1SCVA

Nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
81
structure length
81
Chain Sequence
b'MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein, structural protein
total genus 13
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scvA00
1CNPA 1IJ5A 2PALA 1A03A 1A2XA 1XFUO 2CCMA 3IQOA 2FCDA 2M9GA 1QX2A 2LLSA 1DJIA 3D10A 1DJZA 1OE9B 1GGWA 1UHJA 1XFXO 2EHBA 2K2AA 4JPZB 2BCBA 3VRQA 1JF2A 2HQ8A 2LCPA 2FJUB 2F2OA 3NSKA 1NX2A 1TIZA 1ZOTB 2M7LA 2KNEA 1OMRA 1OZSA 1S6JA 1U5IB 4I5KA 2K61A 3C1VA 1IGVA 2Y4QA 2KAXA 2OTGC 1QLSA 1AK8A 5KTYA 4MN0A 1KWOC 4WQ3A 1YRUB 1RROA 3I5HC 1WDCB 4MZJA 3RLZA 2LMUA 2LP3A 2BL0C 1OMVA 3FS7A 1HQVA 1MQ1A 5AERA 3EK8A 1Y1AA 3BUMB 2NXQA 4NQGA 1IKUA 1XK4C 1WRKA 1QATA 1B8LA 1RTP1 4MEWA 5F6TA 3VRNA 1NSHA 4MSPA 2ZNEA 1WLMA 1A75A 1SR6C 1BF5A 1LVCD 1IWQA 3PM8A 1PALA 1J7QA 1BMOA 1EL4A 1F4OA 1QIWA 2GGMA 3HCMA 3SJSA 2LNKA 5GQQC 1Y0VH 5J3XA 4L9MA 5JOLA 2L2EA 2LMVA 3OP0A 1V1GA 4Q04A 1K2HA 1JUOA 2EC6C 2LP2A 4I5NB 4YI8A 4BY5A 1YVLA 2VRGA 1V1FA 4OVNF 3ZWHA 1IH0A 2EGDA 2CNPA 3BUWB 2DOQA 3TUYB 1OQPA 1J1DA 1M45A 2LHLA 1L2OC 5DKQA 3EKJA 4IL1A 2M8UA 2KBMA 1R2UA 5B8IB 2AMIA 1SBJA 2I2RE 2K8MB 2KI6C 1RJVA 1CDNA 2KBIA 4GGNA 5BPJA 1TNPA 4OV2A 1F4QA 2Y1NA 3BYAA 3E3RA 3LK0A 3DVKA 2CT9A 1XFYO 4GNKB 4XJKA 2ZKMX 1QLKA 1G8IA 5CSFA 2WC8A 4MRYA 2ISDA 5DKNA 1PVAA 1YUSA 4M2QA 2PRUA 4MZKA 2H2KA 1DGUA 2JWWA 2K7DA 4N5XA 3CTNA 2WCFA 1B4CA 1UHKA 2ZN8A 4R1EA 2KI4B 1XK4A 1QS7A 4C0LA 2KFGA 4YGCB 1NCYA 4JQ0D 1MF8B 1F8HA 1XA5A 2RGIA 4PE4A 1D1OA 1CM1A 1R6PA 2K2FA 1BU3A 1AJ4A 3ZNIA 1TNWA 1YTZC 4PE1A 1S26D 1IQ5A 3OX5A 2M29A 1EH2A 2L0PA 3BOWA 1SYMA 3AAKA 5D7FA 3SG2A 3TDIA 1J7RA 3PALA 1JWDA 1FF1A 5DKRA 5D69A 1S6CA 5HYDA 2PMYA 2KAVA 1AVSA 2E6WA 3SG7A 1PVBA 2NCPA 1XO5A 2HETA 1TNQA 1CLMA 2JRFA 4M2OA 1NIWA 1CM4A 4ORBB 2BE6A 1DT7B 1TOPA 3PLFB 1F54A 2H61A 3EVRA 1QASA 1JFKA 1A29A 2Q4UA 3I5IB 1SCMB 1JC2A 1H8BA 1NUBA 2LUCA 2MA2A 1SCVA 1K93D 1YUTA 1CTRA 1XFVO 2SASA 1IG5A 3FWCA 1Y1UA 2GGZA 4P5OE 4N1FA 3TZ1A 2I18A 1JSAA 1YX8A 1XFZO 1QV1A 3CWGA 1RWYA 4UPGA 3I5FB 1KK8B 2V53A 1CMGA 1Q80A 1PSBA 5HLOA 1KQVA 4NDBA 1KCYA 1QV0A 2M3WA 1WRLA 5KSZA 5I2LA 2MLFC 3A8RA 1H4BA 1L7ZA 4YGDB 2M1UA 1SMGA 3HX4A 2KQ6A 1N65A 3ICBA 4YGBB 4YGAA 1BOCA 1NPQA 5JJGA 1WDCC 1LA3A 3DVMA 2ZFDA 1ALWA 2BKHB 1PSRA 1YR5A 1N2DA 5I2QA 2QACA 4M2PA 1CFPA 4QJ4B 1NYAA 3KO0A 2G2BA 1DF0A 2HPSA 3GK2A 1ALVA 1K9KA 1YVHA 1KFUS 1NP8A 3KHEA 1DJYA 2CXJA 2KYFA 4XJKB 4AQIA 4QJ5B 1S6IA 3BUNB 1QTXA 1CKKA 2L4IA 1JF0A 1SPYA 2JULA 1BR1B 2AAOA 5CSIA 1J7OA 1K96A 1YURA 2R2IA 1UHIA 1SRAA 5AFPA 1MWNA 3A4UB 2BKIB 5HKWA 1OOJA 5HLVA 1JFJA 3D0YA 2JT0A 4C0KA 2TN4A 2JZIA 1TCFA 1DVIA 4MBEA 1SL7A 3TUYC 1RECA 2LHIA 1UHHA 4PE0A 2MLEC 4DCKA 3OB1B 1ZMZA 2COLB 1BT6A 1YUUA 3VRPA 1NCZA 3I5GB 3GK1A 2BCXA 4PHNA 3EK7A 3BOWB 1DMOA 1QJTA 4CFRA 4U8DA 2JOJA 2I94A 3SG6A 1YRTB 3WNXB 3PN7B 2FCEA 4CIDA 1CDPA 1KFUL 1UURA 1BLQA 1F70A 2Y1MA 1DJWA 1U5IA 2JT8A 2WORA 1LKJA 2GV5A 2OS8B 1PK0D 2ZRSA 3GOFA 2LUXA 4PHKA 1RFJA 5FYXA 2L5XB 3VRRA 3TS5B 4OCIA 1BJFA 3DF0A 4HREE 1GGZA 2Y5IA 3OX6A 1DJXA 1B8CA 1CB1A 5I2OA 1CLBA 1SK6D 1W7JB 3RM1A 4AQJA 2G9BA 2LMTA 1W7IB 3SIBA 2L50A 1JBAA 1S5GZ 2KI4C 5HKZA 4GGFC 4ORCB 1KFXS 4WQ2A 1C07A 3JVTB 1S5GY 2M0RA 2ZRTA 4N1GA 1KSOA 2BBNA 1EXRA 1J1EA 1A4PA 2LVVA 3BXKA 4YBHB 1UUSA 4GUKA 1KQMB 2KOTA 4WRIA 2LLTA 3H4SE 1TN4A 1BR4B 1B7TZ 1MR8A 4PHMA 1QIVA 3OHMB 2BECA 1NX1A 2KFHA 3AKAA 3CZTX 5TNCA 1B7TY 1FBVA 3JTDB 2JT3A 1QX7A 2ZNDA 5AXIA 1C7VA 1TRFA 2LC5A 1K90D 4TNCA 2F3ZA 3WHUB 2LE9B 3AAJA 3SG4A 1DGVA 1G33A 5CPVA 2BCAA 1B8RA 1K94A 5ER5A 2B1UA 3DVEA 4MRXA 2BE4A 2KFFA 2CTNA 3I5IC 1SCMC 2QPTA 2A4JA 1DF0B 2HF5A 1HT9A 2M97A 1MXEA 2LM5A 3PATA 1MHOA 2M49B 2D8NA 2E30A 1ODBA 4PE7A 1A75B 4CPVA 1CMFA 1DJHA 2MRDA 1VRKA 1FW4A 4NDCA 1CFDA 3CS1A 4GBAA 2JTZA 2NLNA 2F3YA 4GFTA 3I5FC 1KK8C 2JNXA 4FTGA 1C7WA 3CLNA 5CSJA 4ZCUA 1RK9A 4A4BA 4I5JA 4FQOA 1B9AA 2Q91A 4GPLB 2KSPA 1S1EA 1LINA 1KK7Y 3D0YB 2JTTA 2NCOA 2LLUA 1OMDA 1UHNA 2LVJA 4C0JA 4PALA 4GGFA 1F71A 4QJ3B 1S36A 4HRGA 3TDZA 1SL9A 4MLWA 2WCBA 1DJGA 3M0WA 4AOMA 2M1KB 1CLLA 4D1EA 4OR9B 2KAYA 2L98A 3PFVA 1AUIB 1WLZA 3DVJA 3CR5X 3O4YA 3O78A 4ORAB 2PVBA 4XYNA 1K95A 1F55A 1N0YA 1X02A 5KU1A 2O60A 2KGRA 2P6BB 1MUXA 3O6BA 3IQQA 1K8UA 2JXLA 4CLNA 2OTGB 5PALA 2F33A 1QVIZ 2FOTA 2MBXA 1KWOB 2KGBC 3DF0B 1AP4A 2K7CA 3KEVA 3K21A 2JXCA 2LANA 3I5HB 4CFQA 1QVIY 5AEQA 1SW8A 2NZ0A 5I8NA 3CR4X 2BL0B 3GK4X 2PASA 3LLEA 1FI6A 5AANA 5HKYA 4HSZA 4I5LB 2KQYA 2HQWA 2KDHA 1FI5A 4DS7A 2LV7A 2KHNA 3AKBA 1EJ3A 1LA0A 2IS9A 1M39A 4P2YB 3NSIA 3WXAA 1SR6B 1B1GA 1BG1A 2WOSA 3I5GC 1IRJA 4DRWA 5CSNA 1NX3A 1SY9A 1NX0A 2LAPA 3MSEB 1WRZA 4ZCVA 2WCEA 2L4HA 4PHJA 2M7NA 4MZLA 3PN7C 3SG3A 1PULA 3EVVA 4ETOA 2BBMA 2EC6B 3BQ3A 3NSOA 3LCPC 1AJ5A 1EG4A 2AUCA 1CDLA 2OS8C 4F0ZB 2JQ6A 1IQ3A 1SKTA 3TS5C 1AHRA 1XVJA 1LXFC 2JC2A 1WY9A 2K7OA 3LK1A 3EVUA 2H61C 1L2OB 3EK4A 1CFFA 1Y1XA 3NSLA 1OSAA 1K9UA 2SCPA 5ER4X 4NDDA 2LVIA 4JWQA 3CR2A 4PDZA 1J7PA 3VGOA 2JPTA 1DTLA 1M31A 1UWOA 1M63B 4E68A 3JVTC 1QX5B 1CDMA 3SG5A 1YX7A 1B47A 1ZFSA 2OPOA 4GAOA 4YGEB 1TCOB 1KQMC 3LL8B 4BY4A 3WHTB 2JU0A 2F2PA 2JNFA 2I7AA 1TNXA 1ZACA 4HRHA 3VROA 5IBWA 1OZOA 1FPWA 1UP5A 1EG3A 3JTDC 3DD4A 3BUOB 3FWBA 3OB2B 1KSMA 4YI9A 2MJWB 3SIAA 2L51A 3TDUA 1SL8A 1Y6WA 4PCWA 3EKHA 1TTXA 2K7BA 1M46A 2PSRA 2KI6D 3BUXB 1GJYA 2F8PA 4A4CA 1SNLA 2O5GA 3CGAA 3O2PA 4MVFA 4USLA 1ZUZA 2LVKA 1PRWA 3FIAA 1KFXL 1NWDA 3KF9A 3PSRA 4ICBA 1BODA 1XFWO 2ZN9A 3NXAA 1IJ6A 1QXPA 1E8AA 1GQMA 1MXLC 4DUQA 1S3PA 2MAZA 3F45A 2KYCA 4YRUA 1J55A 5G08A 2WNDA 2CBLA 3KPXA 3QRXA 1CFCA 4OKHA 2K0JA 4DIRA 5K89A 1KK7Z 1K9PA 2MHHA 3IF7A 1XYDA 1NCXA 1G4YR
