1SCVA

Nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein, structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure.
pubmed doi rcsb
source organism Gallus gallus
total genus 13
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scvA00
1YTZC 3JVTC 3SG6A 2AUCA 1BMOA 1SW8A 3HCMA 3OB2B 3PATA 2JNFA 2PRUA 2MJWB 1CLBA 4I5NB 1JFKA 1WRKA 2HPSA 4GGFC 4YGAA 2FJUB 2ZKMX 1U5IB 1MHOA 4MZLA 5AERA 1WLMA 3OHMB 3PM8A 4PCWA 5AANA 2FOTA 4ICBA 5KU1A 1M63B 1G33A 1D1OA 2ZRSA 2I94A 3HX4A 1WLZA 2ZNDA 1C07A 1YURA 1ZFSA 2EC6B 4D1EA 1J7QA 2AAOA 2JT0A 3BUXB 2K7DA 1XK4C 1SL9A 1SL8A 3LK0A 5TNCA 2O60A 2JXLA 3SG3A 3WHTB 1FPWA 1XO5A 1CFCA 1S3PA 3NSOA 2KAXA 2KHNA 2H61C 1LXFC 1SR6C 2G2BA 1X02A 5DKRA 1DJGA 1F8HA 1S1EA 1RROA 1B1GA 2M3WA 1XFVO 2HETA 2JU0A 2L50A 1H4BA 3CZTX 2KBMA 2KNEA 4E68A 3DF0A 2EC6C 4GNKB 1UP5A 3ZNIA 1J7RA 2AMIA 4PE1A 1WDCC 1GJYA 1NP8A 3IQQA 5K89A 1W7IB 3TUYC 3KF9A 1AP4A 1AUIB 4M2QA 2LC5A 4M2PA 1OOJA 1QATA 4MZKA 1F55A 1XFYO 1OSAA 3SJSA 1KSOA 3BUMB 4YI9A 4QJ4B 2EHBA 4A4CA 2KSPA 1DGUA 1BODA 3CR2A 3DD4A 2K8MB 4GAOA 4DUQA 3I5IC 2EGDA 1W7JB 3CLNA 2QACA 4YGEB 4OVNF 1F71A 5D7FA 4GBAA 3DF0B 3WHUB 1WRLA 2E30A 1KCYA 3VGOA 1IKUA 3D0YB 1SPYA 2G9BA 3I5HB 1XYDA 2VRGA 5G08A 4MLWA 1DJHA 4PHMA 2PMYA 1NIWA 3FWBA 1UHNA 3EK4A 3PSRA 1CLMA 3SG4A 4PDZA 2JPTA 1K9KA 1K93D 3H4SE 4JWQA 1QV1A 1S5GZ 5CSJA 1NWDA 2K2FA 4A4BA 4GGFA 1N2DA 1KFUL 1SCMB 1NX1A 3A8RA 3KHEA 1BOCA 2COLB 1BG1A 2BL0C 1G4YR 5CSNA 1NX3A 2FCEA 3I5HC 1A29A 1M39A 4GFTA 2F8PA 5HKYA 2KFHA 1XVJA 5FYXA 4YGCB 1UHHA 2M49B 1SRAA 1BT6A 1PULA 1K95A 1V1GA 1XK4A 1K90D 1NSHA 2WCEA 3EK8A 2OS8C 3FWCA 2NLNA 2JTZA 4F0ZB 2MLEC 1IJ6A 3TDZA 4Q04A 1KQVA 2KDHA 1FI6A 3DVKA 1U5IA 3VRRA 2H61A 4DCKA 1TOPA 2M8UA 3JVTB 3LL8B 4MBEA 2SASA 2KI6C 4OR9B 2GV5A 4P5OE 1AHRA 5ER4X 2M97A 1RWYA 2CNPA 2PVBA 2WCBA 4OV2A 1QLSA 1CMGA 1OZSA 1IWQA 3LCPC 2L98A 2MBXA 4GUKA 2KFGA 4P2YB 1K2HA 2K7OA 1KQMC 3O6BA 2KYFA 2KI4C 3KEVA 1BR1B 1FW4A 1WRZA 2BCAA 1PK0D 3M0WA 3VRNA 5HYDA 1UHKA 2FCDA 3SG7A 3GOFA 1Y1UA 3D10A 4JQ0D 1QLKA 3A4UB 5BPJA 1MR8A 2WORA 4U8DA 1LKJA 3SIAA 2JOJA 5DKQA 1B8LA 1E8AA 1NYAA 1MUXA 1SCVA 3BUNB 1QS7A 1KFXL 1SYMA 2LUXA 3TDUA 2SCPA 2B1UA 1FI5A 1SR6B 1DTLA 3PLFB 2V53A 1YRTB 1L2OC 4FTGA 2LMUA 1CM1A 1YVHA 1MWNA 1RFJA 5CSIA 1TRFA 1NCYA 3TDIA 3CWGA 3NXAA 5HLVA 2KI6D 1NX0A 4QJ3B 1K8UA 1WDCB 3TUYB 5JJGA 1KK7Z 2LNKA 2HQWA 1J1DA 1ODBA 4C0JA 1RTP1 1JUOA 2L0PA 2L4HA 1YUTA 1B7TZ 2P6BB 4MEWA 4BY5A 4N1FA 5ER5A 2NCPA 2LE9B 3PFVA 2K7CA 2OTGB 3QRXA 1EXRA 1TTXA 4OKHA 3AAJA 3LLEA 1DJXA 1RECA 4MSPA 2ZRTA 3D0YA 5AXIA 1DVIA 3K21A 1HQVA 3I5IB 1GQMA 1QIWA 1GGZA 2LV7A 3BUWB 2LLUA 2LMTA 2BCBA 2L51A 4YI8A 2OTGC 4YGDB 1UWOA 1JBAA 3IF7A 4MRXA 3ZWHA 4CIDA 3EKJA 1S36A 1PALA 2Q91A 3CTNA 3RLZA 3CR4X 1KWOC 2OPOA 4HRHA 2F3ZA 3DVEA 2CT9A 1EH2A 2KGBC 1CDMA 1NUBA 1ZOTB 4PHKA 3CS1A 1EG3A 1S5GY 2WC8A 2LHLA 2E6WA 1B4CA 3LK1A 3GK1A 2BCXA 4HRGA 5HLOA 2BL0B 4NDCA 1GGWA 1K9UA 1KK8C 2Y1NA 5I2QA 3CR5X 3SG2A 3SG5A 1J7OA 1PSBA 1CB1A 3JTDB 1OZOA 2L5XB 3I5GC 4MZJA 2PALA 1UUSA 2WNDA 1J55A 3DVMA 4OCIA 4JPZB 5JOLA 1LINA 1RK9A 4AQIA 1M46A 1XFXO 2MRDA 3VROA 2OS8B 1MQ1A 1TN4A 3OB1B 3EVVA 1ZACA 4NDDA 1YUSA 2JNXA 2TN4A 1XFWO 1YRUB 1EG4A 2LVKA 4AQJA 1PRWA 2NZ0A 3VRQA 3JTDC 2JXCA 2LANA 3BOWA 4PALA 4NQGA 4HSZA 1SL7A 1KQMB 1IQ3A 1PVBA 1WY9A 2KI4B 3AAKA 2LP2A 2ZNEA 1LA3A 1Y1XA 1AVSA 3F45A 1N0YA 1NPQA 1IG5A 2BECA 2CTNA 4N5XA 1AK8A 2KOTA 1SMGA 2M7LA 2PSRA 2LVJA 1CM4A 2IS9A 2ZN8A 2LLTA 2JTTA 2HF5A 4CFQA 1FBVA 2K61A 4GPLB 1DMOA 1R2UA 1DJIA 1YVLA 3KO0A 4YBHB 4DIRA 2CCMA 5D69A 2MA2A 1AJ4A 1L2OB 2LVIA 2BBMA 1CDPA 1B9AA 4ORCB 2QPTA 3EVRA 3OP0A 1J7PA 1JF2A 3BOWB 3IQOA 2LAPA 2M9GA 3BUOB 5HKZA 2KBIA 2PASA 3I5FC 4QJ5B 5IBWA 4FQOA 2JRFA 1QVIZ 4PHJA 5I2LA 1BF5A 2H2KA 2LHIA 1KK7Y 1Y1AA 1NCZA 2HQ8A 1S6CA 4DS7A 1C7WA 2JQ6A 1B7TY 4USLA 5HKWA 1OQPA 4R1EA 3GK4X 1IQ5A 1QIVA 3MSEB 1L7ZA 3BQ3A 4ZCVA 3PALA 1K96A 1IJ5A 1K9PA 1UHJA 1HT9A 1OMDA 1ZUZA 2MAZA 2M29A 2BE6A 3FS7A 2M7NA 1FF1A 2M1KB 1EL4A 1DGVA 1JWDA 2LMVA 2M0RA 1QTXA 5J3XA 2BE4A 4ETOA 2Y1MA 4L9MA 1J1EA 1YX7A 1ALWA 2KAVA 3E3RA 1MXLC 1MF8B 1F4OA 1DJZA 1M31A 2Y5IA 1TCOB 3RM1A 1LVCD 1S26D 4I5JA 1CKKA 4IL1A 5I2OA 3C1VA 1CDLA 2RGIA 5CSFA 1ALVA 2GGZA 1Q80A 1A75A 1SY9A 2LM5A 1KWOB 3NSLA 2WCFA 3NSKA 2I18A 3GK2A 2BKIB 1QX5B 2LUCA 1OE9B 1QX2A 1CDNA 1MXEA 3ICBA 5KTYA 2R2IA 1DJWA 2I2RE 1A4PA 1RJVA 1S6IA 1N65A 2JC2A 2Y4QA 4MN0A 4MVFA 4TNCA 1A03A 1KK8B 2NXQA 5DKNA 5AEQA 1V1FA 3I5GB 2LCPA 1F70A 2Q4UA 3TS5B 1F54A 2WOSA 1TNPA 3TZ1A 2ISDA 2F3YA 2JWWA 2ZN9A 2KQYA 2CBLA 2KYCA 5AFPA 2L4IA 1UHIA 1ZMZA 2ZFDA 4YGBB 3VRPA 1A75B 3DVJA 2O5GA 3CGAA 4CPVA 4I5KA 5KSZA 1XFZO 4CLNA 5PALA 2MHHA 1JC2A 1KSMA 4ZCUA 5F6TA 2GGMA 2K7BA 1Y0VH 1QASA 4C0KA 1R6PA 3O78A 3WNXB 3OX6A 3TS5C 1CNPA 5CPVA 1B47A 1NCXA 1Y6WA 4I5LB 4XJKA 4ORBB 1TIZA 1SKTA 1SBJA 4C0LA 1CMFA 1TCFA 1UURA 2DOQA 2M1UA 1TNXA 1OMVA 1BU3A 3PN7B 3SIBA 3O2PA 1H8BA 3AKBA 1AJ5A 1DJYA 4ORAB 5I8NA 1IGVA 1KFUS 2CXJA 2JT8A 2JULA 3OX5A 1DF0A 1S6JA 3BXKA 2A4JA 3AKAA 4WRIA 2KGRA 3O4YA 2BKHB 3EK7A 2BBNA 4MRYA 4PE0A 4YRUA 1IH0A 1PSRA 2LLSA 3EKHA 4UPGA 1TNQA 1YR5A 1BLQA 3PN7C 1QX7A 4CFRA 2JZIA 1G8IA 1K94A 1DT7B 2F2PA 1LA0A 1F4QA 1BR4B 3I5FB 4N1GA 3EVUA 4XJKB 1QVIY 3FIAA 1JSAA 5GQQC 1NX2A 2KQ6A 4AOMA 4PE4A 1EJ3A 4HREE 1CFFA 4WQ3A 1IRJA 1QJTA 1C7VA 1PVAA 2D8NA 4WQ2A 4BY4A 3WXAA 3KPXA 4PHNA 4M2OA 2MLFC 4GGNA 1SCMC 5B8IB 1SNLA 2KFFA 1SK6D 1DF0B 1YX8A 2KAYA 1CTRA 1JF0A 2I7AA 1QXPA 4PE7A 1CFDA 4DRWA 2K2AA 2LVVA 2LP3A 1CFPA 1CLLA 4XYNA 1TNWA 2K0JA 1JFJA 1VRKA 1YUUA 1M45A 1QV0A 3BYAA 1XA5A 2F33A 2NCOA 1BJFA 1B8RA 1KFXS 4NDBA 1XFUO 1B8CA 2F2OA 2JT3A 1A2XA 3NSIA 1OMRA 2L2EA
