCKA 5DKNA 4NQGA 1UUSA 1Y6WA 1EG3A 3ZWHA 2BKIB 2O5GA 1SR6B 1QS7A 3EG5B 2KFFA 1F55A 3B6XA 1SRAA 4PE0A 4PT1A 1JC2A 1UHIA 5HKZA 3JVTB 4YGEB 2MRDA 2JPOA 4PE1A 2PALA 3NSIA 1J7OA 2BL0C 3CDNA 3L47A 5F6TA 1NCZA 1NCXA 1DF0A 2NXQA 1A03A 2K7CA 5JOLA 1YRUB 1IIOA 4PE7A 3OBVA 1PALA 1C7VA 2K61A 2KI4C 1KQVA 1OOHA 4GGFA 4E68A 2E6WA 1KK8C 4ZCVA 1F4QA 5I94A 1DJIA 1ALVA 2KLEA 1NX1A 1MUXA 1XVJA 3I5IC 1S3PA 4PHNA 4ZCUA 2BE6A 3VRRA 1S6JA 4MRXA 2LVKA 1SKTA 1XO5A 1SNLA 3EKJA 1CM1A 3CYZA 2DOQA 1R2UA 2JT8A 3UO9A 1CLMA 1LXFC 2KYCA 1QJTA 2WC5A 4IL1A 1M39A 2WOSA 2OTGC 1CFPA 3E3RA 1IWQA 1OZSA 1MWNA 1E8AA 1L2OC 2KQ6A 2L98A 1C3YA 1B8LA 1YX8A 3DVEA 1BR1B 1LA0A 3NSLA 3B7AA 1F70A 4FTGA 2CT9A 2MHHA 1DTLA 3R1OA 2ERBA 5HKYA 1G8IA 1DELA 2I94A 1Q80A 2M97A 3FS7A 3L4LA 4I5JA 2GV5A 1XFUO 4XJKA 2FOTA 3BFHA 1KQMC 4MZJA 4YBHB 2JNXA 1UHJA 3VRNA 3EK4A 1DEKA 2WCMA 4MRYA 4JQ0D 2F3ZA 1QIWA 3DVMA 1S5GY 3KO0A 1QASA 1N2DA 2WCJA 3PLFB 2LLSA 1SYMA 4XYNA 1BU3A 1RTP1 4N1GA 1DQEA 4C0KA 3ICBA 1RK9A 2K60A 4A4BA 1S5GZ 3OHMB 1ORGA 3CTNA 1LINA 2ZN8A 3S0AA 3S0DA 1OMRA 4JKTA 3S0FA 4M2QA 3IF7A 1QX7A 1FBVA 2F33A 2KFHA 4NDBA 1F54A 3M0WA 4DIRA 4OKHA 3I5HC 2D8NA 2LHIA 4HREE 3EKHA 2TN4A 4DRWA 3CABA 2MAZA 1G4YR 3WXAA 5BPJA 2BCAA 3BJHA 3TUYB 3PALA 2ZRTA 4F0ZB 1DJZA 1KFUL 2Y4QA 4YGDB 1EXRA 1OE9B 1V1GA 2JTZA 3BUWB 3SG5A 5KSZA 1SK6D 2KGBC 2RGIA 2EGDA 1L7ZA 4AQIA 1GGWA 1PULA 2L2EA 1BT6A 1ZUZA 2LE9B 3JTDB 1TRFA 2QEHA 1DT7B 2PRUA 1Y1UA 2K2FA 2ZNDA 3GK1A 2K8MB 3UNWA 1LA3A 1PRWA 2WCEA 2WC8A 2R2IA 2ZKMX 2LP3A 3KEVA 5EL2A 4ETOA 4BY5A 1BODA 2WNDA 4YGCB 3DVJA 4N1FA 3CZ1A 1CM4A 2F3YA 1A2XA 2V53A 5IBWA 1B9AA 1CDLA 2H61C 5FYXA 1NPQA 1SBJA 5J3XA 1QV0A 1M63B 1YUTA 3I5FB 4UPGA 3BXKA 4WQ2A 4GNKB 1FW4A 3ZNIA 4I5NB 1PVBA 1DF0B 1SCMC 1UHHA 3CR4X 3KPXA 1DJWA 2BCXA 2L5XB 3DXLA 1RROA 3B88A 3F45A 1J55A 1OOGA 2WCFA 1BLQA 1JF0A 2QEOA 1BG1A 1RECA 3Q8IA 3D73A 3FWBA 3WNXB 2LLTA 3I5GB 4INXA 4MZKA 1TWOA 5CPVA 3TS5B 2H61A 4N5XA 3RLZA 2KBMA 2M7NA 4GFTA 3TUYC 3SG6A 2KI6C 3D0YA 4MN0A 1FPWA 4MLWA 4HSZA 3D74A 5HLOA 2CXJA 3OB2B 3DD4A 4JD9A 2K7DA 3JVTC 1K9PA 1UHNA 1KSMA 1ZFSA 2L4IA 3KF9A 5I2OA 2BAPA 1EG4A 2I2RE 3CWGA 1XK4C 2Y5IA 2CTNA 1KSOA 3NSOA 3IQQA 3SS3A 3BUMB 5GQQC 1IGVA 1CNPA 2FCDA 2LV7A 1NUBA 1OQPA 1QVIY 1OZOA 2NCOA 4CFRA 3VRQA 1S6CA
chains in the Genus database with same CATH topology
2LCPA 1IG5A 1JUOA 2HF5A 1CDNA 1H8BA 4HRGA 1B7TZ 3GK2A 2BECA 3BQ3A 4MVFA 5JJGA 1FI6A 1C07A 2LP2A 5KU1A 2I7AA 1D1OA 3EK8A 1Y1XA 2LMUA 3KHEA 2NZ0A 1F4OA 1CMFA 5DKRA 1MHOA 2JC2A 3O6BA 1KK7Z 1DJXA 1BR4B 2WORA 3D0YB 1KK8B 4QJ4B 1DGVA 4GAOA 2VRGA 3VROA 1J7QA 4I5LB 1CLLA 1K8UA 2M1KB 2ZNEA 2JXLA 4JPZB 1QTXA 4P5OE 2JPTA 1AP4A 1QLSA 1J7RA 1OOJA 2LAPA 1KQMB 1BMOA 1IRJA 2CNPA 2M0RA 3NSKA 1XFXO 5CSNA 1IQ3A 2JZIA 4QJ3B 1VRKA 1XFWO 2KOTA 3QRXA 2NLNA 3AAKA 1X02A 1K95A 2KFGA 4JWQA 2WCBA 1TNWA 2JT0A 2LLUA 1YUSA 2JWWA 4DS7A 1DJGA 1CLBA 2HETA 3A8RA 1B4CA 2F2PA 1DMOA 2K7OA 1CKKA 2KI6D 2F8PA 2BBMA 3I5HB 3PM8A 4NDCA 3LCPC 4YI9A 1F71A 1YURA 2JRFA 1M31A 1B47A 4CLNA 4AQJA 1CFFA 2LANA 5AANA 1HQVA 2LVJA 1EL4A 5TNCA 1NCYA 3OX5A 1A75B 4M2OA 5CSIA 5ER4X 5G08A 5HLVA 3OB1B 1QV1A 3CGAA 1YR5A 1R6PA 2ZRSA 1WY9A 3A4UB 5CSFA 4YRUA 4CFQA 2LUCA 2BL0B 3FIAA 4YGBB 2LUXA 4MSPA 4YI8A 2KQYA 4CIDA 4ORAB 2KDHA 1SR6C 1AVSA 4DUQA 4WQ3A 2SASA 5AERA 2P6BB 1MXLC 1CMGA 4TNCA 1AJ4A 5KTYA 2AMIA 5D7FA 2KBIA 3LK0A 1A29A 1OMDA 3CLNA 1NIWA 1NP8A 1NYAA 1K90D 1TNXA 4GGNA 1YRTB 1AHRA 2JULA 1YVHA 3SIBA 1W7IB 2KNEA 1K94A 2KAXA 1A4PA 3BUOB 1SCMB 2KHNA 1ODBA 4MBEA 3WHTB 1PVAA 1QIVA 1JWDA 1QX5B 2GGMA 1WRKA 2LC5A 1RJVA 3PATA 2EC6B 2L0PA 4R1EA 2I18A 4USLA 2ISDA 2BBNA 2K7BA 1UHKA 1KFXS 4ORBB 3I5FC 2IS9A 4AOMA 1KK7Y 2Q4UA 1SY9A 3BOWA 2CBLA 1J1DA 5I2LA 3TDZA 2JT3A 4C0JA 1U5IB 3GK4X 3IQOA 2PMYA 4ICBA 5I2QA 1XYDA 1XK4A 5PALA 1JFJA 2LVIA 3EVVA 1NSHA 1XFVO 1YTZC 2EHBA 1NX0A 1SL9A 3OP0A 2B1UA 2BKHB 1MXEA 1K9UA 1Y1AA 1JFKA 2COLB 1TN4A 3PN7C 5HYDA 2OPOA 1ALWA 2OS8B 3D10A 3MSEB 3PFVA 3GOFA 2FJUB 1S26D 1WDCB 1N65A 1GGZA 1TNPA 2KAYA 3SG2A 1PSBA 5ER5A 2MA2A 1GJYA 3TZ1A 5HKWA 1QATA 2K0JA 2PASA 1AJ5A 4NDDA 4U8DA 3K21A 4GUKA 2M9GA 1NWDA 1KFUS 2L51A 1BOCA 1JF2A 5K89A 1QXPA 2MLFC 1J7PA 1GQMA 3SG3A 