chains in the Genus database with same CATH superfamily
1CNPA 1IJ5A 2PALA 1A03A 1A2XA 1XFUO 2PQLA 2CCMA 3IQOA 2FCDA 2M9GA 1QX2A 2LLSA 1DELA 1DJIA 3D10A 1DJZA 1OE9B 1GGWA 1UHJA 1XFXO 2EHBA 2K2AA 4JPZB 1TUZA 2BCBA 3VRQA 1JF2A 2HQ8A 2LCPA 2FJUB 2F2OA 3NSKA 1NX2A 1TIZA 1ZOTB 2M7LA 2KNEA 1OMRA 1OZSA 1S6JA 1U5IB 3DXLA 4I5KA 2K61A 3C1VA 1IGVA 2Y4QA 2KAXA 2OTGC 1QLSA 1AK8A 3QMEA 4MN0A 5KTYA 1KWOC 4WQ3A 1YRUB 1RROA 3I5HC 1WDCB 4MZJA 3RLZA 2LMUA 3DY9A 2LP3A 2BL0C 1OMVA 3FS7A 1HQVA 1MQ1A 5AERA 3EK8A 2QEBA 1Y1AA 3BUMB 2NXQA 4NQGA 1IKUA 2WC6A 1XK4C 1WRKA 1QATA 1B8LA 1RTP1 4MEWA 5F6TA 3VRNA 1NSHA 4MSPA 2ZNEA 1WLMA 1ORGA 1A75A 1SR6C 3OBVA 1BF5A 1LVCD 1IWQA 3PM8A 1PALA 1J7QA 1BMOA 1EL4A 1F4OA 1OOFA 1QIWA 2GGMA 3HCMA 3SJSA 2LNKA 1IIOA 3B87A 5GQQC 4IJ7A 1Y0VH 5J3XA 4L9MA 5JOLA 2L2EA 2LMVA 3OP0A 1V1GA 4Q04A 1K2HA 1JUOA 2EC6C 2LP2A 4I5NB 4YI8A 4BY5A 1YVLA 2VRGA 1V1FA 3O4XA 4OVNF 3ZWHA 3V2LA 1IH0A 2EGDA 2KLDA 2CNPA 3BUWB 2DOQA 3TUYB 1OQPA 1J1DA 1M45A 2LHLA 1L2OC 5DKQA 3EKJA 3D78A 4IL1A 2M8UA 3L4LA 2KBMA 1R2UA 1TUJA 2AMIA 1SBJA 2I2RE 2K8MB 2KI6C 5B8IB 1RJVA 1OOHA 2KBIA 2P70A 4GGNA 5BPJA 1CDNA 1OOIX 1TNPA 1F4QA 4OV2A 2Y1NA 3BYAA 3E3RA 3LK0A 3DVKA 2CT9A 1XFYO 4GNKB 4XJKA 2ZKMX 1QLKA 1G8IA 5CSFA 2WC8A 4MRYA 2ISDA 5DKNA 1PVAA 1YUSA 4M2QA 2PRUA 4MZKA 2H2KA 1DGUA 3NHTA 2JWWA 3BFBA 2K7DA 4N5XA 4OZDA 3CTNA 2WCFA 3UO9A 1B4CA 1UHKA 2ZN8A 4R1EA 2KI4B 1XK4A 1QS7A 4C0LA 2KFGA 4YGCB 1NCYA 4JQ0D 2L2CA 3L4AA 1MF8B 1F8HA 1XA5A 2RGIA 4PE4A 1D1OA 1CM1A 1R6PA 2K2FA 1QWVA 1BU3A 1AJ4A 3ZNIA 1TNWA 1YTZC 1Z2CB 3PJIA 4PE1A 1S26D 1IQ5A 3OX5A 2M29A 1EH2A 2L0PA 3BOWA 1SYMA 3AAKA 5D7FA 3SG2A 3TDIA 1J7RA 3PALA 3S0EA 1JWDA 1FF1A 5DKRA 5D69A 1S6CA 5HYDA 3D77A 2PMYA 2WCHA 3EG5B 2KAVA 4F7FA 1AVSA 2E6WA 4FQTA 3SG7A 1PVBA 2NCPA 5FI2A 1XO5A 2HETA 1P28A 1TNQA 1CLMA 2JRFA 4M2OA 1NIWA 1CM4A 4ORBB 2BE6A 1DT7B 1TOPA 3PLFB 1F54A 2H61A 3EVRA 1QASA 2WCKA 1JFKA 1A29A 2Q4UA 2WCLA 3I5IB 1SCMB 1JC2A 1H8BA 1NUBA 2LUCA 2MA2A 1SCVA 2H8VA 1K93D 1YUTA 1CTRA 1XFVO 2SASA 1IG5A 3FWCA 1Y1UA 2GGZA 1SSEB 4P5OE 2WCMA 4N1FA 3TZ1A 2I18A 1JSAA 1YX8A 1XFZO 1QV1A 3CWGA 1RWYA 4UPGA 3I5FB 1KK8B 2V53A 4PT1A 1Q80A 1CMGA 1PSBA 5HLOA 1KQVA 4NDBA 3CZ0A 1KCYA 1QV0A 2M3WA 1WRLA 5KSZA 5I2LA 3SS5A 2MLFC 3A8RA 1H4BA 1L7ZA 2ERBA 2M1UA 4YGDB 1SMGA 3HX4A 2KQ6A 1N65A 3ICBA 4YGBB 4YGAA 2WC5A 1BOCA 1NPQA 5JJGA 1WDCC 1LA3A 3DVMA 2ZFDA 3S0DA 1ALWA 2BKHB 1PSRA 1YR5A 1N2DA 5I2QA 2QACA 4M2PA 1CFPA 4QJ4B 1NYAA 3KO0A 2G2BA 1DF0A 2HPSA 3GK2A 3SS3A 1ALVA 1K9KA 1YVHA 3FE8A 1KFUS 1NP8A 5I94A 3KHEA 1DJYA 2CXJA 2KYFA 4XJKB 4AQIA 4QJ5B 3D76A 1S6IA 3BUNB 1QTXA 1CKKA 2L4IA 3CABA 1JF0A 1SPYA 2JULA 1BR1B 2AAOA 5CSIA 1J7OA 2WCJA 1K96A 1YURA 2R2IA 1UHIA 1SRAA 5AFPA 1MWNA 3A4UB 5D3OA 2BKIB 5HKWA 3S0GA 1OOJA 5HLVA 1JFJA 3D0YA 2JT0A 4C0KA 2TN4A 2JZIA 1TCFA 1DVIA 4MBEA 2KPHA 1SL7A 3TUYC 1RECA 2LHIA 1UHHA 4PE0A 2MLEC 4DCKA 3OB1B 1ZMZA 2COLB 1BT6A 1YUUA 3VRPA 3K1EA 1NCZA 3I5GB 3GK1A 2BCXA 4PHNA 3EK7A 3BOWB 1DMOA 1QJTA 4CFRA 4U8DA 2JOJA 2I94A 3SG6A 1YRTB 1OOGA 1T14A 3WNXB 3PN7B 2FCEA 4CIDA 1CDPA 1KFUL 1UURA 1BLQA 1F70A 2Y1MA 1DJWA 1U5IA 2JT8A 2WORA 1LKJA 2GV5A 2OS8B 1PK0D 2ZRSA 3GOFA 2LUXA 3PM2A 1RFJA 4PHKA 2L5XB 5FYXA 3VRRA 2QDIA 3TS5B 4OCIA 1BJFA 3DF0A 4HREE 1GGZA 2Y5IA 3OX6A 1DJXA 1B8CA 3BFAA 5I2OA 1CB1A 1CLBA 1SK6D 1W7JB 3RM1A 4AQJA 2G9BA 2LMTA 3RZSA 1W7IB 3SIBA 2L50A 1Z4HA 1JBAA 1S5GZ 2KI4C 4INWA 4GGFC 4ORCB 5HKZA 1KFXS 4WQ2A 1C07A 3JVTB 1S5GY 2M0RA 2ZRTA 4N1GA 1KSOA 2BBNA 2GTEA 1EXRA 1J1EA 1A4PA 2LVVA 3BXKA 3IVTA 1UUSA 4GUKA 1KQMB 2KOTA 1GM0A 1C3ZA 3FE6A 4WRIA 2LLTA 3H4SE 1TN4A 1BR4B 1B7TZ 1MR8A 4PHMA 1QIVA 3OHMB 2BECA 1NX1A 2KFHA 3AKAA 3CZTX 5TNCA 1B7TY 1FBVA 3JTDB 2JT3A 1XFRA 1QX7A 2ZNDA 5AXIA 1C7VA 2YGUA 4JKTA 1TRFA 2LC5A 1K90D 4TNCA 2F3ZA 3WHUB 2LE9B 3AAJA 3SG4A 1DGVA 1G33A 5CPVA 2BCAA 1B8RA 1K94A 2L5YA 5ER5A 2B1UA 3DVEA 4MRXA 2BE4A 2KFFA 2CTNA 3I5IC 1SCMC 2QPTA 5FI7A 2A4JA 3N7HA 1DF0B 3SS4A 3L47A 2HF5A 1HT9A 2M97A 1MXEA 2LM5A 3PATA 1MHOA 2M49B 2D8NA 2E30A 1ODBA 4PE7A 1A75B 4CPVA 1CMFA 1DJHA 2MRDA 1VRKA 1FW4A 4NDCA 1CFDA 3CS1A 4GBAA 3S0FA 2JTZA 2NLNA 2QEOA 2F3YA 2FJYA 4GFTA 3I5FC 1KK8C 2JNXA 4FTGA 1C7WA 3CLNA 5CSJA 4ZCUA 1RK9A 3D74A 4A4BA 4I5JA 4FQOA 1B9AA 2Q91A 4GPLB 2KSPA 1S1EA 1LINA 1KK7Y 2P71A 3CYZA 2JTTA 2NCOA 3D0YB 2LLUA 1OMDA 1UHNA 2LVJA 4C0JA 4PALA 4GGFA 1F71A 4QJ3B 1S36A 4HRGA 3TDZA 1SL9A 4MLWA 3DYEA 2WCBA 1DJGA 3M0WA 4AOMA 2M1KB 1CLLA 4D1EA 4OR9B 1C3YA 2KAYA 2L98A 3PFVA 1AUIB 1WLZA 3DVJA 3CR5X 3O4YA 3O78A 4ORAB 5EL2A 2PVBA 3R1PA 4XYNA 1K95A 2JPOA 1F55A 1N0YA 4KYNA 1X02A 5FI6A 5KU1A 2O60A 2KGRA 2P6BB 1MUXA 3BFHA 3O6BA 3IQQA 3NGVA 1K8UA 2JXLA 4CLNA 2OTGB 5PALA 2F33A 1QVIZ 2FOTA 2MBXA 1KWOB 2KGBC 3DF0B 1AP4A 2K7CA 3KEVA 3K21A 3B86A 2JXCA 2LANA 3I5HB 3OGNA 3Q8IA 4CFQA 1QVIY 5AEQA 1SW8A 2NZ0A 5I8NA 3CR4X 2BL0B 3GK4X 1DQEA 2PASA 3LLEA 1FI6A 5AANA 5HKYA 4HSZA 4I5LB 2KQYA 3B88A 2HQWA 2KDHA 1FI5A 4DS7A 2BAPA 2KLEA 2LV7A 2KHNA 3NHIA 3AKBA 1EJ3A 1LA0A 2IS9A 1M39A 4P2YB 3NSIA 3WXAA 1SR6B 1B1GA 1BG1A 2WOSA 3I5GC 1IRJA 2QEHA 4DRWA 5CSNA 1NX3A 1SY9A 1NX0A 2LAPA 3MSEB 3R1VA 1WRZA 3R1OA 3B7AA 4ZCVA 