chains in the Genus database with same CATH superfamily
1YTZC 3JVTC 3SG6A 2AUCA 1BMOA 1SW8A 3HCMA 3OB2B 3PATA 2JNFA 2PRUA 1XFRA 2MJWB 1CLBA 4I5NB 1JFKA 1WRKA 1TUJA 2HPSA 2WC6A 4GGFC 4YGAA 2FJUB 2ZKMX 1U5IB 1MHOA 4MZLA 3UO9A 1WLMA 5AERA 3OHMB 3PM8A 4PCWA 5AANA 2FOTA 4ICBA 5KU1A 1M63B 1G33A 1D1OA 2ZRSA 2I94A 3HX4A 1WLZA 2ZNDA 1C07A 1YURA 1ZFSA 2EC6B 4D1EA 1J7QA 2AAOA 2JT0A 3BUXB 2K7DA 1XK4C 2FJYA 1SL9A 1SL8A 3LK0A 5TNCA 2O60A 2JXLA 3SG3A 3WHTB 1FPWA 1OOGA 1XO5A 1S3PA 1CFCA 3NSOA 2KAXA 2KHNA 2H61C 1LXFC 1SR6C 2G2BA 1X02A 5DKRA 1DJGA 1F8HA 3B6XA 1S1EA 2BAPA 3CZ2A 1RROA 3S0EA 1B1GA 2M3WA 2PYQA 1OW4A 1SSEB 1XFVO 2HETA 2JU0A 2L50A 1H4BA 3CZTX 2KBMA 2KNEA 4E68A 3DF0A 2EC6C 4GNKB 1UP5A 3ZNIA 1J7RA 2AMIA 4PE1A 1WDCC 1GJYA 1NP8A 2QEVA 3IQQA 5K89A 1W7IB 3TUYC 3KF9A 1AP4A 1AUIB 4M2QA 1Z2CB 2LC5A 4M2PA 1OOJA 1QATA 4MZKA 1F55A 1XFYO 3L4LA 1OSAA 3SJSA 1KSOA 3BUMB 3Q8IA 1OOIX 5FI7A 4YI9A 4QJ4B 2EHBA 4A4CA 2KSPA 1DGUA 1BODA 3CR2A 3DD4A 2K8MB 4GAOA 4DUQA 3V2LA 2K60A 2EGDA 1W7JB 3CLNA 3I5IC 3OGNA 2QACA 4YGEB 4OVNF 1F71A 5D7FA 4GBAA 3DF0B 3WHUB 1WRLA 3CZ0A 2E30A 1KCYA 3VGOA 1IKUA 3D0YB 1SPYA 2G9BA 3I5HB 1XYDA 2VRGA 2QEHA 4MLWA 5G08A 1DJHA 4PHMA 2PMYA 1NIWA 3FWBA 1UHNA 3EK4A 3PSRA 1CLMA 3SG4A 4PDZA 1QWVA 2JPTA 1K9KA 1K93D 3H4SE 4JWQA 1LS8A 1QV1A 1S5GZ 5CSJA 1NWDA 2K2FA 4A4BA 4GGFA 1N2DA 1KFUL 1SCMB 3FE6A 3L4AA 1NX1A 3A8RA 3BFBA 3KHEA 1BOCA 2COLB 1BG1A 2BL0C 1G4YR 5CSNA 1NX3A 2YGUA 2FCEA 3I5HC 1A29A 1M39A 4GFTA 2F8PA 5HKYA 2KFHA 1XVJA 2BNXA 2ERBA 5FYXA 4YGCB 2L2CA 1UHHA 2M49B 1SRAA 1BT6A 1PULA 1K95A 1V1GA 1XK4A 1K90D 1NSHA 2WCEA 2L5YA 2OS8C 3EK8A 3FWCA 2NLNA 2JTZA 4F0ZB 2MLEC 1IJ6A 3TDZA 4Q04A 1KQVA 2KDHA 1FI6A 3DVKA 1U5IA 3VRRA 2H61A 4DCKA 1TOPA 3BFAA 2M8UA 3JVTB 3LL8B 4MBEA 2SASA 2KI6C 4OR9B 2GV5A 3D76A 1AHRA 4P5OE 2M97A 5ER4X 1RWYA 2CNPA 2PVBA 2WCBA 4OV2A 1QLSA 1CMGA 1OZSA 1IWQA 3LCPC 2JPOA 2L98A 2MBXA 4GUKA 2KFGA 3R1PA 4P2YB 1K2HA 1C3YA 2K7OA 1KQMC 3DYEA 3O6BA 2KYFA 2KI4C 3KEVA 1BR1B 1FW4A 1WRZA 2BCAA 1PK0D 3M0WA 3VRNA 1C3ZA 1TUZA 1UHKA 2FCDA 3GOFA 3SG7A 1Y1UA 3D10A 4JQ0D 1QLKA 3A4UB 3DY9A 5BPJA 1MR8A 2WORA 4U8DA 1LKJA 3SIAA 2JOJA 5DKQA 1B8LA 1E8AA 1NYAA 1MUXA 1SCVA 3BUNB 1QS7A 1KFXL 1SYMA 2LUXA 3CYZA 3TDUA 3CZ1A 2SCPA 3UNWA 2B1UA 1FI5A 1SR6B 1DTLA 3PLFB 2V53A 1YRTB 3D73A 1L2OC 4FTGA 2LMUA 1CM1A 1YVHA 1MWNA 1RFJA 5CSIA 3NGVA 1TRFA 1NCYA 3TDIA 3CWGA 3NXAA 5HLVA 2KI6D 1NX0A 1OOHA 1K8UA 4QJ3B 1WDCB 3TUYB 5JJGA 1KK7Z 2LNKA 2HQWA 2KLEA 1J1DA 1ODBA 4C0JA 1RTP1 1JUOA 2L0PA 2L4HA 1YUTA 1B7TZ 2P6BB 4MEWA 4BY5A 4N1FA 5ER5A 2NCPA 2LE9B 3PFVA 2K7CA 2OTGB 3QRXA 1EXRA 1TTXA 4OKHA 3AAJA 3FE9A 3LLEA 1DJXA 1RECA 3IVTA 4MSPA 2ZRTA 3D0YA 1DC1A 5AXIA 1DVIA 3K21A 1HQVA 3NHIA 3I5IB 1GQMA 1QIWA 2WCLA 1GGZA 2LV7A 4KYNA 3BUWB 2LLUA 2LMTA 2BCBA 2QEOA 2L51A 3O4XA 4YI8A 2WCJA 2OTGC 4YGDB 1UWOA 1JBAA 3IF7A 4MRXA 3ZWHA 4CIDA 3EKJA 1S36A 1PALA 2Q91A 3CTNA 3RLZA 3CR4X 1KWOC 2OPOA 4HRHA 4JKTA 3BFHA 2F3ZA 3DVEA 2CT9A 1EH2A 2KGBC 1CDMA 1NUBA 1ZOTB 4PHKA 3CS1A 1EG3A 1S5GY 2WC8A 2LHLA 2E6WA 1B4CA 3D75A 3LK1A 3GK1A 2BCXA 4HRGA 5HLOA 2BL0B 3BJHA 4NDCA 1GGWA 1K9UA 1KK8C 2Y1NA 5I2QA 3CR5X 3SG2A 3SG5A 1J7OA 1PSBA 1CB1A 3JTDB 1OZOA 2L5XB 3I5GC 4MZJA 2PALA 1UUSA 2WNDA 1J55A 3DVMA 4OCIA 4JPZB 5JOLA 1LINA 1RK9A 1T14A 3D77A 4AQIA 1M46A 1XFXO 2MRDA 3VROA 2OS8B 1MQ1A 1TN4A 2PQLA 3OB1B 3EVVA 1ZACA 4NDDA 1YUSA 2JNXA 2TN4A 1XFWO 5HL1A 1YRUB 1EG4A 2LVKA 4AQJA 5FI6A 1PRWA 2NZ0A 3VRQA 3JTDC 3CABA 2JXCA 2LANA 3BOWA 4PALA 4NQGA 4HSZA 1SL7A 1Z4HA 1KQMB 1IQ3A 1PVBA 1WY9A 2KI4B 3AAKA 2P71A 2LP2A 2ZNEA 1ORGA 1LA3A 1Y1XA 1AVSA 3F45A 1N0YA 1NPQA 1IG5A 2BECA 2CTNA 4N5XA 1AK8A 2KOTA 1SMGA 2M7LA 2PSRA 2LVJA 1CM4A 2KPHA 3D78A 2IS9A 2ZN8A 2LLTA 2JTTA 2HF5A 3S0DA 4CFQA 1FBVA 2K61A 4GPLB 1DMOA 1R2UA 1DJIA 1YVLA 3KO0A 4YBHB 4DIRA 3N7HA 2CCMA 5D69A 2MA2A 1AJ4A 1L2OB 2LVIA 2BBMA 1CDPA 1B9AA 4ORCB 2QPTA 3EVRA 3OP0A 1J7PA 1JF2A 3BOWB 3IQOA 2LAPA 2M9GA 2WCHA 3BUOB 5HKZA 2KBIA 2PASA 3I5FC 5HYDA 4QJ5B 5IBWA 4FQOA 2JRFA 1QVIZ 4PHJA 5I2LA 1BF5A 2H2KA 2LHIA 1KK7Y 1Y1AA 1NCZA 2HQ8A 1S6CA 3D74A 4DS7A 1C7WA 2JQ6A 1B7TY 4USLA 5HKWA 1OQPA 4R1EA 3GK4X 1IQ5A 4JD9A 2KLDA 4INWA 1QIVA 3MSEB 1L7ZA 3RZSA 3BQ3A 4ZCVA 3PALA 1K96A 1IJ5A 1K9PA 1UHJA 1HT9A 1OMDA 1ZUZA 2MAZA 2M29A 2BE6A 3FS7A 2M7NA 1FF1A 2M1KB 1EL4A 1DGVA 2QEBA 1JWDA 2LMVA 2M0RA 1QTXA 5J3XA 2BE4A 4FQTA 3SS4A 4ETOA 2Y1MA 4IJ7A 1J1EA 1YX7A 4L9MA 1ALWA 2KAVA 3E3RA 1MXLC 1MF8B 3K1EA 1F4OA 1DJZA 1M31A 2Y5IA 1TCOB 3RM1A 1LVCD 1S26D 4I5JA 5EL2A 1CKKA 3B87A 4IL1A 5I2OA 3C1VA 1CDLA 2RGIA 5CSFA 3S0GA 1ALVA 2GGZA 1Q80A 1A75A 3OBVA 1SY9A 2LM5A 1KWOB 3NSLA 2WCFA 3NSKA 2I18A 4OZDA 3GK2A 2BKIB 1QX5B 1GM0A 2LUCA 1OE9B 1QX2A 1CDNA 1MXEA 3ICBA 5KTYA 2R2IA 1DJWA 2I2RE 3EG5B 3CDNA 2QDIA 1A4PA 1RJVA 1S6IA 1N65A 2JC2A 1DELA 2Y4QA 4MN0A 4MVFA 4TNCA 1A03A 1TWOA 1KK8B 4PT1A 2NXQA 5DKNA 5AEQA 1V1FA 3I5GB 2LCPA 1F70A 2Q4UA 3TS5B 1F54A 3QMEA 2WOSA 1TNPA 3TZ1A 2ISDA 2F3YA 2JWWA 2WCKA 2ZN9A 2KQYA 2CBLA 2KYCA 3B88A 5AFPA 2L4IA 1UHIA 1ZMZA 2ZFDA 4YGBB 3VRPA 1A75B 3DVJA 2WCMA 3SS5A 2O5GA 3CGAA 4CPVA 4I5KA 5KSZA 1XFZO 4CLNA 5PALA 2MHHA 1JC2A 1KSMA 3PM2A 