2FCEA 4Q04A 1JSAA 3CS1A 2MBXA 4L9MA 2KYFA 3RM1A 4CPVA 1DVIA 2HPSA 2SCPA 4PHKA 1OSAA 1ZOTB 3DF0A 4MEWA 1CB1A 1WRZA 1FF1A 3I5IB 4WRIA 1RFJA 2M3WA 3DVKA 1B1GA 3AAJA 2LMVA 2M1UA 3VRPA 5DKQA 1K93D 3O2PA 3C1VA 3CZTX 1V1FA 3LK1A 4PALA 1DGUA 2KI4B 4BY4A 1CDPA 1WLZA 4PHJA 4MZLA 3SJSA 2OTGB 2JQ6A 1M45A 1NX2A 1SMGA 1IQ5A 2LNKA 5I8NA 3CR5X 1YVLA 2AAOA 3I5GC 2OS8C 1AUIB 3TS5C 1NX3A 1AK8A 1TIZA 5B8IB 2E30A 1S1EA 4ORCB 1K96A 1CTRA 1B8CA 1BJFA 2M49B 1WLMA 3SG7A 2LVVA 1OMVA 2JU0A 4HRHA 2KAVA 1QX2A 1KWOC 2M8UA 2AUCA 2O60A 3VGOA 3SG4A 1F8HA 2L4HA 1S36A 1IJ6A 1W7JB 1A75A 2M7LA 2HQ8A 1U5IA 4M2PA 1UWOA 2QACA 1YUUA 2ZFDA 3BOWB 1KCYA 1SPYA 4GPLB 1M46A 1MF8B 2JXCA 2JTTA 2LMTA 1ZACA 2NCPA 4OV2A 3OX6A 1SL8A 3TDIA 1N0YA 1LVCD 3AKBA 3BUNB 2F2OA 4P2YB 2KGRA 1S6IA 2QPTA 4D1EA 1H4BA 1C7WA 1SCVA 4C0LA 1HT9A 1B7TY 1DJYA 3AKAA 5AFPA 5D69A 3EVRA 1CDMA 2EC6C 1K9KA 1QLKA 1G33A 2PSRA 2PVBA 1LKJA 3BYAA 4A4CA 2K2AA 2GGZA 1TNQA 2CCMA 2Y1MA 4OR9B 2Q91A 1UURA 1RWYA 1YX7A 1TTXA 1KWOB 1PSRA 2KSPA 4OCIA 4QJ5B 2JNFA 4PDZA 5CSJA 4YGAA 1XA5A 3HX4A 1IH0A 2A4JA 1EJ3A 2Y1NA 2JOJA 3LLEA 3JTDC 4OVNF 4PCWA 4FQOA 3HCMA 3EVUA 1ZMZA 2G9BA 3LL8B 2LM5A 2G2BA 1DJHA 3FWCA 1EH2A 5AXIA 1UP5A 2L50A 1KFXL 3BUXB 3CR2A 3H4SE 4I5KA 4XJKB 1QVIZ 1CFCA 4DCKA 4GBAA 3TDUA 1XFZO 1TCFA 1TOPA 1WRLA 2BCBA 1PK0D 2BE4A 3PSRA 1TCOB 1XFYO 3DF0B 1FI5A 1MQ1A 1Y0VH 2HQWA 1SL7A 4PHMA 2MLEC 1BF5A 3WHUB 5AEQA 4GGFC 1WDCC 3NXAA 1B8RA 2LHLA 1MR8A 1J1EA 2M29A 2MJWB 1IJ5A 2H2KA 1K2HA 3O78A 1JBAA 2ZN9A 4PE4A 3O4YA 1CFDA 3SIAA 3PN7B 1SW8A 1IKUA 3EK7A 1L2OB 5DKNA 4NQGA 1UUSA 1Y6WA 1EG3A 3ZWHA 2BKIB 2O5GA 1SR6B 1QS7A 2KFFA 1F55A 1SRAA 4PE0A 1JC2A 1UHIA 5HKZA 3JVTB 4YGEB 2MRDA 4PE1A 2PALA 3NSIA 1J7OA 2BL0C 5F6TA 1NCZA 1NCXA 1DF0A 2NXQA 1A03A 2K7CA 5JOLA 1YRUB 4PE7A 1PALA 1C7VA 2K61A 2KI4C 1KQVA 4GGFA 4E68A 2E6WA 1KK8C 4ZCVA 1F4QA 1DJIA 1ALVA 1NX1A 1MUXA 1XVJA 3I5IC 1S3PA 4PHNA 4ZCUA 2BE6A 3VRRA 1S6JA 4MRXA 2LVKA 1SKTA 1XO5A 1SNLA 3EKJA 1CM1A 2DOQA 1R2UA 2JT8A 1CLMA 1LXFC 2KYCA 1QJTA 4IL1A 1M39A 2WOSA 2OTGC 1CFPA 3E3RA 1IWQA 1OZSA 1MWNA 1E8AA 1L2OC 2KQ6A 2L98A 1B8LA 1YX8A 3DVEA 1BR1B 1LA0A 3NSLA 1F70A 4FTGA 2CT9A 2MHHA 1DTLA 5HKYA 1G8IA 2I94A 1Q80A 2M97A 3FS7A 4XJKA 4I5JA 2GV5A 1XFUO 2FOTA 4YBHB 1KQMC 4MZJA 2JNXA 1UHJA 3VRNA 3EK4A 4MRYA 4JQ0D 2F3ZA 1QIWA 3DVMA 1S5GY 3KO0A 1QASA 1N2DA 3PLFB 2LLSA 1SYMA 4XYNA 1BU3A 1RTP1 4N1GA 4C0KA 3ICBA 1RK9A 4A4BA 1S5GZ 3OHMB 3CTNA 1LINA 2ZN8A 1OMRA 4M2QA 3IF7A 1QX7A 1FBVA 2F33A 2KFHA 4NDBA 1F54A 3M0WA 4DIRA 4OKHA 3I5HC 2D8NA 2LHIA 4HREE 3EKHA 2TN4A 2MAZA 1G4YR 3WXAA 5BPJA 2BCAA 3TUYB 3PALA 2ZRTA 4F0ZB 1DJZA 1KFUL 2Y4QA 4YGDB 1EXRA 1OE9B 1V1GA 2JTZA 3BUWB 3SG5A 5KSZA 1SK6D 2KGBC 2RGIA 2EGDA 1L7ZA 4AQIA 1GGWA 1PULA 2L2EA 1BT6A 1ZUZA 2LE9B 3JTDB 1TRFA 1DT7B 2PRUA 1Y1UA 2K2FA 2ZNDA 3GK1A 2K8MB 1LA3A 1PRWA 2WCEA 2WC8A 2R2IA 2ZKMX 2LP3A 3KEVA 4ETOA 1BODA 4BY5A 2WNDA 4YGCB 3DVJA 4N1FA 1CM4A 2F3YA 1A2XA 2V53A 5IBWA 1B9AA 1CDLA 2H61C 5FYXA 1NPQA 1SBJA 5J3XA 1QV0A 1M63B 1YUTA 3I5FB 4UPGA 3BXKA 4WQ2A 4GNKB 1FW4A 3ZNIA 4I5NB 1PVBA 1DF0B 1SCMC 1UHHA 3CR4X 3KPXA 1DJWA 2BCXA 2L5XB 1RROA 3F45A 1J55A 1BLQA 2WCFA 1JF0A 1BG1A 1RECA 4DRWA 3FWBA 3WNXB 2LLTA 3I5GB 4MZKA 5CPVA 3TS5B 2H61A 4N5XA 3RLZA 2KBMA 2M7NA 4GFTA 3TUYC 3SG6A 2KI6C 3D0YA 4MN0A 1FPWA 4MLWA 4HSZA 5HLOA 2CXJA 3OB2B 3DD4A 2K7DA 3JVTC 1K9PA 1UHNA 1KSMA 1ZFSA 2L4IA 3KF9A 5I2OA 1EG4A 2I2RE 3CWGA 1XK4C 2Y5IA 2CTNA 1KSOA 3NSOA 3IQQA 3BUMB 5GQQC 1IGVA 1CNPA 2FCDA 2LV7A 1NUBA 1OQPA 1QVIY 1OZOA 2NCOA 4CFRA 3VRQA 1S6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCP A;  1IG5 A;  1JUO A;  2HF5 A;  1CDN A;  1H8B A;  4HRG A;  1B7T Z;  3GK2 A;  2BEC A;  3BQ3 A;  4MVF A;  5JJG A;  1FI6 A;  1C07 A;  2LP2 A;  5KU1 A;  2I7A A;  1D1O A;  3EK8 A;  1Y1X A;  2LMU A;  3KHE A;  2NZ0 A;  1F4O A;  1CMF A;  5DKR A;  1MHO A;  2JC2 A;  3O6B A;  1KK7 Z;  1DJX A;  1BR4 B;  2WOR A;  3D0Y B;  1KK8 B;  4QJ4 B;  1DGV A;  4GAO A;  2VRG A;  3VRO A;  1J7Q A;  4I5L B;  1CLL A;  1K8U A;  2M1K B;  2ZNE A;  2JXL A;  4JPZ B;  1QTX A;  4P5O E;  2JPT A;  1AP4 A;  1QLS A;  1J7R A;  1OOJ A;  2LAP A;  1KQM B;  1BMO A;  1IRJ A;  2CNP A;  2M0R A;  