2WCEA 2L4HA 4PHJA 2M7NA 4MZLA 3PN7C 3SG3A 1PULA 3EVVA 3S0AA 4ETOA 2BBMA 2EC6B 3BQ3A 3NSOA 4YBHB 3LCPC 1AJ5A 1EG4A 2AUCA 1CDLA 2OS8C 3R72A 4F0ZB 1OW4A 2JQ6A 3CZ1A 1IQ3A 1SKTA 3TS5C 1AHRA 1XVJA 1LXFC 2JC2A 1WY9A 2K7OA 3LK1A 3CZ2A 3EVUA 2H61C 1L2OB 3EK4A 1CFFA 1Y1XA 3NSLA 1OSAA 1K9UA 2SCPA 5ER4X 1W9ZA 4NDDA 2LVIA 3CDNA 4JWQA 3CR2A 4PDZA 1J7PA 3VGOA 2JPTA 1DC1A 1DTLA 1M31A 1UWOA 1DEKA 1M63B 4E68A 3JVTC 1QX5B 1CDMA 3SG5A 1YX7A 1B47A 1ZFSA 2OPOA 4GAOA 4YGEB 1TCOB 1KQMC 3D75A 3S0BA 3LL8B 4BY4A 3WHTB 2JU0A 2F2PA 2JNFA 2QEVA 2I7AA 1TNXA 1ZACA 4HRHA 1LS8A 3VROA 5IBWA 1OZOA 3B6XA 1UP5A 1FPWA 1EG3A 5DICA 3JTDC 3DD4A 3VB1A 3BUOB 3FWBA 3OB2B 1KSMA 4YI9A 4JD9A 2MJWB 3SIAA 3UNWA 2L51A 3TDUA 1SL8A 1Y6WA 4PCWA 3EKHA 1TTXA 2K7BA 2PYQA 1M46A 2PSRA 2KI6D 3BUXB 1GJYA 2F8PA 5HL1A 4A4CA 1SNLA 2O5GA 3CGAA 3O2PA 4MVFA 4USLA 1ZUZA 2LVKA 1PRWA 3FIAA 1KFXL 4INXA 1NWDA 3KF9A 3PSRA 3D73A 4ICBA 1BODA 1XFWO 3FE9A 2ZN9A 3NXAA 1IJ6A 1QXPA 1E8AA 1GQMA 1MXLC 4DUQA 1S3PA 2MAZA 3F45A 2KYCA 4YRUA 1J55A 5G08A 1TWOA 2WNDA 2CBLA 3KPXA 3QRXA 2BNXA 4OKHA 2K0JA 3DZTA 3BJHA 4DIRA 5K89A 1CFCA 1KK7Z 1K9PA 2MHHA 2K60A 3IF7A 1XYDA 1NCXA 1G4YR
chains in the Genus database with same CATH topology
1CNPA 1IJ5A 2PALA 1A03A 1A2XA 1XFUO 2CCMA 3IQOA 2FCDA 2M9GA 1QX2A 2LLSA 1DJIA 3D10A 1DJZA 1OE9B 1GGWA 1UHJA 1XFXO 2EHBA 2K2AA 4JPZB 2BCBA 3VRQA 1JF2A 2HQ8A 2LCPA 2FJUB 2F2OA 3NSKA 1NX2A 1TIZA 1ZOTB 2M7LA 2KNEA 1OMRA 1OZSA 1S6JA 1U5IB 4I5KA 2K61A 3C1VA 1IGVA 2Y4QA 2KAXA 2OTGC 1QLSA 1AK8A 5KTYA 4MN0A 1KWOC 4WQ3A 1YRUB 1RROA 3I5HC 1WDCB 4MZJA 3RLZA 2LMUA 2LP3A 2BL0C 1OMVA 3FS7A 1HQVA 1MQ1A 5AERA 3EK8A 1Y1AA 3BUMB 2NXQA 4NQGA 1IKUA 1XK4C 1WRKA 1QATA 1B8LA 1RTP1 4MEWA 5F6TA 3VRNA 1NSHA 4MSPA 2ZNEA 1WLMA 1A75A 1SR6C 1BF5A 1LVCD 1IWQA 3PM8A 1PALA 1J7QA 1BMOA 1EL4A 1F4OA 1QIWA 2GGMA 3HCMA 3SJSA 2LNKA 5GQQC 1Y0VH 5J3XA 4L9MA 5JOLA 2L2EA 2LMVA 3OP0A 1V1GA 4Q04A 1K2HA 1JUOA 2EC6C 2LP2A 4I5NB 4YI8A 4BY5A 1YVLA 2VRGA 1V1FA 4OVNF 3ZWHA 1IH0A 2EGDA 2CNPA 3BUWB 2DOQA 3TUYB 1OQPA 1J1DA 1M45A 2LHLA 1L2OC 5DKQA 3EKJA 4IL1A 2M8UA 2KBMA 1R2UA 5B8IB 2AMIA 1SBJA 2I2RE 2K8MB 2KI6C 1RJVA 1CDNA 2KBIA 4GGNA 5BPJA 1TNPA 4OV2A 1F4QA 2Y1NA 3BYAA 3E3RA 3LK0A 3DVKA 2CT9A 1XFYO 4GNKB 4XJKA 2ZKMX 1QLKA 1G8IA 5CSFA 2WC8A 4MRYA 2ISDA 5DKNA 1PVAA 1YUSA 4M2QA 2PRUA 4MZKA 2H2KA 1DGUA 2JWWA 2K7DA 4N5XA 3CTNA 2WCFA 1B4CA 1UHKA 2ZN8A 4R1EA 2KI4B 1XK4A 1QS7A 4C0LA 2KFGA 4YGCB 1NCYA 4JQ0D 1MF8B 1F8HA 1XA5A 2RGIA 4PE4A 1D1OA 1CM1A 1R6PA 2K2FA 1BU3A 1AJ4A 3ZNIA 1TNWA 1YTZC 4PE1A 1S26D 1IQ5A 3OX5A 2M29A 1EH2A 2L0PA 3BOWA 1SYMA 3AAKA 5D7FA 3SG2A 3TDIA 1J7RA 3PALA 1JWDA 1FF1A 5DKRA 5D69A 1S6CA 5HYDA 2PMYA 2KAVA 1AVSA 2E6WA 3SG7A 1PVBA 2NCPA 1XO5A 2HETA 1TNQA 1CLMA 2JRFA 4M2OA 1NIWA 1CM4A 4ORBB 2BE6A 1DT7B 1TOPA 3PLFB 1F54A 2H61A 3EVRA 1QASA 1JFKA 1A29A 2Q4UA 3I5IB 1SCMB 1JC2A 1H8BA 1NUBA 2LUCA 2MA2A 1SCVA 1K93D 1YUTA 1CTRA 1XFVO 2SASA 1IG5A 3FWCA 1Y1UA 2GGZA 4P5OE 4N1FA 3TZ1A 2I18A 1JSAA 1YX8A 1XFZO 1QV1A 3CWGA 1RWYA 4UPGA 3I5FB 1KK8B 2V53A 1CMGA 1Q80A 1PSBA 5HLOA 1KQVA 4NDBA 1KCYA 1QV0A 2M3WA 1WRLA 5KSZA 5I2LA 2MLFC 3A8RA 1H4BA 1L7ZA 4YGDB 2M1UA 1SMGA 3HX4A 2KQ6A 1N65A 3ICBA 4YGBB 4YGAA 1BOCA 1NPQA 5JJGA 1WDCC 1LA3A 3DVMA 2ZFDA 1ALWA 2BKHB 1PSRA 1YR5A 1N2DA 5I2QA 2QACA 4M2PA 1CFPA 4QJ4B 1NYAA 3KO0A 2G2BA 1DF0A 2HPSA 3GK2A 1ALVA 1K9KA 1YVHA 1KFUS 1NP8A 3KHEA 1DJYA 2CXJA 2KYFA 4XJKB 4AQIA 4QJ5B 1S6IA 3BUNB 1QTXA 1CKKA 2L4IA 1JF0A 1SPYA 2JULA 1BR1B 2AAOA 5CSIA 1J7OA 1K96A 1YURA 2R2IA 1UHIA 1SRAA 5AFPA 1MWNA 3A4UB 2BKIB 5HKWA 1OOJA 5HLVA 1JFJA 3D0YA 2JT0A 4C0KA 2TN4A 2JZIA 1TCFA 1DVIA 4MBEA 1SL7A 3TUYC 1RECA 2LHIA 1UHHA 4PE0A 2MLEC 4DCKA 3OB1B 1ZMZA 2COLB 1BT6A 1YUUA 3VRPA 1NCZA 3I5GB 3GK1A 2BCXA 4PHNA 3EK7A 3BOWB 1DMOA 1QJTA 4CFRA 4U8DA 2JOJA 2I94A 3SG6A 1YRTB 3WNXB 3PN7B 2FCEA 4CIDA 1CDPA 1KFUL 1UURA 1BLQA 1F70A 2Y1MA 1DJWA 1U5IA 2JT8A 2WORA 1LKJA 2GV5A 2OS8B 1PK0D 2ZRSA 3GOFA 2LUXA 4PHKA 1RFJA 5FYXA 2L5XB 3VRRA 3TS5B 4OCIA 1BJFA 3DF0A 4HREE 1GGZA 2Y5IA 3OX6A 1DJXA 1B8CA 1CB1A 5I2OA 1CLBA 1SK6D 1W7JB 3RM1A 4AQJA 2G9BA 2LMTA 1W7IB 3SIBA 2L50A 1JBAA 1S5GZ 2KI4C 5HKZA 4GGFC 4ORCB 1KFXS 4WQ2A 1C07A 3JVTB 1S5GY 2M0RA 2ZRTA 4N1GA 1KSOA 2BBNA 1EXRA 1J1EA 1A4PA 2LVVA 3BXKA 4YBHB 1UUSA 4GUKA 1KQMB 2KOTA 4WRIA 2LLTA 3H4SE 1TN4A 1BR4B 1B7TZ 1MR8A 4PHMA 1QIVA 3OHMB 2BECA 1NX1A 2KFHA 3AKAA 3CZTX 5TNCA 1B7TY 1FBVA 3JTDB 2JT3A 1QX7A 2ZNDA 5AXIA 1C7VA 1TRFA 2LC5A 1K90D 4TNCA 2F3ZA 3WHUB 2LE9B 3AAJA 3SG4A 1DGVA 1G33A 5CPVA 2BCAA 1B8RA 1K94A 5ER5A 2B1UA 3DVEA 4MRXA 2BE4A 2KFFA 2CTNA 3I5IC 1SCMC 2QPTA 2A4JA 1DF0B 2HF5A 1HT9A 2M97A 1MXEA 2LM5A 3PATA 1MHOA 2M49B 2D8NA 2E30A 1ODBA 4PE7A 1A75B 4CPVA 1CMFA 1DJHA 2MRDA 1VRKA 1FW4A 4NDCA 1CFDA 3CS1A 4GBAA 2JTZA 2NLNA 2F3YA 4GFTA 3I5FC 1KK8C 2JNXA 4FTGA 1C7WA 3CLNA 5CSJA 4ZCUA 1RK9A 4A4BA 4I5JA 4FQOA 1B9AA 2Q91A 4GPLB 2KSPA 1S1EA 1LINA 1KK7Y 3D0YB 2JTTA 2NCOA 2LLUA 1OMDA 1UHNA 2LVJA 4C0JA 4PALA 4GGFA 1F71A 4QJ3B 1S36A 4HRGA 3TDZA 1SL9A 4MLWA 2WCBA 1DJGA 3M0WA 4AOMA 2M1KB 1CLLA 4D1EA 4OR9B 2KAYA 2L98A 3PFVA 1AUIB 1WLZA 3DVJA 3CR5X 3O4YA 3O78A 4ORAB 2PVBA 4XYNA 1K95A 1F55A 1N0YA 1X02A 5KU1A 2O60A 2KGRA 2P6BB 1MUXA 3O6BA 3IQQA 1K8UA 2JXLA 4CLNA 2OTGB 5PALA 2F33A 1QVIZ 2FOTA 2MBXA 1KWOB 2KGBC 3DF0B 1AP4A 2K7CA 3KEVA 3K21A 2JXCA 2LANA 3I5HB 4CFQA 1QVIY 5AEQA 1SW8A 2NZ0A 5I8NA 3CR4X 2BL0B 3GK4X 2PASA 