4ZCUA 5F6TA 2GGMA 2K7BA 1Y0VH 1QASA 4C0KA 1R6PA 3O78A 3WNXB 3OX6A 3R1OA 3TS5C 3R72A 1CNPA 5CPVA 1B47A 1IIOA 1NCXA 3B86A 5D3OA 5DICA 5I94A 1Y6WA 4F7FA 2H8VA 4I5LB 4XJKA 4ORBB 2WC5A 1TIZA 1SKTA 1SBJA 4C0LA 1CMFA 1TCFA 1UURA 2DOQA 2M1UA 1TNXA 1OMVA 1BU3A 3PN7B 3SIBA 3O2PA 3R1VA 1H8BA 3AKBA 1AJ5A 1DJYA 1W9ZA 4ORAB 3S0AA 1DEKA 5I8NA 1IGVA 1KFUS 2CXJA 2JT8A 2JULA 3OX5A 1DF0A 1S6JA 3BXKA 2A4JA 3AKAA 3PJIA 4WRIA 2KGRA 3O4YA 2BKHB 3EK7A 2BBNA 4MRYA 4PE0A 4YRUA 2P70A 1PSRA 2LLSA 3EKHA 4UPGA 1IH0A 3S0FA 1TNQA 1YR5A 1BLQA 3VB1A 5FI2A 3PN7C 1QX7A 4CFRA 2JZIA 1DQEA 1G8IA 1K94A 2GTEA 1DT7B 2F2PA 1LA0A 1F4QA 1BR4B 3I5FB 4N1GA 1OOFA 3EVUA 4XJKB 1QVIY 3FIAA 3B7AA 5GQQC 1NX2A 2KQ6A 4AOMA 1JSAA 4PE4A 1EJ3A 4HREE 1CFFA 4WQ3A 1P28A 3DXLA 1IRJA 1QJTA 1C7VA 1PVAA 2D8NA 4WQ2A 3L47A 4BY4A 3S0BA 3WXAA 3KPXA 4PHNA 3SS3A 4M2OA 2MLFC 4GGNA 1SCMC 5B8IB 1SNLA 2KFFA 1SK6D 1DF0B 1YX8A 3DZTA 2KAYA 1CTRA 1JF0A 2I7AA 1QXPA 4PE7A 1CFDA 4DRWA 2K2AA 2LVVA 2LP3A 3FE8A 1CLLA 1CFPA 4XYNA 1TNWA 2K0JA 1JFJA 1VRKA 1YUUA 1M45A 1QV0A 3BYAA 4INXA 3NHTA 1XA5A 2F33A 2NCOA 1BJFA 1B8RA 1KFXS 4NDBA 1XFUO 1B8CA 2F2OA 2JT3A 1A2XA 3NSIA 1OMRA 2L2EA
chains in the Genus database with same CATH topology
1YTZC 3JVTC 3SG6A 2AUCA 1BMOA 1SW8A 3HCMA 3OB2B 3PATA 2JNFA 2PRUA 2MJWB 1CLBA 4I5NB 1JFKA 1WRKA 2HPSA 4GGFC 4YGAA 2FJUB 2ZKMX 1U5IB 1MHOA 4MZLA 5AERA 1WLMA 3OHMB 3PM8A 4PCWA 5AANA 2FOTA 4ICBA 5KU1A 1M63B 1G33A 1D1OA 2ZRSA 2I94A 3HX4A 1WLZA 2ZNDA 1C07A 1YURA 1ZFSA 2EC6B 4D1EA 1J7QA 2AAOA 2JT0A 3BUXB 2K7DA 1XK4C 1SL9A 1SL8A 3LK0A 5TNCA 2O60A 2JXLA 3SG3A 3WHTB 1FPWA 1XO5A 1CFCA 1S3PA 3NSOA 2KAXA 2KHNA 2H61C 1LXFC 1SR6C 2G2BA 1X02A 5DKRA 1DJGA 1F8HA 1S1EA 1RROA 1B1GA 2M3WA 1XFVO 2HETA 2JU0A 2L50A 1H4BA 3CZTX 2KBMA 2KNEA 4E68A 3DF0A 2EC6C 4GNKB 1UP5A 3ZNIA 1J7RA 2AMIA 4PE1A 1WDCC 1GJYA 1NP8A 3IQQA 5K89A 1W7IB 3TUYC 3KF9A 1AP4A 1AUIB 4M2QA 2LC5A 4M2PA 1OOJA 1QATA 4MZKA 1F55A 1XFYO 1OSAA 3SJSA 1KSOA 3BUMB 4YI9A 4QJ4B 2EHBA 4A4CA 2KSPA 1DGUA 1BODA 3CR2A 3DD4A 2K8MB 4GAOA 4DUQA 3I5IC 2EGDA 1W7JB 3CLNA 2QACA 4YGEB 4OVNF 1F71A 5D7FA 4GBAA 3DF0B 3WHUB 1WRLA 2E30A 1KCYA 3VGOA 1IKUA 3D0YB 1SPYA 2G9BA 3I5HB 1XYDA 2VRGA 5G08A 4MLWA 1DJHA 4PHMA 2PMYA 1NIWA 3FWBA 1UHNA 3EK4A 3PSRA 1CLMA 3SG4A 4PDZA 2JPTA 1K9KA 1K93D 3H4SE 4JWQA 1QV1A 1S5GZ 5CSJA 1NWDA 2K2FA 4A4BA 4GGFA 1N2DA 1KFUL 1SCMB 1NX1A 3A8RA 3KHEA 1BOCA 2COLB 1BG1A 2BL0C 1G4YR 5CSNA 1NX3A 2FCEA 3I5HC 1A29A 1M39A 4GFTA 2F8PA 5HKYA 2KFHA 1XVJA 5FYXA 4YGCB 1UHHA 2M49B 1SRAA 1BT6A 1PULA 1K95A 1V1GA 1XK4A 1K90D 1NSHA 2WCEA 3EK8A 2OS8C 3FWCA 2NLNA 2JTZA 4F0ZB 2MLEC 1IJ6A 3TDZA 4Q04A 1KQVA 2KDHA 1FI6A 3DVKA 1U5IA 3VRRA 2H61A 4DCKA 1TOPA 2M8UA 3JVTB 3LL8B 4MBEA 2SASA 2KI6C 4OR9B 2GV5A 4P5OE 1AHRA 5ER4X 2M97A 1RWYA 2CNPA 2PVBA 2WCBA 4OV2A 1QLSA 1CMGA 1OZSA 1IWQA 3LCPC 2L98A 2MBXA 4GUKA 2KFGA 4P2YB 1K2HA 2K7OA 1KQMC 3O6BA 2KYFA 2KI4C 3KEVA 1BR1B 1FW4A 1WRZA 2BCAA 1PK0D 3M0WA 3VRNA 5HYDA 1UHKA 2FCDA 3SG7A 3GOFA 1Y1UA 3D10A 4JQ0D 1QLKA 3A4UB 5BPJA 1MR8A 2WORA 4U8DA 1LKJA 3SIAA 2JOJA 5DKQA 1B8LA 1E8AA 1NYAA 1MUXA 1SCVA 3BUNB 1QS7A 1KFXL 1SYMA 2LUXA 3TDUA 2SCPA 2B1UA 1FI5A 1SR6B 1DTLA 3PLFB 2V53A 1YRTB 1L2OC 4FTGA 2LMUA 1CM1A 1YVHA 1MWNA 1RFJA 5CSIA 1TRFA 1NCYA 3TDIA 3CWGA 3NXAA 5HLVA 2KI6D 1NX0A 4QJ3B 1K8UA 1WDCB 3TUYB 5JJGA 1KK7Z 2LNKA 2HQWA 1J1DA 1ODBA 4C0JA 1RTP1 1JUOA 2L0PA 2L4HA 1YUTA 1B7TZ 2P6BB 4MEWA 4BY5A 4N1FA 5ER5A 2NCPA 2LE9B 3PFVA 2K7CA 2OTGB 3QRXA 1EXRA 1TTXA 4OKHA 3AAJA 3LLEA 1DJXA 1RECA 4MSPA 2ZRTA 3D0YA 5AXIA 1DVIA 3K21A 1HQVA 3I5IB 1GQMA 1QIWA 1GGZA 2LV7A 3BUWB 2LLUA 2LMTA 2BCBA 2L51A 4YI8A 2OTGC 4YGDB 1UWOA 1JBAA 3IF7A 4MRXA 3ZWHA 4CIDA 3EKJA 1S36A 1PALA 2Q91A 3CTNA 3RLZA 3CR4X 1KWOC 2OPOA 4HRHA 2F3ZA 3DVEA 2CT9A 1EH2A 2KGBC 1CDMA 1NUBA 1ZOTB 4PHKA 3CS1A 1EG3A 1S5GY 2WC8A 2LHLA 2E6WA 1B4CA 3LK1A 3GK1A 2BCXA 4HRGA 5HLOA 2BL0B 4NDCA 1GGWA 1K9UA 1KK8C 2Y1NA 5I2QA 3CR5X 3SG2A 3SG5A 1J7OA 1PSBA 1CB1A 3JTDB 1OZOA 2L5XB 3I5GC 4MZJA 2PALA 1UUSA 2WNDA 1J55A 3DVMA 4OCIA 4JPZB 5JOLA 1LINA 1RK9A 4AQIA 1M46A 1XFXO 2MRDA 3VROA 2OS8B 1MQ1A 1TN4A 3OB1B 3EVVA 1ZACA 4NDDA 1YUSA 2JNXA 2TN4A 1XFWO 1YRUB 1EG4A 2LVKA 4AQJA 1PRWA 2NZ0A 3VRQA 3JTDC 2JXCA 2LANA 3BOWA 4PALA 4NQGA 4HSZA 1SL7A 1KQMB 1IQ3A 1PVBA 1WY9A 2KI4B 3AAKA 2LP2A 2ZNEA 1LA3A 1Y1XA 1AVSA 3F45A 1N0YA 1NPQA 1IG5A 2BECA 2CTNA 4N5XA 1AK8A 2KOTA 1SMGA 2M7LA 2PSRA 2LVJA 1CM4A 2IS9A 2ZN8A 2LLTA 2JTTA 2HF5A 4CFQA 1FBVA 2K61A 4GPLB 1DMOA 1R2UA 1DJIA 1YVLA 3KO0A 4YBHB 4DIRA 2CCMA 5D69A 2MA2A 1AJ4A 1L2OB 2LVIA 2BBMA 1CDPA 1B9AA 4ORCB 2QPTA 3EVRA 3OP0A 1J7PA 1JF2A 3BOWB 3IQOA 2LAPA 2M9GA 3BUOB 5HKZA 2KBIA 2PASA 3I5FC 4QJ5B 5IBWA 4FQOA 2JRFA 1QVIZ 4PHJA 5I2LA 1BF5A 2H2KA 2LHIA 1KK7Y 1Y1AA 1NCZA 2HQ8A 1S6CA 4DS7A 1C7WA 2JQ6A 1B7TY 4USLA 5HKWA 1OQPA 4R1EA 3GK4X 1IQ5A 1QIVA 3MSEB 1L7ZA 3BQ3A 4ZCVA 3PALA 1K96A 1IJ5A 1K9PA 1UHJA 1HT9A 1OMDA 1ZUZA 2MAZA 2M29A 2BE6A 3FS7A 2M7NA 1FF1A 2M1KB 1EL4A 1DGVA 1JWDA 2LMVA 2M0RA 1QTXA 5J3XA 2BE4A 4ETOA 2Y1MA 4L9MA 1J1EA 1YX7A 1ALWA 2KAVA 3E3RA 1MXLC 1MF8B 1F4OA 1DJZA 1M31A 2Y5IA 1TCOB 3RM1A 1LVCD 1S26D 4I5JA 1CKKA 4IL1A 5I2OA 3C1VA 1CDLA 2RGIA 5CSFA 1ALVA 2GGZA 1Q80A 1A75A 1SY9A 2LM5A 1KWOB 3NSLA 2WCFA 3NSKA 2I18A 3GK2A 2BKIB 1QX5B 2LUCA 1OE9B 1QX2A 1CDNA 1MXEA 3ICBA 5KTYA 2R2IA 1DJWA 2I2RE 1A4PA 1RJVA 1S6IA 1N65A 2JC2A 2Y4QA 4MN0A 4MVFA 4TNCA 1A03A 1KK8B 2NXQA 