3NSK A;  1XFX O;  5CSN A;  1IQ3 A;  2JZI A;  4QJ3 B;  1VRK A;  1XFW O;  2KOT A;  3QRX A;  2NLN A;  3AAK A;  1X02 A;  1K95 A;  2KFG A;  4JWQ A;  2WCB A;  1TNW A;  2JT0 A;  2LLU A;  1YUS A;  2JWW A;  4DS7 A;  1DJG A;  1CLB A;  2HET A;  3A8R A;  1B4C A;  2F2P A;  1DMO A;  2K7O A;  1CKK A;  2KI6 D;  2F8P A;  2BBM A;  3I5H B;  3PM8 A;  4NDC A;  3LCP C;  4YI9 A;  1F71 A;  1YUR A;  2JRF A;  1M31 A;  1B47 A;  4CLN A;  4AQJ A;  1CFF A;  2LAN A;  5AAN A;  1HQV A;  2LVJ A;  1EL4 A;  5TNC A;  1NCY A;  3OX5 A;  1A75 B;  4M2O A;  5CSI A;  5ER4 X;  5G08 A;  5HLV A;  3OB1 B;  1QV1 A;  3CGA A;  1YR5 A;  1R6P A;  2ZRS A;  1WY9 A;  3A4U B;  5CSF A;  4YRU A;  4CFQ A;  2LUC A;  2BL0 B;  3FIA A;  4YGB B;  2LUX A;  4MSP A;  4YI8 A;  2KQY A;  4CID A;  4ORA B;  2KDH A;  1SR6 C;  1AVS A;  4DUQ A;  4WQ3 A;  2SAS A;  5AER A;  2P6B B;  1MXL C;  1CMG A;  4TNC A;  1AJ4 A;  5KTY A;  2AMI A;  5D7F A;  2KBI A;  3LK0 A;  1A29 A;  1OMD A;  3CLN A;  1NIW A;  1NP8 A;  1NYA A;  1K90 D;  1TNX A;  4GGN A;  1YRT B;  1AHR A;  2JUL A;  1YVH A;  3SIB A;  1W7I B;  2KNE A;  1K94 A;  2KAX A;  1A4P A;  3BUO B;  1SCM B;  2KHN A;  1ODB A;  4MBE A;  3WHT B;  1PVA A;  1QIV A;  1JWD A;  1QX5 B;  2GGM A;  1WRK A;  2LC5 A;  1RJV A;  3PAT A;  2EC6 B;  2L0P A;  4R1E A;  2I18 A;  4USL A;  2ISD A;  2BBN A;  2K7B A;  1UHK A;  1KFX S;  4ORB B;  3I5F C;  2IS9 A;  4AOM A;  1KK7 Y;  2Q4U A;  1SY9 A;  3BOW A;  2CBL A;  1J1D A;  5I2L A;  3TDZ A;  2JT3 A;  4C0J A;  1U5I B;  3GK4 X;  3IQO A;  2PMY A;  4ICB A;  5I2Q A;  1XYD A;  1XK4 A;  5PAL A;  1JFJ A;  2LVI A;  3EVV A;  1NSH A;  1XFV O;  1YTZ C;  2EHB A;  1NX0 A;  1SL9 A;  3OP0 A;  2B1U A;  2BKH B;  1MXE A;  1K9U A;  1Y1A A;  1JFK A;  2COL B;  1TN4 A;  3PN7 C;  5HYD A;  2OPO A;  1ALW A;  2OS8 B;  3D10 A;  3MSE B;  3PFV A;  3GOF A;  2FJU B;  1S26 D;  1WDC B;  1N65 A;  1GGZ A;  1TNP A;  2KAY A;  3SG2 A;  1PSB A;  5ER5 A;  2MA2 A;  1GJY A;  3TZ1 A;  5HKW A;  1QAT A;  2K0J A;  2PAS A;  1AJ5 A;  4NDD A;  4U8D A;  3K21 A;  4GUK A;  2M9G A;  1NWD A;  1KFU S;  2L51 A;  1BOC A;  1JF2 A;  5K89 A;  1QXP A;  2MLF C;  1J7P A;  1GQM A;  3SG3 A;  2FCE A;  4Q04 A;  1JSA A;  3CS1 A;  2MBX A;  4L9M A;  2KYF A;  3RM1 A;  4CPV A;  1DVI A;  2HPS A;  2SCP A;  4PHK A;  1OSA A;  1ZOT B;  3DF0 A;  4MEW A;  1CB1 A;  1WRZ A;  1FF1 A;  3I5I B;  4WRI A;  1RFJ A;  2M3W A;  3DVK A;  1B1G A;  3AAJ A;  2LMV A;  2M1U A;  3VRP A;  5DKQ A;  1K93 D;  3O2P A;  3C1V A;  3CZT X;  1V1F A;  3LK1 A;  4PAL A;  1DGU A;  2KI4 B;  4BY4 A;  1CDP A;  1WLZ A;  4PHJ A;  4MZL A;  3SJS A;  2OTG B;  2JQ6 A;  1M45 A;  1NX2 A;  1SMG A;  1IQ5 A;  2LNK A;  5I8N A;  3CR5 X;  1YVL A;  2AAO A;  3I5G C;  2OS8 C;  1AUI B;  3TS5 C;  1NX3 A;  1AK8 A;  1TIZ A;  5B8I B;  2E30 A;  1S1E A;  4ORC B;  1K96 A;  1CTR A;  1B8C A;  1BJF A;  2M49 B;  1WLM A;  3SG7 A;  2LVV A;  1OMV A;  2JU0 A;  4HRH A;  2KAV A;  1QX2 A;  1KWO C;  2M8U A;  2AUC A;  2O60 A;  3VGO A;  3SG4 A;  1F8H A;  2L4H A;  1S36 A;  1IJ6 A;  1W7J B;  1A75 A;  2M7L A;  2HQ8 A;  1U5I A;  4M2P A;  1UWO A;  2QAC A;  1YUU A;  2ZFD A;  3BOW B;  1KCY A;  1SPY A;  4GPL B;  1M46 A;  1MF8 B;  2JXC A;  2JTT A;  2LMT A;  1ZAC A;  2NCP A;  4OV2 A;  3OX6 A;  1SL8 A;  3TDI A;  1N0Y A;  1LVC D;  3AKB A;  3BUN B;  2F2O A;  4P2Y B;  2KGR A;  1S6I A;  2QPT A;  4D1E A;  1H4B A;  1C7W A;  1SCV A;  4C0L A;  1HT9 A;  1B7T Y;  1DJY A;  3AKA A;  5AFP A;  5D69 A;  3EVR A;  1CDM A;  2EC6 C;  1K9K A;  1QLK A;  1G33 A;  2PSR A;  2PVB A;  1LKJ A;  3BYA A;  4A4C A;  2K2A A;  2GGZ A;  1TNQ A;  2CCM A;  2Y1M A;  4OR9 B;  2Q91 A;  1UUR A;  1RWY A;  1YX7 A;  1TTX A;  1KWO B;  1PSR A;  2KSP A;  4OCI A;  4QJ5 B;  2JNF A;  4PDZ A;  5CSJ A;  4YGA A;  1XA5 A;  3HX4 A;  1IH0 A;  2A4J A;  1EJ3 A;  2Y1N A;  2JOJ A;  3LLE A;  3JTD C;  4OVN F;  4PCW A;  4FQO A;  3HCM A;  3EVU A;  1ZMZ A;  2G9B A;  3LL8 B;  2LM5 A;  2G2B A;  1DJH A;  3FWC A;  1EH2 A;  5AXI A;  1UP5 A;  2L50 A;  1KFX L;  3BUX B;  3CR2 A;  3H4S E;  4I5K A;  4XJK B;  1QVI Z;  1CFC A;  4DCK A;  4GBA A;  3TDU A;  1XFZ O;  1TCF A;  1TOP A;  1WRL A;  2BCB A;  1PK0 D;  2BE4 A;  3PSR A;  1TCO B;  