3LLEA 1FI6A 5AANA 5HKYA 4HSZA 4I5LB 2KQYA 2HQWA 2KDHA 1FI5A 4DS7A 2LV7A 2KHNA 3AKBA 1EJ3A 1LA0A 2IS9A 1M39A 4P2YB 3NSIA 3WXAA 1SR6B 1B1GA 1BG1A 2WOSA 3I5GC 1IRJA 4DRWA 5CSNA 1NX3A 1SY9A 1NX0A 2LAPA 3MSEB 1WRZA 4ZCVA 2WCEA 2L4HA 4PHJA 2M7NA 4MZLA 3PN7C 3SG3A 1PULA 3EVVA 4ETOA 2BBMA 2EC6B 3BQ3A 3NSOA 3LCPC 1AJ5A 1EG4A 2AUCA 1CDLA 2OS8C 4F0ZB 2JQ6A 1IQ3A 1SKTA 3TS5C 1AHRA 1XVJA 1LXFC 2JC2A 1WY9A 2K7OA 3LK1A 3EVUA 2H61C 1L2OB 3EK4A 1CFFA 1Y1XA 3NSLA 1OSAA 1K9UA 2SCPA 5ER4X 4NDDA 2LVIA 4JWQA 3CR2A 4PDZA 1J7PA 3VGOA 2JPTA 1DTLA 1M31A 1UWOA 1M63B 4E68A 3JVTC 1QX5B 1CDMA 3SG5A 1YX7A 1B47A 1ZFSA 2OPOA 4GAOA 4YGEB 1TCOB 1KQMC 3LL8B 4BY4A 3WHTB 2JU0A 2F2PA 2JNFA 2I7AA 1TNXA 1ZACA 4HRHA 3VROA 5IBWA 1OZOA 1FPWA 1UP5A 1EG3A 3JTDC 3DD4A 3BUOB 3FWBA 3OB2B 1KSMA 4YI9A 2MJWB 3SIAA 2L51A 3TDUA 1SL8A 1Y6WA 4PCWA 3EKHA 1TTXA 2K7BA 1M46A 2PSRA 2KI6D 3BUXB 1GJYA 2F8PA 4A4CA 1SNLA 2O5GA 3CGAA 3O2PA 4MVFA 4USLA 1ZUZA 2LVKA 1PRWA 3FIAA 1KFXL 1NWDA 3KF9A 3PSRA 4ICBA 1BODA 1XFWO 2ZN9A 3NXAA 1IJ6A 1QXPA 1E8AA 1GQMA 1MXLC 4DUQA 1S3PA 2MAZA 3F45A 2KYCA 4YRUA 1J55A 5G08A 2WNDA 2CBLA 3KPXA 3QRXA 1CFCA 4OKHA 2K0JA 4DIRA 5K89A 1KK7Z 1K9PA 2MHHA 3IF7A 1XYDA 1NCXA 1G4YR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CNP A;  1IJ5 A;  2PAL A;  1A03 A;  1A2X A;  1XFU O;  2CCM A;  3IQO A;  2FCD A;  2M9G A;  1QX2 A;  2LLS A;  1DJI A;  3D10 A;  1DJZ A;  1OE9 B;  1GGW A;  1UHJ A;  1XFX O;  2EHB A;  2K2A A;  4JPZ B;  2BCB A;  3VRQ A;  1JF2 A;  2HQ8 A;  2LCP A;  2FJU B;  2F2O A;  3NSK A;  1NX2 A;  1TIZ A;  1ZOT B;  2M7L A;  2KNE A;  1OMR A;  1OZS A;  1S6J A;  1U5I B;  4I5K A;  2K61 A;  3C1V A;  1IGV A;  2Y4Q A;  2KAX A;  2OTG C;  1QLS A;  1AK8 A;  5KTY A;  4MN0 A;  1KWO C;  4WQ3 A;  1YRU B;  1RRO A;  3I5H C;  1WDC B;  4MZJ A;  3RLZ A;  2LMU A;  2LP3 A;  2BL0 C;  1OMV A;  3FS7 A;  1HQV A;  1MQ1 A;  5AER A;  3EK8 A;  1Y1A A;  3BUM B;  2NXQ A;  4NQG A;  1IKU A;  1XK4 C;  1WRK A;  1QAT A;  1B8L A;  1RTP 1;  4MEW A;  5F6T A;  3VRN A;  1NSH A;  4MSP A;  2ZNE A;  1WLM A;  1A75 A;  1SR6 C;  1BF5 A;  1LVC D;  1IWQ A;  3PM8 A;  1PAL A;  1J7Q A;  1BMO A;  1EL4 A;  1F4O A;  1QIW A;  2GGM A;  3HCM A;  3SJS A;  2LNK A;  5GQQ C;  1Y0V H;  5J3X A;  4L9M A;  5JOL A;  2L2E A;  2LMV A;  3OP0 A;  1V1G A;  4Q04 A;  1K2H A;  1JUO A;  2EC6 C;  2LP2 A;  4I5N B;  4YI8 A;  4BY5 A;  1YVL A;  2VRG A;  1V1F A;  4OVN F;  3ZWH A;  1IH0 A;  2EGD A;  2CNP A;  3BUW B;  2DOQ A;  3TUY B;  1OQP A;  1J1D A;  1M45 A;  2LHL A;  1L2O C;  5DKQ A;  3EKJ A;  4IL1 A;  2M8U A;  2KBM A;  1R2U A;  5B8I B;  2AMI A;  1SBJ A;  2I2R E;  2K8M B;  2KI6 C;  1RJV A;  1CDN A;  2KBI A;  4GGN A;  5BPJ A;  1TNP A;  4OV2 A;  1F4Q A;  2Y1N A;  3BYA A;  3E3R A;  3LK0 A;  3DVK A;  2CT9 A;  1XFY O;  4GNK B;  4XJK A;  2ZKM X;  1QLK A;  1G8I A;  5CSF A;  2WC8 A;  4MRY A;  2ISD A;  5DKN A;  1PVA A;  1YUS A;  4M2Q A;  2PRU A;  4MZK A;  2H2K A;  1DGU A;  2JWW A;  2K7D A;  4N5X A;  3CTN A;  2WCF A;  1B4C A;  1UHK A;  2ZN8 A;  4R1E A;  2KI4 B;  1XK4 A;  1QS7 A;  4C0L A;  2KFG A;  4YGC B;  1NCY A;  4JQ0 D;  1MF8 B;  1F8H A;  1XA5 A;  2RGI A;  4PE4 A;  1D1O A;  1CM1 A;  1R6P A;  2K2F A;  1BU3 A;  1AJ4 A;  3ZNI A;  1TNW A;  1YTZ C;  4PE1 A;  1S26 D;  1IQ5 A;  3OX5 A;  2M29 A;  1EH2 A;  2L0P A;  3BOW A;  1SYM A;  3AAK A;  5D7F A;  3SG2 A;  3TDI A;  1J7R A;  3PAL A;  1JWD A;  1FF1 A;  5DKR A;  5D69 A;  1S6C A;  5HYD A;  2PMY A;  2KAV A;  1AVS A;  2E6W A;  3SG7 A;  1PVB A;  2NCP A;  1XO5 A;  2HET A;  1TNQ A;  1CLM A;  2JRF A;  4M2O A;  1NIW A;  1CM4 A;  4ORB B;  2BE6 A;  1DT7 B;  1TOP A;  3PLF B;  1F54 A;  2H61 A;  3EVR A;  1QAS A;  1JFK A;  1A29 A;  2Q4U A;  3I5I B;  1SCM B;  1JC2 A;  1H8B A;  1NUB A;  2LUC A;  2MA2 A;  1SCV A;  1K93 D;  1YUT A;  1CTR A;  1XFV O;  2SAS A;  1IG5 A;  3FWC A;  1Y1U A;  2GGZ A;  4P5O E;  4N1F A;  3TZ1 A;  2I18 A;  1JSA A;  1YX8 A;  1XFZ O;  1QV1 A;  3CWG A;  1RWY A;  4UPG A;  3I5F B;  1KK8 B;  2V53 A;  1CMG A;  1Q80 A;  1PSB A;  5HLO A;  1KQV A;  4NDB A;  1KCY A;  1QV0 A;  2M3W A;  1WRL A;  5KSZ A;  5I2L A;  2MLF C;  3A8R A;  1H4B A;  1L7Z A;  4YGD B;  2M1U A;  1SMG A;  3HX4 A;  2KQ6 A;  1N65 A;  3ICB A;  4YGB B;  4YGA A;  1BOC A;  1NPQ A;  5JJG A;  1WDC C;  1LA3 A;  3DVM A;  2ZFD A;  1ALW A;  2BKH B;  1PSR A;  1YR5 A;  1N2D A;  5I2Q A;  2QAC A;  4M2P A;  1CFP A;  4QJ4 B;  1NYA A;  3KO0 A;  2G2B A;  1DF0 A;  2HPS A;  3GK2 A;  1ALV A;  1K9K A;  1YVH A;  1KFU S;  1NP8 A;  3KHE A;  1DJY A;  2CXJ A;  2KYF A;  4XJK B;  4AQI A;  4QJ5 B;  1S6I A;  3BUN B;  1QTX A;  1CKK A;  2L4I A;  1JF0 A;  1SPY A;  2JUL A;  1BR1 B;  2AAO A;  5CSI A;  1J7O A;  1K96 A;  1YUR A;  2R2I A;  1UHI A;  1SRA A;  5AFP A;  1MWN A;  3A4U B;  2BKI B;  5HKW A;  1OOJ A;  5HLV A;  1JFJ A;  3D0Y A;  2JT0 A;  4C0K A;  2TN4 A;  2JZI A;  1TCF A;  1DVI A;  4MBE A;  1SL7 A;  3TUY C;  1REC A;  2LHI A;  1UHH A;  4PE0 A;  2MLE C;  4DCK A;  3OB1 B;  1ZMZ A;  2COL B;  1BT6 A;  1YUU A;  3VRP A;  1NCZ A;  3I5G B;  3GK1 A;  2BCX A;  4PHN A;  3EK7 A;  3BOW B;  1DMO A;  1QJT A;  4CFR A;  4U8D A;  2JOJ A;  2I94 A;  3SG6 A;  1YRT B;  3WNX B;  3PN7 B;  2FCE A;  4CID A;  1CDP A;  1KFU L;  1UUR A;  1BLQ A;  1F70 A;  2Y1M A;  1DJW A;  1U5I A;  2JT8 A;  2WOR A;  1LKJ A;  2GV5 A;  2OS8 B;  1PK0 D;  2ZRS A;  3GOF A;  2LUX A;  4PHK A;  1RFJ A;  5FYX A;  2L5X