5DKNA 5AEQA 1V1FA 3I5GB 2LCPA 1F70A 2Q4UA 3TS5B 1F54A 2WOSA 1TNPA 3TZ1A 2ISDA 2F3YA 2JWWA 2ZN9A 2KQYA 2CBLA 2KYCA 5AFPA 2L4IA 1UHIA 1ZMZA 2ZFDA 4YGBB 3VRPA 1A75B 3DVJA 2O5GA 3CGAA 4CPVA 4I5KA 5KSZA 1XFZO 4CLNA 5PALA 2MHHA 1JC2A 1KSMA 4ZCUA 5F6TA 2GGMA 2K7BA 1Y0VH 1QASA 4C0KA 1R6PA 3O78A 3WNXB 3OX6A 3TS5C 1CNPA 5CPVA 1B47A 1NCXA 1Y6WA 4I5LB 4XJKA 4ORBB 1TIZA 1SKTA 1SBJA 4C0LA 1CMFA 1TCFA 1UURA 2DOQA 2M1UA 1TNXA 1OMVA 1BU3A 3PN7B 3SIBA 3O2PA 1H8BA 3AKBA 1AJ5A 1DJYA 4ORAB 5I8NA 1IGVA 1KFUS 2CXJA 2JT8A 2JULA 3OX5A 1DF0A 1S6JA 3BXKA 2A4JA 3AKAA 4WRIA 2KGRA 3O4YA 2BKHB 3EK7A 2BBNA 4MRYA 4PE0A 4YRUA 1IH0A 1PSRA 2LLSA 3EKHA 4UPGA 1TNQA 1YR5A 1BLQA 3PN7C 1QX7A 4CFRA 2JZIA 1G8IA 1K94A 1DT7B 2F2PA 1LA0A 1F4QA 1BR4B 3I5FB 4N1GA 3EVUA 4XJKB 1QVIY 3FIAA 1JSAA 5GQQC 1NX2A 2KQ6A 4AOMA 4PE4A 1EJ3A 4HREE 1CFFA 4WQ3A 1IRJA 1QJTA 1C7VA 1PVAA 2D8NA 4WQ2A 4BY4A 3WXAA 3KPXA 4PHNA 4M2OA 2MLFC 4GGNA 1SCMC 5B8IB 1SNLA 2KFFA 1SK6D 1DF0B 1YX8A 2KAYA 1CTRA 1JF0A 2I7AA 1QXPA 4PE7A 1CFDA 4DRWA 2K2AA 2LVVA 2LP3A 1CFPA 1CLLA 4XYNA 1TNWA 2K0JA 1JFJA 1VRKA 1YUUA 1M45A 1QV0A 3BYAA 1XA5A 2F33A 2NCOA 1BJFA 1B8RA 1KFXS 4NDBA 1XFUO 1B8CA 2F2OA 2JT3A 1A2XA 3NSIA 1OMRA 2L2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTZ C;  3JVT C;  3SG6 A;  2AUC A;  1BMO A;  1SW8 A;  3HCM A;  3OB2 B;  3PAT A;  2JNF A;  2PRU A;  2MJW B;  1CLB A;  4I5N B;  1JFK A;  1WRK A;  2HPS A;  4GGF C;  4YGA A;  2FJU B;  2ZKM X;  1U5I B;  1MHO A;  4MZL A;  5AER A;  1WLM A;  3OHM B;  3PM8 A;  4PCW A;  5AAN A;  2FOT A;  4ICB A;  5KU1 A;  1M63 B;  1G33 A;  1D1O A;  2ZRS A;  2I94 A;  3HX4 A;  1WLZ A;  2ZND A;  1C07 A;  1YUR A;  1ZFS A;  2EC6 B;  4D1E A;  1J7Q A;  2AAO A;  2JT0 A;  3BUX B;  2K7D A;  1XK4 C;  1SL9 A;  1SL8 A;  3LK0 A;  5TNC A;  2O60 A;  2JXL A;  3SG3 A;  3WHT B;  1FPW A;  1XO5 A;  1CFC A;  1S3P A;  3NSO A;  2KAX A;  2KHN A;  2H61 C;  1LXF C;  1SR6 C;  2G2B A;  1X02 A;  5DKR A;  1DJG A;  1F8H A;  1S1E A;  1RRO A;  1B1G A;  2M3W A;  1XFV O;  2HET A;  2JU0 A;  2L50 A;  1H4B A;  3CZT X;  2KBM A;  2KNE A;  4E68 A;  3DF0 A;  2EC6 C;  4GNK B;  1UP5 A;  3ZNI A;  1J7R A;  2AMI A;  4PE1 A;  1WDC C;  1GJY A;  1NP8 A;  3IQQ A;  5K89 A;  1W7I B;  3TUY C;  3KF9 A;  1AP4 A;  1AUI B;  4M2Q A;  2LC5 A;  4M2P A;  1OOJ A;  1QAT A;  4MZK A;  1F55 A;  1XFY O;  1OSA A;  3SJS A;  1KSO A;  3BUM B;  4YI9 A;  4QJ4 B;  2EHB A;  4A4C A;  2KSP A;  1DGU A;  1BOD A;  3CR2 A;  3DD4 A;  2K8M B;  4GAO A;  4DUQ A;  3I5I C;  2EGD A;  1W7J B;  3CLN A;  2QAC A;  4YGE B;  4OVN F;  1F71 A;  5D7F A;  4GBA A;  3DF0 B;  3WHU B;  1WRL A;  2E30 A;  1KCY A;  3VGO A;  1IKU A;  3D0Y B;  1SPY A;  2G9B A;  3I5H B;  1XYD A;  2VRG A;  5G08 A;  4MLW A;  1DJH A;  4PHM A;  2PMY A;  1NIW A;  3FWB A;  1UHN A;  3EK4 A;  3PSR A;  1CLM A;  3SG4 A;  4PDZ A;  2JPT A;  1K9K A;  1K93 D;  3H4S E;  4JWQ A;  1QV1 A;  1S5G Z;  5CSJ A;  1NWD A;  2K2F A;  4A4B A;  4GGF A;  1N2D A;  1KFU L;  1SCM B;  1NX1 A;  3A8R A;  3KHE A;  1BOC A;  2COL B;  1BG1 A;  2BL0 C;  1G4Y R;  5CSN A;  1NX3 A;  2FCE A;  3I5H C;  1A29 A;  1M39 A;  4GFT A;  2F8P A;  5HKY A;  2KFH A;  1XVJ A;  5FYX A;  4YGC B;  1UHH A;  2M49 B;  1SRA A;  1BT6 A;  1PUL A;  1K95 A;  1V1G A;  1XK4 A;  1K90 D;  1NSH A;  2WCE A;  3EK8 A;  2OS8 C;  3FWC A;  2NLN A;  2JTZ A;  4F0Z B;  2MLE C;  1IJ6 A;  3TDZ A;  4Q04 A;  1KQV A;  2KDH A;  1FI6 A;  3DVK A;  1U5I A;  3VRR A;  2H61 A;  4DCK A;  1TOP A;  2M8U A;  3JVT B;  3LL8 B;  4MBE A;  2SAS A;  2KI6 C;  4OR9 B;  2GV5 A;  4P5O E;  1AHR A;  5ER4 X;  2M97 A;  1RWY A;  2CNP A;  2PVB A;  2WCB A;  4OV2 A;  1QLS A;  1CMG A;  1OZS A;  1IWQ A;  3LCP C;  2L98 A;  2MBX A;  4GUK A;  2KFG A;  4P2Y B;  1K2H A;  2K7O A;  1KQM C;  3O6B A;  2KYF A;  2KI4 C;  3KEV A;  1BR1 B;  1FW4 A;  1WRZ A;  2BCA A;  1PK0 D;  3M0W A;  3VRN A;  5HYD A;  1UHK A;  2FCD A;  3SG7 A;  3GOF A;  1Y1U A;  3D10 A;  4JQ0 D;  1QLK A;  3A4U B;  5BPJ A;  1MR8 A;  2WOR A;  4U8D A;  1LKJ A;  3SIA A;  2JOJ A;  5DKQ A;  1B8L A;  1E8A A;  1NYA A;  1MUX A;  1SCV A;  3BUN B;  1QS7 A;  1KFX L;  1SYM A;  2LUX A;  3TDU A;  2SCP A;  2B1U A;  1FI5 A;  1SR6 B;  1DTL A;  3PLF B;  2V53 A;  1YRT B;  1L2O C;  4FTG A;  2LMU A;  1CM1 A;  1YVH A;  1MWN A;  1RFJ A;  5CSI A;  1TRF A;  1NCY A;  3TDI A;  3CWG A;  3NXA A;  5HLV A;  2KI6 D;  1NX0 A;  4QJ3 B;  1K8U A;  1WDC B;  3TUY B;  5JJG A;  1KK7 Z;  2LNK A;  2HQW A;  1J1D A;  1ODB A;  4C0J A;  1RTP 1;  1JUO A;  2L0P A;  2L4H A;  1YUT A;  1B7T Z;  2P6B B;  4MEW A;  4BY5 A;  4N1F A;  5ER5 A;  2NCP A;  2LE9 B;  3PFV A;  2K7C A;  2OTG B;  3QRX A;  1EXR A;  1TTX A;  4OKH A;  3AAJ A;  3LLE A;  1DJX A;  1REC A;  4MSP A;  2ZRT A;  3D0Y A;  5AXI A;  1DVI A;  3K21 A;  1HQV A;  3I5I B;  1GQM A;  1QIW A;  1GGZ A;  2LV7 A;  3BUW B;  2LLU A;  2LMT A;  2BCB A;  2L51 A;  4YI8 A;  2OTG C;  4YGD B;  1UWO A;  1JBA A;  3IF7 A;  4MRX A;  3ZWH A;  4CID A;  3EKJ A;  1S36 A;  1PAL A;  2Q91 A;  3CTN A;  3RLZ A;  3CR4 X;  1KWO C;  2OPO A;  4HRH A;  2F3Z A;  3DVE A;  2CT9 A;  1EH2 A;  2KGB C;  1CDM A;  1NUB A;  1ZOT B;  4PHK A;  3CS1 A;  1EG3 A;  1S5G Y;  2WC8 A;  2LHL A;  2E6W A;  1B4C A;  3LK1 A;  3GK1 A;  2BCX A;  4HRG A;  5HLO A;  2BL0 B;  4NDC A;  1GGW A;  1K9U A;  1KK8 C;  2Y1N A;  5I2Q A;  3CR5 X;  3SG2 A;  3SG5 A;  1J7O A;  1PSB A;  1CB1 A;  3JTD B;  1OZO A;  2L5X