1XFY O;  3DF0 B;  1FI5 A;  1MQ1 A;  1Y0V H;  2HQW A;  1SL7 A;  4PHM A;  2MLE C;  1BF5 A;  3WHU B;  5AEQ A;  4GGF C;  1WDC C;  3NXA A;  1B8R A;  2LHL A;  1MR8 A;  1J1E A;  2M29 A;  2MJW B;  1IJ5 A;  2H2K A;  1K2H A;  3O78 A;  1JBA A;  2ZN9 A;  4PE4 A;  3O4Y A;  1CFD A;  3SIA A;  3PN7 B;  1SW8 A;  1IKU A;  3EK7 A;  1L2O B;  5DKN A;  4NQG A;  1UUS A;  1Y6W A;  1EG3 A;  3ZWH A;  2BKI B;  2O5G A;  1SR6 B;  1QS7 A;  2KFF A;  1F55 A;  1SRA A;  4PE0 A;  1JC2 A;  1UHI A;  5HKZ A;  3JVT B;  4YGE B;  2MRD A;  4PE1 A;  2PAL A;  3NSI A;  1J7O A;  2BL0 C;  5F6T A;  1NCZ A;  1NCX A;  1DF0 A;  2NXQ A;  1A03 A;  2K7C A;  5JOL A;  1YRU B;  4PE7 A;  1PAL A;  1C7V A;  2K61 A;  2KI4 C;  1KQV A;  4GGF A;  4E68 A;  2E6W A;  1KK8 C;  4ZCV A;  1F4Q A;  1DJI A;  1ALV A;  1NX1 A;  1MUX A;  1XVJ A;  3I5I C;  1S3P A;  4PHN A;  4ZCU A;  2BE6 A;  3VRR A;  1S6J A;  4MRX A;  2LVK A;  1SKT A;  1XO5 A;  1SNL A;  3EKJ A;  1CM1 A;  2DOQ A;  1R2U A;  2JT8 A;  1CLM A;  1LXF C;  2KYC A;  1QJT A;  4IL1 A;  1M39 A;  2WOS A;  2OTG C;  1CFP A;  3E3R A;  1IWQ A;  1OZS A;  1MWN A;  1E8A A;  1L2O C;  2KQ6 A;  2L98 A;  1B8L A;  1YX8 A;  3DVE A;  1BR1 B;  1LA0 A;  3NSL A;  1F70 A;  4FTG A;  2CT9 A;  2MHH A;  1DTL A;  5HKY A;  1G8I A;  2I94 A;  1Q80 A;  2M97 A;  3FS7 A;  4XJK A;  4I5J A;  2GV5 A;  1XFU O;  2FOT A;  4YBH B;  1KQM C;  4MZJ A;  2JNX A;  1UHJ A;  3VRN A;  3EK4 A;  4MRY A;  4JQ0 D;  2F3Z A;  1QIW A;  3DVM A;  1S5G Y;  3KO0 A;  1QAS A;  1N2D A;  3PLF B;  2LLS A;  1SYM A;  4XYN A;  1BU3 A;  1RTP 1;  4N1G A;  4C0K A;  3ICB A;  1RK9 A;  4A4B A;  1S5G Z;  3OHM B;  3CTN A;  1LIN A;  2ZN8 A;  1OMR A;  4M2Q A;  3IF7 A;  1QX7 A;  1FBV A;  2F33 A;  2KFH A;  4NDB A;  1F54 A;  3M0W A;  4DIR A;  4OKH A;  3I5H C;  2D8N A;  2LHI A;  4HRE E;  3EKH A;  2TN4 A;  2MAZ A;  1G4Y R;  3WXA A;  5BPJ A;  2BCA A;  3TUY B;  3PAL A;  2ZRT A;  4F0Z B;  1DJZ A;  1KFU L;  2Y4Q A;  4YGD B;  1EXR A;  1OE9 B;  1V1G A;  2JTZ A;  3BUW B;  3SG5 A;  5KSZ A;  1SK6 D;  2KGB C;  2RGI A;  2EGD A;  1L7Z A;  4AQI A;  1GGW A;  1PUL A;  2L2E A;  1BT6 A;  1ZUZ A;  2LE9 B;  3JTD B;  1TRF A;  1DT7 B;  2PRU A;  1Y1U A;  2K2F A;  2ZND A;  3GK1 A;  2K8M B;  1LA3 A;  1PRW A;  2WCE A;  2WC8 A;  2R2I A;  2ZKM X;  2LP3 A;  3KEV A;  4ETO A;  1BOD A;  4BY5 A;  2WND A;  4YGC B;  3DVJ A;  4N1F A;  1CM4 A;  2F3Y A;  1A2X A;  2V53 A;  5IBW A;  1B9A A;  1CDL A;  2H61 C;  5FYX A;  1NPQ A;  1SBJ A;  5J3X A;  1QV0 A;  1M63 B;  1YUT A;  3I5F B;  4UPG A;  3BXK A;  4WQ2 A;  4GNK B;  1FW4 A;  3ZNI A;  4I5N B;  1PVB A;  1DF0 B;  1SCM C;  1UHH A;  3CR4 X;  3KPX A;  1DJW A;  2BCX A;  2L5X B;  1RRO A;  3F45 A;  1J55 A;  1BLQ A;  2WCF A;  1JF0 A;  1BG1 A;  1REC A;  4DRW A;  3FWB A;  3WNX B;  2LLT A;  3I5G B;  4MZK A;  5CPV A;  3TS5 B;  2H61 A;  4N5X A;  3RLZ A;  2KBM A;  2M7N A;  4GFT A;  3TUY C;  3SG6 A;  2KI6 C;  3D0Y A;  4MN0 A;  1FPW A;  4MLW A;  4HSZ A;  5HLO A;  2CXJ A;  3OB2 B;  3DD4 A;  2K7D A;  3JVT C;  1K9P A;  1UHN A;  1KSM A;  1ZFS A;  2L4I A;  3KF9 A;  5I2O A;  1EG4 A;  2I2R E;  3CWG A;  1XK4 C;  2Y5I A;  2CTN A;  1KSO A;  3NSO A;  3IQQ A;  3BUM B;  5GQQ C;  1IGV A;  1CNP A;  2FCD A;  2LV7 A;  1NUB A;  1OQP A;  1QVI Y;  1OZO A;  2NCO A;  4CFR A;  3VRQ A;  1S6C A; 
#chains in the Genus database with same CATH topology
 2LCP A;  1IG5 A;  1JUO A;  3S0B A;  2HF5 A;  1CDN A;  1H8B A;  4HRG A;  1B7T Z;  3GK2 A;  2BEC A;  3BQ3 A;  4MVF A;  5JJG A;  1FI6 A;  1C07 A;  2LP2 A;  5KU1 A;  2I7A A;  2WCL A;  1D1O A;  3EK8 A;  1Y1X A;  2LMU A;  3KHE A;  2NZ0 A;  1F4O A;  1CMF A;  5DKR A;  1MHO A;  2JC2 A;  3O6B A;  1KK7 Z;  1DJX A;  1BR4 B;  2WOR A;  3CZ2 A;  3D0Y B;  1KK8 B;  4QJ4 B;  1DGV A;  4GAO A;  2VRG A;  3VRO A;  3D77 A;  1J7Q A;  4I5L B;  1CLL A;  1K8U A;  2M1K B;  2GTE A;  2ZNE A;  2JXL A;  4JPZ B;  1QTX A;  4P5O E;  2JPT A;  1AP4 A;  1QLS A;  1J7R A;  3CZ0 A;  1OOJ A;  2LAP A;  1KQM B;  1BMO A;  1IRJ A;  2CNP A;  2M0R A;  3NSK A;  1XFX O;  5CSN A;  1IQ3 A;  2JZI A;  4QJ3 B;  1VRK A;  1XFW O;  2KOT A;  3QRX A;  2NLN A;  3AAK A;  5FI6 A;  1X02 A;  1K95 A;  2KFG A;  4JWQ A;  4INW A;  2WCB A;  