B;  3VRR A;  3TS5 B;  4OCI A;  1BJF A;  3DF0 A;  4HRE E;  1GGZ A;  2Y5I A;  3OX6 A;  1DJX A;  1B8C A;  1CB1 A;  5I2O A;  1CLB A;  1SK6 D;  1W7J B;  3RM1 A;  4AQJ A;  2G9B A;  2LMT A;  1W7I B;  3SIB A;  2L50 A;  1JBA A;  1S5G Z;  2KI4 C;  5HKZ A;  4GGF C;  4ORC B;  1KFX S;  4WQ2 A;  1C07 A;  3JVT B;  1S5G Y;  2M0R A;  2ZRT A;  4N1G A;  1KSO A;  2BBN A;  1EXR A;  1J1E A;  1A4P A;  2LVV A;  3BXK A;  4YBH B;  1UUS A;  4GUK A;  1KQM B;  2KOT A;  4WRI A;  2LLT A;  3H4S E;  1TN4 A;  1BR4 B;  1B7T Z;  1MR8 A;  4PHM A;  1QIV A;  3OHM B;  2BEC A;  1NX1 A;  2KFH A;  3AKA A;  3CZT X;  5TNC A;  1B7T Y;  1FBV A;  3JTD B;  2JT3 A;  1QX7 A;  2ZND A;  5AXI A;  1C7V A;  1TRF A;  2LC5 A;  1K90 D;  4TNC A;  2F3Z A;  3WHU B;  2LE9 B;  3AAJ A;  3SG4 A;  1DGV A;  1G33 A;  5CPV A;  2BCA A;  1B8R A;  1K94 A;  5ER5 A;  2B1U A;  3DVE A;  4MRX A;  2BE4 A;  2KFF A;  2CTN A;  3I5I C;  1SCM C;  2QPT A;  2A4J A;  1DF0 B;  2HF5 A;  1HT9 A;  2M97 A;  1MXE A;  2LM5 A;  3PAT A;  1MHO A;  2M49 B;  2D8N A;  2E30 A;  1ODB A;  4PE7 A;  1A75 B;  4CPV A;  1CMF A;  1DJH A;  2MRD A;  1VRK A;  1FW4 A;  4NDC A;  1CFD A;  3CS1 A;  4GBA A;  2JTZ A;  2NLN A;  2F3Y A;  4GFT A;  3I5F C;  1KK8 C;  2JNX A;  4FTG A;  1C7W A;  3CLN A;  5CSJ A;  4ZCU A;  1RK9 A;  4A4B A;  4I5J A;  4FQO A;  1B9A A;  2Q91 A;  4GPL B;  2KSP A;  1S1E A;  1LIN A;  1KK7 Y;  3D0Y B;  2JTT A;  2NCO A;  2LLU A;  1OMD A;  1UHN A;  2LVJ A;  4C0J A;  4PAL A;  4GGF A;  1F71 A;  4QJ3 B;  1S36 A;  4HRG A;  3TDZ A;  1SL9 A;  4MLW A;  2WCB A;  1DJG A;  3M0W A;  4AOM A;  2M1K B;  1CLL A;  4D1E A;  4OR9 B;  2KAY A;  2L98 A;  3PFV A;  1AUI B;  1WLZ A;  3DVJ A;  3CR5 X;  3O4Y A;  3O78 A;  4ORA B;  2PVB A;  4XYN A;  1K95 A;  1F55 A;  1N0Y A;  1X02 A;  5KU1 A;  2O60 A;  2KGR A;  2P6B B;  1MUX A;  3O6B A;  3IQQ A;  1K8U A;  2JXL A;  4CLN A;  2OTG B;  5PAL A;  2F33 A;  1QVI Z;  2FOT A;  2MBX A;  1KWO B;  2KGB C;  3DF0 B;  1AP4 A;  2K7C A;  3KEV A;  3K21 A;  2JXC A;  2LAN A;  3I5H B;  4CFQ A;  1QVI Y;  5AEQ A;  1SW8 A;  2NZ0 A;  5I8N A;  3CR4 X;  2BL0 B;  3GK4 X;  2PAS A;  3LLE A;  1FI6 A;  5AAN A;  5HKY A;  4HSZ A;  4I5L B;  2KQY A;  2HQW A;  2KDH A;  1FI5 A;  4DS7 A;  2LV7 A;  2KHN A;  3AKB A;  1EJ3 A;  1LA0 A;  2IS9 A;  1M39 A;  4P2Y B;  3NSI A;  3WXA A;  1SR6 B;  1B1G A;  1BG1 A;  2WOS A;  3I5G C;  1IRJ A;  4DRW A;  5CSN A;  1NX3 A;  1SY9 A;  1NX0 A;  2LAP A;  3MSE B;  1WRZ A;  4ZCV A;  2WCE A;  2L4H A;  4PHJ A;  2M7N A;  4MZL A;  3PN7 C;  3SG3 A;  1PUL A;  3EVV A;  4ETO A;  2BBM A;  2EC6 B;  3BQ3 A;  3NSO A;  3LCP C;  1AJ5 A;  1EG4 A;  2AUC A;  1CDL A;  2OS8 C;  4F0Z B;  2JQ6 A;  1IQ3 A;  1SKT A;  3TS5 C;  1AHR A;  1XVJ A;  1LXF C;  2JC2 A;  1WY9 A;  2K7O A;  3LK1 A;  3EVU A;  2H61 C;  1L2O B;  3EK4 A;  1CFF A;  1Y1X A;  3NSL A;  1OSA A;  1K9U A;  2SCP A;  5ER4 X;  4NDD A;  2LVI A;  4JWQ A;  3CR2 A;  4PDZ A;  1J7P A;  3VGO A;  2JPT A;  1DTL A;  1M31 A;  1UWO A;  1M63 B;  4E68 A;  3JVT C;  1QX5 B;  1CDM A;  3SG5 A;  1YX7 A;  1B47 A;  1ZFS A;  2OPO A;  4GAO A;  4YGE B;  1TCO B;  1KQM C;  3LL8 B;  4BY4 A;  3WHT B;  2JU0 A;  2F2P A;  2JNF A;  2I7A A;  1TNX A;  1ZAC A;  4HRH A;  3VRO A;  5IBW A;  1OZO A;  1FPW A;  1UP5 A;  1EG3 A;  3JTD C;  3DD4 A;  3BUO B;  3FWB A;  3OB2 B;  1KSM A;  4YI9 A;  2MJW B;  3SIA A;  2L51 A;  3TDU A;  1SL8 A;  1Y6W A;  4PCW A;  3EKH A;  1TTX A;  2K7B A;  1M46 A;  2PSR A;  2KI6 D;  3BUX B;  1GJY A;  2F8P A;  4A4C A;  1SNL A;  2O5G A;  3CGA A;  3O2P A;  4MVF A;  4USL A;  1ZUZ A;  2LVK A;  1PRW A;  3FIA A;  1KFX L;  1NWD A;  3KF9 A;  3PSR A;  4ICB A;  1BOD A;  1XFW O;  2ZN9 A;  3NXA A;  1IJ6 A;  1QXP A;  1E8A A;  1GQM A;  1MXL C;  4DUQ A;  1S3P A;  2MAZ A;  3F45 A;  2KYC A;  4YRU A;  1J55 A;  5G08 A;  2WND A;  2CBL A;  3KPX A;  3QRX A;  1CFC A;  4OKH A;  2K0J A;  4DIR A;  5K89 A;  1KK7 Z;  1K9P A;  2MHH A;  3IF7 A;  1XYD A;  1NCX A;  1G4Y R; 
#chains in the Genus database with same CATH topology
 1CNP A;  1IJ5 A;  2PAL A;  1A03 A;  1A2X A;  1XFU O;  2PQL A;  2CCM A;  3IQO A;  2FCD A;  2M9G A;  1QX2 A;  2LLS A;  1DEL A;  1DJI A;  3D10 A;  1DJZ A;  1OE9 B;  1GGW A;  1UHJ A;  1XFX O;  2EHB A;  2K2A A;  4JPZ B;  1TUZ A;  2BCB A;  3VRQ A;  1JF2 A;  2HQ8 A;  2LCP A;  2FJU B;  2F2O A;  3NSK A;  1NX2 A;  1TIZ A;  1ZOT B;  2M7L A;  2KNE A;  1OMR A;  1OZS A;  1S6J A;  1U5I B;  3DXL A;  4I5K A;  2K61 A;  3C1V A;  1IGV A;  2Y4Q A;  2KAX A;  2OTG C;  1QLS A;  1AK8 A;  3QME A;  4MN0 A;  5KTY A;  1KWO C;  4WQ3 A;  1YRU B;  1RRO A;  3I5H C;  1WDC B;  4MZJ A;  3RLZ A;  2LMU A;  3DY9 A;  2LP3 A;  2BL0 C;  1OMV A;  3FS7 A;  1HQV A;  1MQ1 A;  5AER A;  3EK8 A;  2QEB A;  1Y1A A;  3BUM B;  2NXQ A;  4NQG A;  1IKU A;  2WC6 A;  1XK4 C;  1WRK A;  1QAT A;  1B8L A;  1RTP 1;  4MEW A;  5F6T A;  3VRN A;  1NSH A;  4MSP A;  2ZNE A;  1WLM A;  1ORG A;  1A75 A;  1SR6 C;  3OBV A;  1BF5 A;  1LVC D;  1IWQ A;  3PM8 A;  1PAL A;  1J7Q A;  1BMO A;  1EL4 A;  1F4O A;  1OOF A;  1QIW A;  2GGM A;  3HCM A;  3SJS A;  2LNK A;  1IIO A;  3B87 A;  5GQQ C;  4IJ7 A;  1Y0V H;  5J3X A;  4L9M A;  5JOL A;  2L2E A;  2LMV A;  3OP0 A;  1V1G A;  4Q04 A;  1K2H A;  1JUO A;  2EC6 C;  2LP2 A;  4I5N B;  4YI8 A;  4BY5 A;  1YVL A;  2VRG A;  1V1F A;  3O4X A;  4OVN F;  3ZWH A;  3V2L A;  1IH0 A;  2EGD A;  2KLD A;  2CNP A;  3BUW B;  2DOQ A;  3TUY B;  1OQP