B;  3I5G C;  4MZJ A;  2PAL A;  1UUS A;  2WND A;  1J55 A;  3DVM A;  4OCI A;  4JPZ B;  5JOL A;  1LIN A;  1RK9 A;  4AQI A;  1M46 A;  1XFX O;  2MRD A;  3VRO A;  2OS8 B;  1MQ1 A;  1TN4 A;  3OB1 B;  3EVV A;  1ZAC A;  4NDD A;  1YUS A;  2JNX A;  2TN4 A;  1XFW O;  1YRU B;  1EG4 A;  2LVK A;  4AQJ A;  1PRW A;  2NZ0 A;  3VRQ A;  3JTD C;  2JXC A;  2LAN A;  3BOW A;  4PAL A;  4NQG A;  4HSZ A;  1SL7 A;  1KQM B;  1IQ3 A;  1PVB A;  1WY9 A;  2KI4 B;  3AAK A;  2LP2 A;  2ZNE A;  1LA3 A;  1Y1X A;  1AVS A;  3F45 A;  1N0Y A;  1NPQ A;  1IG5 A;  2BEC A;  2CTN A;  4N5X A;  1AK8 A;  2KOT A;  1SMG A;  2M7L A;  2PSR A;  2LVJ A;  1CM4 A;  2IS9 A;  2ZN8 A;  2LLT A;  2JTT A;  2HF5 A;  4CFQ A;  1FBV A;  2K61 A;  4GPL B;  1DMO A;  1R2U A;  1DJI A;  1YVL A;  3KO0 A;  4YBH B;  4DIR A;  2CCM A;  5D69 A;  2MA2 A;  1AJ4 A;  1L2O B;  2LVI A;  2BBM A;  1CDP A;  1B9A A;  4ORC B;  2QPT A;  3EVR A;  3OP0 A;  1J7P A;  1JF2 A;  3BOW B;  3IQO A;  2LAP A;  2M9G A;  3BUO B;  5HKZ A;  2KBI A;  2PAS A;  3I5F C;  4QJ5 B;  5IBW A;  4FQO A;  2JRF A;  1QVI Z;  4PHJ A;  5I2L A;  1BF5 A;  2H2K A;  2LHI A;  1KK7 Y;  1Y1A A;  1NCZ A;  2HQ8 A;  1S6C A;  4DS7 A;  1C7W A;  2JQ6 A;  1B7T Y;  4USL A;  5HKW A;  1OQP A;  4R1E A;  3GK4 X;  1IQ5 A;  1QIV A;  3MSE B;  1L7Z A;  3BQ3 A;  4ZCV A;  3PAL A;  1K96 A;  1IJ5 A;  1K9P A;  1UHJ A;  1HT9 A;  1OMD A;  1ZUZ A;  2MAZ A;  2M29 A;  2BE6 A;  3FS7 A;  2M7N A;  1FF1 A;  2M1K B;  1EL4 A;  1DGV A;  1JWD A;  2LMV A;  2M0R A;  1QTX A;  5J3X A;  2BE4 A;  4ETO A;  2Y1M A;  4L9M A;  1J1E A;  1YX7 A;  1ALW A;  2KAV A;  3E3R A;  1MXL C;  1MF8 B;  1F4O A;  1DJZ A;  1M31 A;  2Y5I A;  1TCO B;  3RM1 A;  1LVC D;  1S26 D;  4I5J A;  1CKK A;  4IL1 A;  5I2O A;  3C1V A;  1CDL A;  2RGI A;  5CSF A;  1ALV A;  2GGZ A;  1Q80 A;  1A75 A;  1SY9 A;  2LM5 A;  1KWO B;  3NSL A;  2WCF A;  3NSK A;  2I18 A;  3GK2 A;  2BKI B;  1QX5 B;  2LUC A;  1OE9 B;  1QX2 A;  1CDN A;  1MXE A;  3ICB A;  5KTY A;  2R2I A;  1DJW A;  2I2R E;  1A4P A;  1RJV A;  1S6I A;  1N65 A;  2JC2 A;  2Y4Q A;  4MN0 A;  4MVF A;  4TNC A;  1A03 A;  1KK8 B;  2NXQ A;  5DKN A;  5AEQ A;  1V1F A;  3I5G B;  2LCP A;  1F70 A;  2Q4U A;  3TS5 B;  1F54 A;  2WOS A;  1TNP A;  3TZ1 A;  2ISD A;  2F3Y A;  2JWW A;  2ZN9 A;  2KQY A;  2CBL A;  2KYC A;  5AFP A;  2L4I A;  1UHI A;  1ZMZ A;  2ZFD A;  4YGB B;  3VRP A;  1A75 B;  3DVJ A;  2O5G A;  3CGA A;  4CPV A;  4I5K A;  5KSZ A;  1XFZ O;  4CLN A;  5PAL A;  2MHH A;  1JC2 A;  1KSM A;  4ZCU A;  5F6T A;  2GGM A;  2K7B A;  1Y0V H;  1QAS A;  4C0K A;  1R6P A;  3O78 A;  3WNX B;  3OX6 A;  3TS5 C;  1CNP A;  5CPV A;  1B47 A;  1NCX A;  1Y6W A;  4I5L B;  4XJK A;  4ORB B;  1TIZ A;  1SKT A;  1SBJ A;  4C0L A;  1CMF A;  1TCF A;  1UUR A;  2DOQ A;  2M1U A;  1TNX A;  1OMV A;  1BU3 A;  3PN7 B;  3SIB A;  3O2P A;  1H8B A;  3AKB A;  1AJ5 A;  1DJY A;  4ORA B;  5I8N A;  1IGV A;  1KFU S;  2CXJ A;  2JT8 A;  2JUL A;  3OX5 A;  1DF0 A;  1S6J A;  3BXK A;  2A4J A;  3AKA A;  4WRI A;  2KGR A;  3O4Y A;  2BKH B;  3EK7 A;  2BBN A;  4MRY A;  4PE0 A;  4YRU A;  1IH0 A;  1PSR A;  2LLS A;  3EKH A;  4UPG A;  1TNQ A;  1YR5 A;  1BLQ A;  3PN7 C;  1QX7 A;  4CFR A;  2JZI A;  1G8I A;  1K94 A;  1DT7 B;  2F2P A;  1LA0 A;  1F4Q A;  1BR4 B;  3I5F B;  4N1G A;  3EVU A;  4XJK B;  1QVI Y;  3FIA A;  1JSA A;  5GQQ C;  1NX2 A;  2KQ6 A;  4AOM A;  4PE4 A;  1EJ3 A;  4HRE E;  1CFF A;  4WQ3 A;  1IRJ A;  1QJT A;  1C7V A;  1PVA A;  2D8N A;  4WQ2 A;  4BY4 A;  3WXA A;  3KPX A;  4PHN A;  4M2O A;  2MLF C;  4GGN A;  1SCM C;  5B8I B;  1SNL A;  2KFF A;  1SK6 D;  1DF0 B;  1YX8 A;  2KAY A;  1CTR A;  1JF0 A;  2I7A A;  1QXP A;  4PE7 A;  1CFD A;  4DRW A;  2K2A A;  2LVV A;  2LP3 A;  1CFP A;  1CLL A;  4XYN A;  1TNW A;  2K0J A;  1JFJ A;  1VRK A;  1YUU A;  1M45 A;  1QV0 A;  3BYA A;  1XA5 A;  2F33 A;  2NCO A;  1BJF A;  1B8R A;  1KFX S;  4NDB A;  1XFU O;  1B8C A;  2F2O A;  2JT3 A;  1A2X A;  3NSI A;  1OMR A;  2L2E A; 
#chains in the Genus database with same CATH topology
 1YTZ C;  3JVT C;  3SG6 A;  2AUC A;  1BMO A;  1SW8 A;  3HCM A;  3OB2 B;  3PAT A;  2JNF A;  2PRU A;  1XFR A;  2MJW B;  1CLB A;  4I5N B;  1JFK A;  1WRK A;  1TUJ A;  2HPS A;  2WC6 A;  4GGF C;  4YGA A;  2FJU B;  2ZKM X;  1U5I B;  1MHO A;  4MZL A;  3UO9 A;  1WLM A;  5AER A;  3OHM B;  3PM8 A;  4PCW A;  5AAN A;  2FOT A;  4ICB A;  5KU1 A;  1M63 B;  1G33 A;  1D1O A;  2ZRS A;  2I94 A;  3HX4 A;  1WLZ A;  2ZND A;  1C07 A;  1YUR A;  1ZFS A;  2EC6 B;  4D1E A;  1J7Q A;  2AAO A;  2JT0 A;  3BUX B;  2K7D A;  1XK4 C;  2FJY A;  1SL9 A;  1SL8 A;  3LK0 A;  5TNC A;  2O60 A;  2JXL A;  3SG3 A;  3WHT B;  1FPW A;  1OOG A;  1XO5 A;  1S3P A;  1CFC A;  3NSO A;  2KAX A;  2KHN A;  2H61 C;  1LXF C;  1SR6 C;  2G2B A;  1X02 A;  5DKR A;  1DJG A;  1F8H A;  3B6X A;  1S1E A;  2BAP A;  3CZ2 A;  1RRO A;  3S0E A;  1B1G A;  2M3W A;  2PYQ A;  1OW4 A;  1SSE B;  1XFV O;  2HET A;  2JU0 A;  2L50 A;  1H4B A;  3CZT X;  2KBM A;  2KNE A;  4E68 A;  3DF0 A;  2EC6 C;  4GNK B;  1UP5 A;  3ZNI A;  1J7R A;  2AMI A;  4PE1 A;  1WDC C;  1GJY A;  1NP8 A;  2QEV A;  3IQQ A;  5K89 A;  1W7I B;  3TUY C;  3KF9 A;  1AP4 A;  1AUI B;  4M2Q A;  1Z2C B;  2LC5 A;  4M2P A;  1OOJ A;  1QAT A;  4MZK A;  1F55 A;  1XFY O;  3L4L A;  1OSA A;  3SJS A;  1KSO A;  3BUM B;  3Q8I A;  1OOI X;  5FI7 A;  4YI9 A;  4QJ4 B;  2EHB A;  4A4C A;  2KSP A;  1DGU A;  1BOD A;  3CR2 A;  3DD4 