1TNW A;  2JT0 A;  2LLU A;  1YUS A;  2JWW A;  4DS7 A;  1DJG A;  1CLB A;  2HET A;  3A8R A;  3FE8 A;  1Z4H A;  1B4C A;  2F2P A;  1DMO A;  5DIC A;  1OOF A;  2K7O A;  2L2C A;  1CKK A;  2KI6 D;  3OGN A;  4FQT A;  2F8P A;  2BBM A;  3I5H B;  3PM8 A;  4NDC A;  3LCP C;  4OZD A;  4YI9 A;  1F71 A;  5D3O A;  1Z2C B;  1YUR A;  1OW4 A;  3DZT A;  2JRF A;  1M31 A;  1B47 A;  4CLN A;  4AQJ A;  3S0G A;  1CFF A;  1OOI X;  2LAN A;  5AAN A;  2WC6 A;  1HQV A;  2LVJ A;  1EL4 A;  5TNC A;  1NCY A;  3OX5 A;  1A75 B;  4M2O A;  5CSI A;  5ER4 X;  5G08 A;  1P28 A;  5HLV A;  3OB1 B;  1QV1 A;  3CGA A;  3K1E A;  1YR5 A;  1R6P A;  2ZRS A;  1WY9 A;  2QEV A;  3A4U B;  3L4A A;  5CSF A;  4YRU A;  4CFQ A;  2LUC A;  2BL0 B;  3FIA A;  4YGB B;  2LUX A;  4MSP A;  3DY9 A;  1GM0 A;  4YI8 A;  2KQY A;  4CID A;  4ORA B;  2KDH A;  1SR6 C;  1AVS A;  3N7H A;  4DUQ A;  4WQ3 A;  3V2L A;  2SAS A;  5AER A;  2P6B B;  3S0E A;  1MXL C;  1CMG A;  4TNC A;  1AJ4 A;  5KTY A;  2AMI A;  3D76 A;  2H8V A;  2KBI A;  3LK0 A;  5D7F A;  1A29 A;  1OMD A;  3CLN A;  1NIW A;  1NP8 A;  1NYA A;  1K90 D;  1TNX A;  2KPH A;  1YRT B;  4GGN A;  1AHR A;  2JUL A;  1YVH A;  3SIB A;  1W7I B;  2KNE A;  1K94 A;  2KAX A;  1A4P A;  2P71 A;  3BUO B;  1SCM B;  2WCH A;  2KHN A;  1ODB A;  4MBE A;  3WHT B;  1PVA A;  1QIV A;  1JWD A;  1QX5 B;  1DC1 A;  2GGM A;  1WRK A;  2LC5 A;  1RJV A;  3PAT A;  2EC6 B;  2L0P A;  4R1E A;  2I18 A;  2QEB A;  4USL A;  2ISD A;  2BBN A;  2K7B A;  1UHK A;  1KFX S;  4ORB B;  3NHI A;  3I5F C;  2IS9 A;  5FI7 A;  4AOM A;  1KK7 Y;  3DYE A;  2Q4U A;  1SY9 A;  3FE6 A;  3BOW A;  2CBL A;  1J1D A;  5I2L A;  3TDZ A;  2JT3 A;  4C0J A;  2L5Y A;  1U5I B;  3GK4 X;  1T14 A;  3IQO A;  2PMY A;  1XFR A;  4ICB A;  5I2Q A;  1XYD A;  1XK4 A;  5PAL A;  1JFJ A;  2LVI A;  3EVV A;  1NSH A;  1XFV O;  2PYQ A;  1YTZ C;  2EHB A;  2KLD A;  3PM2 A;  1NX0 A;  1SL9 A;  1C3Z A;  3OP0 A;  2B1U A;  2BKH B;  1MXE A;  1K9U A;  1Y1A A;  1JFK A;  2COL B;  1TN4 A;  3PN7 C;  5HYD A;  2OPO A;  1ALW A;  2OS8 B;  3D10 A;  3MSE B;  3PFV A;  3GOF A;  2FJU B;  1S26 D;  1WDC B;  1N65 A;  1GGZ A;  1TNP A;  2KAY A;  3SG2 A;  1PSB A;  5ER5 A;  3RZS A;  2MA2 A;  1GJY A;  3TZ1 A;  5HKW A;  1QAT A;  2K0J A;  2PAS A;  1AJ5 A;  4NDD A;  4U8D A;  3K21 A;  4KYN A;  4GUK A;  2M9G A;  1NWD A;  5HL1 A;  1KFU S;  2L51 A;  1BOC A;  1JF2 A;  5K89 A;  1QXP A;  2MLF C;  1J7P A;  1GQM A;  4IJ7 A;  3SG3 A;  2FCE A;  4Q04 A;  1JSA A;  3CS1 A;  2MBX A;  4L9M A;  2KYF A;  3RM1 A;  4CPV A;  1DVI A;  2HPS A;  2SCP A;  4PHK A;  1OSA A;  1ZOT B;  3DF0 A;  4MEW A;  1CB1 A;  1W9Z A;  1WRZ A;  1FF1 A;  3I5I B;  4WRI A;  1RFJ A;  2M3W A;  3DVK A;  1B1G A;  3AAJ A;  2LMV A;  2M1U A;  3VRP A;  5DKQ A;  1K93 D;  3O2P A;  3C1V A;  3CZT X;  1V1F A;  3LK1 A;  4PAL A;  3R1V A;  1TUZ A;  3BFB A;  1DGU A;  2KI4 B;  4BY4 A;  1CDP A;  3FE9 A;  1WLZ A;  4PHJ A;  4MZL A;  3SJS A;  3NGV A;  2OTG B;  2JQ6 A;  1M45 A;  3QME A;  1NX2 A;  1SMG A;  1IQ5 A;  2LNK A;  3O4X A;  3CR5 X;  5I8N A;  1YVL A;  2AAO A;  3I5G C;  2OS8 C;  1AUI B;  3TS5 C;  1NX3 A;  1AK8 A;  1TIZ A;  5B8I B;  2E30 A;  3D75 A;  1S1E A;  4ORC B;  1K96 A;  1CTR A;  1B8C A;  1BJF A;  2M49 B;  1WLM A;  3SG7 A;  2LVV A;  1OMV A;  4F7F A;  2JU0 A;  4HRH A;  2KAV A;  1QX2 A;  3B87 A;  1KWO C;  2M8U A;  2AUC A;  2O60 A;  3NHT A;  3VGO A;  3SG4 A;  2FJY A;  1F8H A;  2L4H A;  1S36 A;  1IJ6 A;  1W7J B;  1A75 A;  2M7L A;  2HQ8 A;  2YGU A;  1U5I A;  4M2P A;  1UWO A;  2QAC A;  1YUU A;  2ZFD A;  3BOW B;  1KCY A;  1SPY A;  4GPL B;  3PJI A;  1M46 A;  1MF8 B;  2JXC A;  2JTT A;  2LMT A;  2P70 A;  1ZAC A;  2NCP A;  4OV2 A;  3OX6 A;  1SL8 A;  3TDI A;  1N0Y A;  1LVC D;  3AKB A;  3BUN B;  2F2O A;  4P2Y B;  1LS8 A;  2PQL A;  2BNX A;  2KGR A;  1S6I A;  2QPT A;  4D1E A;  1H4B A;  1C7W A;  1SCV A;  4C0L A;  1HT9 A;  1B7T Y;  1DJY A;  3AKA A;  5AFP A;  5D69 A;  3EVR A;  1CDM A;  2EC6 C;  1K9K A;  1QLK A;  3IVT A;  1G33 A;  2PSR A;  2PVB A;  1LKJ A;  3B86 A;  3BYA A;  2K2A A;  4A4C A;  2GGZ A;  1TNQ A;  2CCM A;  1TUJ A;  2Y1M A;  4OR9 B;  2Q91 A;  1UUR A;  3SS4 A;  1RWY A;  1YX7 A;  2QDI A;  1TTX A;  5FI2 A;  