A;  1J1D A;  1M45 A;  2LHL A;  1L2O C;  5DKQ A;  3EKJ A;  3D78 A;  4IL1 A;  2M8U A;  3L4L A;  2KBM A;  1R2U A;  1TUJ A;  2AMI A;  1SBJ A;  2I2R E;  2K8M B;  2KI6 C;  5B8I B;  1RJV A;  1OOH A;  2KBI A;  2P70 A;  4GGN A;  5BPJ A;  1CDN A;  1OOI X;  1TNP A;  1F4Q A;  4OV2 A;  2Y1N A;  3BYA A;  3E3R A;  3LK0 A;  3DVK A;  2CT9 A;  1XFY O;  4GNK B;  4XJK A;  2ZKM X;  1QLK A;  1G8I A;  5CSF A;  2WC8 A;  4MRY A;  2ISD A;  5DKN A;  1PVA A;  1YUS A;  4M2Q A;  2PRU A;  4MZK A;  2H2K A;  1DGU A;  3NHT A;  2JWW A;  3BFB A;  2K7D A;  4N5X A;  4OZD A;  3CTN A;  2WCF A;  3UO9 A;  1B4C A;  1UHK A;  2ZN8 A;  4R1E A;  2KI4 B;  1XK4 A;  1QS7 A;  4C0L A;  2KFG A;  4YGC B;  1NCY A;  4JQ0 D;  2L2C A;  3L4A A;  1MF8 B;  1F8H A;  1XA5 A;  2RGI A;  4PE4 A;  1D1O A;  1CM1 A;  1R6P A;  2K2F A;  1QWV A;  1BU3 A;  1AJ4 A;  3ZNI A;  1TNW A;  1YTZ C;  1Z2C B;  3PJI A;  4PE1 A;  1S26 D;  1IQ5 A;  3OX5 A;  2M29 A;  1EH2 A;  2L0P A;  3BOW A;  1SYM A;  3AAK A;  5D7F A;  3SG2 A;  3TDI A;  1J7R A;  3PAL A;  3S0E A;  1JWD A;  1FF1 A;  5DKR A;  5D69 A;  1S6C A;  5HYD A;  3D77 A;  2PMY A;  2WCH A;  3EG5 B;  2KAV A;  4F7F A;  1AVS A;  2E6W A;  4FQT A;  3SG7 A;  1PVB A;  2NCP A;  5FI2 A;  1XO5 A;  2HET A;  1P28 A;  1TNQ A;  1CLM A;  2JRF A;  4M2O A;  1NIW A;  1CM4 A;  4ORB B;  2BE6 A;  1DT7 B;  1TOP A;  3PLF B;  1F54 A;  2H61 A;  3EVR A;  1QAS A;  2WCK A;  1JFK A;  1A29 A;  2Q4U A;  2WCL A;  3I5I B;  1SCM B;  1JC2 A;  1H8B A;  1NUB A;  2LUC A;  2MA2 A;  1SCV A;  2H8V A;  1K93 D;  1YUT A;  1CTR A;  1XFV O;  2SAS A;  1IG5 A;  3FWC A;  1Y1U A;  2GGZ A;  1SSE B;  4P5O E;  2WCM A;  4N1F A;  3TZ1 A;  2I18 A;  1JSA A;  1YX8 A;  1XFZ O;  1QV1 A;  3CWG A;  1RWY A;  4UPG A;  3I5F B;  1KK8 B;  2V53 A;  4PT1 A;  1Q80 A;  1CMG A;  1PSB A;  5HLO A;  1KQV A;  4NDB A;  3CZ0 A;  1KCY A;  1QV0 A;  2M3W A;  1WRL A;  5KSZ A;  5I2L A;  3SS5 A;  2MLF C;  3A8R A;  1H4B A;  1L7Z A;  2ERB A;  2M1U A;  4YGD B;  1SMG A;  3HX4 A;  2KQ6 A;  1N65 A;  3ICB A;  4YGB B;  4YGA A;  2WC5 A;  1BOC A;  1NPQ A;  5JJG A;  1WDC C;  1LA3 A;  3DVM A;  2ZFD A;  3S0D A;  1ALW A;  2BKH B;  1PSR A;  1YR5 A;  1N2D A;  5I2Q A;  2QAC A;  4M2P A;  1CFP A;  4QJ4 B;  1NYA A;  3KO0 A;  2G2B A;  1DF0 A;  2HPS A;  3GK2 A;  3SS3 A;  1ALV A;  1K9K A;  1YVH A;  3FE8 A;  1KFU S;  1NP8 A;  5I94 A;  3KHE A;  1DJY A;  2CXJ A;  2KYF A;  4XJK B;  4AQI A;  4QJ5 B;  3D76 A;  1S6I A;  3BUN B;  1QTX A;  1CKK A;  2L4I A;  3CAB A;  1JF0 A;  1SPY A;  2JUL A;  1BR1 B;  2AAO A;  5CSI A;  1J7O A;  2WCJ A;  1K96 A;  1YUR A;  2R2I A;  1UHI A;  1SRA A;  5AFP A;  1MWN A;  3A4U B;  5D3O A;  2BKI B;  5HKW A;  3S0G A;  1OOJ A;  5HLV A;  1JFJ A;  3D0Y A;  2JT0 A;  4C0K A;  2TN4 A;  2JZI A;  1TCF A;  1DVI A;  4MBE A;  2KPH A;  1SL7 A;  3TUY C;  1REC A;  2LHI A;  1UHH A;  4PE0 A;  2MLE C;  4DCK A;  3OB1 B;  1ZMZ A;  2COL B;  1BT6 A;  1YUU A;  3VRP A;  3K1E A;  1NCZ A;  3I5G B;  3GK1 A;  2BCX A;  4PHN A;  3EK7 A;  3BOW B;  1DMO A;  1QJT A;  4CFR A;  4U8D A;  2JOJ A;  2I94 A;  3SG6 A;  1YRT B;  1OOG A;  1T14 A;  3WNX B;  3PN7 B;  2FCE A;  4CID A;  1CDP A;  1KFU L;  1UUR A;  1BLQ A;  1F70 A;  2Y1M A;  1DJW A;  1U5I A;  2JT8 A;  2WOR A;  1LKJ A;  2GV5 A;  2OS8 B;  1PK0 D;  2ZRS A;  3GOF A;  2LUX A;  3PM2 A;  1RFJ A;  4PHK A;  2L5X B;  5FYX A;  3VRR A;  2QDI A;  3TS5 B;  4OCI A;  1BJF A;  3DF0 A;  4HRE E;  1GGZ A;  2Y5I A;  3OX6 A;  1DJX A;  1B8C A;  3BFA A;  5I2O A;  1CB1 A;  1CLB A;  1SK6 D;  1W7J B;  3RM1 A;  4AQJ A;  2G9B A;  2LMT A;  3RZS A;  1W7I B;  3SIB A;  2L50 A;  1Z4H A;  1JBA A;  1S5G Z;  2KI4 C;  4INW A;  4GGF C;  4ORC B;  5HKZ A;  1KFX S;  4WQ2 A;  1C07 A;  3JVT B;  1S5G Y;  2M0R A;  2ZRT A;  4N1G A;  1KSO A;  2BBN A;  2GTE A;  1EXR A;  1J1E A;  1A4P A;  2LVV A;  3BXK A;  3IVT A;  1UUS A;  4GUK A;  1KQM B;  2KOT A;  1GM0 A;  1C3Z A;  3FE6 A;  4WRI A;  2LLT A;  3H4S E;  1TN4 A;  1BR4 B;  1B7T Z;  1MR8 A;  4PHM A;  1QIV A;  3OHM B;  2BEC A;  1NX1 A;  2KFH A;  3AKA A;  3CZT X;  5TNC A;  1B7T Y;  1FBV A;  3JTD B;  2JT3 A;  1XFR A;  1QX7 A;  2ZND A;  5AXI A;  1C7V A;  2YGU A;  4JKT A;  1TRF A;  2LC5 A;  1K90 D;  4TNC A;  2F3Z A;  3WHU B;  2LE9 B;  3AAJ A;  3SG4 A;  1DGV A;  1G33 A;  5CPV A;  2BCA A;  1B8R A;  1K94 A;  2L5Y A;  5ER5 A;  2B1U A;  3DVE A;  4MRX A;  2BE4 A;  2KFF A;  2CTN A;  3I5I C;  1SCM C;  2QPT A;  5FI7 A;  2A4J A;  3N7H A;  1DF0 B;  3SS4 A;  3L47 A;  2HF5 A;  1HT9 A;  2M97 A;  1MXE A;  2LM5 A;  3PAT A;  1MHO A;  2M49 B;  2D8N A;  2E30 A;  1ODB A;  4PE7 A;  1A75 B;  4CPV A;  1CMF A;  1DJH A;  2MRD A;  1VRK A;  1FW4 A;  4NDC A;  1CFD A;  3CS1 A;  4GBA A;  3S0F A;  2JTZ A;  2NLN A;  2QEO A;  2F3Y A;  2FJY A;  4GFT A;  3I5F C;  1KK8 C;  2JNX A;  4FTG A;  1C7W A;  3CLN A;  5CSJ A;  4ZCU A;  1RK9 A;  3D74 A;  4A4B A;  4I5J A;  4FQO A;  1B9A A;  2Q91 A;  4GPL B;  2KSP A;  1S1E A;  1LIN A;  1KK7 Y;  2P71 A;  3CYZ A;  2JTT A;  2NCO A;  3D0Y B;  2LLU A;  1OMD A;  1UHN A;  2LVJ A;  4C0J A;  4PAL A;  4GGF A;  1F71 A;  4QJ3 B;  1S36 A;  4HRG A;  3TDZ A;  1SL9 A;  4MLW A;  3DYE A;  2WCB A;  1DJG A;  3M0W A;  4AOM A;  2M1K B;  1CLL A;  4D1E A;  4OR9 B;  1C3Y A;  2KAY A;  2L98 A;  3PFV A;  1AUI B;  1WLZ A;  3DVJ A;  3CR5 X;  3O4Y A;  3O78 A;  4ORA B;  5EL2 A;  2PVB A;  3R1P A;  4XYN A;  1K95 A;  2JPO A;  1F55 A;  1N0Y A;  4KYN A;  1X02 A;  5FI6 A;  5KU1 A;  2O60 A;  2KGR A;  2P6B B;  1MUX A;  3BFH A;  3O6B A;  3IQQ A;  3NGV A;  1K8U A;  2JXL A;  4CLN A;  2OTG B;  5PAL A;  2F33 A;  1QVI Z;  2FOT A;  2MBX A;  1KWO B;  2KGB C;  3DF0 B;  1AP4 A;  2K7C A;  3KEV A;  3K21 A;  3B86 A;  2JXC A;  2LAN A;  3I5H B;  3OGN A;  3Q8I A;  4CFQ A;  1QVI Y;  5AEQ A;  1SW8 A;  2NZ0 A;  5I8N A;  3CR4 X;  2BL0 B;  3GK4 X;  1DQE A;  2PAS A;  3LLE A;  1FI6 A;  5AAN A;  5HKY A;  4HSZ A;  4I5L B;  2KQY A;  3B88 A;  2HQW A;  2KDH A;  1FI5 A;  4DS7 A;  2BAP A;  2KLE A;  2LV7 A;  2KHN A;  3NHI A;  3AKB A;  1EJ3 A;  1LA0 A;  2IS9 A;  1M39 A;  4P2Y B;  3NSI A;  3WXA A;  1SR6 B;  1B1G A;  1BG1 A;  2WOS A;  3I5G C;  1IRJ A;  2QEH A;  4DRW A;  5CSN A;  1NX3 A;  1SY9 A;  1NX0 A;  2LAP A;  3MSE B;  3R1V A;  1WRZ A;  3R1O A;  3B7A A;  4ZCV A;  2WCE A;  2L4H A;  4PHJ A;  2M7N A;  4MZL A;  3PN7 C;  3SG3 A;  1PUL A;  3EVV A;  3S0A A;  4ETO A;  2BBM A;  2EC6 B;  3BQ3 A;  3NSO A;  4YBH B;  3LCP C;  1AJ5 A;  1EG4 A;  2AUC A;  1CDL A;  2OS8 C;  3R72 A;  4F0Z B;  1OW4 A;  2JQ6 A;  3CZ1 A;  1IQ3 A;  1SKT A;  3TS5 C;  1AHR A;  1XVJ A;  1LXF C;  2JC2 A;  1WY9 A;  2K7O A;  3LK1 A;  3CZ2 A;  3EVU A;  2H61 C;  1L2O B;  3EK4 A;  1CFF A;  1Y1X A;  3NSL A;  1OSA A;  1K9U A;  2SCP A;  5ER4 X;  1W9Z A;  4NDD A;  2LVI A;  3CDN A;  4JWQ A;  3CR2 A;  4PDZ A;  1J7P A;  3VGO A;  2JPT A;  1DC1 A;  1DTL A;  1M31 A;  1UWO A;  1DEK A;  1M63 B;  4E68 A;  3JVT C;  1QX5 B;  1CDM A;  3SG5 A;  1YX7 A;  1B47 A;  1ZFS A;  2OPO A;  4GAO A;  4YGE B;  1TCO B;  1KQM C;  3D75 A;  3S0B A;  3LL8 B;  4BY4 A;  3WHT B;  2JU0 A;  2F2P A;  2JNF A;  2QEV A;  2I7A A;  1TNX A;  1ZAC A;  4HRH A;  1LS8 A;  3VRO A;  5IBW A;  1OZO A;  3B6X A;  1UP5 A;  1FPW A;  1EG3 A;  5DIC A;  3JTD C;  3DD4 A;  3VB1 A;  3BUO B;  3FWB A;  3OB2 B;  1KSM A;  4YI9 A;  4JD9 A;  2MJW B;  3SIA A;  3UNW A;  2L51 A;  3TDU A;  1SL8 A;  1Y6W A;  4PCW A;  3EKH A;  1TTX A;  2K7B A;  2PYQ A;  1M46 A;  2PSR A;  2KI6 D;  3BUX B;  1GJY A;  2F8P A;  5HL1 A;  4A4C A;  1SNL A;  2O5G A;  3CGA A;  3O2P A;  4MVF A;  4USL A;  1ZUZ A;  2LVK A;  1PRW A;  3FIA A;  1KFX L;  4INX A;  1NWD A;  3KF9 A;  3PSR A;  3D73 A;  4ICB A;  1BOD A;  1XFW O;  3FE9 A;  2ZN9 A;  3NXA A;  1IJ6 A;  1QXP A;  1E8A A;  1GQM A;  1MXL C;  4DUQ A;  1S3P A;  2MAZ A;  3F45 A;  2KYC A;  4YRU A;  1J55 A;  5G08 A;  1TWO A;  2WND A;  2CBL A;  3KPX A;  3QRX A;  2BNX A;  4OKH A;  2K0J A;  3DZT A;  3BJH A;  4DIR A;  5K89 A;  1CFC A;  1KK7 Z;  1K9P A;  2MHH A;  2K60 A;  3IF7 A;  1XYD A;  1NCX A;  1G4Y R; 
#chains in the Genus database with same CATH homology
 1CNP A;  1IJ5 A;  2PAL A;  1A03 A;  1A2X A;  1XFU O;  2CCM A;  3IQO A;  2FCD A;  2M9G A;  1QX2 A;  2LLS A;  1DJI A;  3D10 A;  1DJZ A;  1OE9 B;  1GGW A;  1UHJ A;  1XFX O;  2EHB A;  2K2A A;  4JPZ B;  2BCB A;  3VRQ A;  1JF2 A;  2HQ8 A;  2LCP A;  2FJU B;  2F2O A;  3NSK A;  1NX2 A;  1TIZ A;  1ZOT B;  2M7L A;  2KNE A;  1OMR A;  1OZS A;  1S6J A;  1U5I B;  4I5K A;  2K61 A;  3C1V A;  1IGV A;  2Y4Q A;  2KAX A;  2OTG C;  1QLS A;  1AK8 A;  5KTY A;  4MN0 A;  1KWO C;  4WQ3 A;  1YRU B;  1RRO A;  3I5H C;  1WDC B;  4MZJ A;  3RLZ A;  2LMU A;  2LP3 A;  2BL0 C;  1OMV A;  3FS7 A;  1HQV A;  1MQ1 A;  5AER A;  3EK8 A;  1Y1A A;  3BUM B;  2NXQ A;  4NQG A;  1IKU A;  1XK4 C;  1WRK A;  1QAT A;  1B8L A;  1RTP 1;  4MEW A;  5F6T A;  3VRN A;  1NSH A;  4MSP A;  2ZNE A;  1WLM A;  1A75 A;  1SR6 C;  1BF5 A;  1LVC D;  1IWQ A;  3PM8 A;  1PAL A;  1J7Q A;  1BMO A;  1EL4 A;  1F4O A;  1QIW A;  2GGM A;  3HCM A;  3SJS A;  2LNK A;  5GQQ C;  1Y0V H;  5J3X A;  4L9M A;  5JOL A;  2L2E A;  2LMV A;  3OP0 A;  1V1G A;  4Q04 A;  1K2H A;  1JUO A;  2EC6 C;  2LP2 A;  4I5N B;  4YI8 A;  4BY5 A;  1YVL A;  2VRG A;  1V1F A;  4OVN F;  3ZWH A;  1IH0 A;  2EGD A;  2CNP A;  3BUW B;  2DOQ A;  3TUY B;  1OQP A;  1J1D A;  1M45 A;  2LHL A;  1L2O C;  5DKQ A;  3EKJ A;  4IL1 A;  2M8U A;  2KBM A;  1R2U A;  5B8I B;  2AMI A;  1SBJ A;  2I2R E;  2K8M B;  2KI6 C;  1RJV A;  1CDN A;  2KBI A;  4GGN A;  5BPJ A;  1TNP A;  4OV2 A;  1F4Q A;  2Y1N A;  3BYA A;  3E3R A;  3LK0 A;  3DVK A;  2CT9 A;  1XFY O;  4GNK B;  4XJK A;  2ZKM X;  1QLK A;  1G8I A;  5CSF A;  2WC8 A;  4MRY A;  2ISD A;  5DKN A;  1PVA A;  1YUS A;  4M2Q A;  2PRU A;  4MZK A;  2H2K A;  1DGU A;  2JWW A;  2K7D A;  4N5X A;  3CTN A;  2WCF A;  1B4C A;  1UHK A;  2ZN8 A;  4R1E A;  2KI4 B;  1XK4 A;  1QS7 A;  4C0L A;  2KFG A;  4YGC B;  1NCY A;  4JQ0 D;  1MF8 B;  1F8H A;  1XA5 A;  2RGI A;  4PE4 A;  1D1O A;  1CM1 A;  1R6P A;  2K2F A;  1BU3 A;  1AJ4 A;  3ZNI A;  1TNW A;  1YTZ C;  4PE1 A;  1S26 D;  1IQ5 A;  3OX5 A;  2M29 A;  1EH2 A;  2L0P A;  3BOW A;  1SYM A;  3AAK A;  5D7F A;  3SG2 A;  3TDI A;  1J7R A;  3PAL A;  1JWD A;  1FF1 A;  5DKR A;  5D69 A;  1S6C A;  5HYD A;  2PMY A;  2KAV A;  1AVS A;  2E6W A;  3SG7 A;  1PVB A;  2NCP A;  1XO5 A;  2HET A;  1TNQ A;  1CLM A;  2JRF A;  4M2O A;  1NIW A;  1CM4 A;  4ORB B;  2BE6 A;  1DT7 B;  1TOP A;  3PLF B;  1F54 A;  2H61 A;  3EVR A;  1QAS A;  1JFK A;  1A29 A;  2Q4U A;  3I5I B;  1SCM B;  1JC2 A;  1H8B A;  1NUB A;  2LUC A;  2MA2 A;  1SCV A;  1K93 D;  1YUT A;  1CTR A;  1XFV O;  2SAS A;  1IG5 A;  3FWC A;  1Y1U A;  2GGZ A;  4P5O E;  4N1F A;  3TZ1 A;  2I18 A;  1JSA A;  1YX8 A;  1XFZ O;  1QV1 A;  3CWG A;  1RWY A;  4UPG A;  3I5F B;  1KK8 B;  2V53 A;  1CMG A;  1Q80 A;  1PSB A;  5HLO A;  1KQV A;  4NDB A;  1KCY A;  1QV0 A;  2M3W A;  1WRL A;  5KSZ A;  5I2L A;  2MLF C;  3A8R A;  1H4B A;  1L7Z A;  4YGD B;  2M1U A;  1SMG A;  3HX4 A;  2KQ6 A;  1N65 A;  3ICB A;  4YGB B;  4YGA A;  1BOC A;  1NPQ A;  5JJG A;  1WDC C;  1LA3 A;  3DVM A;  2ZFD A;  1ALW A;  2BKH B;  1PSR A;  1YR5 A;  1N2D A;  5I2Q A;  2QAC A;  4M2P A;  1CFP A;  4QJ4 B;  1NYA A;  3KO0 A;  2G2B A;  1DF0 A;  2HPS A;  3GK2 A;  1ALV A;  1K9K A;  1YVH A;  1KFU S;  1NP8 A;  3KHE A;  1DJY A;  2CXJ A;  2KYF A;  4XJK B;  4AQI A;  4QJ5 B;  1S6I A;  3BUN B;  1QTX A;  1CKK A;  2L4I A;  1JF0 A;  1SPY A;  2JUL A;  1BR1 B;  2AAO A;  5CSI A;  1J7O A;  1K96 A;  1YUR A;  2R2I A;  1UHI A;  1SRA A;  5AFP A;  1MWN A;  3A4U B;  2BKI B;  5HKW A;  1OOJ A;  5HLV A;  1JFJ A;  3D0Y A;  2JT0 A;  4C0K A;  2TN4 A;  2JZI A;  1TCF A;  1DVI A;  4MBE A;  1SL7 A;  3TUY C;  1REC A;  2LHI A;  1UHH A;  4PE0 A;  2MLE C;  4DCK A;  3OB1 B;  1ZMZ A;  2COL B;  1BT6 A;  1YUU A;  3VRP A;  1NCZ A;  3I5G B;  3GK1 A;  2BCX A;  4PHN A;  3EK7 A;  3BOW B;  1DMO A;  1QJT A;  4CFR A;  4U8D A;  2JOJ A;  2I94 A;  3SG6 A;  1YRT B;  3WNX B;  3PN7 B;  2FCE A;  4CID A;  1CDP A;  1KFU L;  1UUR A;  1BLQ A;  1F70 A;  2Y1M A;  1DJW A;  1U5I A;  2JT8 A;  2WOR A;  1LKJ A;  2GV5 A;  2OS8 B;  1PK0 D;  2ZRS A;  3GOF A;  2LUX A;  4PHK A;  1RFJ A;  5FYX A;  2L5X B;  3VRR A;  3TS5 B;  4OCI A;  1BJF A;  3DF0 A;  4HRE E;  1GGZ A;  2Y5I A;  3OX6 A;  1DJX A;  1B8C A;  1CB1 A;  5I2O A;  1CLB A;  1SK6 D;  1W7J B;  3RM1 A;  4AQJ A;  2G9B A;  2LMT A;  1W7I B;  3SIB A;  2L50 A;  1JBA A;  1S5G Z;  2KI4 C;  5HKZ A;  4GGF C;  4ORC B;  1KFX S;  4WQ2 A;  1C07 A;  3JVT B;  1S5G Y;  2M0R A;  2ZRT A;  4N1G A;  1KSO A;  2BBN A;  1EXR A;  1J1E A;  1A4P A;  2LVV A;  3BXK A;  4YBH B;  1UUS A;  4GUK A;  1KQM B;  2KOT A;  4WRI A;  2LLT A;  3H4S E;  1TN4 A;  1BR4 B;  1B7T Z;  1MR8 A;  4PHM A;  1QIV A;  3OHM B;  2BEC A;  1NX1 A;  2KFH A;  3AKA A;  3CZT X;  5TNC A;  1B7T Y;  1FBV A;  3JTD B;  2JT3 A;  1QX7 A;  2ZND A;  5AXI A;  1C7V A;  1TRF A;  2LC5 A;  1K90 D;  4TNC A;  2F3Z A;  3WHU B;  2LE9 B;  3AAJ A;  3SG4 A;  1DGV A;  1G33 A;  5CPV A;  2BCA A;  1B8R A;  1K94 A;  5ER5 A;  2B1U A;  3DVE A;  4MRX A;  2BE4 A;  2KFF A;  2CTN A;  3I5I C;  1SCM C;  2QPT A;  2A4J A;  1DF0 B;  2HF5 A;  1HT9 A;  2M97 A;  1MXE A;  2LM5 A;  3PAT A;  1MHO A;  2M49 B;  2D8N A;  2E30 A;  1ODB A;  4PE7 A;  1A75 B;  4CPV A;  1CMF A;  1DJH A;  2MRD A;  1VRK A;  1FW4 A;  4NDC A;  1CFD A;  3CS1 A;  4GBA A;  2JTZ A;  2NLN A;  2F3Y A;  4GFT A;  3I5F C;  1KK8 C;  2JNX A;  4FTG A;  1C7W A;  3CLN A;  5CSJ A;  4ZCU A;  1RK9 A;  4A4B A;  4I5J A;  4FQO A;  1B9A A;  2Q91 A;  4GPL B;  2KSP A;  1S1E A;  1LIN A;  1KK7 Y;  3D0Y B;  2JTT A;  2NCO A;  2LLU A;  1OMD A;  1UHN A;  2LVJ A;  4C0J A;  4PAL A;  4GGF A;  1F71 A;  4QJ3 B;  1S36 A;  4HRG A;  3TDZ A;  1SL9 A;  4MLW A;  2WCB A;  1DJG A;  3M0W A;  4AOM A;  2M1K B;  1CLL A;  4D1E A;  4OR9 B;  2KAY A;  2L98 A;  3PFV A;  1AUI B;  1WLZ A;  3DVJ A;  3CR5 X;  3O4Y A;  3O78 A;  4ORA B;  2PVB A;  4XYN A;  1K95 A;  1F55 A;  1N0Y A;  1X02 A;  5KU1 A;  2O60 A;  2KGR A;  2P6B B;  1MUX A;  3O6B A;  3IQQ A;  1K8U A;  2JXL A;  4CLN A;  2OTG B;  5PAL A;  2F33 A;  1QVI Z;  2FOT A;  2MBX A;  1KWO B;  2KGB C;  3DF0 B;  1AP4 A;  2K7C A;  3KEV A;  3K21 A;  2JXC A;  2LAN A;  3I5H B;  4CFQ A;  1QVI Y;  5AEQ A;  1SW8 A;  2NZ0 A;  5I8N A;  3CR4 X;  2BL0 B;  3GK4 X;  2PAS A;  3LLE A;  1FI6 A;  5AAN A;  5HKY A;  4HSZ A;  4I5L B;  2KQY A;  2HQW A;  2KDH A;  1FI5 A;  4DS7 A;  2LV7 A;  2KHN A;  3AKB A;  1EJ3 A;  1LA0 A;  2IS9 A;  1M39 A;  4P2Y B;  3NSI A;  3WXA A;  1SR6 B;  1B1G A;  1BG1 A;  2WOS A;  3I5G C;  1IRJ A;  4DRW A;  5CSN A;  1NX3 A;  1SY9 A;  1NX0 A;  2LAP A;  3MSE B;  1WRZ A;  4ZCV A;  2WCE A;  2L4H A;  4PHJ A;  2M7N A;  4MZL A;  3PN7 C;  3SG3 A;  1PUL A;  3EVV A;  4ETO A;  2BBM A;  2EC6 B;  3BQ3 A;  3NSO A;  3LCP C;  1AJ5 A;  1EG4 A;  2AUC A;  1CDL A;  2OS8 C;  4F0Z B;  2JQ6 A;  1IQ3 A;  1SKT A;  3TS5 C;  1AHR A;  1XVJ A;  1LXF C;  2JC2 A;  1WY9 A;  2K7O A;  3LK1 A;  3EVU A;  2H61 C;  1L2O B;  3EK4 A;  1CFF A;  1Y1X A;  3NSL A;  1OSA A;  1K9U A;  2SCP A;  5ER4 X;  4NDD A;  2LVI A;  4JWQ A;  3CR2 A;  4PDZ A;  1J7P A;  3VGO A;  2JPT A;  1DTL A;  1M31 A;  1UWO A;  1M63 B;  4E68 A;  3JVT C;  1QX5 B;  1CDM A;  3SG5 A;  1YX7 A;  1B47 A;  1ZFS A;  2OPO A;  4GAO A;  4YGE B;  1TCO B;  1KQM C;  3LL8 B;  4BY4 A;  3WHT B;  2JU0 A;  2F2P A;  2JNF A;  2I7A A;  1TNX A;  1ZAC A;  4HRH A;  3VRO A;  5IBW A;  1OZO A;  1FPW A;  1UP5 A;  1EG3 A;  3JTD C;  3DD4 A;  3BUO B;  3FWB A;  3OB2 B;  1KSM A;  4YI9 A;  2MJW B;  3SIA A;  2L51 A;  3TDU A;  1SL8 A;  1Y6W A;  4PCW A;  3EKH A;  1TTX A;  2K7B A;  1M46 A;  2PSR A;  2KI6 D;  3BUX B;  1GJY A;  2F8P A;  4A4C A;  1SNL A;  2O5G A;  3CGA A;  3O2P A;  4MVF A;  4USL A;  1ZUZ A;  2LVK A;  1PRW A;  3FIA A;  1KFX L;  1NWD A;  3KF9 A;  3PSR A;  4ICB A;  1BOD A;  1XFW O;  2ZN9 A;  3NXA A;  1IJ6 A;  1QXP A;  1E8A A;  1GQM A;  1MXL C;  4DUQ A;  1S3P A;  2MAZ A;  3F45 A;  2KYC A;  4YRU A;  1J55 A;  5G08 A;  2WND A;  2CBL A;  3KPX A;  3QRX A;  1CFC A;  4OKH A;  2K0J A;  4DIR A;  5K89 A;  1KK7 Z;  1K9P A;  2MHH A;  3IF7 A;  1XYD A;  1NCX A;  1G4Y R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...