A;  2K8M B;  4GAO A;  4DUQ A;  3V2L A;  2K60 A;  2EGD A;  1W7J B;  3CLN A;  3I5I C;  3OGN A;  2QAC A;  4YGE B;  4OVN F;  1F71 A;  5D7F A;  4GBA A;  3DF0 B;  3WHU B;  1WRL A;  3CZ0 A;  2E30 A;  1KCY A;  3VGO A;  1IKU A;  3D0Y B;  1SPY A;  2G9B A;  3I5H B;  1XYD A;  2VRG A;  2QEH A;  4MLW A;  5G08 A;  1DJH A;  4PHM A;  2PMY A;  1NIW A;  3FWB A;  1UHN A;  3EK4 A;  3PSR A;  1CLM A;  3SG4 A;  4PDZ A;  1QWV A;  2JPT A;  1K9K A;  1K93 D;  3H4S E;  4JWQ A;  1LS8 A;  1QV1 A;  1S5G Z;  5CSJ A;  1NWD A;  2K2F A;  4A4B A;  4GGF A;  1N2D A;  1KFU L;  1SCM B;  3FE6 A;  3L4A A;  1NX1 A;  3A8R A;  3BFB A;  3KHE A;  1BOC A;  2COL B;  1BG1 A;  2BL0 C;  1G4Y R;  5CSN A;  1NX3 A;  2YGU A;  2FCE A;  3I5H C;  1A29 A;  1M39 A;  4GFT A;  2F8P A;  5HKY A;  2KFH A;  1XVJ A;  2BNX A;  2ERB A;  5FYX A;  4YGC B;  2L2C A;  1UHH A;  2M49 B;  1SRA A;  1BT6 A;  1PUL A;  1K95 A;  1V1G A;  1XK4 A;  1K90 D;  1NSH A;  2WCE A;  2L5Y A;  2OS8 C;  3EK8 A;  3FWC A;  2NLN A;  2JTZ A;  4F0Z B;  2MLE C;  1IJ6 A;  3TDZ A;  4Q04 A;  1KQV A;  2KDH A;  1FI6 A;  3DVK A;  1U5I A;  3VRR A;  2H61 A;  4DCK A;  1TOP A;  3BFA A;  2M8U A;  3JVT B;  3LL8 B;  4MBE A;  2SAS A;  2KI6 C;  4OR9 B;  2GV5 A;  3D76 A;  1AHR A;  4P5O E;  2M97 A;  5ER4 X;  1RWY A;  2CNP A;  2PVB A;  2WCB A;  4OV2 A;  1QLS A;  1CMG A;  1OZS A;  1IWQ A;  3LCP C;  2JPO A;  2L98 A;  2MBX A;  4GUK A;  2KFG A;  3R1P A;  4P2Y B;  1K2H A;  1C3Y A;  2K7O A;  1KQM C;  3DYE A;  3O6B A;  2KYF A;  2KI4 C;  3KEV A;  1BR1 B;  1FW4 A;  1WRZ A;  2BCA A;  1PK0 D;  3M0W A;  3VRN A;  1C3Z A;  1TUZ A;  1UHK A;  2FCD A;  3GOF A;  3SG7 A;  1Y1U A;  3D10 A;  4JQ0 D;  1QLK A;  3A4U B;  3DY9 A;  5BPJ A;  1MR8 A;  2WOR A;  4U8D A;  1LKJ A;  3SIA A;  2JOJ A;  5DKQ A;  1B8L A;  1E8A A;  1NYA A;  1MUX A;  1SCV A;  3BUN B;  1QS7 A;  1KFX L;  1SYM A;  2LUX A;  3CYZ A;  3TDU A;  3CZ1 A;  2SCP A;  3UNW A;  2B1U A;  1FI5 A;  1SR6 B;  1DTL A;  3PLF B;  2V53 A;  1YRT B;  3D73 A;  1L2O C;  4FTG A;  2LMU A;  1CM1 A;  1YVH A;  1MWN A;  1RFJ A;  5CSI A;  3NGV A;  1TRF A;  1NCY A;  3TDI A;  3CWG A;  3NXA A;  5HLV A;  2KI6 D;  1NX0 A;  1OOH A;  1K8U A;  4QJ3 B;  1WDC B;  3TUY B;  5JJG A;  1KK7 Z;  2LNK A;  2HQW A;  2KLE A;  1J1D A;  1ODB A;  4C0J A;  1RTP 1;  1JUO A;  2L0P A;  2L4H A;  1YUT A;  1B7T Z;  2P6B B;  4MEW A;  4BY5 A;  4N1F A;  5ER5 A;  2NCP A;  2LE9 B;  3PFV A;  2K7C A;  2OTG B;  3QRX A;  1EXR A;  1TTX A;  4OKH A;  3AAJ A;  3FE9 A;  3LLE A;  1DJX A;  1REC A;  3IVT A;  4MSP A;  2ZRT A;  3D0Y A;  1DC1 A;  5AXI A;  1DVI A;  3K21 A;  1HQV A;  3NHI A;  3I5I B;  1GQM A;  1QIW A;  2WCL A;  1GGZ A;  2LV7 A;  4KYN A;  3BUW B;  2LLU A;  2LMT A;  2BCB A;  2QEO A;  2L51 A;  3O4X A;  4YI8 A;  2WCJ A;  2OTG C;  4YGD B;  1UWO A;  1JBA A;  3IF7 A;  4MRX A;  3ZWH A;  4CID A;  3EKJ A;  1S36 A;  1PAL A;  2Q91 A;  3CTN A;  3RLZ A;  3CR4 X;  1KWO C;  2OPO A;  4HRH A;  4JKT A;  3BFH A;  2F3Z A;  3DVE A;  2CT9 A;  1EH2 A;  2KGB C;  1CDM A;  1NUB A;  1ZOT B;  4PHK A;  3CS1 A;  1EG3 A;  1S5G Y;  2WC8 A;  2LHL A;  2E6W A;  1B4C A;  3D75 A;  3LK1 A;  3GK1 A;  2BCX A;  4HRG A;  5HLO A;  2BL0 B;  3BJH A;  4NDC A;  1GGW A;  1K9U A;  1KK8 C;  2Y1N A;  5I2Q A;  3CR5 X;  3SG2 A;  3SG5 A;  1J7O A;  1PSB A;  1CB1 A;  3JTD B;  1OZO A;  2L5X B;  3I5G C;  4MZJ A;  2PAL A;  1UUS A;  2WND A;  1J55 A;  3DVM A;  4OCI A;  4JPZ B;  5JOL A;  1LIN A;  1RK9 A;  1T14 A;  3D77 A;  4AQI A;  1M46 A;  1XFX O;  2MRD A;  3VRO A;  2OS8 B;  1MQ1 A;  1TN4 A;  2PQL A;  3OB1 B;  3EVV A;  1ZAC A;  4NDD A;  1YUS A;  2JNX A;  2TN4 A;  1XFW O;  5HL1 A;  1YRU B;  1EG4 A;  2LVK A;  4AQJ A;  5FI6 A;  1PRW A;  2NZ0 A;  3VRQ A;  3JTD C;  3CAB A;  2JXC A;  2LAN A;  3BOW A;  4PAL A;  4NQG A;  4HSZ A;  1SL7 A;  1Z4H A;  1KQM B;  1IQ3 A;  1PVB A;  1WY9 A;  2KI4 B;  3AAK A;  2P71 A;  2LP2 A;  2ZNE A;  1ORG A;  1LA3 A;  1Y1X A;  1AVS A;  3F45 A;  1N0Y A;  1NPQ A;  1IG5 A;  2BEC A;  2CTN A;  4N5X A;  1AK8 A;  2KOT A;  1SMG A;  2M7L A;  2PSR A;  2LVJ A;  1CM4 A;  2KPH A;  3D78 A;  2IS9 A;  2ZN8 A;  2LLT A;  2JTT A;  2HF5 A;  3S0D A;  4CFQ A;  1FBV A;  2K61 A;  4GPL B;  1DMO A;  1R2U A;  1DJI A;  1YVL A;  3KO0 A;  4YBH B;  4DIR A;  3N7H A;  2CCM A;  5D69 A;  2MA2 A;  1AJ4 A;  1L2O B;  2LVI A;  2BBM A;  1CDP A;  1B9A A;  4ORC B;  2QPT A;  3EVR A;  3OP0 A;  1J7P A;  1JF2 A;  3BOW B;  3IQO A;  2LAP A;  2M9G A;  2WCH A;  3BUO B;  5HKZ A;  2KBI A;  2PAS A;  3I5F C;  5HYD A;  4QJ5 B;  5IBW A;  4FQO A;  2JRF A;  1QVI Z;  4PHJ A;  5I2L A;  1BF5 A;  2H2K A;  2LHI A;  1KK7 Y;  1Y1A A;  1NCZ A;  2HQ8 A;  1S6C A;  3D74 A;  4DS7 A;  1C7W A;  2JQ6 A;  1B7T Y;  4USL A;  5HKW A;  1OQP A;  4R1E A;  3GK4 X;  1IQ5 A;  4JD9 A;  2KLD A;  4INW A;  1QIV A;  3MSE B;  1L7Z A;  3RZS A;  3BQ3 A;  4ZCV A;  3PAL A;  1K96 A;  1IJ5 A;  1K9P A;  1UHJ A;  1HT9 A;  1OMD A;  1ZUZ A;  2MAZ A;  2M29 A;  2BE6 A;  3FS7 A;  2M7N A;  1FF1 A;  2M1K B;  1EL4 A;  1DGV A;  2QEB A;  1JWD A;  2LMV A;  2M0R A;  1QTX A;  5J3X A;  2BE4 A;  4FQT A;  3SS4 A;  4ETO A;  2Y1M A;  4IJ7 A;  1J1E A;  1YX7 A;  4L9M A;  1ALW A;  2KAV A;  3E3R A;  1MXL C;  1MF8 B;  3K1E A;  1F4O A;  1DJZ A;  1M31 A;  2Y5I A;  1TCO B;  3RM1 A;  1LVC D;  1S26 D;  4I5J A;  5EL2 A;  1CKK A;  3B87 A;  4IL1 A;  5I2O A;  3C1V A;  1CDL A;  2RGI A;  5CSF A;  3S0G A;  1ALV A;  2GGZ A;  1Q80 A;  1A75 A;  3OBV A;  1SY9 A;  2LM5 A;  1KWO B;  3NSL A;  2WCF A;  3NSK A;  2I18 A;  4OZD A;  3GK2 A;  2BKI B;  1QX5 B;  1GM0 A;  2LUC A;  1OE9 B;  1QX2 A;  1CDN A;  1MXE A;  3ICB A;  5KTY A;  2R2I A;  1DJW A;  2I2R E;  3EG5 B;  3CDN A;  2QDI A;  1A4P A;  1RJV A;  1S6I A;  1N65 A;  2JC2 A;  1DEL A;  2Y4Q A;  4MN0 A;  4MVF A;  4TNC A;  1A03 A;  1TWO A;  1KK8 B;  4PT1 A;  2NXQ A;  5DKN A;  5AEQ A;  1V1F A;  3I5G B;  2LCP A;  1F70 A;  2Q4U A;  3TS5 B;  1F54 A;  3QME A;  2WOS A;  1TNP A;  3TZ1 A;  2ISD A;  2F3Y A;  2JWW A;  2WCK A;  2ZN9 A;  2KQY A;  2CBL A;  2KYC A;  3B88 A;  5AFP A;  2L4I A;  1UHI A;  1ZMZ A;  2ZFD A;  4YGB B;  3VRP A;  1A75 B;  3DVJ A;  2WCM A;  3SS5 A;  2O5G A;  3CGA A;  4CPV A;  4I5K A;  5KSZ A;  1XFZ O;  4CLN A;  5PAL A;  2MHH A;  1JC2 A;  1KSM A;  3PM2 A;  4ZCU A;  5F6T A;  2GGM A;  2K7B A;  1Y0V H;  1QAS A;  4C0K A;  1R6P A;  3O78 A;  3WNX B;  3OX6 A;  3R1O A;  3TS5 C;  3R72 A;  1CNP A;  5CPV A;  1B47 A;  1IIO A;  1NCX A;  3B86 A;  5D3O A;  5DIC A;  5I94 A;  1Y6W A;  4F7F A;  2H8V A;  4I5L B;  4XJK A;  4ORB B;  2WC5 A;  1TIZ A;  1SKT A;  1SBJ A;  4C0L A;  1CMF A;  1TCF A;  1UUR A;  2DOQ A;  2M1U A;  1TNX A;  1OMV A;  1BU3 A;  3PN7 B;  3SIB A;  3O2P A;  3R1V A;  1H8B A;  3AKB A;  1AJ5 A;  1DJY A;  1W9Z A;  4ORA B;  3S0A A;  1DEK A;  5I8N A;  1IGV A;  1KFU S;  2CXJ A;  2JT8 A;  2JUL A;  3OX5 A;  1DF0 A;  1S6J A;  3BXK A;  2A4J A;  3AKA A;  3PJI A;  4WRI A;  2KGR A;  3O4Y A;  2BKH B;  3EK7 A;  2BBN A;  4MRY A;  4PE0 A;  4YRU A;  2P70 A;  1PSR A;  2LLS A;  3EKH A;  4UPG A;  1IH0 A;  3S0F A;  1TNQ A;  1YR5 A;  1BLQ A;  3VB1 A;  5FI2 A;  3PN7 C;  1QX7 A;  4CFR A;  2JZI A;  1DQE A;  1G8I A;  1K94 A;  2GTE A;  1DT7 B;  2F2P A;  1LA0 A;  1F4Q A;  1BR4 B;  3I5F B;  4N1G A;  1OOF A;  3EVU A;  4XJK B;  1QVI Y;  3FIA A;  3B7A A;  5GQQ C;  1NX2 A;  2KQ6 A;  4AOM A;  1JSA A;  4PE4 A;  1EJ3 A;  4HRE E;  1CFF A;  4WQ3 A;  1P28 A;  3DXL A;  1IRJ A;  1QJT A;  1C7V A;  1PVA A;  2D8N A;  4WQ2 A;  3L47 A;  4BY4 A;  3S0B A;  3WXA A;  3KPX A;  4PHN A;  3SS3 A;  4M2O A;  2MLF C;  4GGN A;  1SCM C;  5B8I B;  1SNL A;  2KFF A;  1SK6 D;  1DF0 B;  1YX8 A;  3DZT A;  2KAY A;  1CTR A;  1JF0 A;  2I7A A;  1QXP A;  4PE7 A;  1CFD A;  4DRW A;  2K2A A;  2LVV A;  2LP3 A;  3FE8 A;  1CLL A;  1CFP A;  4XYN A;  1TNW A;  2K0J A;  1JFJ A;  1VRK A;  1YUU A;  1M45 A;  1QV0 A;  3BYA A;  4INX A;  3NHT A;  1XA5 A;  2F33 A;  2NCO A;  1BJF A;  1B8R A;  1KFX S;  4NDB A;  1XFU O;  1B8C A;  2F2O A;  2JT3 A;  1A2X A;  3NSI A;  1OMR A;  2L2E A; 
#chains in the Genus database with same CATH homology
 1YTZ C;  3JVT C;  3SG6 A;  2AUC A;  1BMO A;  1SW8 A;  3HCM A;  3OB2 B;  3PAT A;  2JNF A;  2PRU A;  2MJW B;  1CLB A;  4I5N B;  1JFK A;  1WRK A;  2HPS A;  4GGF C;  4YGA A;  2FJU B;  2ZKM X;  1U5I B;  1MHO A;  4MZL A;  5AER A;  1WLM A;  3OHM B;  3PM8 A;  4PCW A;  5AAN A;  2FOT A;  4ICB A;  5KU1 A;  1M63 B;  1G33 A;  1D1O A;  2ZRS A;  2I94 A;  3HX4 A;  1WLZ A;  2ZND A;  1C07 A;  1YUR A;  1ZFS A;  2EC6 B;  4D1E A;  1J7Q A;  2AAO A;  2JT0 A;  3BUX B;  2K7D A;  1XK4 C;  1SL9 A;  1SL8 A;  3LK0 A;  5TNC A;  2O60 A;  2JXL A;  3SG3 A;  3WHT B;  1FPW A;  1XO5 A;  1CFC A;  1S3P A;  3NSO A;  2KAX A;  2KHN A;  2H61 C;  1LXF C;  1SR6 C;  2G2B A;  1X02 A;  5DKR A;  1DJG A;  1F8H A;  1S1E A;  1RRO A;  1B1G A;  2M3W A;  1XFV O;  2HET A;  2JU0 A;  2L50 A;  1H4B A;  3CZT X;  2KBM A;  2KNE A;  4E68 A;  3DF0 A;  2EC6 C;  4GNK B;  1UP5 A;  3ZNI A;  1J7R A;  2AMI A;  4PE1 A;  1WDC C;  1GJY A;  1NP8 A;  3IQQ A;  5K89 A;  1W7I B;  3TUY C;  3KF9 A;  1AP4 A;  1AUI B;  4M2Q A;  2LC5 A;  4M2P A;  1OOJ A;  1QAT A;  4MZK A;  1F55 A;  1XFY O;  1OSA A;  3SJS A;  1KSO A;  3BUM B;  4YI9 A;  4QJ4 B;  2EHB A;  4A4C A;  2KSP A;  1DGU A;  1BOD A;  3CR2 A;  3DD4 A;  2K8M B;  4GAO A;  4DUQ A;  3I5I C;  2EGD A;  1W7J B;  3CLN A;  2QAC A;  4YGE B;  4OVN F;  1F71 A;  5D7F A;  4GBA A;  3DF0 B;  3WHU B;  1WRL A;  2E30 A;  1KCY A;  3VGO A;  1IKU A;  3D0Y B;  1SPY A;  2G9B A;  3I5H B;  1XYD A;  2VRG A;  5G08 A;  4MLW A;  1DJH A;  4PHM A;  2PMY A;  1NIW A;  3FWB A;  1UHN A;  3EK4 A;  3PSR A;  1CLM A;  3SG4 A;  4PDZ A;  2JPT A;  1K9K A;  1K93 D;  3H4S E;  4JWQ A;  1QV1 A;  1S5G Z;  5CSJ A;  1NWD A;  2K2F A;  4A4B A;  4GGF A;  1N2D A;  1KFU L;  1SCM B;  1NX1 A;  3A8R A;  3KHE A;  1BOC A;  2COL B;  1BG1 A;  2BL0 C;  1G4Y R;  5CSN A;  1NX3 A;  2FCE A;  3I5H C;  1A29 A;  1M39 A;  4GFT A;  2F8P A;  5HKY A;  2KFH A;  1XVJ A;  5FYX A;  4YGC B;  1UHH A;  2M49 B;  1SRA A;  1BT6 A;  1PUL A;  1K95 A;  1V1G A;  1XK4 A;  1K90 D;  1NSH A;  2WCE A;  3EK8 A;  2OS8 C;  3FWC A;  2NLN A;  2JTZ A;  4F0Z B;  2MLE C;  1IJ6 A;  3TDZ A;  4Q04 A;  1KQV A;  2KDH A;  1FI6 A;  3DVK A;  1U5I A;  3VRR A;  2H61 A;  4DCK A;  1TOP A;  2M8U A;  3JVT B;  3LL8 B;  4MBE A;  2SAS A;  2KI6 C;  4OR9 B;  2GV5 A;  4P5O E;  1AHR A;  5ER4 X;  2M97 A;  1RWY A;  2CNP A;  2PVB A;  2WCB A;  4OV2 A;  1QLS A;  1CMG A;  1OZS A;  1IWQ A;  3LCP C;  2L98 A;  2MBX A;  4GUK A;  2KFG A;  4P2Y B;  1K2H A;  2K7O A;  1KQM C;  3O6B A;  2KYF A;  2KI4 C;  3KEV A;  1BR1 B;  1FW4 A;  1WRZ A;  2BCA A;  1PK0 D;  3M0W A;  3VRN A;  5HYD A;  1UHK A;  2FCD A;  3SG7 A;  3GOF A;  1Y1U A;  3D10 A;  4JQ0 D;  1QLK A;  3A4U B;  5BPJ A;  1MR8 A;  2WOR A;  4U8D A;  1LKJ A;  3SIA A;  2JOJ A;  5DKQ A;  1B8L A;  1E8A A;  1NYA A;  1MUX A;  1SCV A;  3BUN B;  1QS7 A;  1KFX L;  1SYM A;  2LUX A;  3TDU A;  2SCP A;  2B1U A;  1FI5 A;  1SR6 B;  1DTL A;  3PLF B;  2V53 A;  1YRT B;  1L2O C;  4FTG A;  2LMU A;  1CM1 A;  1YVH A;  1MWN A;  1RFJ A;  5CSI A;  1TRF A;  1NCY A;  3TDI A;  3CWG A;  3NXA A;  5HLV A;  2KI6 D;  1NX0 A;  4QJ3 B;  1K8U A;  1WDC B;  3TUY B;  5JJG A;  1KK7 Z;  2LNK A;  2HQW A;  1J1D A;  1ODB A;  4C0J A;  1RTP 1;  1JUO A;  2L0P A;  2L4H A;  1YUT A;  1B7T Z;  2P6B B;  4MEW A;  4BY5 A;  4N1F A;  5ER5 A;  2NCP A;  2LE9 B;  3PFV A;  2K7C A;  2OTG B;  3QRX A;  1EXR A;  1TTX A;  4OKH A;  3AAJ A;  3LLE A;  1DJX A;  1REC A;  4MSP A;  2ZRT A;  3D0Y A;  5AXI A;  1DVI A;  3K21 A;  1HQV A;  3I5I B;  1GQM A;  1QIW A;  1GGZ A;  2LV7 A;  3BUW B;  2LLU A;  2LMT A;  2BCB A;  2L51 A;  4YI8 A;  2OTG C;  4YGD B;  1UWO A;  1JBA A;  3IF7 A;  4MRX A;  3ZWH A;  4CID A;  3EKJ A;  1S36 A;  1PAL A;  2Q91 A;  3CTN A;  3RLZ A;  3CR4 X;  1KWO C;  2OPO A;  4HRH A;  2F3Z A;  3DVE A;  2CT9 A;  1EH2 A;  2KGB C;  1CDM A;  1NUB A;  1ZOT B;  4PHK A;  3CS1 A;  1EG3 A;  1S5G Y;  2WC8 A;  2LHL A;  2E6W A;  1B4C A;  3LK1 A;  3GK1 A;  2BCX A;  4HRG A;  5HLO A;  2BL0 B;  4NDC A;  1GGW A;  1K9U A;  1KK8 C;  2Y1N A;  5I2Q A;  3CR5 X;  3SG2 A;  3SG5 A;  1J7O A;  1PSB A;  1CB1 A;  3JTD B;  1OZO A;  2L5X B;  3I5G C;  4MZJ A;  2PAL A;  1UUS A;  2WND A;  1J55 A;  3DVM A;  4OCI A;  4JPZ B;  5JOL A;  1LIN A;  1RK9 A;  4AQI A;  1M46 A;  1XFX O;  2MRD A;  3VRO A;  2OS8 B;  1MQ1 A;  1TN4 A;  3OB1 B;  3EVV A;  1ZAC A;  4NDD A;  1YUS A;  2JNX A;  2TN4 A;  1XFW O;  1YRU B;  1EG4 A;  2LVK A;  4AQJ A;  1PRW A;  2NZ0 A;  3VRQ A;  3JTD C;  2JXC A;  2LAN A;  3BOW A;  4PAL A;  4NQG A;  4HSZ A;  1SL7 A;  1KQM B;  1IQ3 A;  1PVB A;  1WY9 A;  2KI4 B;  3AAK A;  2LP2 A;  2ZNE A;  1LA3 A;  1Y1X A;  1AVS A;  3F45 A;  1N0Y A;  1NPQ A;  1IG5 A;  2BEC A;  2CTN A;  4N5X A;  1AK8 A;  2KOT A;  1SMG A;  2M7L A;  2PSR A;  2LVJ A;  1CM4 A;  2IS9 A;  2ZN8 A;  2LLT A;  2JTT A;  2HF5 A;  4CFQ A;  1FBV A;  2K61 A;  4GPL B;  1DMO A;  1R2U A;  1DJI A;  1YVL A;  3KO0 A;  4YBH B;  4DIR A;  2CCM A;  5D69 A;  2MA2 A;  1AJ4 A;  1L2O B;  2LVI A;  2BBM A;  1CDP A;  1B9A A;  4ORC B;  2QPT A;  3EVR A;  3OP0 A;  1J7P A;  1JF2 A;  3BOW B;  3IQO A;  2LAP A;  2M9G A;  3BUO B;  5HKZ A;  2KBI A;  2PAS A;  3I5F C;  4QJ5 B;  5IBW A;  4FQO A;  2JRF A;  1QVI Z;  4PHJ A;  5I2L A;  1BF5 A;  2H2K A;  2LHI A;  1KK7 Y;  1Y1A A;  1NCZ A;  2HQ8 A;  1S6C A;  4DS7 A;  1C7W A;  2JQ6 A;  1B7T Y;  4USL A;  5HKW A;  1OQP A;  4R1E A;  3GK4 X;  1IQ5 A;  1QIV A;  3MSE B;  1L7Z A;  3BQ3 A;  4ZCV A;  3PAL A;  1K96 A;  1IJ5 A;  1K9P A;  1UHJ A;  1HT9 A;  1OMD A;  1ZUZ A;  2MAZ A;  2M29 A;  2BE6 A;  3FS7 A;  2M7N A;  1FF1 A;  2M1K B;  1EL4 A;  1DGV A;  1JWD A;  2LMV A;  2M0R A;  1QTX A;  5J3X A;  2BE4 A;  4ETO A;  2Y1M A;  4L9M A;  1J1E A;  1YX7 A;  1ALW A;  2KAV A;  3E3R A;  1MXL C;  1MF8 B;  1F4O A;  1DJZ A;  1M31 A;  2Y5I A;  1TCO B;  3RM1 A;  1LVC D;  1S26 D;  4I5J A;  1CKK A;  4IL1 A;  5I2O A;  3C1V A;  1CDL A;  2RGI A;  5CSF A;  1ALV A;  2GGZ A;  1Q80 A;  1A75 A;  1SY9 A;  2LM5 A;  1KWO B;  3NSL A;  2WCF A;  3NSK A;  2I18 A;  3GK2 A;  2BKI B;  1QX5 B;  2LUC A;  1OE9 B;  1QX2 A;  1CDN A;  1MXE A;  3ICB A;  5KTY A;  2R2I A;  1DJW A;  2I2R E;  1A4P A;  1RJV A;  1S6I A;  1N65 A;  2JC2 A;  2Y4Q A;  4MN0 A;  4MVF A;  4TNC A;  1A03 A;  1KK8 B;  2NXQ A;  5DKN A;  5AEQ A;  1V1F A;  3I5G B;  2LCP A;  1F70 A;  2Q4U A;  3TS5 B;  1F54 A;  2WOS A;  1TNP A;  3TZ1 A;  2ISD A;  2F3Y A;  2JWW A;  2ZN9 A;  2KQY A;  2CBL A;  2KYC A;  5AFP A;  2L4I A;  1UHI A;  1ZMZ A;  2ZFD A;  4YGB B;  3VRP A;  1A75 B;  3DVJ A;  2O5G A;  3CGA A;  4CPV A;  4I5K A;  5KSZ A;  1XFZ O;  4CLN A;  5PAL A;  2MHH A;  1JC2 A;  1KSM A;  4ZCU A;  5F6T A;  2GGM A;  2K7B A;  1Y0V H;  1QAS A;  4C0K A;  1R6P A;  3O78 A;  3WNX B;  3OX6 A;  3TS5 C;  1CNP A;  5CPV A;  1B47 A;  1NCX A;  1Y6W A;  4I5L B;  4XJK A;  4ORB B;  1TIZ A;  1SKT A;  1SBJ A;  4C0L A;  1CMF A;  1TCF A;  1UUR A;  2DOQ A;  2M1U A;  1TNX A;  1OMV A;  1BU3 A;  3PN7 B;  3SIB A;  3O2P A;  1H8B A;  3AKB A;  1AJ5 A;  1DJY A;  4ORA B;  5I8N A;  1IGV A;  1KFU S;  2CXJ A;  2JT8 A;  2JUL A;  3OX5 A;  1DF0 A;  1S6J A;  3BXK A;  2A4J A;  3AKA A;  4WRI A;  2KGR A;  3O4Y A;  2BKH B;  3EK7 A;  2BBN A;  4MRY A;  4PE0 A;  4YRU A;  1IH0 A;  1PSR A;  2LLS A;  3EKH A;  4UPG A;  1TNQ A;  1YR5 A;  1BLQ A;  3PN7 C;  1QX7 A;  4CFR A;  2JZI A;  1G8I A;  1K94 A;  1DT7 B;  2F2P A;  1LA0 A;  1F4Q A;  1BR4 B;  3I5F B;  4N1G A;  3EVU A;  4XJK B;  1QVI Y;  3FIA A;  1JSA A;  5GQQ C;  1NX2 A;  2KQ6 A;  4AOM A;  4PE4 A;  1EJ3 A;  4HRE E;  1CFF A;  4WQ3 A;  1IRJ A;  1QJT A;  1C7V A;  1PVA A;  2D8N A;  4WQ2 A;  4BY4 A;  3WXA A;  3KPX A;  4PHN A;  4M2O A;  2MLF C;  4GGN A;  1SCM C;  5B8I B;  1SNL A;  2KFF A;  1SK6 D;  1DF0 B;  1YX8 A;  2KAY A;  1CTR A;  1JF0 A;  2I7A A;  1QXP A;  4PE7 A;  1CFD A;  4DRW A;  2K2A A;  2LVV A;  2LP3 A;  1CFP A;  1CLL A;  4XYN A;  1TNW A;  2K0J A;  1JFJ A;  1VRK A;  1YUU A;  1M45 A;  1QV0 A;  3BYA A;  1XA5 A;  2F33 A;  2NCO A;  1BJF A;  1B8R A;  1KFX S;  4NDB A;  1XFU O;  1B8C A;  2F2O A;  2JT3 A;  1A2X A;  3NSI A;  1OMR A;  2L2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...