1KWO B;  3VB1 A;  1PSR A;  2KSP A;  4OCI A;  4QJ5 B;  2JNF A;  4PDZ A;  5CSJ A;  3R1P A;  4YGA A;  1XA5 A;  3HX4 A;  1IH0 A;  2A4J A;  1EJ3 A;  3D78 A;  1QWV A;  2Y1N A;  2JOJ A;  3LLE A;  3JTD C;  4OVN F;  4PCW A;  4FQO A;  3HCM A;  3EVU A;  1ZMZ A;  2G9B A;  3LL8 B;  2LM5 A;  2G2B A;  1DJH A;  1SSE B;  3BFA A;  3FWC A;  1EH2 A;  5AXI A;  1UP5 A;  2L50 A;  1KFX L;  3BUX B;  3CR2 A;  3H4S E;  4I5K A;  4XJK B;  1QVI Z;  1CFC A;  4DCK A;  4GBA A;  3TDU A;  1XFZ O;  1TCF A;  1TOP A;  1WRL A;  2BCB A;  1PK0 D;  2BE4 A;  3PSR A;  1TCO B;  1XFY O;  3DF0 B;  1FI5 A;  3SS5 A;  1MQ1 A;  1Y0V H;  2HQW A;  1SL7 A;  4PHM A;  2MLE C;  1BF5 A;  3WHU B;  5AEQ A;  4GGF C;  1WDC C;  3NXA A;  1B8R A;  2LHL A;  1MR8 A;  1J1E A;  2M29 A;  2MJW B;  1IJ5 A;  2H2K A;  3R72 A;  1K2H A;  3O78 A;  1JBA A;  2ZN9 A;  4PE4 A;  3O4Y A;  1CFD A;  3SIA A;  3PN7 B;  1SW8 A;  1IKU A;  3EK7 A;  1L2O B;  2WCK A;  5DKN A;  4NQG A;  1UUS A;  1Y6W A;  1EG3 A;  3ZWH A;  2BKI B;  2O5G A;  1SR6 B;  1QS7 A;  3EG5 B;  2KFF A;  1F55 A;  3B6X A;  1SRA A;  4PE0 A;  4PT1 A;  1JC2 A;  1UHI A;  5HKZ A;  3JVT B;  4YGE B;  2MRD A;  2JPO A;  4PE1 A;  2PAL A;  3NSI A;  1J7O A;  2BL0 C;  3CDN A;  3L47 A;  5F6T A;  1NCZ A;  1NCX A;  1DF0 A;  2NXQ A;  1A03 A;  2K7C A;  5JOL A;  1YRU B;  1IIO A;  4PE7 A;  3OBV A;  1PAL A;  1C7V A;  2K61 A;  2KI4 C;  1KQV A;  1OOH A;  4GGF A;  4E68 A;  2E6W A;  1KK8 C;  4ZCV A;  1F4Q A;  5I94 A;  1DJI A;  1ALV A;  2KLE A;  1NX1 A;  1MUX A;  1XVJ A;  3I5I C;  1S3P A;  4PHN A;  4ZCU A;  2BE6 A;  3VRR A;  1S6J A;  4MRX A;  2LVK A;  1SKT A;  1XO5 A;  1SNL A;  3EKJ A;  1CM1 A;  3CYZ A;  2DOQ A;  1R2U A;  2JT8 A;  3UO9 A;  1CLM A;  1LXF C;  2KYC A;  1QJT A;  2WC5 A;  4IL1 A;  1M39 A;  2WOS A;  2OTG C;  1CFP A;  3E3R A;  1IWQ A;  1OZS A;  1MWN A;  1E8A A;  1L2O C;  2KQ6 A;  2L98 A;  1C3Y A;  1B8L A;  1YX8 A;  3DVE A;  1BR1 B;  1LA0 A;  3NSL A;  3B7A A;  1F70 A;  4FTG A;  2CT9 A;  2MHH A;  1DTL A;  3R1O A;  2ERB A;  5HKY A;  1G8I A;  1DEL A;  2I94 A;  1Q80 A;  2M97 A;  3FS7 A;  3L4L A;  4I5J A;  2GV5 A;  1XFU O;  4XJK A;  2FOT A;  3BFH A;  1KQM C;  4MZJ A;  4YBH B;  2JNX A;  1UHJ A;  3VRN A;  3EK4 A;  1DEK A;  2WCM A;  4MRY A;  4JQ0 D;  2F3Z A;  1QIW A;  3DVM A;  1S5G Y;  3KO0 A;  1QAS A;  1N2D A;  2WCJ A;  3PLF B;  2LLS A;  1SYM A;  4XYN A;  1BU3 A;  1RTP 1;  4N1G A;  1DQE A;  4C0K A;  3ICB A;  1RK9 A;  2K60 A;  4A4B A;  1S5G Z;  3OHM B;  1ORG A;  3CTN A;  1LIN A;  2ZN8 A;  3S0A A;  3S0D A;  1OMR A;  4JKT A;  3S0F A;  4M2Q A;  3IF7 A;  1QX7 A;  1FBV A;  2F33 A;  2KFH A;  4NDB A;  1F54 A;  3M0W A;  4DIR A;  4OKH A;  3I5H C;  2D8N A;  2LHI A;  4HRE E;  3EKH A;  2TN4 A;  4DRW A;  3CAB A;  2MAZ A;  1G4Y R;  3WXA A;  5BPJ A;  2BCA A;  3BJH A;  3TUY B;  3PAL A;  2ZRT A;  4F0Z B;  1DJZ A;  1KFU L;  2Y4Q A;  4YGD B;  1EXR A;  1OE9 B;  1V1G A;  2JTZ A;  3BUW B;  3SG5 A;  5KSZ A;  1SK6 D;  2KGB C;  2RGI A;  2EGD A;  1L7Z A;  4AQI A;  1GGW A;  1PUL A;  2L2E A;  1BT6 A;  1ZUZ A;  2LE9 B;  3JTD B;  1TRF A;  2QEH A;  1DT7 B;  2PRU A;  1Y1U A;  2K2F A;  2ZND A;  3GK1 A;  2K8M B;  3UNW A;  1LA3 A;  1PRW A;  2WCE A;  2WC8 A;  2R2I A;  2ZKM X;  2LP3 A;  3KEV A;  5EL2 A;  4ETO A;  4BY5 A;  1BOD A;  2WND A;  4YGC B;  3DVJ A;  4N1F A;  3CZ1 A;  1CM4 A;  2F3Y A;  1A2X A;  2V53 A;  5IBW A;  1B9A A;  1CDL A;  2H61 C;  5FYX A;  1NPQ A;  1SBJ A;  5J3X A;  1QV0 A;  1M63 B;  1YUT A;  3I5F B;  4UPG A;  3BXK A;  4WQ2 A;  4GNK B;  1FW4 A;  3ZNI A;  4I5N B;  1PVB A;  1DF0 B;  1SCM C;  1UHH A;  3CR4 X;  3KPX A;  1DJW A;  2BCX A;  2L5X B;  3DXL A;  1RRO A;  3B88 A;  3F45 A;  1J55 A;  1OOG A;  2WCF A;  1BLQ A;  1JF0 A;  2QEO A;  1BG1 A;  1REC A;  3Q8I A;  3D73 A;  3FWB A;  3WNX B;  2LLT A;  3I5G B;  4INX A;  4MZK A;  1TWO A;  5CPV A;  3TS5 B;  2H61 A;  4N5X A;  3RLZ A;  2KBM A;  2M7N A;  4GFT A;  3TUY C;  3SG6 A;  2KI6 C;  3D0Y A;  4MN0 A;  1FPW A;  4MLW A;  4HSZ A;  3D74 A;  5HLO A;  2CXJ A;  3OB2 B;  3DD4 A;  4JD9 A;  2K7D A;  3JVT C;  1K9P A;  1UHN A;  1KSM A;  1ZFS A;  2L4I A;  3KF9 A;  5I2O A;  2BAP A;  1EG4 A;  2I2R E;  3CWG A;  1XK4 C;  2Y5I A;  2CTN A;  1KSO A;  3NSO A;  3IQQ A;  3SS3 A;  3BUM B;  5GQQ C;  1IGV A;  1CNP A;  2FCD A;  2LV7 A;  1NUB A;  1OQP A;  1QVI Y;  1OZO A;  2NCO A;  4CFR A;  3VRQ A;  1S6C A; 
#chains in the Genus database with same CATH homology
 2LCP A;  1IG5 A;  1JUO A;  2HF5 A;  1CDN A;  1H8B A;  4HRG A;  1B7T Z;  3GK2 A;  2BEC A;  3BQ3 A;  4MVF A;  5JJG A;  1FI6 A;  1C07 A;  2LP2 A;  5KU1 A;  2I7A A;  1D1O A;  3EK8 A;  1Y1X A;  2LMU A;  3KHE A;  2NZ0 A;  1F4O A;  1CMF A;  5DKR A;  1MHO A;  2JC2 A;  3O6B A;  1KK7 Z;  1DJX A;  1BR4 B;  2WOR A;  3D0Y B;  1KK8 B;  4QJ4 B;  1DGV A;  4GAO A;  2VRG A;  3VRO A;  1J7Q A;  4I5L B;  1CLL A;  1K8U A;  2M1K B;  2ZNE A;  2JXL A;  4JPZ B;  1QTX A;  4P5O E;  2JPT A;  1AP4 A;  1QLS A;  1J7R A;  1OOJ A;  2LAP A;  1KQM B;  1BMO A;  1IRJ A;  2CNP A;  2M0R A;  3NSK A;  1XFX O;  5CSN A;  1IQ3 A;  2JZI A;  4QJ3 B;  1VRK A;  1XFW O;  2KOT A;  3QRX A;  2NLN A;  3AAK A;  1X02 A;  1K95 A;  2KFG A;  4JWQ A;  2WCB A;  1TNW A;  2JT0 A;  2LLU A;  1YUS A;  2JWW A;  4DS7 A;  1DJG A;  1CLB A;  2HET A;  3A8R A;  1B4C A;  2F2P A;  1DMO A;  2K7O A;  1CKK A;  2KI6 D;  2F8P A;  2BBM A;  3I5H B;  3PM8 A;  4NDC A;  3LCP C;  4YI9 A;  1F71 A;  1YUR A;  2JRF A;  1M31 A;  1B47 A;  4CLN A;  4AQJ A;  1CFF A;  2LAN A;  5AAN A;  1HQV A;  2LVJ A;  1EL4 A;  5TNC A;  1NCY A;  3OX5 A;  1A75 B;  4M2O A;  5CSI A;  5ER4 X;  5G08 A;  5HLV A;  3OB1 B;  1QV1 A;  3CGA A;  1YR5 A;  1R6P A;  2ZRS A;  1WY9 A;  3A4U B;  5CSF A;  4YRU A;  4CFQ A;  2LUC A;  2BL0 B;  3FIA A;  4YGB B;  2LUX A;  4MSP A;  4YI8 A;  2KQY A;  4CID A;  4ORA B;  2KDH A;  1SR6 C;  1AVS A;  4DUQ A;  4WQ3 A;  2SAS A;  5AER A;  2P6B B;  1MXL C;  1CMG A;  4TNC A;  1AJ4 A;  5KTY A;  2AMI A;  5D7F A;  2KBI A;  3LK0 A;  1A29 A;  1OMD A;  3CLN A;  1NIW A;  1NP8 A;  1NYA A;  1K90 D;  1TNX A;  4GGN A;  1YRT B;  1AHR A;  2JUL A;  1YVH A;  3SIB A;  1W7I B;  2KNE A;  1K94 A;  2KAX A;  1A4P A;  3BUO B;  1SCM B;  2KHN A;  1ODB A;  4MBE A;  3WHT B;  1PVA A;  1QIV A;  1JWD A;  1QX5 B;  2GGM A;  1WRK A;  2LC5 A;  1RJV A;  3PAT A;  2EC6 B;  2L0P A;  4R1E A;  2I18 A;  4USL A;  2ISD A;  2BBN A;  2K7B A;  1UHK A;  1KFX S;  4ORB B;  3I5F C;  2IS9 A;  4AOM A;  1KK7 Y;  2Q4U A;  1SY9 A;  3BOW A;  2CBL A;  1J1D A;  5I2L A;  3TDZ A;  2JT3 A;  4C0J A;  1U5I B;  3GK4 X;  3IQO A;  2PMY A;  4ICB A;  5I2Q A;  1XYD A;  1XK4 A;  5PAL A;  1JFJ A;  2LVI A;  3EVV A;  1NSH A;  1XFV O;  1YTZ C;  2EHB A;  1NX0 A;  1SL9 A;  3OP0 A;  2B1U A;  2BKH B;  1MXE A;  1K9U A;  1Y1A A;  1JFK A;  2COL B;  1TN4 A;  3PN7 C;  5HYD A;  2OPO A;  1ALW A;  2OS8 B;  3D10 A;  3MSE B;  3PFV A;  3GOF A;  2FJU B;  1S26 D;  1WDC B;  1N65 A;  1GGZ A;  1TNP A;  2KAY A;  3SG2 A;  1PSB A;  5ER5 A;  2MA2 A;  1GJY A;  3TZ1 A;  5HKW A;  1QAT A;  2K0J A;  2PAS A;  1AJ5 A;  4NDD A;  4U8D A;  3K21 A;  4GUK A;  2M9G A;  1NWD A;  1KFU S;  2L51 A;  1BOC A;  1JF2 A;  5K89 A;  1QXP A;  2MLF C;  1J7P A;  1GQM A;  3SG3 A;  2FCE A;  4Q04 A;  1JSA A;  3CS1 A;  2MBX A;  4L9M A;  2KYF A;  3RM1 A;  4CPV A;  1DVI A;  2HPS A;  2SCP A;  4PHK A;  1OSA A;  1ZOT B;  3DF0 A;  4MEW A;  1CB1 A;  1WRZ A;  1FF1 A;  3I5I B;  4WRI A;  1RFJ A;  2M3W A;  3DVK A;  1B1G A;  3AAJ A;  2LMV A;  2M1U A;  3VRP A;  5DKQ A;  1K93 D;  3O2P A;  3C1V A;  3CZT X;  1V1F A;  3LK1 A;  4PAL A;  1DGU A;  2KI4 B;  4BY4 A;  1CDP A;  1WLZ A;  4PHJ A;  4MZL A;  3SJS A;  2OTG B;  2JQ6 A;  1M45 A;  1NX2 A;  1SMG A;  1IQ5 A;  2LNK A;  5I8N A;  3CR5 X;  1YVL A;  2AAO A;  3I5G C;  2OS8 C;  1AUI B;  3TS5 C;  1NX3 A;  1AK8 A;  1TIZ A;  5B8I B;  2E30 A;  1S1E A;  4ORC B;  1K96 A;  1CTR A;  1B8C A;  1BJF A;  2M49 B;  1WLM A;  3SG7 A;  2LVV A;  1OMV A;  2JU0 A;  4HRH A;  2KAV A;  1QX2 A;  1KWO C;  2M8U A;  2AUC A;  2O60 A;  3VGO A;  3SG4 A;  1F8H A;  2L4H A;  1S36 A;  1IJ6 A;  1W7J B;  1A75 A;  2M7L A;  2HQ8 A;  1U5I A;  4M2P A;  1UWO A;  2QAC A;  1YUU A;  2ZFD A;  3BOW B;  1KCY A;  1SPY A;  4GPL B;  1M46 A;  1MF8 B;  2JXC A;  2JTT A;  2LMT A;  1ZAC A;  2NCP A;  4OV2 A;  3OX6 A;  1SL8 A;  3TDI A;  1N0Y A;  1LVC D;  3AKB A;  3BUN B;  2F2O A;  4P2Y B;  2KGR A;  1S6I A;  2QPT A;  4D1E A;  1H4B A;  1C7W A;  1SCV A;  4C0L A;  1HT9 A;  1B7T Y;  1DJY A;  3AKA A;  5AFP A;  5D69 A;  3EVR A;  1CDM A;  2EC6 C;  1K9K A;  1QLK A;  1G33 A;  2PSR A;  2PVB A;  1LKJ A;  3BYA A;  4A4C A;  2K2A A;  2GGZ A;  1TNQ A;  2CCM A;  2Y1M A;  4OR9 B;  2Q91 A;  1UUR A;  1RWY A;  1YX7 A;  1TTX A;  1KWO B;  1PSR A;  2KSP A;  4OCI A;  4QJ5 B;  2JNF A;  4PDZ A;  5CSJ A;  4YGA A;  1XA5 A;  3HX4 A;  1IH0 A;  2A4J A;  1EJ3 A;  2Y1N A;  2JOJ A;  3LLE A;  3JTD C;  4OVN F;  4PCW A;  4FQO A;  3HCM A;  3EVU A;  1ZMZ A;  2G9B A;  3LL8 B;  2LM5 A;  2G2B A;  1DJH A;  3FWC A;  1EH2 A;  5AXI A;  1UP5 A;  2L50 A;  1KFX L;  3BUX B;  3CR2 A;  3H4S E;  4I5K A;  4XJK B;  1QVI Z;  1CFC A;  4DCK A;  4GBA A;  3TDU A;  1XFZ O;  1TCF A;  1TOP A;  1WRL A;  2BCB A;  1PK0 D;  2BE4 A;  3PSR A;  1TCO B;  1XFY O;  3DF0 B;  1FI5 A;  1MQ1 A;  1Y0V H;  2HQW A;  1SL7 A;  4PHM A;  2MLE C;  1BF5 A;  3WHU B;  5AEQ A;  4GGF C;  1WDC C;  3NXA A;  1B8R A;  2LHL A;  1MR8 A;  1J1E A;  2M29 A;  2MJW B;  1IJ5 A;  2H2K A;  1K2H A;  3O78 A;  1JBA A;  2ZN9 A;  4PE4 A;  3O4Y A;  1CFD A;  3SIA A;  3PN7 B;  1SW8 A;  1IKU A;  3EK7 A;  1L2O B;  5DKN A;  4NQG A;  1UUS A;  1Y6W A;  1EG3 A;  3ZWH A;  2BKI B;  2O5G A;  1SR6 B;  1QS7 A;  2KFF A;  1F55 A;  1SRA A;  4PE0 A;  1JC2 A;  1UHI A;  5HKZ A;  3JVT B;  4YGE B;  2MRD A;  4PE1 A;  2PAL A;  3NSI A;  1J7O A;  2BL0 C;  5F6T A;  1NCZ A;  1NCX A;  1DF0 A;  2NXQ A;  1A03 A;  2K7C A;  5JOL A;  1YRU B;  4PE7 A;  1PAL A;  1C7V A;  2K61 A;  2KI4 C;  1KQV A;  4GGF A;  4E68 A;  2E6W A;  1KK8 C;  4ZCV A;  1F4Q A;  1DJI A;  1ALV A;  1NX1 A;  1MUX A;  1XVJ A;  3I5I C;  1S3P A;  4PHN A;  4ZCU A;  2BE6 A;  3VRR A;  1S6J A;  4MRX A;  2LVK A;  1SKT A;  1XO5 A;  1SNL A;  3EKJ A;  1CM1 A;  2DOQ A;  1R2U A;  2JT8 A;  1CLM A;  1LXF C;  2KYC A;  1QJT A;  4IL1 A;  1M39 A;  2WOS A;  2OTG C;  1CFP A;  3E3R A;  1IWQ A;  1OZS A;  1MWN A;  1E8A A;  1L2O C;  2KQ6 A;  2L98 A;  1B8L A;  1YX8 A;  3DVE A;  1BR1 B;  1LA0 A;  3NSL A;  1F70 A;  4FTG A;  2CT9 A;  2MHH A;  1DTL A;  5HKY A;  1G8I A;  2I94 A;  1Q80 A;  2M97 A;  3FS7 A;  4XJK A;  4I5J A;  2GV5 A;  1XFU O;  2FOT A;  4YBH B;  1KQM C;  4MZJ A;  2JNX A;  1UHJ A;  3VRN A;  3EK4 A;  4MRY A;  4JQ0 D;  2F3Z A;  1QIW A;  3DVM A;  1S5G Y;  3KO0 A;  1QAS A;  1N2D A;  3PLF B;  2LLS A;  1SYM A;  4XYN A;  1BU3 A;  1RTP 1;  4N1G A;  4C0K A;  3ICB A;  1RK9 A;  4A4B A;  1S5G Z;  3OHM B;  3CTN A;  1LIN A;  2ZN8 A;  1OMR A;  4M2Q A;  3IF7 A;  1QX7 A;  1FBV A;  2F33 A;  2KFH A;  4NDB A;  1F54 A;  3M0W A;  4DIR A;  4OKH A;  3I5H C;  2D8N A;  2LHI A;  4HRE E;  3EKH A;  2TN4 A;  2MAZ A;  1G4Y R;  3WXA A;  5BPJ A;  2BCA A;  3TUY B;  3PAL A;  2ZRT A;  4F0Z B;  1DJZ A;  1KFU L;  2Y4Q A;  4YGD B;  1EXR A;  1OE9 B;  1V1G A;  2JTZ A;  3BUW B;  3SG5 A;  5KSZ A;  1SK6 D;  2KGB C;  2RGI A;  2EGD A;  1L7Z A;  4AQI A;  1GGW A;  1PUL A;  2L2E A;  1BT6 A;  1ZUZ A;  2LE9 B;  3JTD B;  1TRF A;  1DT7 B;  2PRU A;  1Y1U A;  2K2F A;  2ZND A;  3GK1 A;  2K8M B;  1LA3 A;  1PRW A;  2WCE A;  2WC8 A;  2R2I A;  2ZKM X;  2LP3 A;  3KEV A;  4ETO A;  1BOD A;  4BY5 A;  2WND A;  4YGC B;  3DVJ A;  4N1F A;  1CM4 A;  2F3Y A;  1A2X A;  2V53 A;  5IBW A;  1B9A A;  1CDL A;  2H61 C;  5FYX A;  1NPQ A;  1SBJ A;  5J3X A;  1QV0 A;  1M63 B;  1YUT A;  3I5F B;  4UPG A;  3BXK A;  4WQ2 A;  4GNK B;  1FW4 A;  3ZNI A;  4I5N B;  1PVB A;  1DF0 B;  1SCM C;  1UHH A;  3CR4 X;  3KPX A;  1DJW A;  2BCX A;  2L5X B;  1RRO A;  3F45 A;  1J55 A;  1BLQ A;  2WCF A;  1JF0 A;  1BG1 A;  1REC A;  4DRW A;  3FWB A;  3WNX B;  2LLT A;  3I5G B;  4MZK A;  5CPV A;  3TS5 B;  2H61 A;  4N5X A;  3RLZ A;  2KBM A;  2M7N A;  4GFT A;  3TUY C;  3SG6 A;  2KI6 C;  3D0Y A;  4MN0 A;  1FPW A;  4MLW A;  4HSZ A;  5HLO A;  2CXJ A;  3OB2 B;  3DD4 A;  2K7D A;  3JVT C;  1K9P A;  1UHN A;  1KSM A;  1ZFS A;  2L4I A;  3KF9 A;  5I2O A;  1EG4 A;  2I2R E;  3CWG A;  1XK4 C;  2Y5I A;  2CTN A;  1KSO A;  3NSO A;  3IQQ A;  3BUM B;  5GQQ C;  1IGV A;  1CNP A;  2FCD A;  2LV7 A;  1NUB A;  1OQP A;  1QVI Y;  1OZO A;  2NCO A;  4CFR A;  3VRQ A;  1S6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...